WorldWideScience

Sample records for long-period polar ai

  1. Long period grating based refractometer with polarization-sensitive interrogation

    International Nuclear Information System (INIS)

    Eftimov, T; Bock, W; Mikulic, P; Nikolova, K

    2010-01-01

    We propose a new scheme for the interrogation of long-period fiber gratings (LPGs) which makes use of their polarization properties. Polarization-sensitive interrogation was applied to detect changes due to changes of the external refractive index by using three wavelengths on the International Telecommunication Union (ITU) grid. We show that the new approach can allow for a greater sensitivity and can be used in combination with spectral multiplexing schemes

  2. Long-period polar rain variations, solar wind and hemispherically symmetric polar rain

    International Nuclear Information System (INIS)

    Makita, K.; Meng, C.

    1987-01-01

    On the basic of electron data obtained by the Defense Meteorological Satellite Program (DMSP) F2 satellite the long-period variations of the polar rain flux are examined for four consecutive solar rotations. It is clearly demonstrated that the asymmetric enhancement of the polar rain flux is strongly controlled by the sector structure of the interplanetary magnetic field (IMF). However, the orbit-to-orbit and day-to-day variations of the polar rain flux are detected even during a very stable sector period, and the polar rain flux does not have any clear relationship to the magnitude of the IMF B/sub x/ or B/sub y/. Thus the polarity of B/sub x/ controls only the accessibility of a polar region. It is also noticed that the intensity of polar rain fluxes does not show any relationship to the density of the solar wind, suggesting that the origin of the polar rain electrons is different from the commonly observed part of the solar wind electron distribution function. In addition to the asymmetric polar rain distribution, increasing polar rain fluxes of similar high intensity are sometimes detected over both polar caps. An examination of more than 1 year's data from the DMSP F2 and F4 satellites shows that simultaneous intense uniform precipitations (>10 7 electrons/cm 2 s sr) over both polar caps are not coincidental; it also shows that the spectra are similar. The occurrence of hemispherically symmetric events is not common. They generally are observed after an IMF sector transition period, during unstable periods in the sector structure, and while the solar wind density is high. copyright American Geophysical Union 1987

  3. Arc-Induced Long Period Gratings from Standard to Polarization-Maintaining and Photonic Crystal Fibers

    Directory of Open Access Journals (Sweden)

    Flavio Esposito

    2018-03-01

    Full Text Available In this work, we report about our recent results concerning the fabrication of Long Period Grating (LPG sensors in several optical fibers, through the Electric Arc Discharge (EAD technique. In particular, the following silica fibers with both different dopants and geometrical structures are considered: standard Ge-doped, photosensitive B/Ge codoped, P-doped, pure-silica core with F-doped cladding, Panda type Polarization-maintaining, and Hollow core Photonic crystal fiber. An adaptive platform was developed and the appropriate “recipe” was identified for each fiber, in terms of both arc discharge parameters and setup arrangement, for manufacturing LPGs with strong and narrow attenuation bands, low insertion losses, and short length. As the fabricated devices have appealing features from the application point of view, the sensitivity characteristics towards changes in different external perturbations (i.e., surrounding refractive index, temperature, and strain are investigated and compared, highlighting the effects of different fiber composition and structure.

  4. Effect of Long-Period Ocean Tides on the Earth's Polar Motion

    Science.gov (United States)

    Gross, R. S.; Chao, B. F.; Desai, S. D.

    1997-01-01

    The second-degree zonal tide raising potential is symmetric about the polar axis and hence can excite the Earth's polar motion only through its action upon nonaxisymmetric features of the Earth such as the oceans.

  5. Ai

    African Journals Online (AJOL)

    :=g=~!Ai~~~~~g~~ ~~~~~~. Jim Taylor, Rob O'Donoghue and Alistair Clacherty. INTRODUCTION. The Department of Environment Affairs, in cooperation with ...

  6. Location and wavefield attributes of long-period signals at Villarrica volcano (Chile) determined by array and polarization-moveout analysis

    Science.gov (United States)

    Lehr, Johanna; Thorwart, Martin; Rabbel, Wolfgang

    2016-04-01

    Villarrica Volcano is the most active volcano in Chile whose latest eruption occurred in March 2015. Increasing the knowledge on its processes, structure and behavior is thus crucial to an effective monitoring and hazard assessment. In this context, long-period volcanic signals (LP) are considered to be a key to the understanding of fluid dynamics and volcanic plumbing systems, accessible by seismological observations. However, standard seismological location tools usually fail due to the emergent onset of the signal and its serious distortion caused by attenuation and scattering in a complex geology. Therefore, alternative methods are needed. In March 2012, a dense seismic network was installed at Villarrica for two weeks with 50 stations covering the volcanic edifice including 6 subarrays. About 400 LP events were identified. LP-events recorded on crater stations look similar to typical earthquakes arrivals with distinguishable P- and S-wave onsets indicating a source near the crater. But with increasing source distance waveforms gradually change into typical LP-events. To investigate how to locate these LP-events we tested two approaches at the basis of a show-case event. In a first trial, records of the subarrays were used to determine backazimuths and slowness by beamforming in the time domain. The analysis was performed in a moving window, using semblance to measure the beam quality. The epicenter was derived by intersecting azimuthal rays. It locates ca. 1 km southeast of the summit crater. Slownesses range from 0.5 s/km up to 2.0 s/km. At frequencies above 2 Hz, additional maxima appear in the semblance distribution of near-summit arrays which can be interpreted as side-scattered signals. Since the crossing points of the backazimuth rays showed some scattering we tested polarization analysis (applied to the subset of 3-component stations) as an alternative location method. Although the direct interpretation of the backazimuths was unreliable, we identified

  7. Long Period Seismological Research Program

    Science.gov (United States)

    1974-10-31

    in central Asia as observed at the high-gain long- period sites. Preliminary results from observations at Chiang Mai (CHG) show that the complexity...Preliminary results from observations at Chiang Mai (CHG) show that the complexity of the surface wave signals from many events in the Tadzhik-Kirgiz...and receivers. A number of Interesting features can be illustrated by examining portions of three selsmograms recorded at Chiang Mai (CHO

  8. Effects of Long Period Ocean Tides on the Earth's Rotation

    Science.gov (United States)

    Gross, Richard S.; Chao, Ben F.; Desai, Shailen D.

    1996-01-01

    The spectra of polar motion excitation functions exhibit enhanced power in the fortnightly tidal band. This enhanced power is attributed to ocean tidal excitation. Ocean tide models predict polar motion excitation effects that differ with each other, and with observations, by factors as large as 2-3. There is a need for inproved models for the effect of long-period ocean tides on Earth's rotation.

  9. Pulsation properties of Mira long period variables

    International Nuclear Information System (INIS)

    Cahn, J.H.

    1980-01-01

    A matter of great interest to variable star students concerns the mode of pulsation of Mira long period variables. In this report we first give observational evidence for the pulsation constant Q. We then compare the observations with calculations. Next, we review two interesting groups of papers dealing with hydrodynamic properties of long period variables. In the first, a fully dynamic nonlinear calculation maps out the Mira instability domain. In the second, special attention is paid to shock propagation beyond the photosphere which in large measure accounts for the complex spectra from this region. (orig./WL)

  10. Multichannel long period seismic data acquisition system

    International Nuclear Information System (INIS)

    Kolvankar, V.G.; Rao, D.S.

    1990-01-01

    This paper discusses the specifications and performance of an eight channel long period seismic digital data acquisition system, which is developed and installed at Seismic Array Station, Gauribidanur, Karnataka State. The paper describes how these data in an unedited form are recorded on a single track of magnetic tape inter-mittantly, which has resulted in recording of 50 days data on a single tapespool. A time indexing technique which enables quick access to any desired portion of a recorded tape is also discussed. Typical examples of long period seismic event signals recorded by this system are also illustrated. Various advantages, the system provides over the analog multichannel instrumentation tape recording system, operating at Seismic Array Station for th e last two decades, are also discussed. (author). 7 figs

  11. Handling nuclear waste over long periods

    International Nuclear Information System (INIS)

    Ancelin, B.; Chenevier, E.

    1983-01-01

    The handling of nuclear waste over long periods throws up new problems, such as the safety for a very long term and the employment of economic logic in order to justify choices involving extended time scales. The result is a very great difficulty of apprehension of the problem by the specialists as well as by the public. A clear policy decision, associated with a coherent administrative organization, will therefore have to make up for an impossible technical-economical optimization of the various possible options. The difficulty of simple technical choices is only going to reinforce this wish; the absence of a global and comparative measuring system is responsible for the fact that in this field the passions often override many of the scientific truths [fr

  12. Magnetomechanically induced long period fiber gratings

    International Nuclear Information System (INIS)

    Causado-Buelvas, Jesus D.; Gomez-Cardona, Nelson D.; Torres, Pedro

    2008-01-01

    In this work, we report a simple, flexible method to create long period fiber gratings mechanically by controlling the repulsion/attraction force between two magnets that pressing a plate with a periodic array of small glass cylinders to a short length of optical fiber. Via the photoelastic effect, the pressure points induce the required periodic refractive index modulation to create the LPFG. We found that the induced device exhibits spectral characteristics similar to those of other types of LPFG. As the optical properties of LPFGs are directly related to the nature of the applied perturbations, we show, to our knowledge for the frrst time, how is the evolution of birefringence effects in mechanically induced LPFGs

  13. Long-Period Variability in o Ceti

    Science.gov (United States)

    Templeton, Matthew R.; Karovska, Margarita

    2009-02-01

    We carried out a new and sensitive search for long-period variability in the prototype of the Mira class of long-period pulsating variables, o Ceti (Mira A), the closest and brightest Mira variable. We conducted this search using an unbroken light curve from 1902 to the present, assembled from the visual data archives of five major variable star observing organizations from around the world. We applied several time-series analysis techniques to search for two specific kinds of variability: long secondary periods (LSPs) longer than the dominant pulsation period of ~333 days, and long-term period variation in the dominant pulsation period itself. The data quality is sufficient to detect coherent periodic variations with photometric amplitudes of 0.05 mag or less. We do not find evidence for coherent LSPs in o Ceti to a limit of 0.1 mag, where the amplitude limit is set by intrinsic, stochastic, low-frequency variability of approximately 0.1 mag. We marginally detect a slight modulation of the pulsation period similar in timescale to that observed in the Miras with meandering periods, but with a much lower period amplitude of ±2 days. However, we do find clear evidence of a low-frequency power-law component in the Fourier spectrum of o Ceti's long-term light curve. The amplitude of this stochastic variability is approximately 0.1 mag at a period of 1000 days, and it exhibits a turnover for periods longer than this. This spectrum is similar to the red noise spectra observed in red supergiants.

  14. AIS authentication

    CERN Multimedia

    2006-01-01

    Users are invited to use the NICE password for AIS authentication. As announced in CNL June-August 2006 (see http://www.cerncourier.com/articles/cnl/3/6/14/1) it is possible to use the NICE username and password to log on to AIS. The procedure is now fully operational and users can themselves reset the AIS password such that the NICE password will be used for authentication required by AIS applications. We strongly recommend CERN users who have a NICE account (this is the case of most users) to do this, with the objective to reduce the number of passwords they need to remember. This can be achieved very easily, directly from the Change Password option on the AIS login (https://aislogin.cern.ch/). Users should just select the '[Change Password]' option displayed at the bottom of the page, provide the 'Old Password' and then click on the button 'Use Nice password' followed by 'Submit'. Change Password option on the AIS login windowSetting the AIS password - Use Nice Password It should be noted that the proce...

  15. (abstract) Effect of Long Period Ocean Tides on the Earth's Rotation

    Science.gov (United States)

    Gross, R. S.; Chao, B. F.; Desai, S.

    1996-01-01

    The second-degree zonal tide raising potential, which is responsible for tidal changes in the Earth's rotation rate and length-of-day, is symmetric about the polar axis and hence can excite the Earth's polar motion only through its action upon nonaxisymmetric features of the Earth such as the oceans. Ocean tidal excitation of polar motion in the diurnal and semidiurnal tidal bands has been previously detected and extensively examined. Here, the detection of ocean tidal excitation of polar motion in the long-period tidal band, specifically at the Mf' (13.63-day) and Mf (13.66-day) tidal frequencies, is reported.

  16. Long-Period Tidal Variations of the Earth's Rotation Rate

    Science.gov (United States)

    Desai, S.; Gross, R.; Wahr, J.

    1999-01-01

    Long-period tidal variations of the Earth's rotation rate are caused by the redistribution of mass associated with the respective elastic solid Earth tides, the ocean tide heights, and the anelasticity of the Earth's mantle, and by the relative angular momentum associated with the long-period ocean tide currents.

  17. Variation of long periodicity in blends of styrene butadiene, styrene ...

    Indian Academy of Sciences (India)

    relationship between long periodicity and concentration of blends. These parameters are ... tential customers for conducting polymers [10]. 2. ... Theory. The linear paracrystalline model of polymer morphology of blends comprises stacks.

  18. Periodical rocking long period gratings in PANDA fibers for high temperature and refractive index sensing

    Science.gov (United States)

    Jin, Wa; Bi, Wei-hong; Fu, Xing-hu; Fu, Guang-wei

    2017-09-01

    We report periodical rocking long period gratings (PR-LPGs) in PANDA fibers fabricated with CO2 laser. The PR-LPGs achieve very high coupling efficiency of 19 dB with 12 periods and a 3.5° twist angle in just one scanning cycle, which is much more effective than the conventional CO2 laser fabrication technique. This type of LPGs exhibits polarization-selective resonance dips which demonstrate different sensitivities to environmental parameters. The high temperature and external refractive index sensitivities are measured simultaneously, so it can be used as a wavelength-selective polarization filter and sensor.

  19. Long periodicity of Blazar with RXTE ASM, TA and HEGRA

    OpenAIRE

    Osone, S.; Teshima, M.

    2002-01-01

    Long periodicity for Mkn501 during a large flare in 1997 have been reported by TA, HEGRA group. Here, we establish this periodicity with archival data of RXTE All Sky Monitor(ASM), Telescope Array(TA) and HEGRA with a chance probability less than $10^{-5}$. We also find that an origin of 23 day periodicity is related with a change of either a gamma factor of electrons $\\gamma$ or the magnetic field or a beaming factor. And, in order to search for a category which have a long periodicity, we m...

  20. Design and development of long-period grating sensors for ...

    Indian Academy of Sciences (India)

    Raja Ramanna Centre for Advanced Technology, Indore 450 213. ∗ e-mail: ... Home built CO2 laser (Max power 20 Watt) is focused onto .... Claus R O 1997 Temperature-insensitive and strain insensitive long-period grating sensors for smart.

  1. Combination spectra in long-period variable stars

    International Nuclear Information System (INIS)

    Bruce, C.E.R.

    1975-01-01

    The electrical discharge theory of the variation in excitation observed in the atmosphere of the long period variable stars offers an explanation for the combination spectra exhibited by many of these stars, which is shown to be in accord with several of the most outstanding changes in their spectra and magnitude. (author)

  2. Highly Sensitive Cadmium Concentration Sensor Using Long Period Grating

    Directory of Open Access Journals (Sweden)

    A. S. Lalasangi

    2011-08-01

    Full Text Available In this paper we have proposed a simple and effective Long Period Grating chemical sensor for detecting the traces of Cadmium (Cd++ in drinking water at ppm level. Long Period gratings (LPG were fabricated by point-by-point technique with CO2 laser. We have characterized the LPG concentration sensor sensitivity for different solutions of Cd concentrations varying from 0.01 ppm to 0.04 ppm by injecting white Light source and observed transmitted spectra using Optical Spectrum Analyzer (OSA. Proper reagents have been used in the solutions for detection of the Cd species. The overall shift in wavelength is 10 nm when surrounding medium gradually changed from water to 0.04 ppm of cadmium concentrations. A comparative study has been done using sophisticated spectroscopic atomic absorption spectrometer (AAS and Inductively Coupled Plasma (ICP instruments. The spectral sensitivity enhancement was done by modifying grating surface with gold nanoparticles.

  3. A Long-Period Grating Sensor for Wind Turbine Blades

    DEFF Research Database (Denmark)

    Glavind, Lars

    This PhD project concerns the applied research for providing a novel sensor for measurements on wind turbine blades, based on Long-Period Gratings. The idea is based on the utilization of a special asymmetrical optical fibre with Long-Period Gratings for directional sensitive bend sensing...... blade material, where a suitable process and recoating material were investigated. The sensor was implemented and tested on a full scale wind turbine blade placed on a test rig. This first prototype has demonstrated the capability of the sensor for wind turbine blade monitoring, particular...... the possibility to distinguish between the flap- and edge-wise bend directions on the wind turbine blade, providing a selective sensor. The sensor has proven to be very robust and suitable for this application....

  4. Optimal ground motion intensity measure for long-period structures

    International Nuclear Information System (INIS)

    Guan, Minsheng; Du, Hongbiao; Zeng, Qingli; Cui, Jie; Jiang, Haibo

    2015-01-01

    This paper aims to select the most appropriate ground motion intensity measure (IM) that is used in selecting earthquake records for the dynamic time history analysis of long-period structures. For this purpose, six reinforced concrete frame-core wall structures, designed according to modern seismic codes, are studied through dynamic time history analyses with a set of twelve selected earthquake records. Twelve IMs and two types of seismic damage indices, namely, the maximum seismic response-based and energy-based parameters, are chosen as the examined indices. Selection criteria such as correlation, efficiency, and proficiency are considered in the selection process. The optimal IM is identified by means of a comprehensive evaluation using a large number of data of correlation, efficiency, and proficiency coefficients. Numerical results illustrate that peak ground velocity is the optimal one for long-period structures and peak ground displacement is also a close contender. As compared to previous reports, the spectral-correlated parameters can only be taken as moderate IMs. Moreover, the widely used peak ground acceleration in the current seismic codes is considered inappropriate for long-period structures. (paper)

  5. Long-Period Tidal Variations in the Length of Day

    Science.gov (United States)

    Ray, Richard D.; Erofeeva, Svetlana Y.

    2014-01-01

    A new model of long-period tidal variations in length of day is developed. The model comprises 80 spectral lines with periods between 18.6 years and 4.7 days, and it consistently includes effects of mantle anelasticity and dynamic ocean tides for all lines. The anelastic properties followWahr and Bergen; experimental confirmation for their results now exists at the fortnightly period, but there remains uncertainty when extrapolating to the longest periods. The ocean modeling builds on recent work with the fortnightly constituent, which suggests that oceanic tidal angular momentum can be reliably predicted at these periods without data assimilation. This is a critical property when modeling most long-period tides, for which little observational data exist. Dynamic ocean effects are quite pronounced at shortest periods as out-of-phase rotation components become nearly as large as in-phase components. The model is tested against a 20 year time series of space geodetic measurements of length of day. The current international standard model is shown to leave significant residual tidal energy, and the new model is found to mostly eliminate that energy, with especially large variance reduction for constituents Sa, Ssa, Mf, and Mt.

  6. Sensing Features of Long Period Gratings in Hollow Core Fibers

    Directory of Open Access Journals (Sweden)

    Agostino Iadicicco

    2015-04-01

    Full Text Available We report on the investigation of the sensing features of the Long-Period fiber Gratings (LPGs fabricated in hollow core photonic crystal fibers (HC-PCFs by the pressure assisted Electric Arc Discharge (EAD technique. In particular, the characterization of the LPG in terms of shift in resonant wavelengths and changes in attenuation band depth to the environmental parameters: strain, temperature, curvature, refractive index and pressure is presented. The achieved results show that LPGs in HC-PCFs represent a novel high performance sensing platform for measurements of different physical parameters including strain, temperature and, especially, for measurements of environmental pressure. The pressure sensitivity enhancement is about four times greater if we compare LPGs in HC and standard fibers. Moreover, differently from LPGs in standard fibers, these LPGs realized in innovative fibers, i.e., the HC-PCFs, are not sensitive to surrounding refractive index.

  7. Cosmogenic nuclide production within the atmosphere and long period comets

    Science.gov (United States)

    Overholt, Andrew C.

    The Earth is constantly bombarded by cosmic rays. These high energy particles collide with target nuclei, producing a shower of secondary particles. These secondaries contribute significantly to the radiation background at sea level and in the atmosphere, as well as producing rare cosmogenic nuclides. This contribution is variable over long time scales as astrophysical events change the cosmic ray flux incident on the Earth. Our work re-examines a previously proposed climate effect of increased cosmic ray flux due to galactic location. Although our work does not support this effect, cosmic ray secondaries remain a threat to terrestrial biota. We calculate the cosmogenic neutron flux within the atmosphere as a function of primary spectrum. This work is pivotal in determining the radiation dose due to any arbitrary astrophysical event where the primary spectrum is known. Additionally, this work can be used to determine the cosmogenic nuclide production from such an event. These neutrons are the fundamental source of cosmogenic nuclides within our atmosphere and extraterrestrial matter. We explore the idea that excursions in 14C and 10Be abundances in the atmosphere may arise from direct deposition by long-period comet impacts, and those in 26Al from any bolide. We find that the amount of nuclide mass on large long-period comets entering the Earth's atmosphere may be sufficient for creating anomalies in the records of 14C and 10Be from past impacts. In particular, the estimated mass of the proposed Younger Dryas comet is consistent with its having deposited sufficient isotopes to account for recorded nuclide increases at that time. The 26Al/10Be ratio is much larger in extraterrestrial objects than in the atmosphere, and so, we note that measuring this ratio in ice cores is a suitable further test for the Younger Dryas impact hypothesis. This portion of our work may be used to find possible impact events in the geologic record as well as determination of a large

  8. Long-period maintenance program of JRR-3M

    International Nuclear Information System (INIS)

    Murayama, Yoji; Onozaki, Michio; Kakefuda, Kazuhiro

    1999-01-01

    The JRR-3M is a swimming pool type research reactor with maximum thermal output of 20 MW, classed in a large-scale research reactor and composed of numerous facilities. An operation cycle consists of 4 weeks of continuously reactor operation and 1 week of shutdown work such as fuel exchange and irradiation sample handling. The temporary and small-scale maintenance is also carried out during the shutdown period. Systematic maintenance period through a year usually follows 2 stages. The former stage of about 4 weeks is prepared to maintain the general facilities related to the overall reactor system such as computer system. The latter stage of about 9 weeks is prepared to maintain the other individual facilities such as cooling facilities and control facilities that are to be inspected by the regulatory body. Since preventive maintenance is required in order to achieve an improvement of safety, reliability and availability throughout the life cycle of the reactor, a long-period maintenance program should be prepared properly in consideration of an ageing degradation of the facilities. The long-period maintenance program of JRR-3M, which determines not only the replacement frequency but also the maintenance frequency of the facilities, is made on the basis of an ageing degradation of the facilities, irradiation effects of the materials, recommendations from the manufacturer and JRR-3M maintenance records. The replacement frequency recommended by the manufacturer is examined from the viewpoint of the safety significance of the facilities and availability of the components. The program is arranged so that it may not concentrate the replacement of the facilities in the specific fiscal year and smooth the budget and maintenance period throughout the life cycle of the reactor. There have been two unanticipated failures of the facilities, which required rearranging the program. (author)

  9. Depth of source from long period P-waves

    International Nuclear Information System (INIS)

    Roy, Falguni

    1986-01-01

    Short period (SP) seismograms are much better than long period (LP) seismograms to get the time resolution needed for the focal depth estimation. However, complex scattering effects due to crustal inhomogeneities and also the multi-pathing of signals usually complicate the short period records. On the other hand the seismograms from long period signals demonstrate clear coherent body waves. Therefore, for intermediate depths (15-60 km) prediction error filtering of LP signals will be useful for identifying the depth phases. Such a study has been carried out in the first part of this report. In a group of 7 events, the p p phases have been extracted from LP signals and the depths so estimated compared well with the published data. For explosions at shallow depths (depth p phases will tend to cancel each other in LP seismograms. As the source depth increases, the cancellation becomes less effective. This feature can be used for the identification of an event as well as for getting an estimate of the source depth. This phenomenon can be successfully exploited for identifying multiple explosions, because at teleseismic distances (Δ > 30 o ) no LP (around 20s period) P waves will be seen in the seismogram due to such events whereas relatively strong SP signals and LP Rayleigh waves will be observed. This phenomenon has been studied for 16 events. For three of these events having m b as high as 6.1 and presumed to be underground explosions, one could not see any P wave on remaining 13 events (which were classified as earthquakes), it was possible to set a threshold value of m b above which an earthquake should produce LP P-wave signals at a given distance. (author)

  10. Long Period Source Characteristics of Great Earthquakes: diagnosing complexity

    Science.gov (United States)

    Rivera, L. A.; Kanamori, H.

    2013-12-01

    With the commonly used centroid moment tensor inversions, just one number represents the long period size of the event, the seismic moment Mo (or corresponding Mw). However, several recent studies have clearly demonstrated that this is not satisfactory, at least for some earthquakes. For example, for the 2004 Sumatra-Andaman Is. Earthquake, the amplitudes of long-period normal modes indicated that the effective seismic moment increases from 4.0x1022 to 7.1x1022 N-m as the period increases from 300 to 1000 sec. For the 2009 Samoa Is. earthquake (Mw=8.1), the moment tensor was found to be strongly dependent on frequency because the source of this earthquake consists of at least 2 distinct events with very different mechanisms. It is possible that other large and great earthquakes may have similar complex characteristics, but with the standard moment tensor inversion with a single frequency band, we may not notice this easily. Here we investigate the possible frequency dependence of the moment tensor of large earthquakes by performing W phase inversions using teleseismic data and equally spaced narrow overlapping frequency bands. We investigate frequencies from 2.6 to 3.8 mHz. We focus on the variation with frequency of the scalar moment, the amount of non double couple and the focal mechanism. We apply this technique to 30 major events in the period 1994-2013 and use the results to detect source complexity. We class them in three groups according to the variability of the source parameters with frequency: Simple, Complex and Intermediate events and we discuss the correlation of the result of this approach with independent observations of source complexity.

  11. Long-Period Exoplanets from Photometric Transit Surveys

    Science.gov (United States)

    Osborn, Hugh

    2017-10-01

    Photometric transit surveys on the ground & in space have detected thousands of transiting exoplanets, typically by analytically combining the signals from multiple transits. This technique of exoplanet detection was exploited in K2 to detect nearly 200 candidate planets, and extensive follow-up was able to confirm the planet K2-110b as a 2.6±0.1R⊕, 16.7±3.2M⊙ planet on a 14d orbit around a K-dwarf. The ability to push beyond the time limit set by transit surveys to detect long-period transiting objects from a single eclipse was also studied. This was performed by developing a search technique to search for planets around bright stars in WASP and NGTS photometry, finding NGTS to be marginally better than WASP at detecting such planets with 4.14±0.16 per year compared to 1.43±0.15, and detecting many planet candidates for which follow-up is on-going. This search was then adapted to search for deep, long-duration eclipses in all WASP targets. The results of this survey are described in this thesis, as well as detailed results for the candidate PDS-110, a young T-Tauri star which exhibited ∼20d-long, 30%-deep eclipses in 2008 and 2011. Space-based photometers such as Kepler have the precision to identify small exoplanets and eclipsing binary candidates from only a single eclipse. K2, with its 75d campaign duration and high-precision photometry, is not only ideally suited to detect significant numbers of single-eclipsing objects, but also to characterise them from a single event. The Bayesian transit-fitting tool ("Namaste: An MCMC Analysis of Single Transit Exoplanets") was developed to extract planetary and orbital information from single transits, and was applied to 71 candidate events detected in K2 photometry. The techniques developed in this thesis are highly applicable to future transit surveys such as TESS & PLATO, which will be able to discover & characterise large numbers of long period planets in this way

  12. Love numbers for the long-period tides estimated by VLBI

    Science.gov (United States)

    Krásná, Hana; Böhm, Johannes; Haas, Rüdiger; Schuh, Harald

    2013-04-01

    Love and Shida numbers are proportionality factors characterizing the deformation of the anelastic Earth which arises as a response to external forces from the Moon and Sun. The increasing precision and quality of the Very Long Baseline Interferometry (VLBI) measurements allow determining those parameters. In particular, the long history of the VLBI data enables the estimation of Love and Shida numbers at the low frequencies of the tidal waves including the periods from 14 days to 18.6 years. In this study we analyse 27 years of VLBI measurements (1984.0 - 2011.0) following the recent IERS Conventions 2010. In several global solutions, we estimate the complex Love and Shida numbers of the solid Earth tides for the main long-period tidal waves. Furthermore, we determine the Love and Shida numbers of the rotational deformation due to polar motion, the so-called pole tide. We also focus on station displacement where still some deficiencies in the long-period signal modelling can be seen.

  13. Artificial Intelligence Study (AIS).

    Science.gov (United States)

    1987-02-01

    ARTIFICIAL INTELLIGNECE HARDWARE ....... 2-50 AI Architecture ................................... 2-49 AI Hardware ....................................... 2...ftf1 829 ARTIFICIAL INTELLIGENCE STUDY (RIS)(U) MAY CONCEPTS 1/3 A~NLYSIS AGENCY BETHESA RD R B NOJESKI FED 6? CM-RP-97-1 NCASIFIED /01/6 M |K 1.0...p/ - - ., e -- CAA- RP- 87-1 SAOFŔ)11 I ARTIFICIAL INTELLIGENCE STUDY (AIS) tNo DTICFEBRUARY 1987 LECT 00 I PREPARED BY RESEARCH AND ANALYSIS

  14. Are dayside long-period pulsations related to the cusp?

    Directory of Open Access Journals (Sweden)

    V. Pilipenko

    2015-03-01

    Full Text Available We compare simultaneous observations of long-period ultra-low-frequency (ULF wave activity from a Svalbard/IMAGE fluxgate magnetometer latitudinal profile covering the expected cusp geomagnetic latitudes. Irregular Pulsations at Cusp Latitudes (IPCL and narrowband Pc5 waves are found to be a ubiquitous element of ULF activity in the dayside high-latitude region. To identify the ionospheric projections of the cusp, we use the width of return signal of the Super Dual Auroral Radar Network (SuperDARN radar covering the Svalbard archipelago, predictions of empirical cusp models, augmented whenever possible by Defense Meteorological Satellite Program (DMSP identification of magnetospheric boundary domains. The meridional spatial structure of broadband dayside Pc5–6 pulsation spectral power has been found to have a localized latitudinal peak, not under the cusp proper as was previously thought, but several degrees southward from the equatorward cusp boundary. The earlier claims of the dayside monochromatic Pc5 wave association with the open–closed boundary also seems doubtful. Transient currents producing broadband Pc5–6 probably originate at the low-latitude boundary layer/central plasma sheet (LLBL/CPS interface, though such identification with available DMSP data is not very precise. The occurrence of broadband Pc5–6 pulsations in the dayside boundary layers is a challenge to modelers because so far their mechanism has not been firmly identified.

  15. Atmospheric kinematics of high velocity long period variables

    International Nuclear Information System (INIS)

    Willson, L.A.

    1982-01-01

    Radial velocities of atomic absorption lines of three long period variables, RT Cyg, Z Oph and S Car, have been analysed in order to understand velocity gradients and discontinuities in their atmospheres. Phase coverage is from five days before maximum to 73 days after maximum for RT Cyg, from 17 days before to 44 days after maximum for Z Oph, and at 9 days before maximum for S Car. On a few spectrograms double lines were seen. All spectrograms were analysed by a four-parameter regression programme to yield the dependence of the radial velocity on the excitation potential, first ionization potential, wavelength and line strength, as indicators of the depth of line formation. The data were analysed to yield the velocity discontinuity across shock waves and velocity gradients between shock waves. Near maximum light the radial velocities cannot be understood by the presence of one shock only but rather require two shocks. The lower shock becomes apparent at the longer wavelengths. Consistent parameters are obtained if these stars are fundamental mode pulsators with total masses in the range of 0.5 to 1.0 solar mass and effective radii in the range of 0.85 to 1.5 x 10 13 cm. (author)

  16. Deep long-period earthquakes beneath Washington and Oregon volcanoes

    Science.gov (United States)

    Nichols, M.L.; Malone, S.D.; Moran, S.C.; Thelen, W.A.; Vidale, J.E.

    2011-01-01

    Deep long-period (DLP) earthquakes are an enigmatic type of seismicity occurring near or beneath volcanoes. They are commonly associated with the presence of magma, and found in some cases to correlate with eruptive activity. To more thoroughly understand and characterize DLP occurrence near volcanoes in Washington and Oregon, we systematically searched the Pacific Northwest Seismic Network (PNSN) triggered earthquake catalog for DLPs occurring between 1980 (when PNSN began collecting digital data) and October 2009. Through our analysis we identified 60 DLPs beneath six Cascade volcanic centers. No DLPs were associated with volcanic activity, including the 1980-1986 and 2004-2008 eruptions at Mount St. Helens. More than half of the events occurred near Mount Baker, where the background flux of magmatic gases is greatest among Washington and Oregon volcanoes. The six volcanoes with DLPs (counts in parentheses) are Mount Baker (31), Glacier Peak (9), Mount Rainier (9), Mount St. Helens (9), Three Sisters (1), and Crater Lake (1). No DLPs were identified beneath Mount Adams, Mount Hood, Mount Jefferson, or Newberry Volcano, although (except at Hood) that may be due in part to poorer network coverage. In cases where the DLPs do not occur directly beneath the volcanic edifice, the locations coincide with large structural faults that extend into the deep crust. Our observations suggest the occurrence of DLPs in these areas could represent fluid and/or magma transport along pre-existing tectonic structures in the middle crust. ?? 2010 Elsevier B.V.

  17. Long Period Earthquakes Beneath California's Young and Restless Volcanoes

    Science.gov (United States)

    Pitt, A. M.; Dawson, P. B.; Shelly, D. R.; Hill, D. P.; Mangan, M.

    2013-12-01

    The newly established USGS California Volcano Observatory has the broad responsibility of monitoring and assessing hazards at California's potentially threatening volcanoes, most notably Mount Shasta, Medicine Lake, Clear Lake Volcanic Field, and Lassen Volcanic Center in northern California; and Long Valley Caldera, Mammoth Mountain, and Mono-Inyo Craters in east-central California. Volcanic eruptions occur in California about as frequently as the largest San Andreas Fault Zone earthquakes-more than ten eruptions have occurred in the last 1,000 years, most recently at Lassen Peak (1666 C.E. and 1914-1917 C.E.) and Mono-Inyo Craters (c. 1700 C.E.). The Long Valley region (Long Valley caldera and Mammoth Mountain) underwent several episodes of heightened unrest over the last three decades, including intense swarms of volcano-tectonic (VT) earthquakes, rapid caldera uplift, and hazardous CO2 emissions. Both Medicine Lake and Lassen are subsiding at appreciable rates, and along with Clear Lake, Long Valley Caldera, and Mammoth Mountain, sporadically experience long period (LP) earthquakes related to migration of magmatic or hydrothermal fluids. Worldwide, the last two decades have shown the importance of tracking LP earthquakes beneath young volcanic systems, as they often provide indication of impending unrest or eruption. Herein we document the occurrence of LP earthquakes at several of California's young volcanoes, updating a previous study published in Pitt et al., 2002, SRL. All events were detected and located using data from stations within the Northern California Seismic Network (NCSN). Event detection was spatially and temporally uneven across the NCSN in the 1980s and 1990s, but additional stations, adoption of the Earthworm processing system, and heightened vigilance by seismologists have improved the catalog over the last decade. LP earthquakes are now relatively well-recorded under Lassen (~150 events since 2000), Clear Lake (~60 events), Mammoth Mountain

  18. T'ai Chi

    Science.gov (United States)

    ... are different styles of t'ai chi, including: Chen style Hao (or Wu Shi) style Hu Lei ... medical advice, diagnoses, and treatment, consult your doctor. © 1995- The Nemours Foundation. All rights reserved. Images provided ...

  19. Modeling Progress in AI

    OpenAIRE

    Brundage, Miles

    2015-01-01

    Participants in recent discussions of AI-related issues ranging from intelligence explosion to technological unemployment have made diverse claims about the nature, pace, and drivers of progress in AI. However, these theories are rarely specified in enough detail to enable systematic evaluation of their assumptions or to extrapolate progress quantitatively, as is often done with some success in other technological domains. After reviewing relevant literatures and justifying the need for more ...

  20. Areal Informations Systemet - AIS

    DEFF Research Database (Denmark)

    Nielsen, K.; Stjernholm, M.; Olsen, B. Ø.

    Forord: Denne rapport giver en kort beskrivelse af Areal Informations Systemet (AIS), som er et databasesystem med natur- og miljødata, som kan stedfæstes geografisk. Projektet er gennemført i perioden 1996-2000 som et samarbejdsprojekt mellem Danmarks Miljøundersøgelser (DMU), Danmarks og...... og enkeltpersoner med interesse for natur- og miljøforhold i Danmark. Yderligere oplysninger om Areal Informations Systemet, herunder adgangsforhold, kan fås på DMU's hjemmeside med følgende adresse: http://ais.dmu.dk/ Projektet er finansieret af Miljø- og Energiministeriet, mens en række...... (planlægning, beskyttelse), geologi (overfladegeologi og marin geologi), samt marin dybdemodel. # Etablering af dataadgang for Miljø- og Energiministeriets institutioner til AIS-data. # Afprøvning af systemet i forhold til konkrete projekter. # Formidling af produkterne til brugerkredsen....

  1. Revised predictions of long-period ocean tidal effects on Earth's rotation rate

    Science.gov (United States)

    Dickman, S. R.; Nam, Young S.

    1995-01-01

    The rotational response of Earth to long-period tidal forces, embodied in a 'zonal response function,' can be expected to vary with frequency because of variable contributions by the oceans, mantle, and core. The zonal response function has been estimated from 9 years of International Radio Interferometric Surveying (IRIS) universal time (UT1) data and compared with theoretical predictions, using a spherical harmonic tide model to compute the oceans' dynamic response, at semiannual, monthly, fortnightly, and 9-day lunisolar tidal frequencies. Different amounts of mantle anelasticity have been considered for both the oceanic and soild earth responses; predictions have been made assuming axial core-mantle coupling which is either complete or absent. Additionally, an extensive recalibration of the ocean model's frictional parameters was performed using constraints derived in part from Space92 polar motion data; zonal response function predictions have also been made employing this recalibrated ocean tide model. Our results indicate that any amount of core coupling can be ruled out at a fortnightly period and probably at a 9-day period, but not at a monthly period. Our results also suggest that the mantle responds purely elastically at a 9-day period but may behave increasingly anelastically at longer periods. A simple dispersive rule is postulated for periods ranging up to the 14-month Chandler wobble period.

  2. MassAI

    DEFF Research Database (Denmark)

    2011-01-01

    A software tool for general analysis and data-mining of mass-spectrometric datasets. The program features a strong emphasis on scan-by-scan identification and results-transparency. MassAI also accommodates residue level analysis of labelled runs, e.g. HDX.......A software tool for general analysis and data-mining of mass-spectrometric datasets. The program features a strong emphasis on scan-by-scan identification and results-transparency. MassAI also accommodates residue level analysis of labelled runs, e.g. HDX....

  3. Study on temperature sensitivity of topological insulators based on long-period fiber grating

    Science.gov (United States)

    Luo, Jianhua; Zhao, Chenghai; Li, Jianbo; He, Mengdong

    2017-06-01

    Based on a long-period fiber grating, we conducted experimental research on the temperature sensitivity of topological insulators. The long-period fiber grating and topological insulators solution were encapsulated in a capillary tube using UV glue, and the temperature response was measured. Within a range of 35 to 75 centigrade, one resonance dip of a long-period fiber grating exhibits a redshift of 1.536 nm. The temperature sensitivity is about 7.7 times of an ordinary long-period fiber grating's sensitivity (0.005 nm/°C). A numerical simulation is also performed on the basis of the experiments.

  4. Tweeting AI: Perceptions of AI-Tweeters (AIT) vs Expert AI-Tweeters (EAIT)

    OpenAIRE

    Manikonda, Lydia; Dudley, Cameron; Kambhampati, Subbarao

    2017-01-01

    With the recent advancements in Artificial Intelligence (AI), various organizations and individuals started debating about the progress of AI as a blessing or a curse for the future of the society. This paper conducts an investigation on how the public perceives the progress of AI by utilizing the data shared on Twitter. Specifically, this paper performs a comparative analysis on the understanding of users from two categories -- general AI-Tweeters (AIT) and the expert AI-Tweeters (EAIT) who ...

  5. Dynamics of long-period irregular pulsations in high latitudes during strong magnetic storms

    International Nuclear Information System (INIS)

    Kurazhkovskaya, N.A.; Klajn, B.I.

    1995-01-01

    Effects of strong magnetic storms within np type high-latitudinal long-period irregular pulsations at Mirny studied using data obtained at observatory of the magnetosphere south hemisphere. Variation of long-period irregular pulsation amplitude is shown to depend essentially on duration of storm initial phase and on the nature of solar wind heterogeneity enabling growth of strong storm. 14 refs

  6. AIS ASM Operational Integration Plan

    Science.gov (United States)

    2013-08-01

    Rack mount computer AIS Radio Interface Ethernet Switch 192.168.0.x Firewall Cable Modem 192.168.0.1 VTS Accred. Boundary AIS ASM Operational... AIS ASM Operational Integration Plan Distribution Statement A: Approved for public release; distribution is unlimited. August 2013 Report No...CD-D-07-15 AIS ASM Operational Integration Plan ii UNCLAS//Public | CG-926 R&DC | I. Gonin, et al. | Public August 2013 N O T I C

  7. General general game AI

    OpenAIRE

    Togelius, Julian; Yannakakis, Georgios N.; 2016 IEEE Conference on Computational Intelligence and Games (CIG)

    2016-01-01

    Arguably the grand goal of artificial intelligence research is to produce machines with general intelligence: the capacity to solve multiple problems, not just one. Artificial intelligence (AI) has investigated the general intelligence capacity of machines within the domain of games more than any other domain given the ideal properties of games for that purpose: controlled yet interesting and computationally hard problems. This line of research, however, has so far focuse...

  8. AI and health

    OpenAIRE

    Martin Anderson

    2018-01-01

    ntelligence refers to the ability of an individual to learn or understand something, or to deal with a new situation. When a machine or software exhibits such characteristics, it is referred to as artificial intelligence (AI). Artificial Intelligence is therefore defined as the theory and development of computer systems able to perform tasks that normally require human intelligence, such as visual perception, speech recognition, decision-making, and translation between languages.

  9. AI and Mathematical Education

    Directory of Open Access Journals (Sweden)

    Angel Garrido

    2012-01-01

    Full Text Available From ancient times, the history of human beings has developed by a succession of steps and sometimes jumps, until reaching the relative sophistication of the modern brain and culture. Researchers are attempting to create systems that mimic human thinking, understand speech, or beat the best human chess player. Understanding the mechanisms of intelligence, and creating intelligent artifacts are the twin goals of Artificial Intelligence (AI. Great mathematical minds have played a key role in AI in recent years; to name only a few: Janos Neumann (also known as John von Neumann, Konrad Zuse, Norbert Wiener, Claude E. Shannon, Alan M. Turing, Grigore Moisil, Lofti A. Zadeh, Ronald R. Yager, Michio Sugeno, Solomon Marcus, or Lászlo A. Barabási. Introducing the study of AI is not merely useful because of its capability for solving difficult problems, but also because of its mathematical nature. It prepares us to understand the current world, enabling us to act on the challenges of the future.

  10. Characteristics of long-period swells measured in the near shore regions of eastern Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Johnson, G.; SanilKumar, V.; Amrutha, M.M.; Singh, J.

    Measured wave data covering two years simultaneously at 3 locations along the eastern Arabian Sea reveals the presence of long-period (peak wave period > 18 s) low-amplitude waves (significant wave height < 1 m) and the characteristics...

  11. AI 3D Cybug Gaming

    OpenAIRE

    Ahmed, Zeeshan

    2010-01-01

    In this short paper I briefly discuss 3D war Game based on artificial intelligence concepts called AI WAR. Going in to the details, I present the importance of CAICL language and how this language is used in AI WAR. Moreover I also present a designed and implemented 3D War Cybug for AI WAR using CAICL and discus the implemented strategy to defeat its enemies during the game life.

  12. Long period seismic source characterization at Popocatépetl volcano, Mexico

    Science.gov (United States)

    Arciniega-Ceballos, Alejandra; Dawson, Phillip; Chouet, Bernard A.

    2012-01-01

    The seismicity of Popocatépetl is dominated by long-period and very-long period signals associated with hydrothermal processes and magmatic degassing. We model the source mechanism of repetitive long-period signals in the 0.4–2 s band from a 15-station broadband network by stacking long-period events with similar waveforms to improve the signal-to-noise ratio. The data are well fitted by a point source located within the summit crater ~250 m below the crater floor and ~200 m from the inferred magma conduit. The inferred source includes a volumetric component that can be modeled as resonance of a horizontal steam-filled crack and a vertical single force component. The long-period events are thought to be related to the interaction between the magmatic system and a perched hydrothermal system. Repetitive injection of fluid into the horizontal fracture and subsequent sudden discharge when a critical pressure threshold is met provides a non-destructive source process.

  13. Application of Notched Long-Period Fiber Grating Based Sensor for CO2 Gas Sensing

    Science.gov (United States)

    Wu, Chao-Wei; Chiang, Chia-Chin

    2016-01-01

    An inductively coupled plasma etching process to fabricate notched long-period fiber gratings for CO2 gas sensing is proposed in this article. In the gas sensing test, the 15% mixed CO2 gas was used for characterization of CO2 adsorption by the amine-modified nanoporous silica foams of the notched long-period fiber grating sensor. The results shows the spectra were changed with the CO2 gas flow within 13 min. During the absorption process, the transmission of the resonant dip was decreased by 2.884 dB. Therefore, the proposed notched long-period fiber grating gas sensor shows good performance and is suitable as a gas sensor for monitoring the CO2 adsorption process.

  14. Effects of Accretionary Prisms on 3-D Long-Period Ground Motion Simulations

    Science.gov (United States)

    Guo, Y.; Koketsu, K.; Miyake, H.

    2014-12-01

    The accretionary prism along the subduction zones such as the Middle America trench or the Nankai trough is considered as an important factor affecting the generation and propagation of long-period ground motions. In Japan, the great earthquake along the Nankai subduction zone which is expected to occur in the near future can generate large long-period ground motions in the metropolitan areas such as Osaka, Nagoya and Tokyo. To investigate the effect of accretionary prism on long-period ground motions, we performed simulations of long-period ground motions for the event (Mw 7.1) that occurred off the Kii peninsula, Japan, at 10:07 on 5 September 2004 (UTC). Our simulation model ranged from the Kinki region to the Kanto region, and included the Osaka, Nobi and Kanto basin. We calculated long-period ground motions for four types of 3-D velocity structure models: (a) model with the accretionary prism (reference model), (b) model where accretionary prism has different 3-D geometry from the reference model, (c) model with the accretionary prism whose velocity, density and Q-value are shifted, (d) model without the accretionary prism. We compared the waveforms calculated for these models and concluded that the accretionary prism along the Nankai subduction zone plays roles in reducing the amplitude of direct waves and extending the duration of coda waves. This is attributed to the trap effect of accretionary prism. Our simulation also suggested that, the edge geometry along the landward side of accretionary prism has major effects on the processes of generation and propagation of long-period ground motions.

  15. Design of Long Period Pseudo-Random Sequences from the Addition of -Sequences over

    Directory of Open Access Journals (Sweden)

    Ren Jian

    2004-01-01

    Full Text Available Pseudo-random sequence with good correlation property and large linear span is widely used in code division multiple access (CDMA communication systems and cryptology for reliable and secure information transmission. In this paper, sequences with long period, large complexity, balance statistics, and low cross-correlation property are constructed from the addition of -sequences with pairwise-prime linear spans (AMPLS. Using -sequences as building blocks, the proposed method proved to be an efficient and flexible approach to construct long period pseudo-random sequences with desirable properties from short period sequences. Applying the proposed method to , a signal set is constructed.

  16. Eight to 14 μm spectral monitoring of long period variable stars with GLADYS.

    Science.gov (United States)

    Levan, P. D.; Sloan, G.; Grasdalen, G.

    The authors describe an ongoing program of spectral monitoring of long period variable stars using GLADYS, a long slit prism spectrometer that employs a 58x62 pixel Si:Ga detector array. The goal is to compare the equivalent widths of the SiC emission features in carbon-rich circumstellar shells, and the silicate emission features in oxygen-rich circumstellar stars, obtained over different phases of the continuum variability cycle. Spectra of long period variables and low amplitude variables recently obtained on the Wyoming Infrared Observatory 2.3 m telescope are presented.

  17. On critical values concerning the evolution of the long period families

    International Nuclear Information System (INIS)

    Hou Xiyun

    2009-01-01

    In a previous paper, we proposed another special critical value concerning the evolution of the long period family around the equilateral equilibrium points, besides the two values given by Henrard. Are there any other special critical values? After studying the stability curves of the long period family carefully, we gave a negative answer. During the study, we found an interesting family of periodic orbits which we called the homo family. We studied the evolution of this family following the increase of μ. With these findings, we were able to explain the origin of the four branches of periodic families emanating from L 4 and the stability results of the equilateral equilibrium points.

  18. AI its nature and future

    CERN Document Server

    Boden, Margaret A

    2016-01-01

    least - on the Internet. Margaret Boden considers the realistic and unrealistic expectations we have placed on AI, analyses its progress, and considers the value of its byproducts. ations we have placed on AI, analyses its progress, and considers the value of its byproducts.

  19. Sensitivity of a long-period optical fiber grating bend sensor

    DEFF Research Database (Denmark)

    Rathje, Jacob; Svalgaard, Mikael; Hübner, Jörg

    1998-01-01

    We have investigated the sensitivity of long-period fiber gratings used in curvature measuring fibre optic sensors and found a bend coefficient of 0.77 dB cm/mrad. In the current setup this corresponds to the ability of detecting curvatures with a radius up to approximately 200 m...

  20. Simulation of the Long period Core Design for WH type of KHNP

    International Nuclear Information System (INIS)

    Jung, Ji-Eun; Moon, Sang-Rae

    2016-01-01

    The current core design of the reactor and the new design of long period based on ANC code are compared here targeting the unit of WH type(Westinghouse nuclear steam supply system) operated by KHNP. The reactor core is composed of 157 fuel assemblies, consisting of a 17×17 array with 264 fuel rods, 24 guide thimbles. To investigate susceptibility of CIPS(crud-induced power shift) for long period core design, the boron mass is also calculated here. The long period core design for WH type of KHNP is simulated and evaluated the risk assessment for the result. 89 feed assemblies and 4.95w/o uranium enrichment (3.2w/o for Axial-blanket) are used for fresh fuel rods. The cycle length of long period design is increased by 6 month than the average of operated cycles satisfying the criteria of risk assessment for the core design; maximum F△h and maximum pin burnup and so on, except burndown curve

  1. Fast Inscription of Long Period Gratings in Microstructured Polymer Optical Fibers

    DEFF Research Database (Denmark)

    Min, Rui; Marques, Carlos; Nielsen, Kristian

    2018-01-01

    We demonstrate 20 dB long period grating (LPG) fast inscription in microstructured polymer optical fibers (mPOFs) using a point-by-point technique obtaining an LPG total length of 25 mm. Two 248 nm UV laser pulses of 15 ns duration have been employed for every inscription point, which means a time...

  2. Simulation of the Long period Core Design for WH type of KHNP

    Energy Technology Data Exchange (ETDEWEB)

    Jung, Ji-Eun; Moon, Sang-Rae [Korea Hydro and Nuclear Power Co., Daejeon (Korea, Republic of)

    2016-10-15

    The current core design of the reactor and the new design of long period based on ANC code are compared here targeting the unit of WH type(Westinghouse nuclear steam supply system) operated by KHNP. The reactor core is composed of 157 fuel assemblies, consisting of a 17×17 array with 264 fuel rods, 24 guide thimbles. To investigate susceptibility of CIPS(crud-induced power shift) for long period core design, the boron mass is also calculated here. The long period core design for WH type of KHNP is simulated and evaluated the risk assessment for the result. 89 feed assemblies and 4.95w/o uranium enrichment (3.2w/o for Axial-blanket) are used for fresh fuel rods. The cycle length of long period design is increased by 6 month than the average of operated cycles satisfying the criteria of risk assessment for the core design; maximum F△h and maximum pin burnup and so on, except burndown curve.

  3. Fiber optic index sensor enhanced by gold nanoparticle assembly on long period grating

    Czech Academy of Sciences Publication Activity Database

    Tian, F.; Li, X.; Kaňka, Jiří; Du, H.

    2017-01-01

    Roč. 132, March (2017), s. 445-449 ISSN 0030-4026 R&D Projects: GA MŠk(CZ) LH11038 Institutional support: RVO:67985882 Keywords : Layer-by-layer * Long period grating * Au nanoparticle Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering OBOR OECD: Electrical and electronic engineering Impact factor: 0.835, year: 2016

  4. Long period gratings written in large-mode area photonic crystal fiber

    DEFF Research Database (Denmark)

    Nodop, D.; Linke, S.; Jansen, F.

    2008-01-01

    We report for the first time, to the best of our knowledge, on the fabrication and characterization of CO2-laser written long-period gratings in a large-mode area photonic crystal fiber with a core diameter of 25 mu m. The gratings have low insertion losses ( 10 d...

  5. High-latitude long-period pulsations in the atmospheric electricity according to observations at Schpitzbergen

    International Nuclear Information System (INIS)

    Klejmenova, N.G.; Kozyreva, O.V.; Mikhnovski, S.; Shimanski, A.; Ermolenko, D.Yu.

    1992-01-01

    The spectrum of long-period oscillations in the electric and magnetic fields is investigated for the first time using the data on simultaneous digital recording in the high altitudes at Schpitzbergen. It is established that during both tranquil and perturbed period at any time of the day, spectrum variation in electric and magnetic fields feature a decline discrete nature

  6. Long-period Ground Motion Simulation in the Osaka Basin during the 2011 Great Tohoku Earthquake

    Science.gov (United States)

    Iwata, T.; Kubo, H.; Asano, K.; Sato, K.; Aoi, S.

    2014-12-01

    Large amplitude long-period ground motions (1-10s) with long duration were observed in the Osaka sedimentary basin during the 2011 Tohoku earthquake (Mw9.0) and its aftershock (Ibaraki-Oki, Mw7.7), which is about 600 km away from the source regions. Sato et al. (2013) analyzed strong ground motion records from the source region to the Osaka basin and showed the following characteristics. (1) In the period range of 1 to 10s, the amplitude of horizontal components of the ground motion at the site-specific period is amplified in the Osaka basin sites. The predominant period is about 7s in the bay area where the largest pSv were observed. (2) The velocity Fourier amplitude spectra with their predominant period of around 7s are observed at the bedrock sites surrounding the Osaka basin. Those characteristics were observed during both of the mainshock and the largest aftershock. Therefore, large long-period ground motions in the Osaka basin are generated by the combination of propagation-path and basin effects. They simulated ground motions due to the largest aftershock as a simple point source model using three-dimensional FDM (GMS; Aoi and Fujiwara, 1999). They used a three-dimensional velocity structure based on the Japan Integrated Velocity Structure Model (JIVSM, Koketsu et al., 2012), with the minimum effective period of the computation of 3s. Their simulation result reproduced the observation characteristics well and it validates the applicability of the JIVSM for the long period ground motion simulation. In this study, we try to simulate long-period ground motions during the mainshock. The source model we used for the simulation is based on the SMGA model obtained by Asano and Iwata (2012). We succeed to simulate long-period ground motion propagation from Kanto area to the Osaka basin fairly well. The long-period ground motion simulations with the several Osaka basin velocity structure models are done for improving the model applicability. We used strong motion

  7. Code AI Personal Web Pages

    Science.gov (United States)

    Garcia, Joseph A.; Smith, Charles A. (Technical Monitor)

    1998-01-01

    The document consists of a publicly available web site (george.arc.nasa.gov) for Joseph A. Garcia's personal web pages in the AI division. Only general information will be posted and no technical material. All the information is unclassified.

  8. Fiber Optic Long Period Grating Based Sensor for Coconut Oil Adulteration Detection

    Directory of Open Access Journals (Sweden)

    T. M. Libish

    2010-03-01

    Full Text Available We report the development and demonstration of a Long-Period Grating (LPG based optical fiber sensor for determining the adulteration of coconut oil by palm oil. The fundamental principle of detection is the sensitive dependence of the resonance peaks of LPG on the changes of the refractive index of the environmental medium around the cladding surface of the grating. Refractive index sensing with LPGs employs light coupling between core and cladding modes in the grating section. The transmittance spectra of a long period grating element immersed in different mixtures of coconut oil and palm oil were recorded. Results show that resonance wavelengths and transmission intensities varied as a function of the adulteration level of coconut oil. Detection limit of adulteration was found to be 2 % for coconut oil–palm oil binary mixture.

  9. On the observed excess of retrograde orbits among long-period comets

    International Nuclear Information System (INIS)

    Fernandez, J.A.

    1981-01-01

    The distribution of orbital inclinations of the observed long-period comets is analysed. An excess of retrograde orbits is found which increases with the perihelion distance, except for the range 1.1 10 3 A U) has the same behaviour as the total sample. It is thus suggested that the excess of retrograde orbits among long-period comets is related to an already existent excess among the incoming new comets (i.e. comets driven into the planetary region by stellar perturbations). Using theoretical considerations and a numerical model it is proposed that an important fraction of the so-called new comets are actually repeating passages through the planetary region. Nearly a half of the new comets with q > 2 A U may be repeating passages. An important consequence of the presence of comets repeating passages among the new ones is the production of an excess of retrograde orbits in the whole sample. (author)

  10. Application of a long-period fibre grating-based transducer in the fuel industry

    International Nuclear Information System (INIS)

    Possetti, G R C; De Arruda, L V R; Muller, M; Fabris, J L; Côcco, L C; Yamamoto, C I; Falate, R

    2009-01-01

    This work shows prospects of long-period fibre grating applications as transducers for fuel conformity analysis. The proposed long-period grating transducer was employed to assess the gasoline conformity in commercial gas stations. Grating responses were used to train and validate a radial base function topology of an artificial neural network. The obtained results show that fibre optic sensors supervised by artificial neural networks can integrate systems for smart sensing with high applicability in the petrochemical field. The radial base function had reached a correct classification probability of approximately 94%. The device applicability in the analysis of hydrated ethanol fuel was also investigated by measuring the concentration of ethanol in ethanol–water mixtures. The results showed that the developed transducer can be used to infer the ethanol–water concentration with a resolution of up to 0.23%

  11. A long-period analog integrator for magnetic measurements in Tore Supra

    International Nuclear Information System (INIS)

    Prou, M.; Barth, E.; Couturier, P.; Ouvrier-Buffet, P.

    1998-01-01

    A new analog integrator, called 'Integrateur 2000', has been developed for precise integration over long periods for the magnetic signals of Tore Supra with the aim of 1000 s discharges for the CIEL project. This new integrator is already in routine use for the present pulse lengths of up to 200 s in T-S, and tests have been carried out up to 1000 s with less than 2 mV of drift. (author)

  12. Application of the X-ray diffractometer DRON to the study of long period structures

    International Nuclear Information System (INIS)

    Gordelij, V.I.; Lushchikov, V.I.; Syrykh, A.G.; Cherezon, V.G.

    1991-01-01

    It is shown that the stock-produced X-ray diffractometer DRON can be adapted for the study of long period structures up to ∼150 A. The experimental data on small-angle diffraction spectra, measured on it, from both lamellar and lateral structures of biological and lipid membranes are reported. The data show that lattice constants of these structures could be determined within the accuracy of 1 A. 15 refs.; 7 figs

  13. The Effect of Seasonal and Long-Period Geopotential Variations on the GPS Orbits

    Science.gov (United States)

    Melachroinos, Stavros A.; Lemoine, Frank G.; Chinn, Douglas S.; Zelensky, Nikita P.; Nicholas, Joseph B.; Beckley, Brian D.

    2013-01-01

    We examine the impact of using seasonal and long-period time-variable gravity field (TVG) models on GPS orbit determination, through simulations from 1994 to 2012. The models of time-variable gravity that we test include the GRGS release RL02 GRACE-derived 10-day gravity field models up to degree and order 20 (grgs20x20), a 4 x 4 series of weekly coefficients using GGM03S as a base derived from SLR and DORIS tracking to 11 satellites (tvg4x4), and a harmonic fit to the above 4 x 4 SLR-DORIS time series (goco2s_fit2). These detailed models are compared to GPS orbit simulations using a reference model (stdtvg) based on the International Earth Rotation Service (IERS) and International GNSS Service (IGS) repro1 standards. We find that the new TVG modeling produces significant along, cross-track orbit differences as well as annual, semi-annual, draconitic and long-period effects in the Helmert translation parameters (Tx, Ty, Tz) of the GPS orbits with magnitudes of several mm. We show that the simplistic TVG modeling approach used by all of the IGS Analysis Centers, which is based on the models provided by the IERS standards, becomes progressively less adequate following 2006 when compared to the seasonal and long-period TVG models.

  14. Salinity measurement in water environment with a long period grating based interferometer

    International Nuclear Information System (INIS)

    Possetti, G R C; Kamikawachi, R C; Muller, M; Fabris, J L; Prevedello, C L

    2009-01-01

    In this work, a comparative study of the behaviour of an in-fibre Mach–Zehnder interferometer for salinity measurement in a water solution is presented. The fibre transducer is composed of two nearly identical long period gratings forming an in-series 7.38 cm long device written in the same fibre optic. Two inorganic and one organic salts (NaCl, KCl, NaCOOH) were characterized within the concentration range from 0 to 150 g L −1 . For the long period grating interferometer, the average obtained sensitivities were −6.61, −5.58 and −3.83 pm/(g L −1 ) for the above salts, respectively, or equivalently −40.8, −46.5 and −39.1 nm RIU −1 . Salinity measured by means of fibre refractometry is compared with measurements obtained using an Abbe refractometer as well as via electrical conductivity. For the long period grating refractometer, the best resolutions attained were 1.30, 1.54 and 2.03 g of salt per litre for NaCl, KCl and NaCOOH, respectively, about two times better than the resolutions obtained by the Abbe refractometer. An average thermal sensitivity of 53 pm °C −1 was measured for the grating transducer immersed in water, indicating the need for the thermal correction of the sensor. Resolutions for the same ionic constituent in different salts are also analysed

  15. Maximizing the TESS Mission’s Yield of Long-Period Planets

    Science.gov (United States)

    Dragomir, Diana; Gaudi, B. Scott; Villanueva, Steven; Crossfield, Ian; Huang, Xu; Ribas, Ignasi; Quinn, Samuel

    2018-01-01

    The upcoming TESS mission will discover thousands of transiting planets around bright stars. However, during its primary mission the satellite will observe most of the sky for just 27 days (and for at most one year even in its continuous viewing zones near the ecliptic poles), thus limiting the mission’s yield of long-period planets that show three or more transits in the TESS light curves. By also pursuing single- and double-transit events, we can increase by several hundred the number of planets with periods longer than 10 days that TESS will discover. I will show how strategic planning and the judicious use of follow-up observations can confirm these planets and refine their ephemerides. Through this program, we will generate a sample of long-period planets transiting bright stars that are ripe for detailed characterization studies such as mass measurements and atmospheric observations. In turn, these studies will provide important constraints on the composition and formation of long-period planets.

  16. Long-period intensity pulsations in the solar corona during activity cycle 23

    Science.gov (United States)

    Auchère, F.; Bocchialini, K.; Solomon, J.; Tison, E.

    2014-03-01

    We report on the detection (10σ) of 917 events of long-period (3 to 16 h) intensity pulsations in the 19.5 nm passband of the SOHO Extreme ultraviolet Imaging Telescope. The data set spans from January 1997 to July 2010, i.e. the entire solar cycle 23 and the beginning of cycle 24. The events can last for up to six days and have relative amplitudes up to 100%. About half of the events (54%) are found to happen in active regions, and 50% of these have been visually associated with coronal loops. The remaining 46% are localized in the quiet Sun. We performed a comprehensive analysis of the possible instrumental artefacts and we conclude that the observed signal is of solar origin. We discuss several scenarios that could explain the main characteristics of the active region events. The long periods and the amplitudes observed rule out any explanation in terms of magnetohydrodynamic waves. Thermal non-equilibrium could produce the right periods, but it fails to explain all the observed properties of coronal loops and the spatial coherence of the events. We propose that moderate temporal variations of the heating term in the energy equation, so as to avoid a thermal non-equilibrium state, could be sufficient to explain those long-period intensity pulsations. The large number of detections suggests that these pulsations are common in active regions. This would imply that the measurement of their properties could provide new constraints on the heating mechanisms of coronal loops. Movies are available in electronic form at http://www.aanda.org

  17. Alternative technique for biodiesel quality control using an optical fiber long-period grating sensor

    International Nuclear Information System (INIS)

    Falate, Rosane; Nike, Karen; Costa Neto, Pedro Ramos da; Cacao Junior, Eduardo; Muller, Marcia; Kalinowski, Hypolito Jose; Fabris, Jose Luis

    2007-01-01

    We report the use of an optical fiber sensor to measure the soybean oil concentration in samples obtained from the mixture of pure biodiesel and commercial soybean oil. The operation of the device is based on the long-period grating sensitivity to the surrounding medium refractive index, which leads to measurable modifications in the grating transmission spectrum. The proposed analysis method results in errors in the oil concentration of 0.4% and 2.6% for pure biodiesel and commercial soybean oil, respectively. Techniques of total glycerol, dynamic viscosity, density, and hydrogen nuclear magnetic resonance spectroscopy were also employed to validate the proposed method. (author)

  18. VizieR Online Data Catalog: Stellar encounters with long-period comets (Feng+, 2015)

    Science.gov (United States)

    Feng, F.; Bailer-Jones, C. A. L.

    2016-07-01

    We have conducted simulations of the perturbation of the Oort cloud in order to estimate the significance of known encounters in generating long-period comets. We collected the data of stellar encounters from three sources: (Bailer-Jones, 2015, Cat. J/A+A/575/A35, hereafter BJ15), Dybczynski & Berski (2015MNRAS.449.2459D), and Mamajek et al. (2015ApJ...800L..17M). Following BJ15, we use the term 'object' to refer to each encountering star in our catalogue. A specific star may appear more than once but with different data, thus leading to a different object. (1 data file).

  19. Control of the long period grating spectrum through low frequency flexural acoustic waves

    International Nuclear Information System (INIS)

    Oliveira, Roberson A; Possetti, Gustavo R C; Kamikawachi, Ricardo C; Fabris, José L; Muller, Marcia; Pohl, Alexandre A P; Marques, Carlos A F; Nogueira, Rogério N; Neves, Paulo T Jr; Cook, Kevin; Canning, John; Bavastri, C

    2011-01-01

    We have shown experimental results of the excitation of long period fiber gratings by means of flexural acoustic waves with a wavelength larger than the grating period, validated by numerical simulations. The effect of the acoustic wave on the grating is modeled with the method of assumed modes, which delivers the strain field inside the grating, then used as the input to the transfer matrix method, needed for calculating the grating spectrum. The experimental and numerical results are found to be in good agreement, even though only the strain-optic effects are taken into account

  20. Study of corrosion using long period fiber gratings coated with iron exposed to salty water

    Science.gov (United States)

    Coelho, L.; Santos, J. L.; Jorge, P. A. S.; de Almeida, J. M. M.

    2017-04-01

    A study of long period fiber gratings (LPFG) over coated with iron (Fe) and subjected to oxidation in water with different sodium chloride (NaCl) concentrations is presented. The formation of iron oxides and hydroxides was monitored in real time by following the features of the LPFG attenuation band. Preliminary results show that Fe coated LPFGs can be used as sensors for early warning of corrosion in offshore and in coastal projects where metal structures made of iron alloys are in contact with sea or brackish water.

  1. Alternative technique for biodiesel quality control using an optical fiber long-period grating sensor

    Energy Technology Data Exchange (ETDEWEB)

    Falate, Rosane [Universidade Estadual de Ponta Grossa, PR (Brazil). Dept. de Informatica; Nike, Karen; Costa Neto, Pedro Ramos da [Universidade Tecnologica Federal do Parana, Curitiba (Brazil). Dept. de Quimica; Cacao Junior, Eduardo; Muller, Marcia; Kalinowski, Hypolito Jose; Fabris, Jose Luis [Universidade Tecnologica Federal do Parana, Curitiba (Brazil). Dept. de Fisica]. E-mail: fabris@utfpr.edu.br

    2007-07-01

    We report the use of an optical fiber sensor to measure the soybean oil concentration in samples obtained from the mixture of pure biodiesel and commercial soybean oil. The operation of the device is based on the long-period grating sensitivity to the surrounding medium refractive index, which leads to measurable modifications in the grating transmission spectrum. The proposed analysis method results in errors in the oil concentration of 0.4% and 2.6% for pure biodiesel and commercial soybean oil, respectively. Techniques of total glycerol, dynamic viscosity, density, and hydrogen nuclear magnetic resonance spectroscopy were also employed to validate the proposed method. (author)

  2. Design of application specific long period waveguide grating filters using adaptive particle swarm optimization algorithms

    International Nuclear Information System (INIS)

    Semwal, Girish; Rastogi, Vipul

    2014-01-01

    We present design optimization of wavelength filters based on long period waveguide gratings (LPWGs) using the adaptive particle swarm optimization (APSO) technique. We demonstrate optimization of the LPWG parameters for single-band, wide-band and dual-band rejection filters for testing the convergence of APSO algorithms. After convergence tests on the algorithms, the optimization technique has been implemented to design more complicated application specific filters such as erbium doped fiber amplifier (EDFA) amplified spontaneous emission (ASE) flattening, erbium doped waveguide amplifier (EDWA) gain flattening and pre-defined broadband rejection filters. The technique is useful for designing and optimizing the parameters of LPWGs to achieve complicated application specific spectra. (paper)

  3. Optical resonance analysis of reflected long period fiber gratings with metal film overlay

    Science.gov (United States)

    Zhang, Guiju; Cao, Bing; Wang, Chinua; Zhao, Minfu

    2008-11-01

    We present the experimental results of a novel single-ended reflecting surface plasma resonance (SPR) based long period fiber grating (LPFG) sensor. A long period fiber grating sensing device is properly designed and fabricated with a pulsed CO2 laser writing system. Different nm-thick thin metal films are deposited on the fiber cladding and the fiber end facet for the excitation of surface plasma waves (SPWs) and the reflection of the transmission spectrum of the LPFG with doubled interaction between metal-dielectric interfaces of the fiber to enhance the SPW of the all-fiber SPR-LPFG sensing system. Different thin metal films with different thicknesses are investigated. The effect of the excited SPW transmission along the fiber cladding-metal interface with silver and aluminum films is observed. It is found that different thicknesses of the metal overlay show different resonant behaviors in terms of resonance peak situation, bandwidth and energy loss. Within a certain range, thinner metal film shows narrower bandwidth and deeper peak loss.

  4. Long-Period Oscillations of Hydraulic Fractures: Attenuation, Scaling Relationships, and Flow Stability

    Science.gov (United States)

    Lipovsky, B.; Dunham, E. M.

    2013-12-01

    Long-period seismicity due to the excitation of hydraulic fracture normal modes is thought to occur in many geological systems, including volcanoes, glaciers and ice sheets, and hydrocarbon reservoirs. To better quantify the physical dimensions of fluid-filled cracks and properties of the fluid within them, we study wave motion along a thin hydraulic fracture waveguide. We present a linearized analysis that accounts for quasi-dynamic elasticity of the fracture wall, as well as fluid drag, inertia, and compressibility. We consider symmetric perturbations and neglect the effects of stratification and gravity. In the long-wavelength or thin-fracture limit, dispersive guided waves known as crack waves propagate with phase velocity cw=√(G*|k|w/ρ), where G* = G/(1-υ) for shear modulus G and Poisson ratio υ, w is the crack half-width, k is the wavenumber, and ρ is the fluid density. Restoring forces from elastic wall deformation drive wave motions. In the opposite, short-wavelength limit, guided waves are simply sound waves within the fluid and little seismic excitation occurs due to minimal fluid-solid coupling. We focus on long-wavelength crack waves, which, in the form of standing wave modes in finite-length cracks, are thought to be a common mechanism for long-period seismicity. The dispersive nature of crack waves implies several basic scaling relations that might be useful when interpreting statistics of long-period events. Seismic observations may constrain a characteristic frequency f0 and seismic moment M0~GδwR2, where δw is the change in crack width and R is the crack dimension. Resonant modes of a fluid-filled crack have associated frequencies f~cw/R. Linear elasticity provides a link between pressure changes δp in the crack and the induced opening δw: δp~G δw/R. Combining these, and assuming that pressure changes have no variation with crack dimension, leads to the scaling law relating seismic moment and oscillation frequency, M0~(Gwδp/ρ)f0

  5. harnessing_ai_20180319.pptx

    OpenAIRE

    Johnson, Matthew

    2018-01-01

    There have been great strides made in Artificial Intelligence in recent years, but it is often not clear how to apply these recent advances to new problems. In this talk I propose one method of thinking about problems in the sciences and how to find the right AI techniques to aid in research.

  6. Ambient Noise Green's Function Simulation of Long-Period Ground Motions for Reverse Faulting

    Science.gov (United States)

    Miyake, H.; Beroza, G. C.

    2009-12-01

    Long-time correlation of ambient seismic noise has been demonstrated as a useful tool for strong ground motion prediction [Prieto and Beroza, 2008]. An important advantage of ambient noise Green's functions is that they can be used for ground motion simulation without resorting to either complex 3-D velocity structure to develop theoretical Green’s functions, or aftershock records for empirical Green’s function analysis. The station-to-station approach inherent to ambient noise Green’s functions imposes some limits to its application, since they are band-limited, applied at the surface, and for a single force. We explore the applicability of this method to strong motion prediction using the 2007 Chuetsu-oki, Japan, earthquake (Mw 6.6, depth = 9 km), which excited long-period ground motions in and around the Kanto basin almost 200 km from the epicenter. We test the performance of ambient noise Green's function for long-period ground motion simulation. We use three components of F-net broadband data at KZK station, which is located near the source region, as a virtual source, and three components of six F-net stations in and around the Kanto basin to calculate the response. An advantage to applying this approach in Japan is that ambient-noise sources are active in diverse directions. The dominant period of the ambient noise for the F-net datasets is mostly 7 s over the year, and amplitudes are largest in winter. This period matches the dominant periods of the Kanto and Niigata basins. For the 9 components of the ambient noise Green’s functions, we have confirmed long-period components corresponding to Love wave and Rayleigh waves that can be used for simulation of the 2007 Chuetsu-oki earthquake. The relative amplitudes, phases, and durations of the ambient noise Green’s functions at the F-net stations in and around the Kanto basin respect to F-net KZK station are fairly well matched with those of the observed ground motions for the 2007 Chuetsu

  7. Toward regional corrections of long period CMT inversions using InSAR

    Science.gov (United States)

    Shakibay Senobari, N.; Funning, G.; Ferreira, A. M.

    2017-12-01

    One of InSAR's main strengths, with respect to other methods of studying earthquakes, is finding the accurate location of the best point source (or `centroid') for an earthquake. While InSAR data have great advantages for study of shallow earthquakes, the number of earthquakes for which we have InSAR data is low, compared with the number of earthquakes recorded seismically. And though improvements to SAR satellite constellations have enhanced the use of InSAR data during earthquake response, post-event data still have a latency on the order of days. On the other hand, earthquake centroid inversion methods using long period seismic data (e.g. the Global CMT method) are fast but include errors caused by inaccuracies in both the Earth velocity model and in wave propagation assumptions (e.g. Hjörleifsdóttir and Ekström, 2010; Ferreira and Woodhouse, 2006). Here we demonstrate a method that combines the strengths of both methods, calculating regional travel-time corrections for long-period waveforms using accurate centroid locations from InSAR, then applying these to other events that occur in the same region. Our method is based on the observation that synthetic seismograms produced from InSAR source models and locations match the data very well except for some phase shifts (travel time biases) between the two waveforms, likely corresponding to inaccuracies in Earth velocity models (Weston et al., 2014). Our previous work shows that adding such phase shifts to the Green's functions can improve the accuracy of long period seismic CMT inversions by reducing tradeoffs between the moment tensor components and centroid location (e.g. Shakibay Senobari et al., AGU Fall Meeting 2015). Preliminary work on several pairs of neighboring events (e.g. Landers-Hector Mine, the 2000 South Iceland earthquake sequences) shows consistent azimuthal patterns of these phase shifts for nearby events at common stations. These phase shift patterns strongly suggest that it is possible to

  8. Surface Modified Long Period Fiber Grating Sensor for Rapid Detection of Aspergillus Niger Fungal Spores

    Science.gov (United States)

    Gambhir, Monika; Gupta, Shilpi; John, Priya; Mahakud, Ramakanta; Kumar, Jitendra; Prakash, Om

    2018-03-01

    We present development of a compact and label-free sensor based on the surface modification of copper vapor laser fabricated long period fiber gratings for detection of airborne Aspergillus niger (A. niger) fungal spores. Surface of sensors were functionalized with monoclonal glucose oxidases IgG1 for target-specific covalent binding. In process of functionalization and binding of 103 cfu/ml of pathogenic A. niger fungal spores, notable shorter wave transition in resonance wavelength from 1562.93 nm to 1555.97 nm, and significant reduction in peak loss from 61.72 dB to 57.48 dB were recorded. The implementation was cost effective and yielded instantaneous results.

  9. DYANA campaign results on long-period atmospheric waves over Thumba and Balasore

    Science.gov (United States)

    Reddi, C. Raghava; Rajeev, K.; Nair, S. Muraleedharan; Subbaraya, B. H.; Rama, G. V.; Appu, K. S.; Narayanan, V.; Apparao, B. V.; Chakravarty, S. C.; Nagpal, O. P.; Perov, S. P.; Kokin, G. A.

    1994-12-01

    The variation with altitude of the spectral amplitudes of the long period waves in the middle atmospheric zonal and meridional wind over Thumba (8.5°N, 76.9°E) and Balasore (21.5°N, 86.9°E) have shown clearly the enhanced dissipation of the atmospheric waves in the lower stratosphere and near the stratopause. The amplitudes are, in general, large for the lower frequency ( <0.1 cycles/day) waves in the troposphere. While propagating through the tropopause into the stratosphere and above, waves with periods in the range of 5-10 days suffer less attenuation. The dissipation of the atmospheric waves is found to be relatively large for frequencies below 0.1 cycles/day. The results are compared with earlier observational studies and theoretical computations on the propagation of equatorial waves through the middle atmosphere.

  10. Selective vancomycin detection using optical fibre long period gratings functionalised with molecularly imprinted polymer nanoparticles.

    Science.gov (United States)

    Korposh, Sergiy; Chianella, Iva; Guerreiro, Antonio; Caygill, Sarah; Piletsky, Sergey; James, Stephen W; Tatam, Ralph P

    2014-05-07

    An optical fibre long period grating (LPG) sensor modified with molecularly imprinted polymer nanoparticles (nanoMIPs) for the specific detection of antibiotics is presented. The operation of the sensor is based on the measurement of changes in refractive index induced by the interaction of nanoMIPs deposited onto the cladding of the LPG with free vancomycin (VA). The binding of nanoMIPs to vancomycin was characterised by a binding constant of 4.3 ± 0.1 × 10(-8) M. The lowest concentration of analyte measured by the fibre sensor was 10 nM. In addition, the sensor exhibited selectivity, as much smaller responses were obtained for high concentrations (∼700 μM) of other commonly prescribed antibiotics such as amoxicillin, bleomycin and gentamicin. In addition, the response of the sensor was characterised in a complex matrix, porcine plasma, spiked with 10 μM of VA.

  11. Sensing Characteristics of Side-Hole Fiber-Based Long-Period Grating

    Directory of Open Access Journals (Sweden)

    Yi Xin

    2013-01-01

    Full Text Available Long-period gratings (LPGs have been fabricated in a side-hole fiber (SHF by using a pulsed CO2 laser. Sensing characteristics of this SHF-LPG to temperature surrounding refractive index and bend have been investigated. Experimental results show that resonant wavelength of the SHF-LPG has a blue shift with temperature with sensitivity of −0.11 nm/°C, a blue shift with increasing sensitivity with surrounding refractive index ranging from 1.335 to 1.44 (the maximum sensitivity is achieved when the surrounding refractive index reaches the effective index of the fiber cladding, and a red shift with bend-direction-dependent sensitivity up to 9.36 nm/m−1.

  12. Perihelion asymmetry in the photometric parameters of long-period comets at large heliocentric distances

    International Nuclear Information System (INIS)

    Svoren, J.

    1982-01-01

    The present statistical analysis is based on a sample of long-period comets selected according to two criteria: (1) availability of photometric observations made at large distances from the Sun and covering an orbital arc long enough for a reliable determination of the photometric parameters, and (2) availability of a well determined orbit making it possible to classify the comet as new or old in Oort's (1950) sense. The selection was confined to comets with nearly parabolic orbits. 67 objects were found to satisfy the selection criteria. Photometric data referring to heliocentric distances of r > 2.5 AU were only used, yielding a total of 2,842 individual estimates and measurements. (Auth.)

  13. Terahertz bandwidth all-optical Hilbert transformers based on long-period gratings.

    Science.gov (United States)

    Ashrafi, Reza; Azaña, José

    2012-07-01

    A novel, all-optical design for implementing terahertz (THz) bandwidth real-time Hilbert transformers is proposed and numerically demonstrated. An all-optical Hilbert transformer can be implemented using a uniform-period long-period grating (LPG) with a properly designed amplitude-only grating apodization profile, incorporating a single π-phase shift in the middle of the grating length. The designed LPG-based Hilbert transformers can be practically implemented using either fiber-optic or integrated-waveguide technologies. As a generalization, photonic fractional Hilbert transformers are also designed based on the same optical platform. In this general case, the resulting LPGs have multiple π-phase shifts along the grating length. Our numerical simulations confirm that all-optical Hilbert transformers capable of processing arbitrary optical signals with bandwidths well in the THz range can be implemented using feasible fiber/waveguide LPG designs.

  14. Long period gratings in multimode optical fibers: application in chemical sensing

    Science.gov (United States)

    Thomas Lee, S.; Dinesh Kumar, R.; Suresh Kumar, P.; Radhakrishnan, P.; Vallabhan, C. P. G.; Nampoori, V. P. N.

    2003-09-01

    We propose and demonstrate a new technique for evanescent wave chemical sensing by writing long period gratings in a bare multimode plastic clad silica fiber. The sensing length of the present sensor is only 10 mm, but is as sensitive as a conventional unclad evanescent wave sensor having about 100 mm sensing length. The minimum measurable concentration of the sensor reported here is 10 nmol/l and the operating range is more than 4 orders of magnitude. Moreover, the detection is carried out in two independent detection configurations viz., bright field detection scheme that detects the core-mode power and dark field detection scheme that detects the cladding mode power. The use of such a double detection scheme definitely enhances the reliability and accuracy of the results. Furthermore, the cladding of the present fiber need not be removed as done in conventional evanescent wave fiber sensors.

  15. New serial time codes for seismic short period and long period data acquisition systems

    International Nuclear Information System (INIS)

    Kolvankar, V.G.; Rao, D.S.

    1988-01-01

    This paper discusses a new time code for time indexing multichannel short period (1 to 25 hz) seismic event data recorded on a single track of magnetic tape in digital format and discusses its usefulness in contrast to Vela time code used in continuous analog multichannel data recording system on multitrack instrumentation tape deck. This paper also discusses another time code, used for time indexing of seismic long period (DC to 2.5 seconds) multichannel data recorded on a single track of magnetic tape in digital format. The time code decoding and display system developed to provide quick access to any desired portion of the tape in both data recording and repro duce system is also discussed. (author). 7 figs

  16. Volcanic Eruption Forecasts From Accelerating Rates of Drumbeat Long-Period Earthquakes

    Science.gov (United States)

    Bell, Andrew F.; Naylor, Mark; Hernandez, Stephen; Main, Ian G.; Gaunt, H. Elizabeth; Mothes, Patricia; Ruiz, Mario

    2018-02-01

    Accelerating rates of quasiperiodic "drumbeat" long-period earthquakes (LPs) are commonly reported before eruptions at andesite and dacite volcanoes, and promise insights into the nature of fundamental preeruptive processes and improved eruption forecasts. Here we apply a new Bayesian Markov chain Monte Carlo gamma point process methodology to investigate an exceptionally well-developed sequence of drumbeat LPs preceding a recent large vulcanian explosion at Tungurahua volcano, Ecuador. For more than 24 hr, LP rates increased according to the inverse power law trend predicted by material failure theory, and with a retrospectively forecast failure time that agrees with the eruption onset within error. LPs resulted from repeated activation of a single characteristic source driven by accelerating loading, rather than a distributed failure process, showing that similar precursory trends can emerge from quite different underlying physics. Nevertheless, such sequences have clear potential for improving forecasts of eruptions at Tungurahua and analogous volcanoes.

  17. Sensitivity Enhancement in Low Cutoff Wavelength Long-Period Fiber Gratings by Cladding Diameter Reduction

    Directory of Open Access Journals (Sweden)

    Ignacio Del Villar

    2017-09-01

    Full Text Available The diameter of long-period fiber gratings (LPFGs fabricated in optical fibers with a low cutoff wavelength was be reduced by hydrofluoric acid etching, enhancing the sensitivity to refractive index by more than a factor of 3, to 2611 nm/refractive index unit in the range from 1.333 to 1.4278. The grating period selected for the LPFGs allowed access to the dispersion turning point at wavelengths close to the visible range of the optical spectrum, where optical equipment is less expensive. As an example of an application, a pH sensor based on the deposition of a polymeric coating was analyzed in two situations: with an LPFG without diameter reduction and with an LPFG with diameter reduction. Again, a sensitivity increase of a factor of near 3 was obtained, demonstrating the ability of this method to enhance the sensitivity of thin-film-coated LPFG chemical sensors.

  18. Sensitivity Enhancement in Low Cutoff Wavelength Long-Period Fiber Gratings by Cladding Diameter Reduction.

    Science.gov (United States)

    Del Villar, Ignacio; Partridge, Matthew; Rodriguez, Wenceslao Eduardo; Fuentes, Omar; Socorro, Abian Bentor; Diaz, Silvia; Corres, Jesus Maria; James, Stephen Wayne; Tatam, Ralph Peter

    2017-09-13

    The diameter of long-period fiber gratings (LPFGs) fabricated in optical fibers with a low cutoff wavelength was be reduced by hydrofluoric acid etching, enhancing the sensitivity to refractive index by more than a factor of 3, to 2611 nm/refractive index unit in the range from 1.333 to 1.4278. The grating period selected for the LPFGs allowed access to the dispersion turning point at wavelengths close to the visible range of the optical spectrum, where optical equipment is less expensive. As an example of an application, a pH sensor based on the deposition of a polymeric coating was analyzed in two situations: with an LPFG without diameter reduction and with an LPFG with diameter reduction. Again, a sensitivity increase of a factor of near 3 was obtained, demonstrating the ability of this method to enhance the sensitivity of thin-film-coated LPFG chemical sensors.

  19. Curvature vector smart sensing with a long-period fibre grating probed by artificial intelligence

    International Nuclear Information System (INIS)

    Costa, R Z V; Possetti, G R C; De Arruda, L V R; Muller, M; Fabris, J L

    2010-01-01

    This work shows a curvature vector sensing device based on a single long-period grating written in a commercial photosensitive optical fibre. The sensing approach uses an artificial neural network based on multilayer perceptrons for data analysis. Curvatures from 0.00 to 3.13 m −1 and angular orientations from 0 to 180° were measured with the device, with combined standard uncertainties of 0.05 m −1 and 1.5°, respectively. The root mean square errors for curvature and angular orientation were 0.0008 m −1 and 0.3° in the training stage and 0.002 m −1 and 0.9° in the test stage, respectively

  20. Understanding interpenetrating-polymer-network-like porous nitrile butadiene rubber hybrids by their long-period miscibility

    International Nuclear Information System (INIS)

    Zhang, Jihua; Wang, Lifeng; Zhao, Yunfeng

    2013-01-01

    Highlights: • Hydrogen bonds are introduced into NBR to develop its IPN-like porous hybrids. • NBR is partly miscible with AO-60. • AO-60 possesses the viscoelastic behavior resembling that of polymers. • Phase separation aggravates and AO-60 crystallizes in the durations. • The porous hybrids may have potential damping applications. - Abstract: In this article, tetrakis [methylene-3-(3, 5-di-tert-butyl-4-hydroxy phenyl) propionyloxy] methane (AO-60) with hydrogen bonds was designed to interpenetrate into the chemical crosslinking bonds of nitrile butadiene rubber (NBR) and then porous materials were prepared. Scanning electron microscopy (SEM), atomic force microscopy (AFM) images and dynamic mechanical analyses (DMA) demonstrate that NBR is partly miscible with AO-60 which induces the micro-pores and interpenetrating-polymer-network (IPN)-like phase morphology in the hybrids. The wide double tan δ peak in DMA curve displays that AO-60 possesses similar viscoelastic behaviors to polymers which come from supramolecular interactions between polar groups of NBR chains and hydroxyl (OH) groups of AO-60. To further understand the supramolecular abilities of AO-60 in the rubber, the long-period observations for their miscibility are conducted. With the increase of durations, the hydrogen bond network from AO-60 is weakened. The phase separation between AO-60 and NBR is aggravated and even extremely few AO-60 crystallizes which develops multi-scale porous morphology in the hybrids. It is believed that these findings can serve as a guide for the designs of the IPN-like hybrids with small molecule substances and their applications of damping materials

  1. Search for Long Period Solar Normal Modes in Ambient Seismic Noise

    Science.gov (United States)

    Caton, R.; Pavlis, G. L.

    2016-12-01

    We search for evidence of solar free oscillations (normal modes) in long period seismic data through multitaper spectral analysis of array stacks. This analysis is similar to that of Thomson & Vernon (2015), who used data from the most quiet single stations of the global seismic network. Our approach is to use stacks of large arrays of noisier stations to reduce noise. Arrays have the added advantage of permitting the use of nonparametic statistics (jackknife errors) to provide objective error estimates. We used data from the Transportable Array, the broadband borehole array at Pinyon Flat, and the 3D broadband array in Homestake Mine in Lead, SD. The Homestake Mine array has 15 STS-2 sensors deployed in the mine that are extremely quiet at long periods due to stable temperatures and stable piers anchored to hard rock. The length of time series used ranged from 50 days to 85 days. We processed the data by low-pass filtering with a corner frequency of 10 mHz, followed by an autoregressive prewhitening filter and median stack. We elected to use the median instead of the mean in order to get a more robust stack. We then used G. Prieto's mtspec library to compute multitaper spectrum estimates on the data. We produce delete-one jackknife error estimates of the uncertainty at each frequency by computing median stacks of all data with one station removed. The results from the TA data show tentative evidence for several lines between 290 μHz and 400 μHz, including a recurring line near 379 μHz. This 379 μHz line is near the Earth mode 0T2 and the solar mode 5g5, suggesting that 5g5 could be coupling into the Earth mode. Current results suggest more statistically significant lines may be present in Pinyon Flat data, but additional processing of the data is underway to confirm this observation.

  2. PLANET HUNTERS. VIII. CHARACTERIZATION OF 41 LONG-PERIOD EXOPLANET CANDIDATES FROM KEPLER ARCHIVAL DATA

    International Nuclear Information System (INIS)

    Wang, Ji; Fischer, Debra A.; Picard, Alyssa; Schmitt, Joseph R.; Boyajian, Tabetha S.; Barclay, Thomas; Ma, Bo; Bowler, Brendan P.; Riddle, Reed; Jek, Kian J.; LaCourse, Daryll; Simister, Dean Joseph; Grégoire, Boscher; Babin, Sean P.; Poile, Trevor; Jacobs, Thomas Lee; Baranec, Christoph; Law, Nicholas M.; Lintott, Chris; Schawinski, Kevin

    2015-01-01

    The census of exoplanets is incomplete for orbital distances larger than 1 AU. Here, we present 41 long-period planet candidates in 38 systems identified by Planet Hunters based on Kepler archival data (Q0–Q17). Among them, 17 exhibit only one transit, 14 have two visible transits, and 10 have more than three visible transits. For planet candidates with only one visible transit, we estimate their orbital periods based on transit duration and host star properties. The majority of the planet candidates in this work (75%) have orbital periods that correspond to distances of 1–3 AU from their host stars. We conduct follow-up imaging and spectroscopic observations to validate and characterize planet host stars. In total, we obtain adaptive optics images for 33 stars to search for possible blending sources. Six stars have stellar companions within 4″. We obtain high-resolution spectra for 6 stars to determine their physical properties. Stellar properties for other stars are obtained from the NASA Exoplanet Archive and the Kepler Stellar Catalog by Huber et al. We validate 7 planet candidates that have planet confidence over 0.997 (3σ level). These validated planets include 3 single-transit planets (KIC-3558849b, KIC-5951458b, and KIC-8540376c), 3 planets with double transits (KIC-8540376b, KIC-9663113b, and KIC-10525077b), and 1 planet with four transits (KIC-5437945b). This work provides assessment regarding the existence of planets at wide separations and the associated false positive rate for transiting observation (17%–33%). More than half of the long-period planets with at least three transits in this paper exhibit transit timing variations up to 41 hr, which suggest additional components that dynamically interact with the transiting planet candidates. The nature of these components can be determined by follow-up radial velocity and transit observations

  3. Primate enamel evinces long period biological timing and regulation of life history.

    Science.gov (United States)

    Bromage, Timothy G; Hogg, Russell T; Lacruz, Rodrigo S; Hou, Chen

    2012-07-21

    The factor(s) regulating the combination of traits that define the overall life history matrix of mammalian species, comprising attributes such as brain and body weight, age at sexual maturity, lifespan and others, remains a complete mystery. The principal objectives of the present research are (1) to provide evidence for a key variable effecting life history integration and (2) to provide a model for how one would go about investigating the metabolic mechanisms responsible for this rhythm. We suggest here that a biological rhythm with a period greater than the circadian rhythm is responsible for observed variation in primate life history. Evidence for this rhythm derives from studies of tooth enamel formation. Enamel contains an enigmatic periodicity in its microstructure called the striae of Retzius, which develops at species specific intervals in units of whole days. We refer to this enamel rhythm as the repeat interval (RI). For primates, we identify statistically significant relationships between RI and all common life history traits. Importantly, RI also correlates with basal and specific metabolic rates. With the exception of estrous cyclicity, all relationships share a dependence upon body mass. This dependence on body mass informs us that some aspect of metabolism is responsible for periodic energy allocations at RI timescales, regulating cell proliferation rates and growth, thus controlling the pace, patterning, and co-variation of life history traits. Estrous cyclicity relates to the long period rhythm in a body mass-independent manner. The mass-dependency and -independency of life history relationships with RI periodicity align with hypothalamic-mediated neurosecretory anterior and posterior pituitary outputs. We term this period the Havers-Halberg Oscillation (HHO), in reference to Clopton Havers, a 17th Century hard tissue anatomist, and Franz Halberg, a long-time explorer of long-period rhythms. We propose a mathematical model that may help elucidate

  4. Detection of very long period solar free oscillations in ambient seismic array noise

    Science.gov (United States)

    Caton, R.; Pavlis, G. L.; Thomson, D. J.; Vernon, F.

    2017-12-01

    For nearly two decades long-period seismologists have been aware that the Earth's free oscillations are in a constant state of excitement, even in the absence of large earthquakes. This phenomenon is now called the "Earth's hum," and much research has been done to determine what generates this hum. Here we examine a hypothesis first put forward by Thomson et al. in 2007 that a portion of the hum's energy comes from the sun. They hypothesized that solar free oscillations couple into the solid Earth, likely through electromagnetic processes, and produce signals that are observable in the frequency domain. If this is true, then at least some measurement of helioseismic oscillations may be possible using relatively cheap, ground-based instruments rather than spacecraft. In this project we attempt to improve upon previous studies by producing spectra from seismic arrays, rather than a single station. We use data from two arrays: The Homestake Mine 3D array in Lead, SD, and the Pinyon Flats array, which has seismometers in boreholes drilled into bedrock. Both have exceptionally low noise levels at ultra long periods and show easily visible earth tides on horizontal component data filtered to below the microseism band. In the Homestake data, below 500 μHz we have found evidence of what we suggest may be closely spaced solar g-mode lines. Such modes are produced by a density inversion at the top of the solar core. There is no sign of these modes in the Pinyon Flats data, but we find this is likely due to the signal-to-noise ratio of those data, which is significantly lower than Homestake. Significance tests of bands below 500 μHz indicate with probability levels as high as 40σ that these lines are not the result of random processes. Critical examination of our processing steps for sources of bias indicate that the observed line structure is not a processing artifact.

  5. PLANET HUNTERS. VIII. CHARACTERIZATION OF 41 LONG-PERIOD EXOPLANET CANDIDATES FROM KEPLER ARCHIVAL DATA

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Ji; Fischer, Debra A.; Picard, Alyssa; Schmitt, Joseph R.; Boyajian, Tabetha S. [Department of Astronomy, Yale University, New Haven, CT 06511 (United States); Barclay, Thomas [NASA Ames Research Center, M/S 244-30, Moffett Field, CA 94035 (United States); Ma, Bo [Department of Astronomy, University of Florida, 211 Bryant Space Science Center, Gainesville, FL 32611-2055 (United States); Bowler, Brendan P.; Riddle, Reed [California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91101 (United States); Jek, Kian J.; LaCourse, Daryll; Simister, Dean Joseph; Grégoire, Boscher; Babin, Sean P.; Poile, Trevor; Jacobs, Thomas Lee; Baranec, Christoph [Institute for Astronomy, University of Hawai‘i at Mānoa, Hilo, HI 96720-2700 (United States); Law, Nicholas M. [Department of Physics and Astronomy, University of North Carolina at Chapel Hill, Chapel Hill, NC 27599-3255 (United States); Lintott, Chris [Oxford Astrophysics, Denys Wilkinson Building, Keble Road, Oxford OX1 3RH (United Kingdom); Schawinski, Kevin [Institute for Astronomy, Department of Physics, ETH Zurich, Wolfgang-Pauli-Strasse 27, CH-8093 Zurich (Switzerland); and others

    2015-12-20

    The census of exoplanets is incomplete for orbital distances larger than 1 AU. Here, we present 41 long-period planet candidates in 38 systems identified by Planet Hunters based on Kepler archival data (Q0–Q17). Among them, 17 exhibit only one transit, 14 have two visible transits, and 10 have more than three visible transits. For planet candidates with only one visible transit, we estimate their orbital periods based on transit duration and host star properties. The majority of the planet candidates in this work (75%) have orbital periods that correspond to distances of 1–3 AU from their host stars. We conduct follow-up imaging and spectroscopic observations to validate and characterize planet host stars. In total, we obtain adaptive optics images for 33 stars to search for possible blending sources. Six stars have stellar companions within 4″. We obtain high-resolution spectra for 6 stars to determine their physical properties. Stellar properties for other stars are obtained from the NASA Exoplanet Archive and the Kepler Stellar Catalog by Huber et al. We validate 7 planet candidates that have planet confidence over 0.997 (3σ level). These validated planets include 3 single-transit planets (KIC-3558849b, KIC-5951458b, and KIC-8540376c), 3 planets with double transits (KIC-8540376b, KIC-9663113b, and KIC-10525077b), and 1 planet with four transits (KIC-5437945b). This work provides assessment regarding the existence of planets at wide separations and the associated false positive rate for transiting observation (17%–33%). More than half of the long-period planets with at least three transits in this paper exhibit transit timing variations up to 41 hr, which suggest additional components that dynamically interact with the transiting planet candidates. The nature of these components can be determined by follow-up radial velocity and transit observations.

  6. Organisational intelligence and distributed AI

    OpenAIRE

    Kirn, Stefan

    1995-01-01

    The analysis of this chapter starts from organisational theory, and from this it draws conclusions for the design, and possible organisational applications, of Distributed AI systems. We first review how the concept of organisations has emerged from non-organised black-box entities to so-called computerised organisations. Within this context, organisational researchers have started to redesign their models of intelligent organisations with respect to the availability of advanced computing tec...

  7. Optimizing Limousine Service with AI

    OpenAIRE

    Chun, Andy Hon Wai

    2011-01-01

    A common problem for companies with strong business growth is that it is hard to find enough experienced staff to support expansion needs. This problem is particular pronounced for operations planners and controllers who must be very highly knowledgeable and experienced with the business domain. This article is a case study of how one of the largest travel agencies in Hong Kong alleviated this problem by using AI to support decision-making and problem-solving so that their planners and contro...

  8. Degradation behavior of Mg-based biomaterials containing different long-period stacking ordered phases

    Science.gov (United States)

    Peng, Qiuming; Guo, Jianxin; Fu, Hui; Cai, Xuecheng; Wang, Yanan; Liu, Baozhong; Xu, Zhigang

    2014-01-01

    Long-period stacking ordered (LPSO) phases play an essential role in the development of magnesium alloys because they have a direct effect on mechanical and corrosion properties of the alloys. The LPSO structures are mostly divided to 18R and 14H. However, to date there are no consistent opinions about their degradation properties although both of them can improve mechanical properties. Herein we have successfully obtained two LPSO phases separately in the same Mg-Dy-Zn system and comparatively investigated the effect of different LPSO phases on degradation behavior in 0.9 wt.% NaCl solution. Our results demonstrate that a fine metastable 14H-LPSO phase in grain interior is more effective to improve corrosion resistance due to the presence of a homogeneous oxidation film and rapid film remediation ability. The outstanding corrosion resistant Mg-Dy-Zn based alloys with a metastable 14H-LPSO phase, coupled with low toxicity of alloying elements, are highly desirable in the design of novel Mg-based biomaterials, opening up a new avenue in the area of bio-Mg.

  9. IUE observations of long period eclipsing binaries: a study of accretion onto non-degenerate stars

    International Nuclear Information System (INIS)

    Plavec, M.J.

    1980-01-01

    It has long been thought that β Lyrae is a unique system, by virtue of its UV spectrum and its nature. The author argues that a whole class of interacting long-period binaries exists, similar to β Lyrae. According to IUE observations made in 1978-79 this group comprises: RX Cas, SX Cas, V 367 Cyg, W Cru, β Lyr, and W Ser. AR Pav is a transition case linking them with the symbiotics. The author also suggests that HD 218393 (KX And), HD 72754, and HD 51480 are their non-eclipsing counterparts. The whole group is called the W Serpentis stars. These systems are mass-transfering binaries (case B) in which the mass transfer rate is relatively high, probably on the order 10 -6 to 10 -4 solar masses/year. They display an ultraviolet continuum with a color temperature definitely higher than the one observed in the optical region. Even more characteristical is the presence of strong emission lines of N V, C IV, Si IV, Fe III, Al III, and lower ions of C and Si. The author discusses these phenomena on the assumption that they are due to accretion onto non-degenerate stars. (Auth.)

  10. Variable stars in metal-rich globular clusters. IV. Long-period variables in NGC 6496

    Energy Technology Data Exchange (ETDEWEB)

    Abbas, Mohamad A. [Astronomisches Rechen-Institut, Zentrum für Astronomie der Universität Heidelberg, Mönchhofstr. 12-14, D-69120 Heidelberg (Germany); Layden, Andrew C.; Guldenschuh, Katherine A. [Physics and Astronomy Department, Bowling Green State University, Bowling Green, OH 43403 (United States); Reichart, D. E.; Ivarsen, K. M.; Haislip, J. B.; Nysewander, M. C.; LaCluyze, A. P. [Department of Physics and Astronomy, University of North Carolina, Chapel Hill, NC 27599 (United States); Welch, Douglas L., E-mail: mabbas@ari.uni-heidelberg.de, E-mail: laydena@bgsu.edu [Department of Physics and Astronomy, McMaster University, Hamilton, Ontario, L8 S 4M1 (Canada)

    2015-02-01

    We present VI-band photometry for stars in the metal-rich globular cluster NGC 6496. Our time-series data were cadenced to search for long-period variables (LPVs) over a span of nearly two years, and our variability search yielded the discovery of 13 new variable stars, of which 6 are LPVs, 2 are suspected LPVs, and 5 are short-period eclipsing binaries. An additional star was found in the ASAS database, and we clarify its type and period. We argue that all of the eclipsing binaries are field stars, while five to six of the LPVs are members of NGC 6496. We compare the period–luminosity distribution of these LPVs with those of LPVs in the Large Magellanic Cloud and 47 Tucanae, and with theoretical pulsation models. We also present a VI color–magnitude diagram, display the evolutionary states of the variables, and match isochrones to determine a reddening of E(B−V)= 0.21±0.02 mag and apparent distance modulus of 15.60±0.15 mag.

  11. TWO NEW LONG-PERIOD HOT SUBDWARF BINARIES WITH DWARF COMPANIONS

    Energy Technology Data Exchange (ETDEWEB)

    Barlow, Brad N.; Wade, Richard A. [Department of Astronomy and Astrophysics, Pennsylvania State University, 525 Davey Lab, University Park, PA 16802 (United States); Liss, Sandra E. [Department of Astronomy, University of Virginia, P.O. Box 400325, Charlottesville, VA 22904-4325 (United States); Green, Elizabeth M., E-mail: bbarlow@psu.edu [Steward Observatory, University of Arizona, 933 N. Cherry Avenue, Tucson, AZ 85721 (United States)

    2013-07-01

    Hot subdwarf stars with F-K main sequence binary companions have been known for decades, but the first orbital periods for such systems were published just recently. Current observations suggest that most have long periods, on the order of years, and that some are or once were hierarchical triple systems. As part of a survey with the Hobby-Eberly Telescope, we have been monitoring the radial velocities of several composite-spectra binaries since 2005 in order to determine their periods, velocities, and eccentricities. Here we present observations and orbital solutions for two of these systems, PG 1449+653 and PG 1701+359. Similar to the other sdB+F/G/K binaries with solved orbits, their periods are long, 909 and 734 days, respectively, and pose a challenge to current binary population synthesis models of hot subdwarf stars. Intrigued by their relatively large systemic velocities, we also present a kinematical analysis of both targets and find that neither is likely a member of the Galactic thin disk.

  12. Studies on measurement of chloride ion concentration in concrete structures with long-period grating sensors

    Science.gov (United States)

    Tang, Jaw-Luen; Chiang, Tsung-Yu; Chang, Hsiang-Ping; Wang, Jian-Neng

    2006-03-01

    We report the development and demonstration of a simple and low-cost long-period grating (LPG) sensor for chloride ion concentration measurement in concrete structures. The LPG sensor is extremely sensitive to the refractive index of the medium surrounding the cladding surface of the sensing grating, thus allowing it to be used as an ambient index sensor or chemical concentration indicator with high stability and reliability. We have measured chloride ion levels in a concrete sample immersed in salt water solution with different weight concentration ranging from 0 % to 20 %, and results showed that the LPG sensor exhibited a linear decrease in the transmission loss and resonance wavelength shift when the concentration increased. The measurement accuracy for concentration of salt in water solution is estimated to be 0.6 % and the limit of detection for chloride ion is about 0.04 %. To further enhance its sensitivity for chloride concentrations, we have coated gold nanoparticles on the grating surface of the LPG sensor. The sensing mechanism is based on the sensitivity of localized surface plasmon resonance of self-assembled Au colloids on the grating portion of the LPG. With this method, a factor of two increases in sensitivity of detecting chemical solution concentrations was obtained. The advantage of this type of the sensor is relatively simple of construction and ease of use. Moreover, the sensor has the potential capability for on-site, in vivo, and remote sensing, and has the potential use for disposable sensors.

  13. ACTIVITY OF 50 LONG-PERIOD COMETS BEYOND 5.2 au

    International Nuclear Information System (INIS)

    Sárneczky, K.; Szabó, Gy. M.; Csák, B.; Kelemen, J.; Pál, A.; Szakáts, R.; Szegedi-Elek, E.; Vida, K.; Vinkó, J.; Kiss, L. L.; Marschalkó, G.; Szalai, T.; Székely, P.

    2016-01-01

    Remote investigations of ancient matter in the solar system have traditionally been carried out through observations of long-period (LP) comets, which are less affected by solar irradiation than their short-period counterparts orbiting much closer to the Sun. Here we summarize the results of our decade-long survey of the distant activity of LP comets. We found that the most important separation in the data set is based on the dynamical nature of the objects. Dynamically new comets are characterized by a higher level of activity on average: the most active new comets in our sample can be characterized by Afρ values >3–4, higher than those for our most active returning comets. New comets develop more symmetric comae, suggesting a generally isotropic outflow. In contrast to this, the comae of recurrent comets can be less symmetrical, ocassionally exhibiting negative slope parameters, which suggest sudden variations in matter production. The morphological appearance of the observed comets is rather diverse. A surprisingly large fraction of the comets have long, tenuous tails, but the presence of impressive tails does not show a clear correlation with the brightness of the comets.

  14. Short and long periodic atmospheric variations between 25 and 200 km

    Science.gov (United States)

    Justus, C. G.; Woodrum, A.

    1973-01-01

    Previously collected data on atmospheric pressure, density, temperature and winds between 25 and 200 km from sources including Meteorological Rocket Network data, ROBIN falling sphere data, grenade release and pitot tube data, meteor winds, chemical release winds, satellite data, and others were analyzed by a daily difference method and results on the distribution statistics, magnitude, and spatial structure of gravity wave and planetary wave atmospheric variations are presented. Time structure of the gravity wave variations were determined by the analysis of residuals from harmonic analysis of time series data. Planetary wave contributions in the 25-85 km range were discovered and found to have significant height and latitudinal variation. Long period planetary waves, and seasonal variations were also computed by harmonic analysis. Revised height variations of the gravity wave contributions in the 25 to 85 km height range were computed. An engineering method and design values for gravity wave magnitudes and wave lengths are given to be used for such tasks as evaluating the effects on the dynamical heating, stability and control of spacecraft such as the space shuttle vehicle in launch or reentry trajectories.

  15. Origin of the pulse-like signature of shallow long-period volcano seismicity

    Science.gov (United States)

    Chouet, Bernard A.; Dawson, Phillip B.

    2016-01-01

    Short-duration, pulse-like long-period (LP) events are a characteristic type of seismicity accompanying eruptive activity at Mount Etna in Italy in 2004 and 2008 and at Turrialba Volcano in Costa Rica and Ubinas Volcano in Peru in 2009. We use the discrete wave number method to compute the free surface response in the near field of a rectangular tensile crack embedded in a homogeneous elastic half space and to gain insights into the origin of the LP pulses. Two source models are considered, including (1) a vertical fluid-driven crack and (2) a unilateral tensile rupture growing at a fixed sub-Rayleigh velocity with constant opening on a vertical crack. We apply cross correlation to the synthetics and data to demonstrate that a fluid-driven crack provides a natural explanation for these data with realistic source sizes and fluid properties. Our modeling points to shallow sources (signatures are representative of the Rayleigh pulse sampled at epicentral distances >∼1 km. While a slow-rupture failure provides another potential model for these events, the synthetics and resulting fits to the data are not optimal in this model compared to a fluid-driven source. We infer that pulse-like LP signatures are parts of the continuum of responses produced by shallow fluid-driven sources in volcanoes.

  16. The analysis and interpretation of very-long-period seismic signals on volcanoes

    Science.gov (United States)

    Sindija, Dinko; Neuberg, Jurgen; Smith, Patrick

    2017-04-01

    The study of very long period (VLP) seismic signals became possible with the widespread use of broadband instruments. VLP seismic signals are caused by transients of pressure in the volcanic edifice and have periods ranging from several seconds to several minutes. For the VLP events recorded in March 2012 and 2014 at Soufriere Hills Volcano, Montserrat, we model the ground displacement using several source time functions: a step function using Richards growth equation, Küpper wavelet, and a damped sine wave to which an instrument response is then applied. This way we get a synthetic velocity seismogram which is directly comparable to the data. After the full vector field of ground displacement is determined, we model the source mechanism to determine the relationship between the source mechanism and the observed VLP waveforms. Emphasis of the research is on how different VLP waveforms are related to the volcano environment and the instrumentation used and on the processing steps in this low frequency band to get most out of broadband instruments.

  17. ACTIVITY OF 50 LONG-PERIOD COMETS BEYOND 5.2 au

    Energy Technology Data Exchange (ETDEWEB)

    Sárneczky, K.; Szabó, Gy. M.; Csák, B.; Kelemen, J.; Pál, A.; Szakáts, R.; Szegedi-Elek, E.; Vida, K.; Vinkó, J.; Kiss, L. L. [Konkoly Observatory, Research Centre for Astronomy and Earth Sciences, Hungarian Academy of Sciences, H-1121 Budapest, Konkoly Thege Miklós út 15-17 (Hungary); Marschalkó, G. [Eötvös Loránd Tudományegyetem, H-1117 Pázmány Péter sétány 1/A, Budapest (Hungary); Szalai, T. [Department of Optics and Quantum Electronics, University of Szeged, H-6720 Szeged, Dóm tér 9 (Hungary); Székely, P. [Department of Experimental Physics, University of Szeged, Szeged H-6720, Dóm tér 9 (Hungary)

    2016-12-01

    Remote investigations of ancient matter in the solar system have traditionally been carried out through observations of long-period (LP) comets, which are less affected by solar irradiation than their short-period counterparts orbiting much closer to the Sun. Here we summarize the results of our decade-long survey of the distant activity of LP comets. We found that the most important separation in the data set is based on the dynamical nature of the objects. Dynamically new comets are characterized by a higher level of activity on average: the most active new comets in our sample can be characterized by Afρ values >3–4, higher than those for our most active returning comets. New comets develop more symmetric comae, suggesting a generally isotropic outflow. In contrast to this, the comae of recurrent comets can be less symmetrical, ocassionally exhibiting negative slope parameters, which suggest sudden variations in matter production. The morphological appearance of the observed comets is rather diverse. A surprisingly large fraction of the comets have long, tenuous tails, but the presence of impressive tails does not show a clear correlation with the brightness of the comets.

  18. TWO NEW LONG-PERIOD HOT SUBDWARF BINARIES WITH DWARF COMPANIONS

    International Nuclear Information System (INIS)

    Barlow, Brad N.; Wade, Richard A.; Liss, Sandra E.; Green, Elizabeth M.

    2013-01-01

    Hot subdwarf stars with F-K main sequence binary companions have been known for decades, but the first orbital periods for such systems were published just recently. Current observations suggest that most have long periods, on the order of years, and that some are or once were hierarchical triple systems. As part of a survey with the Hobby-Eberly Telescope, we have been monitoring the radial velocities of several composite-spectra binaries since 2005 in order to determine their periods, velocities, and eccentricities. Here we present observations and orbital solutions for two of these systems, PG 1449+653 and PG 1701+359. Similar to the other sdB+F/G/K binaries with solved orbits, their periods are long, 909 and 734 days, respectively, and pose a challenge to current binary population synthesis models of hot subdwarf stars. Intrigued by their relatively large systemic velocities, we also present a kinematical analysis of both targets and find that neither is likely a member of the Galactic thin disk.

  19. Volatile Organic Compounds Sensing Using Optical Fibre Long Period Grating with Mesoporous Nano-Scale Coating

    Directory of Open Access Journals (Sweden)

    Jiri Hromadka

    2017-02-01

    Full Text Available A long period grating (LPG modified with a mesoporous film infused with a calixarene as a functional compound was employed for the detection of individual volatile organic compounds (VOCs and their mixtures. The mesoporous film consisted of an inorganic part, SiO2 nanoparticles (NPs, along with an organic moiety of poly(allylamine hydrochloride polycation PAH, which was finally infused with the functional compound, p-sulphanato calix[4]arene (CA[4] or p-sulphanato calix[8]arene (CA[8]. The LPG sensor was designed to operate at the phase matching turning point to provide the highest sensitivity. The sensing mechanism is based on the measurement of the refractive index (RI change induced by a complex of the VOCs with calixarene. The LPG, modified with a coating of 5 cycles of (SiO2 NPs/PAH and infused with CA[4] or CA[8], was exposed to chloroform, benzene, toluene and acetone vapours. The British Standards test of the VOCs emissions from material (BS EN ISO 16000-9:2006 was used to test the LPG sensor performance.

  20. All-optical switching based on optical fibre long period gratings modified bacteriorhodopsin

    Science.gov (United States)

    Korposh, S.; James, S.; Partridge, M.; Sichka, M.; Tatam, R.

    2018-05-01

    All-optical switching using an optical fibre long-period gating (LPG) modified with bacteriorhodopsin (bR) is demonstrated. The switching process is based on the photo-induced RI change of bR, which in turn changes the phase matching conditions of the mode coupling by the LPG, leading to modulation of the propagating light. The effect was studied with an LPG immersed into a bR solution and with LPGs coated with the bR films, deposited onto the LPGs using the layer-by-layer electrostatic self-assembly (LbL) method. The dependence of the all-optical switching efficiency upon the concentration of the bR solution and on the grating period of the LPG was also studied. In addition, an in-fibre Mach-Zehnder interferometer (MZI) composed of a cascaded LPG pair separated by 30 mm and modified with bR was used to enhance the wavelength range of all-optical switching. The switching wavelength is determined by the grating period of the LPG. Switching efficiencies of 16% and 35% were observed when an LPG and an MZI were immersed into bR solutions, respectively. The switching time for devices coated with bR-films was within 1 s, 10 times faster than that observed for devices immersed into bR solution.

  1. Metal coatings on long-period fiber gratings and the implementation of an associated sensing model

    Science.gov (United States)

    Li, Yulong; Jiang, Jianfeng; Wang, Feifan; Fu, Yanshu; Zhang, Hua

    2017-05-01

    A mathematical model for analyzing the temperature sensing properties of a metal-coated long-period fiber grating (LPFG) was presented. The influences of metal coatings on the temperature sensing properties of LPFGs were simulated and experimentally investigated. The effects of various material parameters were estimated using the single variable method of the Matlab 7.0 software. The simulation results showed that temperature sensitivity increased with an increasing elastic modulus, Poisson's ratio, and thermal expansion coefficient of the coating metal. Both the experimental and simulated results showed that the thickness of the metal coating had a significant impact on the associated temperature sensing properties. The calculated temperature sensitivities of the LPFGs with Ni-coating thicknesses of 6.5, 5.2, and 7.2 μm were 57.27, 60.91, and 66.55 pm/°C, respectively; and with Cu-coating thicknesses of 3.8, 4.9, and 5.4 μm, the calculated temperature sensitivities were 58.17, 59.58, and 61.18 pm/°C, respectively. Compared to the experimental results, the relative errors in the simulation were less than 9.75%, indicating the feasibility of the new temperature sensing model.

  2. A differential detection scheme of spectral shifts in long-period fiber gratings

    Science.gov (United States)

    Zhelyazkova, Katerina; Eftimov, Tinko; Smietana, Mateusz; Bock, Wojtek

    2010-10-01

    In this work we present an analysis of the response of a compact, simple and inexpensive optoelectronic sensor system intended to detect spectral shifts of a long-period fiber grating (LPG). The system makes use of a diffraction grating and a couple of receiving optical fibers that pick up signals at two different wavelengths. This differential detection system provides the same useful information from an LPG-based sensor as with a conventional laboratory system using optical spectrum analyzers for monitoring the minimum offset of LPG. The design of the fiber detection pair as a function of the parameters of the dispersion grating, the pick-up fiber and the LPG parameters, is presented in detail. Simulation of the detection system responses is presented using real from spectral shifts in nano-coated LPGs caused by the evaporation of various liquids such as water, ethanol and acetone, which are examples of corrosive, flammable and hazardous substances. Fiber optic sensors with similar detection can find applications in structural health monitoring for moisture detection, monitoring the spillage of toxic and flammable substances in industry etc.

  3. VERY LONG-PERIOD PULSATIONS BEFORE THE ONSET OF SOLAR FLARES

    Energy Technology Data Exchange (ETDEWEB)

    Tan, Baolin; Huang, Jing; Tan, Chengming; Zhang, Yin [Key Laboratory of Solar Activity, National Astronomical Observatories of Chinese Academy of Sciences, Beijing 100012 (China); Yu, Zhiqiang, E-mail: bltan@nao.cas.cn [School of Astronomy and Space Sciences, University of Chinese Academy of Sciences, Beijing 100049 (China)

    2016-12-20

    Solar flares are the most powerful explosions occurring in the solar system, which may lead to disastrous space weather events and impact various aspects of our Earth. It remains a big challenge in modern astrophysics to understand the origin of solar flares and predict their onset. Based on the analysis of soft X-ray emission observed by the Geostationary Operational Environmental Satellite , this work reports a new discovery of very long-periodic pulsations occurring in the preflare phase before the onset of solar flares (preflare-VLPs). These pulsations typically have periods of 8–30 min and last for about 1–2 hr. They are possibly generated from LRC oscillations of plasma loops where electric current dominates the physical process during magnetic energy accumulation in the source region. Preflare-VLPs provide essential information for understanding the triggering mechanism and origin of solar flares, and may be a convenient precursory indicator to help us respond to solar explosions and the corresponding disastrous space weather events.

  4. 2006 SQ372: A LIKELY LONG-PERIOD COMET FROM THE INNER OORT CLOUD

    International Nuclear Information System (INIS)

    Kaib, Nathan A.; Becker, Andrew C.; Jones, R. Lynne; Quinn, Thomas; Puckett, Andrew W.; Bizyaev, Dmitry; Oravetz, Daniel J.; Pan, Kaike; Watters, Shannon; Dilday, Benjamin; Frieman, Joshua A.; Schneider, Donald P.

    2009-01-01

    We report the discovery of a minor planet (2006 SQ 372 ) on an orbit with a perihelion of 24 AU and a semimajor axis of 796 AU. Dynamical simulations show that this is a transient orbit and is unstable on a timescale of ∼200 Myr. Falling near the upper semimajor axis range of the scattered disk and the lower semimajor axis range of the Oort Cloud, previous membership in either class is possible. By modeling the production of similar orbits from the Oort Cloud as well as from the scattered disk, we find that the Oort Cloud produces 16 times as many objects on SQ 372 -like orbits as the scattered disk. Given this result, we believe this to be the most distant long-period comet (LPC) ever discovered. Furthermore, our simulation results also indicate that 2000 OO 67 has had a similar dynamical history. Unaffected by the 'Jupiter-Saturn Barrier', these two objects are most likely LPCs from the inner Oort Cloud.

  5. High precision locations of long-period events at La Fossa Crater (Vulcano Island, Italy

    Directory of Open Access Journals (Sweden)

    Salvatore Rapisarda

    2009-06-01

    Full Text Available Since the last eruption in 1888-90, the volcanic activity on Vulcano Island (Aeolian Archipelago, Italy has been limited to fumarolic degassing. Fumaroles are mainly concentred at the active cone of La Fossa in the northern sector of the island and are periodically characterized by increases in temperature as well as in the amount of both CO2 and He. Seismic background activity at Vulcano is dominated by micro-seismicity originating at shallow depth (<1-1.5 km under La Fossa cone. This seismicity is related to geothermal system processes and comprises long period (LP events. LPs are generally considered as the resonance of a fluid-filled volume in response to a trigger. We analyzed LP events recorded during an anomalous degassing period (August-October 2006 applying a high precision technique to define the shape of the trigger source. Absolute and high precision locations suggest that LP events recorded at Vulcano during 2006 were produced by a shallow focal zone ca. 200 m long, 40 m wide and N30-40E oriented. Their occurrence is linked to magmatic fluid inputs that by modifying the hydrothermal system cause excitation of a fluid-filled cavity.

  6. 2-D Modelling of Long Period Variations of Galactic Cosmic Ray Intensity

    International Nuclear Information System (INIS)

    Siluszyk, M; Iskra, K; Alania, M

    2015-01-01

    A new two-dimensional (2-D) time dependent model describing long-period variations of the Galactic Cosmic Ray (GCR) intensity has been developed. New approximations for the changes of the magnitude B of the Interplanetary Magnetic Field (IMF), the tilt angle δ of the Heliospheric Neutral Sheet (HNS) and drift effects of the GCR particles have been included into the model. Moreover, temporal changes of the exponent γ expressing the power law - rigidity dependence of the amplitudes of the 11-year variation of the GCR intensity have been added. We show that changes of the expected GCR particle density precedes changes of the GCR intensity measured by the Moscow Neutron (MN) monitor by about 18 months. So ∼18 months can be taken as an effective delay time between the expected intensity caused by the combined influence of the changes of the parameters implemented in the time-dependent 2-D model and the GCR intensity measured by neutron monitors during the 21 cycle of solar activity. (paper)

  7. Two New Long-period Hot Subdwarf Binaries with Dwarf Companions

    Science.gov (United States)

    Barlow, Brad N.; Liss, Sandra E.; Wade, Richard A.; Green, Elizabeth M.

    2013-07-01

    Hot subdwarf stars with F-K main sequence binary companions have been known for decades, but the first orbital periods for such systems were published just recently. Current observations suggest that most have long periods, on the order of years, and that some are or once were hierarchical triple systems. As part of a survey with the Hobby-Eberly Telescope, we have been monitoring the radial velocities of several composite-spectra binaries since 2005 in order to determine their periods, velocities, and eccentricities. Here we present observations and orbital solutions for two of these systems, PG 1449+653 and PG 1701+359. Similar to the other sdB+F/G/K binaries with solved orbits, their periods are long, 909 and 734 days, respectively, and pose a challenge to current binary population synthesis models of hot subdwarf stars. Intrigued by their relatively large systemic velocities, we also present a kinematical analysis of both targets and find that neither is likely a member of the Galactic thin disk. Based on observations obtained with the Hobby-Eberly Telescope, which is a joint project of the University of Texas at Austin, the Pennsylvania State University, Stanford University, Ludwig-Maximilians-Universität München, and Georg-August-Universität Göttingen.

  8. Using the Kepler Full Frame Images to Find Long-Period Variables in the Milky Way

    Science.gov (United States)

    Mullen, Melissa A.; Kraemer, Kathleen; Kuchar, T. A.; Sloan, G. C.

    2018-01-01

    We are using the monthly Full Frame Images (FFIs) images from the 4+ year Kepler mission to conduct a uniform census of long-period variables (LPVs, primarily Miras and semiregular variables) in the Milky Way disk. Our goal is to help understand how stellar pulsation and dust production interact as these dying stars eject their envelopes and enrich the interstellar medium with new fusion products and dust. To that end, we are processing the monthly FFIs for the entire 116 square-degree Kepler field to identify the LPVs and determine their period, pulsation mode, and amplitude measured with the same instrument for the 4+ year mission. Since the FFIs are not fully calibrated, we must first remove the instrumental systematics from the data and determine the flux calibration factors that can then be applied to all the stars in the field. To find these corrections, we use aperture photometry and PRF-fitting from well-characterized stars known to be stable – those with exoplanet candidates. We remove effects of the quarterly spacecraft rolls as well as longterm trends in the responsivity, which reduces the scatter in each star from 5-10% to <1-3%. We examine the effects of the optical distortions that are present in the outer parts of the array, as well as source crowding throughout the field. The fluxes from the PRF fits are typically ~1% higher than those from the aperture photometry. We present preliminary results on previously known and new, candidate, variable stars in a test field near the center of the FFIs.This work is supported by NASA ADAP grant NNX16AF45G.

  9. Long-period noise source inversion in a 3-D heterogeneous Earth

    Science.gov (United States)

    Sager, K.; Ermert, L. A.; Afanasiev, M.; Boehm, C.; Fichtner, A.

    2017-12-01

    We have implemented a new method for ambient noise source inversion that fully honors finite-frequency wave propagation and 3-D heterogeneous Earth structure.Here, we present results of its first application to the Earth's long-period background signal, the hum, in a period band of around 120 - 300 s. In addition to being a computationally convenient test case, the hum is also the topic of ongoing research in its own right, because different physical mechanisms have been proposed for its excitation. The broad patterns of this model for South and North hemisphere winter are qualitatively consistent with previous long-term studies of the hum sources; however, thanks to methodological improvements, the iterative refinement, and the use of a comparatively extensive dataset, we retrieve a more detailed model in certain locations. In particular, our results support findings that the dominant hum sources are focused along coasts and shelf areas, particularly in the North hemisphere winter, with a possible though not well-constrained contribution of pelagic sources. Additionally, our findings indicate that hum source locations in the ocean, tentatively linked to locally high bathymetry, are important contributors particularly during South hemisphere winter. These results, in conjunction with synthetic recovery tests and observed cross-correlation waveforms, suggest that hum sources are rather narrowly concentrated in space, with length scales on the order of few hundred kilometers. Future work includes the extension of the model to spring and fall season and to shorter periods, as well as its use in full-waveform ambient noise inversion for 3-D Earth structure.

  10. Theoretical growth rates, periods, and pulsation constants for long-period variables

    International Nuclear Information System (INIS)

    Fox, M.W.; Wood, P.R.

    1982-01-01

    Theoretical values of the growth rate, period, and pulsation constant for the first three radial pulsation modes in red giants (Population II and galactic disk) and supergiants have been derived in the linear, nonadiabatic approximation. The effects of altering the surface boundary conditions, the effective temperature (or mixing length), and the opacity in the outer layers have been explored. In the standard models, the Q-value for the first overtone can be much larger (Q 1 1 roughly-equal0.04); in addition, the Q-value for the fundamental mode is reduced from previous values, as is the period ratio P 0 /P 1 . The growth rate for the fundamental mode is found to increase with luminosity on the giant branch while the growth rate for the first overtone decreases. Dynamical instabilities found in previous adiabatic models of extreme red giants do not occur when nonadiabatic effects are included in the models. In some massive, luminous models, period ratios P 0 /P 1 approx.7 occur when P 0 approx.2000--5000 days; it is suggested that the massive galactic supergiants and carbon stars which have secondary periods Papprox.2000--7000 days and primary periods Papprox.300--700 days are first-overtone pulsators in which the long secondary periods are due to excitation of the fundamental mode. Some other consequences of the present results are briefly discussed, with particular emphasis on the mode of pulsation of the Mira variables. Subject headings: stars: long-period variables: stars: pulsation: stars: supergiants

  11. An Optical Fiber Viscometer Based on Long-Period Fiber Grating Technology and Capillary Tube Mechanism

    Directory of Open Access Journals (Sweden)

    Jian-Neng Wang

    2010-12-01

    Full Text Available This work addresses the development and assessment of a fiber optical viscometer using a simple and low-cost long-period fiber grating (LPFG level sensor and a capillary tube mechanism. Previous studies of optical viscosity sensors were conducted by using different optical sensing methods. The proposed optical viscometer consists of an LPFG sensor, a temperature-controlled chamber, and a cone-shaped reservoir where gravitational force could cause fluid to flow through the capillary tube. We focused on the use of LPFGs as level sensors and the wavelength shifts were not used to quantify the viscosity values of asphalt binders. When the LPFG sensor was immersed in the constant volume (100 mL AC-20 asphalt binder, a wavelength shift was observed and acquired using LabVIEW software and GPIB controller. The time spent between empty and 100 mL was calculated to determine the discharge time. We simultaneously measured the LPFG-induced discharge time and the transmission spectra both in hot air and AC-20 asphalt binder at five different temperatures, 60, 80, 100, 135, and 170 Celsius. An electromechanical rotational viscometer was also used to measure the viscosities, 0.15–213.80 Pa·s, of the same asphalt binder at the above five temperatures. A non-linear regression analysis was performed to convert LPFG-induced discharge time into viscosities. Comparative analysis shows that the LPFG-induced discharge time agreed well with the viscosities obtained from the rotational viscometer.

  12. Long-period Intensity Pulsations in Coronal Loops Explained by Thermal Non-equilibrium Cycles

    Energy Technology Data Exchange (ETDEWEB)

    Froment, C.; Auchère, F.; Bocchialini, K.; Buchlin, E.; Solomon, J. [Institut d’Astrophysique Spatiale, CNRS, Univ. Paris-Sud, Université Paris-Saclay, Bât. 121, F-91405 Orsay cedex (France); Aulanier, G. [LESIA, Observatoire de Paris, PSL Research University, CNRS, Sorbonne Universités, UPMC Univ. Paris 06, Univ. Paris Diderot, Sorbonne Paris Cité, 5 place Jules Janssen, F-92195 Meudon (France); Mikić, Z., E-mail: clara.froment@astro.uio.no [Predictive Science, Inc., San Diego, CA 92121 (United States)

    2017-02-01

    In solar coronal loops, thermal non-equilibrium (TNE) is a phenomenon that can occur when the heating is both highly stratified and quasi-constant. Unambiguous observational identification of TNE would thus permit us to strongly constrain heating scenarios. While TNE is currently the standard interpretation of coronal rain, the long-term periodic evolution predicted by simulations has never been observed. However, the detection of long-period intensity pulsations (periods of several hours) has been recently reported with the Solar and Heliospheric Observatory /EIT, and this phenomenon appears to be very common in loops. Moreover, the three intensity-pulsation events that we recently studied with the Solar Dynamics Observatory /Atmospheric Imaging Assembly (AIA) show strong evidence for TNE in warm loops. In this paper, a realistic loop geometry from linear force-free field (LFFF) extrapolations is used as input to 1D hydrodynamic simulations. Our simulations show that, for the present loop geometry, the heating has to be asymmetrical to produce TNE. We analyze in detail one particular simulation that reproduces the average thermal behavior of one of the pulsating loop bundle observed with AIA. We compare the properties of this simulation with those deduced from the observations. The magnetic topology of the LFFF extrapolations points to the presence of sites of preferred reconnection at one footpoint, supporting the presence of asymmetric heating. In addition, we can reproduce the temporal large-scale intensity properties of the pulsating loops. This simulation further strengthens the interpretation of the observed pulsations as signatures of TNE. This consequently provides important information on the heating localization and timescale for these loops.

  13. Measurement of chloride-ion concentration with long-period grating technology

    Science.gov (United States)

    Tang, Jaw-Luen; Wang, Jian-Neng

    2007-06-01

    A simple and low-cost long-period fiber grating (LPG) sensor suited for chloride-ion concentration measurement is presented. The LPG sensor is found to be sensitive to the refractive index of the medium around the cladding surface of the sensing grating, thus offering the prospect of development of practical sensors such as an ambient index sensor or a chemical concentration indicator with high stability and reliability. We measured chloride ions in a typical concrete sample immersed in salt water solutions with different weight concentrations ranging from 0% to 25%. Results show that the LPG sensor exhibited a linear decrease in the transmission loss and resonance wavelength shift when the concentration increased. The measurement accuracy for the concentration of salt in water solution is estimated to be 0.6% and the limit of detection for chloride ions is about 0.04%. To further enhance its sensitivity for chloride concentrations, we coated a monolayer of colloidal gold nanoparticles as the active material on the grating surface of the LPG sensor. The operating principle of sensing is based on the sensitivity of localized surface plasmon resonance of self-assembled gold colloids on the grating section of the LPG. With this method, a factor of two increase in the sensitivity of detecting chemical solution concentrations was obtained. The advantages of this type of fiber-optic sensor are that it is compact, relatively simple to construct and easy to use. Moreover, the sensor has the potential capability for on-site, in vivo and remote sensing, and it has potential use as a disposable sensor.

  14. Location of long-period events below Kilauea Volcano using seismic amplitudes and accurate relative relocation

    Science.gov (United States)

    Battaglia, J.; Got, J.-L.; Okubo, P.

    2003-01-01

    We present methods for improving the location of long-period (LP) events, deep and shallow, recorded below Kilauea Volcano by the permanent seismic network. LP events might be of particular interest to understanding eruptive processes as their source mechanism is assumed to directly involve fluid transport. However, it is usually difficult or impossible to locate their source using traditional arrival time methods because of emergent wave arrivals. At Kilauea, similar LP waveform signatures suggest the existence of LP multiplets. The waveform similarity suggests spatially close sources, while catalog solutions using arrival time estimates are widely scattered beneath Kilauea's summit caldera. In order to improve estimates of absolute LP location, we use the distribution of seismic amplitudes corrected for station site effects. The decay of the amplitude as a function of hypocentral distance is used for inferring LP location. In a second stage, we use the similarity of the events to calculate their relative positions. The analysis of the entire LP seismicity recorded between January 1997 and December 1999 suggests that a very large part of the LP event population, both deep and shallow, is generated by a small number of compact sources. Deep events are systematically composed of a weak high-frequency onset followed by a low-frequency wave train. Aligning the low-frequency wave trains does not lead to aligning the onsets indicating the two parts of the signal are dissociated. This observation favors an interpretation in terms of triggering and resonance of a magmatic conduit. Instead of defining fault planes, the precise relocation of similar LP events, based on the alignment of the high-energy low-frequency wave trains, defines limited size volumes. Copyright 2003 by the American Geophysical Union.

  15. Validation and Initial Characterization of the Long-period Planet Kepler-1654 b

    Science.gov (United States)

    Beichman, C. A.; Giles, H. A. C.; Akeson, R.; Ciardi, D.; Christiansen, J.; Isaacson, H.; Marcy, G. M.; Sinukoff, E.; Greene, T.; Fortney, J. J.; Crossfield, I.; Hu, R.; Howard, A. W.; Petigura, E. A.; Knutson, H. A.

    2018-04-01

    Fewer than 20 transiting Kepler planets have periods longer than one year. Our early search of the Kepler light curves revealed one such system, Kepler-1654b (originally KIC 8410697b), which shows exactly two transit events and whose second transit occurred only five days before the failure of the second of two reaction wheels brought the primary Kepler mission to an end. A number of authors have also examined light curves from the Kepler mission searching for long-period planets and identified this candidate. Starting in 2014 September, we began an observational program of imaging, reconnaissance spectroscopy, and precision radial velocity (RV) measurements that confirm with a high degree of confidence that Kepler-1654b is a bona fide transiting planet orbiting a mature G5V star (T eff = 5580 K, [Fe/H] = ‑0.08) with a semimajor axis of 2.03 au, a period of 1047.84 days, and a radius of 0.82 ± 0.02 R Jup. RV measurements using Keck’s HIRES spectrometer obtained over 2.5 years set a limit to the planet’s mass of <0.5 (3σ) M Jup. The bulk density of the planet is similar to that of Saturn or possibly lower. We assess the suitability of temperate gas giants like Kepler-1654b for transit spectroscopy with the James Webb Space Telescope, as their relatively cold equilibrium temperatures (T pl ∼ 200 K) make them interesting from the standpoint of exoplanet atmospheric physics. Unfortunately, these low temperatures also make the atmospheric scale heights small and thus transmission spectroscopy challenging. Finally, the long time between transits can make scheduling JWST observations difficult—as is the case with Kepler-1654b.

  16. Monitoring of high refractive index edible oils using coated long period fiber grating sensors

    Science.gov (United States)

    Coelho, Luís.; Viegas, Diana; Santos, José Luís.; de Almeida, Jose Manuel M. M.

    2015-05-01

    Monitoring the quality of high refractive index edible oils is of great importance for the human health. Uncooked edible oils in general are healthy foodstuff, olive oil in particular, however, they are frequently used for baking and cooking. High quality edible oils are made from seeds, nuts or fruits by mechanical processes. Nevertheless, once the mechanical extraction is complete, up to 15% of the oil remains in oil pomace and in the mill wastewater, which can be extracted using organic solvents, often hexane. Optical fiber sensors based on long period fiber gratings (LPFG) have very low wavelength sensitivity when the surround refractive index is higher than the refractive index of the cladding. Titanium dioxide (TiO2) coated LPFG could lead to the realization of high sensitivity chemical sensor for the food industry. In this work LPFG coated with a TiO2 thin film were successfully used for to detect small levels of hexane diluted in edible oils and for real time monitoring the thermal deterioration of edible oils. For a TiO2 coating of 30 nm a wavelength sensitivity of 1361.7 nm/RIU (or 0.97 nm / % V/V) in the 1.4610-1.4670 refractive index range was achieved, corresponding to 0 to 12 % V/V of hexane in olive oil. A sensitivity higher than 638 nm/RIU at 225 ºC was calculated, in the 1.4670-1.4735 refractive index range with a detection limit of thermal deterioration of about 1 minute.

  17. Importance of moisture determination in studies of infiltration and surface runoff for long periods

    Directory of Open Access Journals (Sweden)

    Fabian Fulginiti

    2011-08-01

    Full Text Available The determination of the natural soil moisture is essential to solve problems related to irrigation water requirements, environmental considerations, and determination of surplus water. For the determination of runoff one can adopt models that consider exclusively the infiltration as a loss or one could use computational models of infiltration to model the infiltrated water. Models based on the infiltration calculation consider well the interaction between infiltration - runoff processes and provide additional information on the phenomenon of infiltration which establishes the existing conditions of moisture in the soil before the occurrence of a new event (simulation for long periods. These models require solving Richards’s equation and for this purpose it is necessary to determine the relation between the soil moisture - suction and hydraulic conductivity - suction which require the determination of the hydraulic properties that can be obtained by measuring the water content by moisture profiles. The aim of this study was the verification of these moisture curves in loessic soils in the south of the city of Cordoba, Argentina. To do this, measurements were done and compared with results of infiltration models based on the determined hydraulic functions. The measurements were done using three probes installed at different depths. The results showed that the values obtained with NETRAIN adequately represent the behavior of wetting and drying conditions of the studied soil.The determination of these curves provided a basis for future studies that include the advancement of agricultural chemicals in the soil and its potential capacity to pollute groundwater, fundamental issue to define environmental management policies.

  18. High-speed landslide mechanism extracted from long-period surface waves

    Science.gov (United States)

    Zhao, Juan

    2016-04-01

    Long-period seismic signals gathered at stations far from landslide area can be used to recover the landslide source force applied on ground during the rapid sliding process. This force history is helpful to improve our ability to deduce the characteristics of the event as well as the dynamic properties of bulk motion. We use source mechanism inversion to analyse two different large landslides. Seismic waves generated by these two events have been recorded respectively by more than 5 stations, with the distance range from 69km to 1325km. The first event is the sudden failure happened at Qianjiangping village (30.97°N, 110.61°E) on 13 July 2003, on the bank of the Qinggan river. The landslide flow brought about 20 million cubic meters rock and soil masses right into the river in a short time. It moved about 250 meters in the main sliding direction of S45°E before stopped by the opposite bank. It is a typical reservoir landslide, which has been compared to the 1963 Vaiont landslide in Italy. The other event is the Xiaolin (120.64°E; 23.16°N) deep-seated landslide, located in southwestern Taiwan and had volume of about 27 million cubic meters. The landslide moved in the westward direction, divided into two streams at about the middle of the run-out, because there had been a small ridge and two valleys extended from the west side of the ridge. The deposit spreading length of this landslide is about 2300 meters. We discuss the different characteristics of the two events in both geological structure and movement mode based on the field survey. Then we show that those differences are also revealed by the source force-time functions from inversion.

  19. The Properties of Long Period Variables in the LMC from MACHO

    Energy Technology Data Exchange (ETDEWEB)

    Fraser, O J; Hawley, S L; Cook, K H

    2008-05-06

    We present a new analysis of the long period variables in the Large Magellanic Cloud from the MACHO Variable Star Catalog. Three-quarters of our sample of evolved, variable stars have periodic light curves. We characterize the stars in our sample using the multiple periods found in their frequency spectra. Additionally, we use single-epoch 2MASS measurements to construct the average infrared light curves for different groups of these stars. Comparison with evolutionary models shows that stars on the RGB or the Early AGB often show non-periodic variability, but begin to pulsate with periods on the two shortest period-luminosity sequences (1 & 2) when they brighten to K{sub s} {approx} 13. The stars on the Thermally Pulsing AGB are more likely to pulsate with longer periods that lie on the next two P-L sequences (3 & 4), including the sequence associated with the Miras in the LMC. The Petersen diagram and its variants show that multi-periodic stars on each pair of these sequences (3 & 4, and 1 & 2), typically pulsate with periods associated only with that pair. The periods in these multi-periodic stars become longer and stronger as the star evolves. We further constrain the mechanism behind the long secondary periods (LSPs) seen in half of our sample, and find that there is a close match between the luminosity functions of the LSP stars and all of the stars in our sample, and that these star's pulsation amplitudes are relatively wavelength independent. Although this is characteristic of stellar multiplicity, the large number of these variables is problematic for that explanation.

  20. Are spontaneous conformational interconversions a molecular basis for long-period oscillations in enzyme activity?

    Science.gov (United States)

    Queiroz-Claret, C; Valon, C; Queiroz, O

    1988-01-01

    An unconventional hypothesis to the molecular basis of enzyme rhythms is that the intrinsic physical instability of the protein molecules which, in an aqueous medium, tend to move continuously from one conformational state to another could lead, in the population of enzyme molecules, to sizeable long-period oscillations in affinity for substrate and sensitivity to ligands and regulatory effects. To investigate this hypothesis, malate dehydrogenase was extracted and purified from leaves of the plant Kalanchoe blossfeldiana. The enzyme solutions were maintained under constant conditions and sampled at regular intervals for up to 40 or 70 h for measurements of activity as a function of substrate concentration, Km for oxaloacetic acid and sensitivity to the action of 2,3-butanedione, a modifier of active site arginyl residues. The results show that continuous slow oscillations in the catalytic capacity of the enzyme occur in all the extracts checked, together with fluctuations in Km. Apparent circadian periodicities were observed in accordance with previous data established during long run (100 h) experiments. The saturation curves for substrate showed multiple kinetic functions, with various pronounced intermediary plateaus and "bumps" depending on the time of sampling. Variation in the response to the effect of butanedione indicated fluctuation in the accessibility to the active site. Taken together, the results suggest that, under constant conditions, the enzyme in solution shifts continuously and reversibly between different configurations. This was confirmed by parallel studies on the proton-NMR spectrum of water aggregates in the enzyme solution and proton exchange rates.(ABSTRACT TRUNCATED AT 250 WORDS)

  1. An SDR based AIS receiver for satellites

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Nielsen, Jens Frederik Dalsgaard

    2011-01-01

    For a few years now, there has been a high interest in monitoring the global ship traffic from space. A few satellite, capable of listening for ship borne AIS transponders have already been launched, and soon the AAUSAT3, carrying two different types of AIS receivers will also be launched. One...... of the AIS receivers onboard AAUSAT3 is an SDR based AIS receiver. This paper serves to describe the background of the AIS system, and how the SDR based receiver has been integrated into the AAUSAT3 satellite. Amongst some of the benefits of using an SDR based receiver is, that due to its versatility, new...... detection algorithms are easily deployed, and it is easily adapted the new proposed AIS transmission channels....

  2. Studying Short-Period Comets and Long-Period Comets Detected by WISE/NEOWISE

    Science.gov (United States)

    Kramer, Emily A.; Fernández, Yanga R.; Bauer, James M.; Stevenson, Rachel; Mainzer, Amy K.; Grav, Tommy; Masiero, Joseph; Walker, Russell G.; Lisse, Carey M.

    2014-11-01

    The Wide-field Infrared Survey Explorer (WISE) mission surveyed the sky in four infrared wavelength bands (3.4, 4.6, 12 and 22-micron) between January 2010 and February 2011 [1, 2]. During the mission, WISE serendipitously observed 160 comets, including 21 newly discovered objects. About 89 of the comets observed by WISE displayed a significant dust tail in the 12 and 22-micron (thermal emission) bands, showing a wide range of activity levels and dust morphology. Since the observed objects are a mix of both long-period comets (LPCs) and short-period comets (SPCs), differences in their activity can be used to better understand the thermal evolution that each of these populations has undergone. For the comets that displayed a significant dust tail, we have estimated the sizes and ages of the particles using dynamical models based on the Finson-Probstein method [3, 4]. For a selection of 40 comets, we have then compared these models to the data using a novel tail-fitting method that allows the best-fit model to be chosen analytically rather than subjectively. For comets that were observed multiple times by WISE, the dust tail particle properties were estimated separately, and then compared. We find that the dust tails of both LPCs and SPCs are primarily comprised of ~mm to cm sized particles, which were the result of emission that occurred several months to several years prior to the observations. The LPCs nearly all have strong dust emission close to the comet's perihelion distance, and the SPCs mostly have strong dust emission close to perihelion, but some have strong dust emission well before perihelion. Acknowledgments: This publication makes use of data products from (1) WISE, which is a joint project of UCLA and JPL/Caltech, funded by NASA; and (2) NEOWISE, which is a project of JPL/Caltech, funded by the Planetary Science Division of NASA. EK was supported by a NASA Earth and Space Sciences Fellowship. RS gratefully acknowledges support from the NASA

  3. Very long period conduit oscillations induced by rockfalls at Kilauea Volcano, Hawaii

    Science.gov (United States)

    Chouet, Bernard A.; Dawson, Phillip B.

    2013-01-01

    Eruptive activity at the summit of Kilauea Volcano, Hawaii, beginning in 2010 and continuing to the present time is characterized by transient outgassing bursts accompanied by very long period (VLP) seismic signals triggered by rockfalls from the vent walls impacting a lava lake in a pit within the Halemaumau pit crater. We use raw data recorded with an 11-station broadband network to model the source mechanism of signals accompanying two large rockfalls on 29 August 2012 and two smaller average rockfalls obtained by stacking over all events with similar waveforms to improve the signal-to-noise ratio. To determine the source centroid location and source mechanism, we minimize the residual error between data and synthetics calculated by the finite difference method for a point source embedded in a homogeneous medium that takes topography into account. We apply a new waveform inversion method that accounts for the contributions from both translation and tilt in horizontal seismograms through the use of Green's functions representing the seismometer response to translation and tilt ground motions. This method enables a robust description of the source mechanism over the period range 1–1000 s. The VLP signals associated with the rockfalls originate in a source region ∼1 km below the eastern perimeter of the Halemaumau pit crater. The observed waveforms are well explained by a simple volumetric source with geometry composed of two intersecting cracks including an east striking crack (dike) dipping 80° to the north, intersecting a north striking crack (another dike) dipping 65° to the east. Each rockfall is marked by a similar step-like inflation trailed by decaying oscillations of the volumetric source, attributed to the efficient coupling at the source centroid location of the pressure and momentum changes induced by the rock mass impacting the top of the lava column. Assuming a simple lumped parameter representation of the shallow magmatic system, the

  4. Feasibility of Fiber Bragg Grating and Long-Period Fiber Grating Sensors under Different Environmental Conditions

    Directory of Open Access Journals (Sweden)

    Jian-Neng Wang

    2010-11-01

    Full Text Available This paper presents the feasibility of utilizing fiber Bragg grating (FBG and long-period fiber grating (LPFG sensors for nondestructive evaluation (NDE of infrastructures using Portland cement concretes and asphalt mixtures for temperature, strain, and liquid-level monitoring. The use of hybrid FBG and LPFG sensors is aimed at utilizing the advantages of two kinds of fiber grating to implement NDE for monitoring strains or displacements, temperatures, and water-levels of infrastructures such as bridges, pavements, or reservoirs for under different environmental conditions. Temperature fluctuation and stability tests were examined using FBG and LPFG sensors bonded on the surface of asphalt and concrete specimens. Random walk coefficient (RWC and bias stability (BS were used for the first time to indicate the stability performance of fiber grating sensors. The random walk coefficients of temperature variations between FBG (or LPFG sensor and a thermocouple were found in the range of −0.7499 °C/ to −1.3548 °C/. In addition, the bias stability for temperature variations, during the fluctuation and stability tests with FBG (or LPFG sensors were within the range of 0.01 °C/h with a 15–18 h time cluster to 0.09 °C/h with a 3–4 h time cluster. This shows that the performance of FBG or LPFG sensors is comparable with that of conventional high-resolution thermocouple sensors under rugged conditions. The strain measurement for infrastructure materials was conducted using a packaged FBG sensor bonded on the surface of an asphalt specimen under indirect tensile loading conditions. A finite element modeling (FEM was applied to compare experimental results of indirect tensile FBG strain measurements. For a comparative analysis between experiment and simulation, the FEM numerical results agreed with those from FBG strain measurements. The results of the liquid-level sensing tests show the LPFG-based sensor could discriminate five stationary liquid

  5. Temporal Variation in Oscillatory Characteristics of Long-period Tremor at Aso Volcano, Japan.

    Science.gov (United States)

    Yamamoto, M.; Ohkura, T.; Kaneshima, S.; Kawakatsu, H.

    2017-12-01

    At Aso volcano, Japan, various kinds of volcanic signals with broad frequency contents have been observed since 1930s. One of these signals is long-period tremor (LPT) with a dominant period of around 15 s, which is intermittently emitted from the volcano regardless of the surface activity. Our broadband seismic observations have revealed that LPTs are a kind of resonance oscillation of a crack-like conduit beneath the crater. In this study, aiming to detect a temporal variation of volcanic system, we analyze the long-term variation of LPTs from 1994 to the present.We first examine the temporal variation of dominant periods of LPTs (fundamental mode of around 15 s and the first overtone of around 7 s) using the continuous data recorded at broadband stations close to the active crater. The result shows a clear temporal change in the dominant periods of LPTs in 2003-2005 and 2014-2015. In 2003-2005, the periods of the two modes show correlated temporal change, and it can be interpreted as compositional and/or thermal change of hydrothermal fluids. On the other hand, in 2014-2015, the period of first overtone is almost constant at around 8 s, while that of the fundamental mode shows relatively large temporal fluctuations between 16 s and 12 s. To explain the different behavior among the two resonant modes, we examine the oscillatory characteristics of a fluid-filled crack having linearly varying thickness. With this model, we find that the ratio between resonance periods becomes smaller than that in the case of a flat crack having constant thickness. This behavior can be understood by considering the effective thickness of the crack depends on the wavelength of each resonant mode. Based on these results, the different temporal variation of dominant periods can be interpreted by depth-dependent thickness of the crack-like conduit which may be caused by pressurization and/or intrusion of magma at deeper portion of the conduit. These results suggest the importance of

  6. Properties of Repetitive Long-Period Seismicity at Villarrica Volcano, Chile

    Science.gov (United States)

    Richardson, J.; Waite, G. P.; Palma, J.; Johnson, J. B.

    2011-12-01

    Villarrica Volcano, Chile hosts a persistent lava lake and is characterized by degassing and long-period seismicity. In order to better understand the relationship between outgassing and seismicity, we recorded broadband seismic and acoustic data along with high-rate SO2 emission data. We used both a densely-spaced linear array deployed on the northern flank of Villarrica, during the austral summer of 2011, and a wider aperture array of stations distributed around the volcano that was active in the austral summer of 2010. Both deployments consisted of three-component broadband stations and were augmented with broadband infrasound sensors. Of particular interests are repetitive, ~1 Hz seismic and coincident infrasound signals that occurred approximately every 2 minutes. Because these events are typically very low amplitude, we used a matched filter approach to identify them. We windowed several high-amplitude records of these events from broadband seismic stations near the vent. The record section of each event served as a template to compare with the entire dataset by cross-correlation. This approach identified ~20,000 nearly identical events during the ~7 day deployment of the linear array, which were otherwise difficult to identify in the raw records. Assuming that all of the events that we identified have identical source mechanisms and depths, we stack the large suite of events to produce low-noise records and particle motions at receivers farther than 5 km from the vent. We find that the records from stations near the edifice are dominated by tangential particle motion, suggesting the influence of near-field components. Correlation of these data with broadband acoustic data collected at the summit suggest that these repeatable seismic processes are linked to acoustic emissions, probably due to gas bubbles bursting at the magma free surface, as no eruptive products besides gas were being emitted by the volcano during the instrument deployment. The acoustic

  7. The source of infrasound associated with long-period events at mount St. Helens

    Science.gov (United States)

    Matoza, R.S.; Garces, M.A.; Chouet, B.A.; D'Auria, L.; Hedlin, M.A.H.; De Groot-Hedlin, C.; Waite, G.P.

    2009-01-01

    During the early stages of the 2004-2008 Mount St. Helens eruption, the source process that produced a sustained sequence of repetitive long-period (LP) seismic events also produced impulsive broadband infrasonic signals in the atmosphere. To assess whether the signals could be generated simply by seismic-acoustic coupling from the shallow LP events, we perform finite difference simulation of the seismo-acoustic wavefield using a single numerical scheme for the elastic ground and atmosphere. The effects of topography, velocity structure, wind, and source configuration are considered. The simulations show that a shallow source buried in a homogeneous elastic solid produces a complex wave train in the atmosphere consisting of P/SV and Rayleigh wave energy converted locally along the propagation path, and acoustic energy originating from , the source epicenter. Although the horizontal acoustic velocity of the latter is consistent with our data, the modeled amplitude ratios of pressure to vertical seismic velocity are too low in comparison with observations, and the characteristic differences in seismic and acoustic waveforms and spectra cannot be reproduced from a common point source. The observations therefore require a more complex source process in which the infrasonic signals are a record of only the broadband pressure excitation mechanism of the seismic LP events. The observations and numerical results can be explained by a model involving the repeated rapid pressure loss from a hydrothermal crack by venting into a shallow layer of loosely consolidated, highly permeable material. Heating by magmatic activity causes pressure to rise, periodically reaching the pressure threshold for rupture of the "valve" sealing the crack. Sudden opening of the valve generates the broadband infrasonic signal and simultaneously triggers the collapse of the crack, initiating resonance of the remaining fluid. Subtle waveform and amplitude variability of the infrasonic signals as

  8. Causes and effects of long periods of ice cover on a remote high Alpine lake

    Directory of Open Access Journals (Sweden)

    Michael STURM

    2000-09-01

    Full Text Available The response of the physical and chemical limnology of Hagelseewli (2339 m a.s.l. to local meteorological forcing was investigated from 1996 to 1998 using an automatic weather station, thermistor chains, water samples and sediment traps. On-site meteorological measurements revealed the paramount importance of local topographic shading for the limnology of the lake. A high cliff to the south diminishes incident radiation by 15% to 90%, resulting in a long period of ice cover. Hence, the spring and summer seasons are extremely condensed, allowing only about 2 months per year for mixing, oxygen uptake, nutrient inflow, water exchange and phytoplankton growth. Regular measurements of water temperature, chemistry and diatom composition show that Hagelseewli responds very rapidly to changes in nutrient concentrations and light conditions. This response is restricted mainly to an extremely short productivity pulse, which takes place as soon as the lake is completely free of ice. Ice-free conditions are indicated by the occurrence of planktonic diatoms. In contrast to most low-altitude lakes, maximum productivity occurs in the middle of the water column (6-9 m, where first light, and then soluble reactive phosphorus (SRP, are the limiting factors. During the period of thawing, large amounts of ammonium enter the lake. Nevertheless, allochthonous nutrient input is not important because SRP, the limiting nutrient for algal growth, originates from the sediments. Water chemistry data and data from sediment traps show that, although autochthonous calcite precipitation does occur, the calcite crystals are redissolved completely in the bottom waters during the extended period of ice cover. Thus, the most important factor for changes in the nutrient budget, primary production and preservation of calcite is the bottom water oxygen status, which is governed by the occurrence of an ice-free period. We hypothesise that the duration of the ice-free period is of

  9. USACE AIS Transmit Technical Support Summary Report

    Science.gov (United States)

    2014-09-01

    the TAG block for the correct transmitters, and then send to the USACE AIS network. B. Outbound openings in the USCG firewall for the USCG Message...USACE AIS Transmit Technical Support Summary Report Distribution Statement A: Approved for public release; distribution is unlimited...September 2014 Report No. CD-D-09-15 USACE AIS Transmit Technical Support Summary Report ii UNCLAS//Public | CG-926 RDC | I. Gonin et al. Public

  10. Adaptive Motion Gaming AI for Health Promotion

    OpenAIRE

    Paliyawan, Pujana; Kusano, Takahiro; Nakagawa, Yuto; Harada, Tomohiro; Thawonmas, Ruck

    2017-01-01

    This paper presents a design of a non-player character (AI) for promoting balancedness in use of body segments when engaging in full-body motion gaming. In our experiment, we settle a battle between the proposed AI and a player by using FightingICE, a fighting game platform for AI development. A middleware called UKI is used to allow the player to control the game by using body motion instead of the keyboard and mouse. During gameplay, the proposed AI analyze health states of the player; it d...

  11. Beyond AI: Artificial Dreams Conference

    CERN Document Server

    Zackova, Eva; Kelemen, Jozef; Beyond Artificial Intelligence : The Disappearing Human-Machine Divide

    2015-01-01

    This book is an edited collection of chapters based on the papers presented at the conference “Beyond AI: Artificial Dreams” held in Pilsen in November 2012. The aim of the conference was to question deep-rooted ideas of artificial intelligence and cast critical reflection on methods standing at its foundations.  Artificial Dreams epitomize our controversial quest for non-biological intelligence, and therefore the contributors of this book tried to fully exploit such a controversy in their respective chapters, which resulted in an interdisciplinary dialogue between experts from engineering, natural sciences and humanities.   While pursuing the Artificial Dreams, it has become clear that it is still more and more difficult to draw a clear divide between human and machine. And therefore this book tries to portrait such an image of what lies beyond artificial intelligence: we can see the disappearing human-machine divide, a very important phenomenon of nowadays technological society, the phenomenon which i...

  12. A Microfluidic Long-Period Fiber Grating Sensor Platform for Chloride Ion Concentration Measurement

    Directory of Open Access Journals (Sweden)

    Jian-Neng Wang

    2011-09-01

    Full Text Available Optical fiber sensors based on waveguide technology are promising and attractive in chemical, biotechnological, agronomy, and civil engineering applications. A microfluidic system equipped with a long-period fiber grating (LPFG capable of measuring chloride ion concentrations of several sample materials is presented. The LPFG-based microfluidic platform was shown to be effective in sensing very small quantities of samples and its transmitted light signal could easily be used as a measurand. The investigated sample materials included reverse osmosis (RO water, tap water, dilute aqueous sample of sea sand soaked in RO water, aqueous sample of sea sand soaked in RO water, dilute seawater, and seawater. By employing additionally a chloride ion-selective electrode sensor for the calibration of chloride-ion concentration, a useful correlation (R2 = 0.975 was found between the separately-measured chloride concentration and the light intensity transmitted through the LPFG at a wavelength of 1,550 nm. Experimental results show that the sensitivity of the LPFG sensor by light intensity interrogation was determined to be 5.0 × 10−6 mW/mg/L for chloride ion concentrations below 2,400 mg/L. The results obtained from the analysis of data variations in time-series measurements for all sample materials show that standard deviations of output power were relatively small and found in the range of 7.413 × 10−5–2.769 × 10−3 mW. In addition, a fairly small coefficients of variations were also obtained, which were in the range of 0.03%–1.29% and decreased with the decrease of chloride ion concentrations of sample materials. Moreover, the analysis of stability performance of the LPFG sensor indicated that the random walk coefficient decreased with the increase of the chloride ion concentration, illustrating that measurement stability using the microfluidic platform was capable of measuring transmitted optical power with accuracy in the range of −0

  13. State estimation and optimal long period clinical treatment of HIV seropositive patients

    Directory of Open Access Journals (Sweden)

    Juliana M. Grégio

    2009-03-01

    Full Text Available Optimal control theory provides a very interesting quantitative method that can be used to assist the decision making process in several areas of application, such as engineering, biology, economics and sociology. The main idea is to determine the values of the manipulated variables, such as drug doses, so that some cost function is minimized, subject to physical constraints. In this work, the cost function reflects the number of CD4+T cells, viral particles and the drug doses. It is worth noticing that high drug doses are related to more intense side-effects, apart from the impact on the actual cost of the treatment. In a previous paper by the authors, the LQR - Linear Quadratic Regulator approach was proposed for the computation of long period maintenance doses for the drugs, which turns out to be of state feedback form. However, it is not practical to determine all the components of the state vector, due to the fact that infected and uninfected CD4+T cells are not microscopically distinguishable. In order to overcome this difficulty, this work proposes the use of Extended Kalman Filter to estimate the state, even though, because of the nonlinear nature of the involved state equations, the separation principle may not be valid. Extensive simulations were then carried out to investigate numerically if the control strategy consisting of the feedback of estimated states yielded satisfactory clinical results.A teoria de controle ótimo apresenta um método quantitativo muito interessante que pode ajudar no processo de tomada de decisão em algumas áreas de aplicação, tais como engenharia, biologia, economia e sociologia. A principal idéia é determinar os valores das variáveis controladas, tais como doses de medicamentos, onde alguma função-custo é minimizada, sujeito às restrições físicas. Neste trabalho, a função-custo reflete o número de células CD4+T, partículas virais e doses de medicamentos. É fato que altas dosagens de

  14. Exploration of deep S-wave velocity structure using microtremor array technique to estimate long-period ground motion

    International Nuclear Information System (INIS)

    Sato, Hiroaki; Higashi, Sadanori; Sato, Kiyotaka

    2007-01-01

    In this study, microtremor array measurements were conducted at 9 sites in the Niigata plain to explore deep S-wave velocity structures for estimation of long-period earthquake ground motion. The 1D S-wave velocity profiles in the Niigata plain are characterized by 5 layers with S-wave velocities of 0.4, 0.8, 1.5, 2.1 and 3.0 km/s, respectively. The depth to the basement layer is deeper in the Niigata port area located at the Japan sea side of the Niigata plain. In this area, the basement depth is about 4.8 km around the Seirou town and about 4.1 km around the Niigata city, respectively. These features about the basement depth in the Niigata plain are consistent with the previous surveys. In order to verify the profiles derived from microtremor array exploration, we estimate the group velocities of Love wave for four propagation paths of long-period earthquake ground motion during Niigata-ken tyuetsu earthquake by multiple filter technique, which were compared with the theoretical ones calculated from the derived profiles. As a result, it was confirmed that the group velocities from the derived profiles were in good agreement with the ones from long-period earthquake ground motion records during Niigata-ken tyuetsu earthquake. Furthermore, we applied the estimation method of design basis earthquake input for seismically isolated nuclear power facilities by using normal mode solution to estimate long-period earthquake ground motion during Niigata-ken tyuetsu earthquake. As a result, it was demonstrated that the applicability of the above method for the estimation of long-period earthquake ground motion were improved by using the derived 1D S-wave velocity profile. (author)

  15. JGOMAS: New Approach to AI Teaching

    Science.gov (United States)

    Barella, A.; Valero, S.; Carrascosa, C.

    2009-01-01

    This paper presents a new environment for teaching practical work in AI subjects. The main purpose of this environment is to make AI techniques more appealing to students and to facilitate the use of the toolkits which are currently widely used in research and development. This new environment has a toolkit for developing and executing agents,…

  16. Adaptive game AI with dynamic scripting

    NARCIS (Netherlands)

    Spronck, P.; Ponsen, M.J.V.; Sprinkhuizen-Kuyper, I.G.; Postma, E.O.

    2006-01-01

    Online learning in commercial computer games allows computer-controlled opponents to adapt to the way the game is being played. As such it provides a mechanism to deal with weaknesses in the game AI, and to respond to changes in human player tactics.We argue that online learning of game AI should

  17. The Relevance of AI Research to CAI.

    Science.gov (United States)

    Kearsley, Greg P.

    This article provides a tutorial introduction to Artificial Intelligence (AI) research for those involved in Computer Assisted Instruction (CAI). The general theme is that much of the current work in AI, particularly in the areas of natural language understanding systems, rule induction, programming languages, and socratic systems, has important…

  18. Nonlinear study of AI Velorum

    International Nuclear Information System (INIS)

    Cox, A.N.; Hodson, S.W.

    1979-01-01

    Using results from earlier studies of double-mode dwarf Cepheids by Cox, King, and Hodson, hydrodynamic calculations were undertaken for AI Vel. The earlier derived evolution theory mass of 1.8 M sub solar, a luminosity of of 23 L sub solar and a T/sub e/ of 7500 0 K give the observed period of 0.11 day and the observed period ratio PI 1 /PI 0 = 0.773. A cooler T/sub e/ than the observed one (7620 0 K) was used because 7620 0 K is beyond the fundamental pulsation mode blue edge. The composition used is X = 0.70 Z = 0.01. This lower than normal Z is necessary to make the period ratio as large as observed. The goal is to see if double-mode behavior, due to either mode switching or a permanent state, can be predicted for the model. Progress in converging the model to a periodic pulsation solution by the von Sengbusch--Stellingwerf relaxation method will be reported. 17 references

  19. Artificial intelligence. Fears of an AI pioneer.

    Science.gov (United States)

    Russell, Stuart; Bohannon, John

    2015-07-17

    From the enraged robots in the 1920 play R.U.R. to the homicidal computer H.A.L. in 2001: A Space Odyssey, science fiction writers have embraced the dark side of artificial intelligence (AI) ever since the concept entered our collective imagination. Sluggish progress in AI research, especially during the “AI winter” of the 1970s and 1980s, made such worries seem far-fetched. But recent breakthroughs in machine learning and vast improvements in computational power have brought a flood of research funding— and fresh concerns about where AI may lead us. One researcher now speaking up is Stuart Russell, a computer scientist at the University of California, Berkeley, who with Peter Norvig, director of research at Google, wrote the premier AI textbook, Artificial Intelligence: A Modern Approach, now in its third edition. Last year, Russell joined the Centre for the Study of Existential Risk at Cambridge University in the United Kingdom as an AI expert focusing on “risks that could lead to human extinction.” Among his chief concerns, which he aired at an April meeting in Geneva, Switzerland, run by the United Nations, is the danger of putting military drones and weaponry under the full control of AI systems. This interview has been edited for clarity and brevity.

  20. Fiber laser with combined feedback of core and cladding modes assisted by an intracavity long-period grating.

    Science.gov (United States)

    Sáez-Rodriguez, D; Cruz, J L; Díez, A; Andrés, M V

    2011-05-15

    We present a fiber laser made in a single piece of conventional doped-core fiber that operates by combined feedback of the fundamental core mode LP((0,1)) and the high-order cladding mode LP((0,10)). The laser is an all-fiber structure that uses two fiber Bragg gratings and a long-period grating to select the modes circulating in the cavity; the laser emits at the coupling wavelength between the core mode LP((0,1)) and the counterpropagating cladding mode LP((0,10)) in the Bragg gratings. This work demonstrates the feasibility of high-order mode fiber lasers assisted by long-period gratings. © 2011 Optical Society of America

  1. Design of Long Period Pseudo-Random Sequences from the Addition of m -Sequences over 𝔽 p

    Directory of Open Access Journals (Sweden)

    Ren Jian

    2004-01-01

    Full Text Available Pseudo-random sequence with good correlation property and large linear span is widely used in code division multiple access (CDMA communication systems and cryptology for reliable and secure information transmission. In this paper, sequences with long period, large complexity, balance statistics, and low cross-correlation property are constructed from the addition of m -sequences with pairwise-prime linear spans (AMPLS. Using m -sequences as building blocks, the proposed method proved to be an efficient and flexible approach to construct long period pseudo-random sequences with desirable properties from short period sequences. Applying the proposed method to 𝔽 2 , a signal set ( ( 2 n − 1 ( 2 m − 1 , ( 2 n + 1 ( 2 m + 1 , ( 2 ( n + 1 / 2 + 1 ( 2 ( m + 1 / 2 + 1 is constructed.

  2. Long-period and short-period variations of ionospheric parameters studied from complex observations performed on Cuba

    Energy Technology Data Exchange (ETDEWEB)

    Laso, B; Lobachevskii, L A; Potapova, N I; Freizon, I A; Shapiro, B S

    1980-09-01

    Cuban data from 1978 are used to study long-period (i.e., diurnal) variations of Doppler shift on a 3000 km path at frequencies of 10 and 15 MHz these variations are related to variations of parameters on the ionospheric path. Short-period variations were also studied on the basis of Doppler shift data and vertical sounding data in the 0.000111-0.00113 Hz frequency range. The relation between the observed variations and internal gravity waves are discussed.

  3. "All-In-One Test" (AI1)

    DEFF Research Database (Denmark)

    Giacalone, Davide; Bredie, Wender Laurentius Petrus; Frøst, Michael Bom

    2013-01-01

    by the Check-All-That-Apply (CATA) technique is reported. In this exploratory "All-In-One Test"(AI1), subjects (N = 160) filled out a questionnaire with demographic and psychographic variables, and appropriateness ratings for specific sensory descriptors of beer. Subsequently, subjects gave hedonic ratings...... between appropriateness and actual hedonic response. Overall, the AI1 test provided interpretable results concerning consumer perception (sensory/hedonic) of the beers, and revealed relations with consumers' background information. Initial results with AI1 test show that it is an efficient and versatile...

  4. Health Information in French (français)

    Science.gov (United States)

    ... Biopsy - français (French) Bilingual PDF Health Information Translations Breast Biopsy - français (French) Bilingual PDF Health Information Translations Colposcopy - français (French) Bilingual PDF ...

  5. Mutation of the planar cell polarity gene VANGL1 in adolescent idiopathic scoliosis

    DEFF Research Database (Denmark)

    Andersen, Malene Rask; Farooq, Muhammad; Koefoed, Karen

    2017-01-01

    STUDY DESIGN: Mutation analysis of a candidate disease gene in a cohort of patients with moderate to severe Adolescent idiopathic scoliosis (AIS). OBJECTIVE: To investigate if damaging mutations in the planar cell polarity gene VANGL1 could be identified in AIS patients. SUMMARY OF BACKGROUND DATA......: AIS is a spinal deformity which occurs in 1-3% of the population. The cause of AIS is often unknown, but genetic factors are important in the etiology. Rare variants in genes encoding regulators of WNT/planar cell polarity (PCP) signaling were recently identified in AIS patients. METHODS: We analyzed...

  6. AIS Ship Traffic: Hawaii: 2011-2012

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Ship position data from a satellite-based Automatic Identification System (AIS) were obtained jointly by PacIOOS (J. Potemra), SOEST/ORE of the University of Hawaii...

  7. Cracks appear in the AI gravy train

    Energy Technology Data Exchange (ETDEWEB)

    Mill, J.

    1983-10-01

    This article highlights some of the problems facing the Alvey committee and outlines some reasons for believing that the optimistically founded Alvey and Esprit funding programmes are no guarantee Britain will win the AI race.

  8. National AIS at 1 Minute Intervals

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — OCM plans to contract for AIS data per the following description. The United States Automatic Identification System Database contains vessel traffic data for...

  9. AI applications in sheet metal forming

    CERN Document Server

    Hussein, Hussein

    2017-01-01

    This book comprises chapters on research work done around the globe in the area of artificial intelligence (AI) applications in sheet metal forming. The first chapter offers an introduction to various AI techniques and sheet metal forming, while subsequent chapters describe traditional procedures/methods used in various sheet metal forming processes, and focus on the automation of those processes by means of AI techniques, such as KBS, ANN, GA, CBR, etc. Feature recognition and the manufacturability assessment of sheet metal parts, process planning, strip-layout design, selecting the type and size of die components, die modeling, and predicting die life are some of the most important aspects of sheet metal work. Traditionally, these activities are highly experience-based, tedious and time consuming. In response, researchers in several countries have applied various AI techniques to automate these activities, which are covered in this book. This book will be useful for engineers working in sheet metal industri...

  10. Synthesized and characterization of AI and Gd substitute ferrite for microwave

    International Nuclear Information System (INIS)

    Sudjono, Hans K.; Muljadi; Soepriyanto, Syony

    2000-01-01

    Ferrite for microwave components has been synthesized from garnet ceramics (YIG)substituted by AI and Gd. Magnetic permeability and magnetic polarization changes according to the AI 3+ ion addition. XRD is performed to determined the sintering products at various temperatures. For some samples the magnetic property and performance in microwave region was tested. The testing is conducted in the form of completely assembled circulator which gives data on isolation, insertion loss when microwave circuit analyzer was employed. Due to high level of porosity insertion lost is still to large, improved process is necessary

  11. Learning game AI programming with Lua

    CERN Document Server

    Young, David

    2014-01-01

    If you are a game developer or a general programmer who wishes to focus on programming systems and techniques to build your game AI without creating low-level interfaces in a game engine, then this book is for you. Knowledge of C++ will come in handy to debug the entirety of the AI sandbox and expand on the features present within the book, but it is not required.

  12. Adaptive game AI with dynamic scripting

    OpenAIRE

    Spronck, P.; Ponsen, M.J.V.; Sprinkhuizen-Kuyper, I.G.; Postma, E.O.

    2006-01-01

    Online learning in commercial computer games allows computer-controlled opponents to adapt to the way the game is being played. As such it provides a mechanism to deal with weaknesses in the game AI, and to respond to changes in human player tactics.We argue that online learning of game AI should meet four computational and four functional requirements. The computational requirements are speed, effectiveness, robustness and ef- ficiency. The functional requirements are clarity, variety, consi...

  13. Research Directions for AI in Computer Games

    OpenAIRE

    Fairclough, Chris; Fagan, Michael; Cunningham, Padraig; Mac Namee, Brian

    2001-01-01

    The computer games industry is now bigger than the film industry. Until recently, technology in games was driven by a desire to achieve real-time, photo-realistic graphics. To a large extent, this has now been achieved. As game developers look for new and innovative technologies to drive games development, AI is coming to the fore. This paper will examine how sophisticated AI techniques, such as those being used in mainstream academic research, can be applied to computer games ...

  14. Fabrication of fiber optic long period gratings operating at the phase matching turning point using an amplitude mask

    Science.gov (United States)

    Hromadka, J.; Correia, R.; Korposh, S.

    2016-05-01

    A fast method for the fabrication of the long period gratings (LPG) optical fibres operating at or near the phase matching turning point (PMTP) with the period of 109.0, 109.5 and 110.0 μm based on an amplitude mask writing system is described. The proposed system allows fabricating 3 cm long LPG sensors operating at PMPT within 20 min that is approximately 8 times faster than point-by-point approach. The reproducibility of the fabrication process was thoroughly studied. The response of the fabricated LPGs to the external change of the refractive index was investigated using water and methanol.

  15. THE PHASES DIFFERENTIAL ASTROMETRY DATA ARCHIVE. II. UPDATED BINARY STAR ORBITS AND A LONG PERIOD ECLIPSING BINARY

    International Nuclear Information System (INIS)

    Muterspaugh, Matthew W.; O'Connell, J.; Hartkopf, William I.; Lane, Benjamin F.; Williamson, M.; Kulkarni, S. R.; Konacki, Maciej; Burke, Bernard F.; Colavita, M. M.; Shao, M.; Wiktorowicz, Sloane J.

    2010-01-01

    Differential astrometry measurements from the Palomar High-precision Astrometric Search for Exoplanet Systems have been combined with lower precision single-aperture measurements covering a much longer timespan (from eyepiece measurements, speckle interferometry, and adaptive optics) to determine improved visual orbits for 20 binary stars. In some cases, radial velocity observations exist to constrain the full three-dimensional orbit and determine component masses. The visual orbit of one of these binaries-α Com (HD 114378)-shows that the system is likely to have eclipses, despite its very long period of 26 years. The next eclipse is predicted to be within a week of 2015 January 24.

  16. Long-period fibre grating writing with a slit-apertured femtosecond laser beam (λ = 1026 nm)

    International Nuclear Information System (INIS)

    Dostovalov, A V; Wolf, A A; Babin, S A

    2015-01-01

    We report on long-period grating (LPG) writing in a standard telecom fibre, SMF-28e+, via refractive index modification by femtosecond pulses. A method is proposed for grating writing with a slit-apertured beam, which enables one to produce LPGs with reduced background losses and a resonance peak markedly stronger than that in the case of grating writing with a Gaussian beam. The method can be used to fabricate LPGs for use as spectral filters of fibre lasers and sensing elements of sensor systems. (fibre and integrated-optical structures)

  17. Metal-organic framework thin films on a surface of optical fibre long period grating for chemical sensing

    Science.gov (United States)

    Hromadka, J.; Tokay, B.; James, S.; Korposh, S.

    2017-04-01

    An optical fibre long period grating (LPG) modified with a thin film of HKUST-1, a material from metal organic framework (MOF) family, was employed for the detection of carbon dioxide. The sensing mechanism is based on the measurement of the change of the refractive index (RI) of the coating that is induced by the penetration of CO2 molecules into the HKUST-1 pores. The responses of the resonance bands in the transmission spectrum of an LPG modified with 40 layers of HKUST-1 upon exposure to carbon dioxide in mixture with nitrogen were investigated.

  18. Axon Initial Segment Cytoskeleton: Architecture, Development, and Role in Neuron Polarity

    Science.gov (United States)

    Svitkina, Tatyana M.

    2016-01-01

    The axon initial segment (AIS) is a specialized structure in neurons that resides in between axonal and somatodendritic domains. The localization of the AIS in neurons is ideal for its two major functions: it serves as the site of action potential firing and helps to maintain neuron polarity. It has become increasingly clear that the AIS cytoskeleton is fundamental to AIS functions. In this review, we discuss current understanding of the AIS cytoskeleton with particular interest in its unique architecture and role in maintenance of neuron polarity. The AIS cytoskeleton is divided into two parts, submembrane and cytoplasmic, based on localization, function, and molecular composition. Recent studies using electron and subdiffraction fluorescence microscopy indicate that submembrane cytoskeletal components (ankyrin G, βIV-spectrin, and actin filaments) form a sophisticated network in the AIS that is conceptually similar to the polygonal/triangular network of erythrocytes, with some important differences. Components of the AIS cytoplasmic cytoskeleton (microtubules, actin filaments, and neurofilaments) reside deeper within the AIS shaft and display structural features distinct from other neuronal domains. We discuss how the AIS submembrane and cytoplasmic cytoskeletons contribute to different aspects of AIS polarity function and highlight recent advances in understanding their AIS cytoskeletal assembly and stability. PMID:27493806

  19. Beyond AI: Interdisciplinary Aspects of Artificial Intelligence

    CERN Document Server

    Romportl, Jan; Zackova, Eva; Beyond Artificial Intelligence : Contemplations, Expectations, Applications

    2013-01-01

    Products of modern artificial intelligence (AI) have mostly been formed by the views, opinions and goals of the “insiders”, i.e. people usually with engineering background who are driven by the force that can be metaphorically described as the pursuit of the craft of Hephaestus. However, since the present-day technology allows for tighter and tighter mergence of the “natural” everyday human life with machines of immense complexity, the responsible reaction of the scientific community should be based on cautious reflection of what really lies beyond AI, i.e. on the frontiers where the tumultuous ever-growing and ever-changing cloud of AI touches the rest of the world.   The chapters of this boo are based on the selected subset of the presentations that were delivered by their respective authors at the conference “Beyond AI: Interdisciplinary Aspects of Artificial Intelligence” held in Pilsen in December 2011.   From its very definition, the reflection of the phenomena that lie beyond AI must be i...

  20. Two new Oxalis species (Oxalidaceae) from the Ai-Ais / Richtersveld Transfrontier Park, South Africa

    NARCIS (Netherlands)

    Roets, F.; Oberlander, K.C.; Dreyer, L.L.

    2012-01-01

    South Africa has a rich, but scantily surveyed, desert flora. Documenting annual and geophytic species in this biome is challenging, as they usually only flower after adequate precipitation, which is characteristically erratic and infrequent. Recent floristic surveys in the Ai-Ais / Richtersveld

  1. Use of AI-1024 and AI-4096 analyzers in multiple regimes

    International Nuclear Information System (INIS)

    Zaika, N.D.; Kovtunenko, I.S.; Savchuk, O.G.

    1975-01-01

    The operation of pulse multichannel analyzers in the following multidimensional modes: AI-1024-4 - amplitude mode from several transducers; amplitude mode from several transducers at different time intervals; AI-4096-3M - amplitude mode at different time intervals in each of four groups with unit BVI-1

  2. A Long-Period Totally Eclipsing Binary Star at the Turnoff of the Open Cluster NGC 6819 Discovered with Kepler

    DEFF Research Database (Denmark)

    Sandquist, Eric L.; Mathieu, Robert D.; Brogaard, Karsten

    2012-01-01

    We present the discovery of the totally eclipsing long-period (P = 771.8 d) binary system WOCS 23009 in the old open cluster NGC 6819 that contains both an evolved star near central hydrogen exhaustion and a low-mass (0.45 Msun) star. This system was previously known to be a single-lined spectros......We present the discovery of the totally eclipsing long-period (P = 771.8 d) binary system WOCS 23009 in the old open cluster NGC 6819 that contains both an evolved star near central hydrogen exhaustion and a low-mass (0.45 Msun) star. This system was previously known to be a single......-lined spectroscopic binary, but the discovery of an eclipse near apastron using data from the Kepler space telescope makes it clear that the system has an inclination that is very close to 90 degrees. Although the secondary star has not been identified in spectra, the mass of the primary star can be constrained using...... other eclipsing binaries in the cluster. The combination of total eclipses and a mass constraint for the primary star allows us to determine a reliable mass for the secondary star and radii for both stars, and to constrain the cluster age. Unlike well-measured stars of similar mass in field binaries...

  3. Long Period Seismic Waves

    Science.gov (United States)

    1976-08-01

    Geoffsica, TPHM. No. 5 , p. 161. Vargas, Freddy (To he published in 1976) 1 .-DTSCRP1TNACTON DE EVENTO«; NATHDALE«; Y ARTTFTCT ALES. 2.- CALCULO DEL...seismic risk, bv de - fininn relative weiqht of maximum MM intensity at a pivon distance ponulation density, area feolupy and attenuation of intensity wit...Population densitv, area peolopv and attenuation of intensitv with distance, is presented topether with a map anplvinp theorv to Bo- livia. ^«^a

  4. Artificial Intelligence Safety and Cybersecurity: a Timeline of AI Failures

    OpenAIRE

    Yampolskiy, Roman V.; Spellchecker, M. S.

    2016-01-01

    In this work, we present and analyze reported failures of artificially intelligent systems and extrapolate our analysis to future AIs. We suggest that both the frequency and the seriousness of future AI failures will steadily increase. AI Safety can be improved based on ideas developed by cybersecurity experts. For narrow AIs safety failures are at the same, moderate, level of criticality as in cybersecurity, however for general AI, failures have a fundamentally different impact. A single fai...

  5. Tweeting AI: Perceptions of Lay vs Expert Twitterati

    OpenAIRE

    Manikonda, Lydia; Kambhampati, Subbarao

    2017-01-01

    With the recent advancements in Artificial Intelligence (AI), various organizations and individuals are debating about the progress of AI as a blessing or a curse for the future of the society. This paper conducts an investigation on how the public perceives the progress of AI by utilizing the data shared on Twitter. Specifically, this paper performs a comparative analysis on the understanding of users belonging to two categories -- general AI-Tweeters (AIT) and expert AI-Tweeters (EAIT) who ...

  6. Strategic Team AI Path Plans: Probabilistic Pathfinding

    Directory of Open Access Journals (Sweden)

    Tng C. H. John

    2008-01-01

    Full Text Available This paper proposes a novel method to generate strategic team AI pathfinding plans for computer games and simulations using probabilistic pathfinding. This method is inspired by genetic algorithms (Russell and Norvig, 2002, in that, a fitness function is used to test the quality of the path plans. The method generates high-quality path plans by eliminating the low-quality ones. The path plans are generated by probabilistic pathfinding, and the elimination is done by a fitness test of the path plans. This path plan generation method has the ability to generate variation or different high-quality paths, which is desired for games to increase replay values. This work is an extension of our earlier work on team AI: probabilistic pathfinding (John et al., 2006. We explore ways to combine probabilistic pathfinding and genetic algorithm to create a new method to generate strategic team AI pathfinding plans.

  7. AI Researchers, Video Games Are Your Friends!

    OpenAIRE

    Togelius, Julian

    2016-01-01

    If you are an artificial intelligence researcher, you should look to video games as ideal testbeds for the work you do. If you are a video game developer, you should look to AI for the technology that makes completely new types of games possible. This chapter lays out the case for both of these propositions. It asks the question "what can video games do for AI", and discusses how in particular general video game playing is the ideal testbed for artificial general intelligence research. It the...

  8. AI, automation and the Flight Telerobotic Servicer

    Science.gov (United States)

    Goforth, Andre; Dominy, Robert

    1988-01-01

    A NASA study for the preliminary definition of a teleoperated robotic device has been recently completed. The Fligt Telerobotic Servicer (FTS) will be used to assist astronauts in many of the on-board tasks of assembly, maintenance, servicing, and inspection of the Space Station. The role of artificial intelligence (AI) in furthering the FTS automation capabilities and, hence, extending its capacity for growth and evolution is discussed. Relevant system engineering issues are identified, and an approach for insertion of AI technology is presented in terms of the NASA/NBS Standard Reference Model control architecture NASREM.

  9. Enhanced refractive index sensor using a combination of a long period fiber grating and a small core singlemode fiber structure

    International Nuclear Information System (INIS)

    Wu, Qiang; Ma, Youqiao; Yang, Minwei; Semenova, Yuliya; Wang, Pengfei; Farrell, Gerald; Chan, Hai Ping; Yuan, Jinhui; Yan, Binbin; Yu, Chongxiu

    2013-01-01

    An enhanced refractive index (RI) sensor based on a combination of a long period fiber grating (LPG) and a small core singlemode fiber (SCSMF) structure is proposed and developed. Since the LPG and SCSMF transmission spectra experience a blue and a red shift respectively as the surrounding RI (SRI) increases, the sensitivity is improved by measuring the separation between the resonant wavelengths of the LPG and SCSMF structures. Experimental results show that the sensor has a sensitivity of 1028 nm/SRI unit in the SRI range from 1.422 to 1.429, which is higher than individual sensitivities of either structure alone used in the experiment. Experimental results agree well with simulation results. (paper)

  10. Effect of the fluid core on changes in the length of day due to long period tides

    Science.gov (United States)

    Wahr, J. M.; Smith, M. L.; Sasao, T.

    1981-01-01

    The long period luni-solar tidal potential is known to cause periodic changes in the earth's rotation rate. It is found that the effect of a dissipationless fluid outer core is to reduce the amplitudes of these tidal perturbations by about 11 percent. When the fluid core effect is added to Agnew and Farrell's (1978) estimate of the effect of an equilibrium ocean, the result is in accord with observation. The effects of dissipative processes within the fluid core are also examined. Out-of-phase perturbations are found which could be as large as about 10 ms at 18.6 yr. It is concluded, however, that the poorly understood decade fluctuations in the earth's rotation rate will prohibit observation of this effect.

  11. Recording of long-period gratings in special single-mode fibers by a CO2 laser

    International Nuclear Information System (INIS)

    Cisarovsky, Petr; Dunovsky, Jiri; Kolarik, Ladislav; Todorov, Filip; Kasik, Ivan; Matejec, Vlastimil

    2006-01-01

    The paper deals with the fabrication of long-period gratings (LPG) in special optical fibers with an inverted parabolic-index profile of the cladding by periodically exposing the fibers to radiation of a high-power CO 2 laser. Details on the fiber fabrication and preparation of LPGs with a period of about 1 mm in the fibers are presented. The fabricated LPGs were evaluated on the basis of their transmission spectra determined by measuring the output spectral density of the fiber with the LPGs. It is shown that the position of the band and its strength depend on the laser beam velocity, beam power and the interaction time of radiation with the fiber

  12. Long-period fading in atmospherics during severe meteorological activity and associated solar geophysical phenomena at low latitudes

    Directory of Open Access Journals (Sweden)

    A. B. Bhattacharya

    1998-02-01

    Full Text Available The records of VLF atmospherics over Calcutta and then over Kalyani (West Bengal during the torrential rainfall, caused by violent monsoon and post-monsoon depressions, exhibit distinct long-period fadings both at day and night. Interesting results obtained from an analysis of round-the-clock atmospherics data and associated meteorological parameters are reported in this paper. A possible correlation between the severe meteorological activity with the solar geophysical phenomena was studied. The results are indicative of an interesting sequence of solar-terrestrial events. A tentative conclusion is reached, suggesting an origin of the fading from atmospheric gravity waves generated in the centre of activity of the depressions concerned.Key words. Meteorology and atmospheric dynamics · Lightning · Precipitation

  13. [INVITED] Design of turn around point long period fiber grating sensor with Au-nanoparticle self monolayer

    Science.gov (United States)

    Bandyopadhyay, Sankhyabrata; Basumallick, Nandini; Bysakh, Sandip; Dey, Tanoy Kumar; Biswas, Palas; Bandyopadhyay, Somnath

    2018-06-01

    In this paper studies on the design and fabrication of a long period fiber grating (LPFG) with a self mono layer of gold nanoparticle (AuNP) has been presented. Refractive index (RI) sensitivity of a dispersed cladding mode (DCM) near turn around point (TAP) of its phase matching curve (PMC) has been investigated with and also without AuNP coated LPFG. The typical role played by the intermediate layer of AuNP on the effective index and thus on the sensitivity of the cladding mode to the surrounding RI has also been explored by carrying out coupled mode analysis of the requisite multilayer waveguide. Deposition of AuNP enhanced the sensitivity by more than a factor of 2. Measured sensitivity was found to be ∼3928 nm/refractive index unit (RIU) in the range of 1.3333-1.3428.

  14. Widely tunable asymmetric long-period fiber grating with high sensitivity using optical polymer on laser-ablated cladding.

    Science.gov (United States)

    Chen, Nan-Kuang; Hsu, Der-Yi; Chi, Sien

    2007-08-01

    We demonstrate high-efficiency, wideband-tunable, laser-ablated long-period fiber gratings that use an optical polymer overlay. Portions of the fiber cladding are periodically removed by CO(2) laser pulses to induce periodic index changes for coupling the core mode into cladding modes. An optical polymer with a high thermo-optic coefficient with a dispersion distinct from that of silica is used on a deep-ablated cladding structure so that the effective indices of cladding modes become dispersive and the resonant wavelengths can be efficiently tuned. The tuning efficiency can be as high as 15.8 nm/ degrees C, and the tuning range can be wider than 105 nm (1545-1650 nm).

  15. High-resolution electron microscopy on incommensurate long-period superstructures of hexagonal-close-packed Cu-Sb alloy

    International Nuclear Information System (INIS)

    Onozuka, T.; Kakehashi, S.; Takahashi, T.; Hirabayashi, M.

    1989-01-01

    Hexagonal incommensurate long-period superstructures of the Cu-Sb alloys containing 18-20 at.% Sb have been investigated by means of superstructure imaging using a high-resolution electron microscope. Honeycomb-type distributions of hexagonal domains consisting of the commensurate superstructure of type 7a 0 -2H are observed. The incommensurabilities of superstructure can be interpreted well with a hexagonal model composed of the 7a 0 -2H domains surrounded by domain walls which contain higher Sb content than the domain interior. The observed image contrast is reproduced well with multislice computer simulations based on the structure models proposed for the 7a 0 -2H domain and the domain wall. (orig.)

  16. High-resolution electron microscopy on incommensurate long-period superstructures of hexagonal-close-packed Cu-Sb alloy

    Energy Technology Data Exchange (ETDEWEB)

    Onozuka, T.; Kakehashi, S.; Takahashi, T.; Hirabayashi, M. (Tohoku Univ., Sendai (Japan). Inst. for Materials Research)

    1989-06-01

    Hexagonal incommensurate long-period superstructures of the Cu-Sb alloys containing 18-20 at.% Sb have been investigated by means of superstructure imaging using a high-resolution electron microscope. Honeycomb-type distributions of hexagonal domains consisting of the commensurate superstructure of type 7a{sub 0}-2H are observed. The incommensurabilities of superstructure can be interpreted well with a hexagonal model composed of the 7a{sub 0}-2H domains surrounded by domain walls which contain higher Sb content than the domain interior. The observed image contrast is reproduced well with multislice computer simulations based on the structure models proposed for the 7a{sub 0}-2H domain and the domain wall. (orig.).

  17. Double resonance long period fiber grating for detection of E. coli in trace concentration by choosing a proper bacteriophage

    Science.gov (United States)

    Chiniforooshan, Y.; Celebanska, A.; Janik, M.; Mikulic, P.; Haddad, F.; Perreault, J.; Bock, W. J.

    2017-04-01

    There is a critical need of a fast, specific and reliable assay for biological species. To address this need, long period fiber gratings (LPFG) among other fiber optic sensors can be used because of their high sensitivity to changes in surrounding medium. In this work we fabricated and used two over-etched LPFGs. One of them was covered with T4 Phage and the other was covered with MS2 phage that both specifically bind with Escherichia coli (E. coli) bacteria. This bacterium is a major cause of the food contaminations and outbreaks. We showed achieving a highest sensitivity region of the LPFG and the way to fine tune to that region by over-etching the grating. Finally, using the highly sensitive LPFG platform we could detect E. coli at concentrations as low as 100 colony forming units (CFU), by covering the LPFG with an optimized bio-functionalization of the fiber surface with MS2 bacteriophage.

  18. Refractive index and temperature sensors based on no-core fiber cascaded with long period fiber grating

    Science.gov (United States)

    Zhang, Jianming; Pu, Shengli; Rao, Jie; Yao, Tianjun

    2018-05-01

    A kind of compact fibre-optic sensor based on no-core fibre (NCF) cascaded with a strong coupling long-period fibre grating (LPFG) is proposed and experimentally demonstrated. The sensing mechanism is based on the Mach-Zehnder-like interference between the core fundamental mode and cladding mode of the fibre structure. The NCF and LPFG are used as the mode exciter and combiner, respectively. Due to the particular properties of the strong coupling LPFG, the measurements of refractive index (RI) and temperature with high sensitivity are realized by monitoring the transmission spectrum with intensity and wavelength interrogation techniques, respectively. The achieved RI sensitivity reaches -580.269 dB/RIU in the range of 1.436-1.454 and the temperature sensitivity reaches 27.2 pm/°C.

  19. Reflection-type long period grating biosensor for the detection of drug resistant bacteria: The Opto-bacteria Project

    Science.gov (United States)

    Consales, M.; Quero, G.; Zuppolini, S.; Sansone, L.; Borriello, A.; Giordano, M.; Venturelli, A.; Cusano, A.

    2014-05-01

    We report on the development of a multilayer coated reflection-type long period fiber grating (LPG) biosensor, useful for the detection of antibiotic resistance bacteria. A standard LPG is first transformed in a more practical probe working in reflection mode, then it is coated by a primary layer of aPS and a secondary layer of PMMA in order to increase its surrounding refractive index sensitivity and at the same time provide the necessary conditions for a correct biofunctionalization. Standard linkage chemistry has been applied to anchor the bioreceptors on the probe surface. We show some preliminary results demonstrating the capability of our LPG biosensor to successfully monitor all the biological steps of the biomolecular experiments, including β-lactamase binding detection tests.

  20. Noise Reduction, Atmospheric Pressure Admittance Estimation and Long-Period Component Extraction in Time-Varying Gravity Signals Using Ensemble Empirical Mode Decomposition

    Directory of Open Access Journals (Sweden)

    Linsong Wang

    2015-01-01

    Full Text Available Time-varying gravity signals, with their nonlinear, non-stationary and multi-scale characteristics, record the physical responses of various geodynamic processes and consist of a blend of signals with various periods and amplitudes, corresponding to numerous phenomena. Superconducting gravimeter (SG records are processed in this study using a multi-scale analytical method and corrected for known effects to reduce noise, to study geodynamic phenomena using their gravimetric signatures. Continuous SG (GWR-C032 gravity and barometric data are decomposed into a series of intrinsic mode functions (IMFs using the ensemble empirical mode decomposition (EEMD method, which is proposed to alleviate some unresolved issues (the mode mixing problem and the end effect of the empirical mode decomposition (EMD. Further analysis of the variously scaled signals is based on a dyadic filter bank of the IMFs. The results indicate that removing the high-frequency IMFs can reduce the natural and man-made noise in the data, which are caused by electronic device noise, Earth background noise and the residual effects of pre-processing. The atmospheric admittances based on frequency changes are estimated from the gravity and the atmospheric pressure IMFs in various frequency bands. These time- and frequency-dependent admittance values can be used effectively to improve the atmospheric correction. Using the EEMD method as a filter, the long-period IMFs are extracted from the SG time-varying gravity signals spanning 7 years. The resulting gravity residuals are well correlated with the gravity effect caused by the _ polar motion after correcting for atmospheric effects.

  1. PAIRS AND GROUPS OF GENETICALLY RELATED LONG-PERIOD COMETS AND PROPOSED IDENTITY OF THE MYSTERIOUS LICK OBJECT OF 1921

    Energy Technology Data Exchange (ETDEWEB)

    Sekanina, Zdenek [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States); Kracht, Rainer, E-mail: Zdenek.Sekanina@jpl.nasa.gov, E-mail: R.Kracht@t-online.de [Ostlandring 53, D-25335 Elmshorn, Schleswig-Holstein (Germany)

    2016-05-20

    We present the history of investigation of the dynamical properties of pairs and groups of genetically related long-period comets (other than the Kreutz sungrazing system). Members of a comet pair or group move in nearly identical orbits, and their origin as fragments of a common parent comet is unquestionable. The only variable is the time of perihelion passage, which differs considerably from member to member owing primarily to an orbital-momentum increment acquired during breakup. Meter-per-second separation velocities account for gaps of years or tens of years, thanks to the orbital periods of many millennia. The physical properties of individual members may not at all be alike, as illustrated by the trio of C/1988 A1, C/1996 Q1, and C/2015 F3. We exploit orbital similarity to examine whether the enigmatic and as-yet-unidentified object discovered from the Lick Observatory near the Sun at sunset on 1921 August 7 happened to be a member of such a pair and to track down the long-period comet to which it might be genetically related. Our search shows that the Lick object, which could not be a Kreutz sungrazer, was likely a companion to comet C/1847 C1 (Hind), whose perihelion distance was ∼9 R {sub ⊙} and true orbital period was approximately 8300 yr. The gap of 74.4 yr between their perihelion times is consistent with a separation velocity of ∼1 m s{sup −1} which sets the fragments apart following the parent's breakup in a general proximity of perihelion during the previous return to the Sun in the seventh millennium BCE.

  2. Ground motion modeling of Hayward fault scenario earthquakes II:Simulation of long-period and broadband ground motions

    Energy Technology Data Exchange (ETDEWEB)

    Aagaard, B T; Graves, R W; Rodgers, A; Brocher, T M; Simpson, R W; Dreger, D; Petersson, N A; Larsen, S C; Ma, S; Jachens, R C

    2009-11-04

    We simulate long-period (T > 1.0-2.0 s) and broadband (T > 0.1 s) ground motions for 39 scenarios earthquakes (Mw 6.7-7.2) involving the Hayward, Calaveras, and Rodgers Creek faults. For rupture on the Hayward fault we consider the effects of creep on coseismic slip using two different approaches, both of which reduce the ground motions compared with neglecting the influence of creep. Nevertheless, the scenario earthquakes generate strong shaking throughout the San Francisco Bay area with about 50% of the urban area experiencing MMI VII or greater for the magnitude 7.0 scenario events. Long-period simulations of the 2007 Mw 4.18 Oakland and 2007 Mw 4.5 Alum Rock earthquakes show that the USGS Bay Area Velocity Model version 08.3.0 permits simulation of the amplitude and duration of shaking throughout the San Francisco Bay area, with the greatest accuracy in the Santa Clara Valley (San Jose area). The ground motions exhibit a strong sensitivity to the rupture length (or magnitude), hypocenter (or rupture directivity), and slip distribution. The ground motions display a much weaker sensitivity to the rise time and rupture speed. Peak velocities, peak accelerations, and spectral accelerations from the synthetic broadband ground motions are, on average, slightly higher than the Next Generation Attenuation (NGA) ground-motion prediction equations. We attribute at least some of this difference to the relatively narrow width of the Hayward fault ruptures. The simulations suggest that the Spudich and Chiou (2008) directivity corrections to the NGA relations could be improved by including a dependence on the rupture speed and increasing the areal extent of rupture directivity with period. The simulations also indicate that the NGA relations may under-predict amplification in shallow sedimentary basins.

  3. SNAP and AI Fuel Summary Report

    International Nuclear Information System (INIS)

    Lords, R.E.

    1994-08-01

    The SNAP and AI Fuel Summary Report provides a detailed overview of treatment and storage of these fuels from fabrication through current storage including design parameters and reactor history. Chemical and physical characteristics are described, and potential indicators of as-stored fuel conditions are emphasized

  4. Polarized neutrons

    International Nuclear Information System (INIS)

    Williams, W.G.

    1988-01-01

    The book on 'polarized neutrons' is intended to inform researchers in condensed matter physics and chemistry of the diversity of scientific problems that can be investigated using polarized neutron beams. The contents include chapters on:- neutron polarizers and instrumentation, polarized neutron scattering, neutron polarization analysis experiments and precessing neutron polarization. (U.K.)

  5. The BSM-AI project: SUSY-AI-generalizing LHC limits on supersymmetry with machine learning

    Energy Technology Data Exchange (ETDEWEB)

    Caron, Sascha [Radboud Universiteit, Institute for Mathematics, Astro- and Particle Physics IMAPP, Nijmegen (Netherlands); Nikhef, Amsterdam (Netherlands); Kim, Jong Soo [UAM/CSIC, Instituto de Fisica Teorica, Madrid (Spain); Rolbiecki, Krzysztof [UAM/CSIC, Instituto de Fisica Teorica, Madrid (Spain); University of Warsaw, Faculty of Physics, Warsaw (Poland); Ruiz de Austri, Roberto [IFIC-UV/CSIC, Instituto de Fisica Corpuscular, Valencia (Spain); Stienen, Bob [Radboud Universiteit, Institute for Mathematics, Astro- and Particle Physics IMAPP, Nijmegen (Netherlands)

    2017-04-15

    A key research question at the Large Hadron Collider is the test of models of new physics. Testing if a particular parameter set of such a model is excluded by LHC data is a challenge: it requires time consuming generation of scattering events, simulation of the detector response, event reconstruction, cross section calculations and analysis code to test against several hundred signal regions defined by the ATLAS and CMS experiments. In the BSM-AI project we approach this challenge with a new idea. A machine learning tool is devised to predict within a fraction of a millisecond if a model is excluded or not directly from the model parameters. A first example is SUSY-AI, trained on the phenomenological supersymmetric standard model (pMSSM). About 300, 000 pMSSM model sets - each tested against 200 signal regions by ATLAS - have been used to train and validate SUSY-AI. The code is currently able to reproduce the ATLAS exclusion regions in 19 dimensions with an accuracy of at least 93%. It has been validated further within the constrained MSSM and the minimal natural supersymmetric model, again showing high accuracy. SUSY-AI and its future BSM derivatives will help to solve the problem of recasting LHC results for any model of new physics. SUSY-AI can be downloaded from http://susyai.hepforge.org/. An on-line interface to the program for quick testing purposes can be found at http://www.susy-ai.org/. (orig.)

  6. The BSM-AI project: SUSY-AI-generalizing LHC limits on supersymmetry with machine learning

    International Nuclear Information System (INIS)

    Caron, Sascha; Kim, Jong Soo; Rolbiecki, Krzysztof; Ruiz de Austri, Roberto; Stienen, Bob

    2017-01-01

    A key research question at the Large Hadron Collider is the test of models of new physics. Testing if a particular parameter set of such a model is excluded by LHC data is a challenge: it requires time consuming generation of scattering events, simulation of the detector response, event reconstruction, cross section calculations and analysis code to test against several hundred signal regions defined by the ATLAS and CMS experiments. In the BSM-AI project we approach this challenge with a new idea. A machine learning tool is devised to predict within a fraction of a millisecond if a model is excluded or not directly from the model parameters. A first example is SUSY-AI, trained on the phenomenological supersymmetric standard model (pMSSM). About 300, 000 pMSSM model sets - each tested against 200 signal regions by ATLAS - have been used to train and validate SUSY-AI. The code is currently able to reproduce the ATLAS exclusion regions in 19 dimensions with an accuracy of at least 93%. It has been validated further within the constrained MSSM and the minimal natural supersymmetric model, again showing high accuracy. SUSY-AI and its future BSM derivatives will help to solve the problem of recasting LHC results for any model of new physics. SUSY-AI can be downloaded from http://susyai.hepforge.org/. An on-line interface to the program for quick testing purposes can be found at http://www.susy-ai.org/. (orig.)

  7. Launching AI in NASA ground systems

    Science.gov (United States)

    Perkins, Dorothy C.; Truszkowski, Walter F.

    1990-01-01

    This paper will discuss recent operational successes in implementing expert systems to support the complex functions of NASA mission control systems at the Goddard Space Flight Center, including fault detection and diagnosis for real time and engineering analysis functions in the Cosmic Background Explorer and Gamma Ray Observatory missions and automation of resource planning and scheduling functions for various missions. It will also discuss ongoing developments and prototypes that will lead to increasingly sophisticated applications of artificial intelligence. These include the use of neural networks to perform telemetry monitoring functions, the implementation of generic expert system shells that can be customized to telemetry handling functions specific to NASA control centers, the applications of AI in training and user support, the long-term potential of implementing systems based around distributed, cooperative problem solving, and the use of AI to control and assist system development activities.

  8. AI systems approach in particle accelerators

    International Nuclear Information System (INIS)

    Kataria, S.K.; Bhagwat, P.V.; Kori, S.A.

    1992-01-01

    The large particle accelerators machines like pelletron accelerator at Tata Institute of Fundamental Research (T.I.F.R) have several levels of controls with operators responsible for overall global control decisions and closed loop feedback controllers for relatively small subsystems of the machines. As the accelerator machines are becoming more complicated and the requirements more stringent, there is a need to provide the operators with an artificial intelligence (AI) system to aid in the tuning the machine and in failure diagnosis. There are few major areas in the pelletron operation, which can be done more efficiently using AI systems approach so that useful beam is available for much more time: 1) Accelerator Conditioning, 2) Accelerator Tuning, and 3) Maintaining the Tune beams. The feasibility study for using expert system for above areas and also for safety evaluation of the various subsystems is carried out. (author). 10 refs., 4 figs

  9. Deploying Embodied AI into Virtual Worlds

    Science.gov (United States)

    Burden, David J. H.

    The last two years have seen the start of commercial activity within virtual worlds. Unlike computer games where Non-Player-Character avatars are common, in most virtual worlds they are the exception — and until recently in Second Life they were non-existent. However there is real commercial scope for Als in these worlds — in roles from virtual sales staff and tutors to personal assistants. Deploying an embodied AI into a virtual world offers a unique opportunity to evaluate embodied Als, and to develop them within an environment where human and computer are on almost equal terms. This paper presents an architecture being used for the deployment of chatbot driven avatars within the Second Life virtual world, looks at the challenges of deploying an AI within such a virtual world, the possible implications for the Turing Test, and identifies research directions for the future.

  10. Managing bioengineering complexity with AI techniques.

    Science.gov (United States)

    Beal, Jacob; Adler, Aaron; Yaman, Fusun

    2016-10-01

    Our capabilities for systematic design and engineering of biological systems are rapidly increasing. Effectively engineering such systems, however, requires the synthesis of a rapidly expanding and changing complex body of knowledge, protocols, and methodologies. Many of the problems in managing this complexity, however, appear susceptible to being addressed by artificial intelligence (AI) techniques, i.e., methods enabling computers to represent, acquire, and employ knowledge. Such methods can be employed to automate physical and informational "routine" work and thus better allow humans to focus their attention on the deeper scientific and engineering issues. This paper examines the potential impact of AI on the engineering of biological organisms through the lens of a typical organism engineering workflow. We identify a number of key opportunities for significant impact, as well as challenges that must be overcome. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  11. The Potential of AI Techniques for Remote Sensing

    Science.gov (United States)

    Estes, J. E.; Sailer, C. T. (Principal Investigator); Tinney, L. R.

    1984-01-01

    The current status of artificial intelligence AI technology is discussed along with imagery data management, database interrogation, and decision making. Techniques adapted from the field of artificial intelligence (AI) have significant, wide ranging impacts upon computer-assisted remote sensing analysis. AI based techniques offer a powerful and fundamentally different approach to many remote sensing tasks. In addition to computer assisted analysis, AI techniques can also aid onboard spacecraft data processing and analysis and database access and query.

  12. AI in space: Past, present, and possible futures

    Science.gov (United States)

    Rose, Donald D.; Post, Jonathan V.

    1992-01-01

    While artificial intelligence (AI) has become increasingly present in recent space applications, new missions being planned will require even more incorporation of AI techniques. In this paper, we survey some of the progress made to date in implementing such programs, some current directions and issues, and speculate about the future of AI in space scenarios. We also provide examples of how thinkers from the realm of science fiction have envisioned AI's role in various aspects of space exploration.

  13. Variation of long-period stacking order structures in rapidly solidified Mg97Zn1Y2 alloy

    International Nuclear Information System (INIS)

    Matsuda, M.; Ii, S.; Kawamura, Y.; Ikuhara, Y.; Nishida, M.

    2005-01-01

    The long-period stacking order (LPSO) structures in rapidly solidified Mg 97 Zn 1 Y 2 alloy have been studied by conventional and high-resolution transmission electron microscopes (HRTEMs). There are four kinds of stacking sequences in the LPSO structures, i.e., 18R of ABABABCACACABCBCBC, 14H of ACBCBABABABCBC, 10H of ABACBCBCAB and 24R of ABABABABCACACACABCBCBCBC. The 18R structure is dominantly observed in the present study. The rest three are occasionally observed in places. The 10H and 24R structures are recently discovered. The lattice constants of 18R(1-bar 1-bar -bar 1-bar 1-bar -bar 2) 3 , 14H(2-bar -bar 1-bar 2-bar -bar 1-bar 1-bar -bar 1-bar 1-bar -bar 2-bar 1-bar -bar 2), 10H(1-bar 3-bar -bar 1-bar 1-bar -bar 3-bar 1-bar ) and 24R(1-bar 1-bar -bar 1-bar 1-bar -bar 1-bar 1-bar -bar 2) 3 structures are estimated to be a=0.320nm and c=4.678nm, a=0.325nm and c=3.694nm, a=0.325nm and c=2.603nm, a=0.322nm and c=6.181nm for the hexagonal structure, respectively

  14. Shallow degassing events as a trigger for very-long-period seismicity at Kīlauea Volcano, Hawai‘i

    Science.gov (United States)

    Patrick, Matthew; Wilson, David; Fee, David; Orr, Tim R.; Swanson, Donald A.

    2011-01-01

    The first eruptive activity at Kīlauea Volcano’s summit in 25 years began in March 2008 with the opening of a 35-m-wide vent in Halema‘uma‘u crater. The new activity has produced prominent very-long-period (VLP) signals corresponding with two new behaviors: episodic tremor bursts and small explosive events, both of which represent degassing events from the top of the lava column. Previous work has shown that VLP seismicity has long been present at Kīlauea’s summit, and is sourced approximately 1 km below Halema‘uma‘u. By integrating video observations, infrasound and seismic data, we show that the onset of the large VLP signals occurs within several seconds of the onset of the degassing events. This timing indicates that the VLP is caused by forces—sourced at or very near the lava free surface due to degassing—transmitted down the magma column and coupling to the surrounding rock at 1 km depth.

  15. Modelling carbon steels corrosion during a long period in soils: Contribution of A.C. impedance spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Pons, E.; Lemaitre, C.; Crusset, D.; David, D. [Laboratoire Roberval de Mecanique, UMR 6066 du CNRS, Universite de Technologie de Compiegne, BP 20529, F - 60205 Compiegne cedex (France)

    2004-07-01

    The corrosion of historical objects from World War I fields were studied by using two methods: characterization of the corrosion products by Raman Laser Spectroscopy, and behaviour of the corrosion layers by using electrochemical studies. The first technique, previously used, had shown that two layers are present on these objects, containing both different oxides and oxy-hydroxides of iron. In the present part of the work, the A.C. Impedance Spectroscopy was used to show the differences between the two layers concerning the corrosion of these objects. In order to observe the different behaviours, the specimens were studied in three surface states: with the two layers, with the internal layer only, and without oxide. The results have shown that the internal layer limits the corrosion kinetics. Then this layer was especially studied, particularly its porosity, by a comparison of the impedance results in two media with very different conductivity, and the evolution of these results with different immersion times. The buried objects had the behaviour of a porous electrode, due to the presence of the internal layer. Thus, this behaviour can be modelled with the simplified De Levie's theory, considering that each porosity is a semi-infinite hole. It appeared that the corrosion process at the oxidized interface corresponds to the transport in the electrolyte in the pores completed by a part of transport in the solid phase. These properties can be used to predict the long term corrosion behaviour of carbon steels in soils for long periods. (authors)

  16. Bending Characteristics Change of Long-Period fiber Grating due to Co-doping of Boron for Optical fiber Sensors

    International Nuclear Information System (INIS)

    Moon, Dae Seung; Chung, Young Joo

    2005-01-01

    In long-period fiber grating (LPFG) to be made up optical fiber sensors, resonance coupling occurs between the forward-propagating core mode and cladding modes at the wavelength that satisfy the Phase matching condition. The resonance wavelength and the coupling strength depends strongly on the external environment like temperature, strain, and ambient index. These characteristics can be utilized for various applications as optical fiber sensors. Fabrication of optical fiber gratings is typically based on the photosensitivity effect, i.e. the permanent change of the refractive index upon irradiation of the UV beam, and therefore, fabrication of the optical fiber with high phososensitivity is an important part of the research on optical fiber gratings. In this work, we measured the effort of to-doping of boron on the index difference between the core and cladding of the optical fiber and the sensitivity of the LPFC to the temperature and bending changes. We observed that the index difference between the core and the cladding decreased by (1.69x10 -4 /SCCM) and the temperature sensitivity of the resonance wavelength shirt decreased by (0.01145nm/ .deg. C/SCCM). The dependence or the bending-induced changes or the transmission characteristics of LPFG on the tore-cladding index difference was investigated experimentally. The measurement results indicate that the bending sensitivity increases as the index difference decreases

  17. Long-Period Gratings in Highly Germanium-Doped, Single-Mode Optical Fibers for Sensing Applications

    Science.gov (United States)

    Schlangen, Sebastian; Bremer, Kort; Zheng, Yulong; Böhm, Sebastian; Steinke, Michael; Wellmann, Felix; Neumann, Jörg; Overmeyer, Ludger

    2018-01-01

    Long-period fiber gratings (LPGs) are well known for their sensitivity to external influences, which make them interesting for a large number of sensing applications. For these applications, fibers with a high numerical aperture (i.e., fibers with highly germanium (Ge)-doped fused silica fiber cores) are more attractive since they are intrinsically photosensitive, as well as less sensitive to bend- and microbend-induced light attenuations. In this work, we introduce a novel method to inscribe LPGs into highly Ge-doped, single-mode fibers. By tapering the optical fiber, and thus, tailoring the effective indices of the core and cladding modes, for the first time, an LPG was inscribed into such fibers using the amplitude mask technique and a KrF excimer laser. Based on this novel method, sensitive LPG-based fiber optic sensors only a few millimeters in length can be incorporated in bend-insensitive fibers for use in various monitoring applications. Moreover, by applying the described inscription method, the LPG spectrum can be influenced and tailored according to the specific demands of a particular application. PMID:29702600

  18. Planet hunters. VI. An independent characterization of KOI-351 and several long period planet candidates from the Kepler archival data

    International Nuclear Information System (INIS)

    Schmitt, Joseph R.; Wang, Ji; Fischer, Debra A.; Moriarty, John C.; Boyajian, Tabetha S.; Jek, Kian J.; LaCourse, Daryll; Omohundro, Mark R.; Winarski, Troy; Goodman, Samuel Jon; Jebson, Tony; Schwengeler, Hans Martin; Paterson, David A.; Schwamb, Megan E.; Lintott, Chris; Simpson, Robert; Lynn, Stuart; Smith, Arfon M.; Parrish, Michael; Schawinski, Kevin

    2014-01-01

    We report the discovery of 14 new transiting planet candidates in the Kepler field from the Planet Hunters citizen science program. None of these candidates overlapped with Kepler Objects of Interest (KOIs) at the time of submission. We report the discovery of one more addition to the six planet candidate system around KOI-351, making it the only seven planet candidate system from Kepler. Additionally, KOI-351 bears some resemblance to our own solar system, with the inner five planets ranging from Earth to mini-Neptune radii and the outer planets being gas giants; however, this system is very compact, with all seven planet candidates orbiting ≲ 1 AU from their host star. A Hill stability test and an orbital integration of the system shows that the system is stable. Furthermore, we significantly add to the population of long period transiting planets; periods range from 124 to 904 days, eight of them more than one Earth year long. Seven of these 14 candidates reside in their host star's habitable zone.

  19. Far Ultraviolet Spectroscopy of Three Long Period Nova-Like Variables, V363 Aur, AC Cnc and RZ Gru

    Science.gov (United States)

    Bisol, Alexandra; Sion, E. M.

    2011-01-01

    We have selected three nova-like variables: V363 Aur, RZ Gru and AC Cnc, all of which are UX UMa types, having similar orbital periods well beyond the 3 to 4 hour range where most nova-likes are found. All should have very similar secondary stars given the fact that they their physical parameters are so similar. V363 Aur is a bona fide SW Sex star, and AC Cnc is a probable one, while RZ Gru is not a member of the SW Sex subclass. Our objective is to carry out the first synthetic spectral analysis of far ultraviolet spectra of the three systems using state-of-the-art models both of accretion disks and photospheres. Therefore we shall compare the distances we obtain from the best fitting synthetic spectral models to other distance estimates in the literature. We present model-derived accretion rates and distances for all three systems. The FUV flux range of RZ Gru and V363 Aur is dominated by radiation from an optically thick, steady state, accretion but for AC Cnc, we find that a hot white dwarf accounts for 70% of the FUV flux. We compare the FUV characteristics and physical properties of these three long period nova-like systems to the properties of other nova-likes at shorter periods. This work was supported in part by NSF grant AST0807892 to Villanova University.

  20. Long-Period Gratings in Highly Germanium-Doped, Single-Mode Optical Fibers for Sensing Applications

    Directory of Open Access Journals (Sweden)

    Sebastian Schlangen

    2018-04-01

    Full Text Available Long-period fiber gratings (LPGs are well known for their sensitivity to external influences, which make them interesting for a large number of sensing applications. For these applications, fibers with a high numerical aperture (i.e., fibers with highly germanium (Ge-doped fused silica fiber cores are more attractive since they are intrinsically photosensitive, as well as less sensitive to bend- and microbend-induced light attenuations. In this work, we introduce a novel method to inscribe LPGs into highly Ge-doped, single-mode fibers. By tapering the optical fiber, and thus, tailoring the effective indices of the core and cladding modes, for the first time, an LPG was inscribed into such fibers using the amplitude mask technique and a KrF excimer laser. Based on this novel method, sensitive LPG-based fiber optic sensors only a few millimeters in length can be incorporated in bend-insensitive fibers for use in various monitoring applications. Moreover, by applying the described inscription method, the LPG spectrum can be influenced and tailored according to the specific demands of a particular application.

  1. Long-period variables in the Large Magellanic Cloud. II. Infrared photometry, spectral classification, AGB evolution, and spatial distribution

    International Nuclear Information System (INIS)

    Hughes, S.M.G.; Wood, P.R.

    1990-01-01

    Infrared JHK photometry and visual spectra have been obtained for a large sample of long-period variables (LPVs) in the Large Magellanic Cloud (LMC). Various aspects of the asymptotic giant branch (AGB) evolution of LPVs are discussed using these data. The birth/death rate of LPVs of different ages in the LMC is compared with the birth rates of appropriate samples of planetary nebulas, clump stars, Cepheids, and OH/IR stars. It appears that there are much fewer large-amplitude LPVs per unit galactic stellar mass in the LMC than in the Galaxy. It is suggested that this may be due to the fact that the evolved intermediate-age AGB stars in the LMC often turn into carbon stars, which tend to have smaller pulsation amplitudes than M stars. There is also a major discrepancy between the number of LPVs in the LMC (and in the Galaxy) and the number predicted by the theories of AGB evolution, pulsation, and mass loss. A distance modulus to the LMC of 18.66 + or - 0.05 is derived by comparing the LMC LPVs with P about 200 days with the 47 Tucanae Mira variables in the (K, log P) plane. 64 refs

  2. Modelling carbon steels corrosion during a long period in soils: Contribution of A.C. impedance spectroscopy

    International Nuclear Information System (INIS)

    Pons, E.; Lemaitre, C.; Crusset, D.; David, D.

    2004-01-01

    The corrosion of historical objects from World War I fields were studied by using two methods: characterization of the corrosion products by Raman Laser Spectroscopy, and behaviour of the corrosion layers by using electrochemical studies. The first technique, previously used, had shown that two layers are present on these objects, containing both different oxides and oxy-hydroxides of iron. In the present part of the work, the A.C. Impedance Spectroscopy was used to show the differences between the two layers concerning the corrosion of these objects. In order to observe the different behaviours, the specimens were studied in three surface states: with the two layers, with the internal layer only, and without oxide. The results have shown that the internal layer limits the corrosion kinetics. Then this layer was especially studied, particularly its porosity, by a comparison of the impedance results in two media with very different conductivity, and the evolution of these results with different immersion times. The buried objects had the behaviour of a porous electrode, due to the presence of the internal layer. Thus, this behaviour can be modelled with the simplified De Levie's theory, considering that each porosity is a semi-infinite hole. It appeared that the corrosion process at the oxidized interface corresponds to the transport in the electrolyte in the pores completed by a part of transport in the solid phase. These properties can be used to predict the long term corrosion behaviour of carbon steels in soils for long periods. (authors)

  3. A multiwavelength study of SXP 1062, the long-period X-ray pulsar associated with a supernova remnant

    Science.gov (United States)

    González-Galán, A.; Oskinova, L. M.; Popov, S. B.; Haberl, F.; Kühnel, M.; Gallagher, J.; Schurch, M. P. E.; Guerrero, M. A.

    2018-04-01

    SXP 1062 is a Be X-ray binary (BeXB) located in the Small Magellanic Cloud. It hosts a long-period X-ray pulsar and is likely associated with the supernova remnant MCSNR J0127-7332. In this work we present a multiwavelength view on SXP 1062 in different luminosity regimes. We consider monitoring campaigns in optical (OGLE survey) and X-ray (Swift telescope). During these campaigns a tight coincidence of X-ray and optical outbursts is observed. We interpret this as typical Type I outbursts as often detected in BeXBs at periastron passage of the neutron star (NS). To study different X-ray luminosity regimes in depth, during the source quiescence we observed it with XMM-Newton while Chandra observations followed an X-ray outburst. Nearly simultaneously with Chandra observations in X-rays, in optical the RSS/SALT telescope obtained spectra of SXP 1062. On the basis of our multiwavelength campaign we propose a simple scenario where the disc of the Be star is observed face-on, while the orbit of the NS is inclined with respect to the disc. According to the model of quasi-spherical settling accretion our estimation of the magnetic field of the pulsar in SXP 1062 does not require an extremely strong magnetic field at the present time.

  4. Increasing sensitivity of arc-induced long-period gratings—pushing the fabrication technique toward its limits

    International Nuclear Information System (INIS)

    Smietana, M; Bock, W J; Mikulic, P; Chen, J

    2011-01-01

    This paper presents an investigation of the sensing properties of long-period gratings (LPGs) written with the electric-arc technique in commonly used standard germanium-doped Corning SMF28 and boron co-doped Fibercore PS1250/1500 fibers. In order to increase the sensitivity of the LPGs, we studied and established for each fiber the writing parameters allowing for the coupling of the highest possible order of cladding modes at a resonance wavelength around λ = 1550 nm. The sensitivity of the LPGs to refractive index, to temperature and to hydrostatic pressure was investigated. The experimental results were supported by extensive numerical simulations. Thanks to the well-established and precisely controlled arc-writing process, we were able to reduce the minimum period of the gratings down to 345 and 221 µm, respectively, for LPGs based on the SMF28 and PS1250/1500 fibers. To the best of our knowledge, these are the shortest periods ever achieved for these fibers using the arc-manufacturing technique. The pressure sensitivities of 13 and 220 pm bar −1 are the highest ever measured for LPGs written in the SMF28 and PS1250/1500 fibers, respectively. Moreover, a reduction in the diameters of the SMF28 fiber induced by the arc was found, which significantly affected the distribution of resonances generated by the coupled cladding modes

  5. SDI satellite autonomy using AI and Ada

    Science.gov (United States)

    Fiala, Harvey E.

    1990-01-01

    The use of Artificial Intelligence (AI) and the programming language Ada to help a satellite recover from selected failures that could lead to mission failure are described. An unmanned satellite will have a separate AI subsystem running in parallel with the normal satellite subsystems. A satellite monitoring subsystem (SMS), under the control of a blackboard system, will continuously monitor selected satellite subsystems to become alert to any actual or potential problems. In the case of loss of communications with the earth or the home base, the satellite will go into a survival mode to reestablish communications with the earth. The use of an AI subsystem in this manner would have avoided the tragic loss of the two recent Soviet probes that were sent to investigate the planet Mars and its moons. The blackboard system works in conjunction with an SMS and a reconfiguration control subsystem (RCS). It can be shown to be an effective way for one central control subsystem to monitor and coordinate the activities and loads of many interacting subsystems that may or may not contain redundant and/or fault-tolerant elements. The blackboard system will be coded in Ada using tools such as the ABLE development system and the Ada Production system.

  6. Monitoring severe accidents using AI techniques

    International Nuclear Information System (INIS)

    No, Young Gyu; Ahn, Kwang Il; Kim, Ju Hyun; Na, Man Gyun; Lim, Dong Hyuk

    2012-01-01

    After the Fukushima nuclear accident in 2011, there has been increasing concern regarding severe accidents in nuclear facilities. Severe accident scenarios are difficult for operators to monitor and identify. Therefore, accurate prediction of a severe accident is important in order to manage it appropriately in the unfavorable conditions. In this study, artificial intelligence (AI) techniques, such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH), and fuzzy neural network (FNN), were used to monitor the major transient scenarios of a severe accident caused by three different initiating events, the hot-leg loss of coolant accident (LOCA), the cold-leg LOCA, and the steam generator tube rupture in pressurized water reactors (PWRs). The SVC and PNN models were used for the event classification. The GMDH and FNN models were employed to accurately predict the important timing representing severe accident scenarios. In addition, in order to verify the proposed algorithm, data from a number of numerical simulations were required in order to train the AI techniques due to the shortage of real LOCA data. The data was acquired by performing simulations using the MAAP4 code. The prediction accuracy of the three types of initiating events was sufficiently high to predict severe accident scenarios. Therefore, the AI techniques can be applied successfully in the identification and monitoring of severe accident scenarios in real PWRs.

  7. Monitoring severe accidents using AI techniques

    Energy Technology Data Exchange (ETDEWEB)

    No, Young Gyu; Ahn, Kwang Il [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Kim, Ju Hyun; Na, Man Gyun [Dept. of Nuclear Engineering, Chosun University, Gwangju (Korea, Republic of); Lim, Dong Hyuk [Korea Institute of Nuclear Nonproliferation and Control, Daejon (Korea, Republic of)

    2012-05-15

    After the Fukushima nuclear accident in 2011, there has been increasing concern regarding severe accidents in nuclear facilities. Severe accident scenarios are difficult for operators to monitor and identify. Therefore, accurate prediction of a severe accident is important in order to manage it appropriately in the unfavorable conditions. In this study, artificial intelligence (AI) techniques, such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH), and fuzzy neural network (FNN), were used to monitor the major transient scenarios of a severe accident caused by three different initiating events, the hot-leg loss of coolant accident (LOCA), the cold-leg LOCA, and the steam generator tube rupture in pressurized water reactors (PWRs). The SVC and PNN models were used for the event classification. The GMDH and FNN models were employed to accurately predict the important timing representing severe accident scenarios. In addition, in order to verify the proposed algorithm, data from a number of numerical simulations were required in order to train the AI techniques due to the shortage of real LOCA data. The data was acquired by performing simulations using the MAAP4 code. The prediction accuracy of the three types of initiating events was sufficiently high to predict severe accident scenarios. Therefore, the AI techniques can be applied successfully in the identification and monitoring of severe accident scenarios in real PWRs.

  8. Why Don't Accounting Students like AIS?

    Science.gov (United States)

    Vatanasakdakul, Savanid; Aoun, Chadi

    2011-01-01

    Purpose: The demand for Accounting Information Systems (AIS) knowledge has increased exponentially over the past two decades, but studying AIS has not proved easy for many accounting students. The aim of the study is to understand the challenges accounting students face in studying AIS through investigation of the factors which may be contributing…

  9. Dicty_cDB: FC-AI04 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI04 (Link to dictyBase) - - - Contig-U15121-1 FC-AI04E (Li...nk to Original site) - - - - - - FC-AI04E 772 Show FC-AI04 Library FC (Link to library) Clone ID FC-AI04 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI04Q.Seq.d/ Representative seq. ID FC-AI...04E (Link to Original site) Representative DNA sequence >FC-AI04 (FC-AI04Q) /CSM/FC/FC-AI/FC-AI04Q.Seq....qvnkhqqvvtktvsd vlvphqvhnqvfphipqqmtlvnkhqpvvtktvsdvlvphqvhnqvfphtpqlkiqvylq vfqvvvvtiisai

  10. Dicty_cDB: FC-AI10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI10 (Link to dictyBase) - - - Contig-U16270-1 FC-AI10F (Li...nk to Original site) FC-AI10F 405 - - - - - - Show FC-AI10 Library FC (Link to library) Clone ID FC-AI10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI10Q.Seq.d/ Representative seq. ID FC-AI...10F (Link to Original site) Representative DNA sequence >FC-AI10 (FC-AI10Q) /CSM/FC/FC-AI/FC-AI10Q.Seq.... sequence RKKRKSDYTSFSTYIHKLLKQITPPTNAKSNEKGDRKFTISSKAMSVMNSFVHDIFDRIA TEASGLAKKKKRQTLHSRDIQVAVRIILTGELAXHAI

  11. Dicty_cDB: FC-AI23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI23 (Link to dictyBase) - - - Contig-U15308-1 FC-AI23Z (Li...nk to Original site) - - FC-AI23Z 603 - - - - Show FC-AI23 Library FC (Link to library) Clone ID FC-AI23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI23Q.Seq.d/ Representative seq. ID FC-AI...23Z (Link to Original site) Representative DNA sequence >FC-AI23 (FC-AI23Q) /CSM/FC/FC-AI/FC-AI23Q.Seq....LNTLAKKNEQVVEGEILAKQLTGVTAEELSEFKACFSHFDKDN DNKLNRLEFSSCLKSIGDELTEEQLNQVISKIDTDGNGTISFEEFIDYMVSSRKGTDSVE STKAAFKVMAEDKDFITEAQIRAAI

  12. Dicty_cDB: FC-AI05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI05 (Link to dictyBase) - - - Contig-U15516-1 FC-AI05E (Li...nk to Original site) - - - - - - FC-AI05E 1189 Show FC-AI05 Library FC (Link to library) Clone ID FC-AI05 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI05Q.Seq.d/ Representative seq. ID FC-AI...05E (Link to Original site) Representative DNA sequence >FC-AI05 (FC-AI05Q) /CSM/FC/FC-AI/FC-AI05Q.Seq...KIVGEASLKNKGKMSRVLAAKAALSARFD ALCEVSDTSYGIAYKGAVDRRAAAIEGREVRKSLNAVKPEKSGNVAKYDHTKSATTNTTR DVATKSSKESSIKQEKQ

  13. Dicty_cDB: FC-AI21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI21 (Link to dictyBase) - - - Contig-U16254-1 FC-AI21Z (Li...nk to Original site) - - FC-AI21Z 696 - - - - Show FC-AI21 Library FC (Link to library) Clone ID FC-AI21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI21Q.Seq.d/ Representative seq. ID FC-AI...21Z (Link to Original site) Representative DNA sequence >FC-AI21 (FC-AI21Q) /CSM/FC/FC-AI/FC-AI21Q.Seq....YPGYMYTDLSTIYERAGRIQGRNGSITQI PILTMPNDDITHPIPDLTGYITEGQIFIDRQINNRQIYPPINVLPSLSRLMKSAI

  14. Long-Period Fiber Grating Sensors for the Measurement of Liquid Level and Fluid-Flow Velocity

    Science.gov (United States)

    Wang, Jian-Neng; Luo, Ching-Ying

    2012-01-01

    This paper presents the development and assessment of two types of Long Period Fiber Grating (LPFG)-based sensors including a mobile liquid level sensor and a reflective sensor for the measurement of liquid level and fluid-flow velocity. Shewhart control charts were used to assess the liquid level sensing capacity and reliability of the mobile CO2-laser engraved LPFG sensor. There were ten groups of different liquid level experiment and each group underwent ten repeated wavelength shift measurements. The results showed that all measurands were within the control limits; thus, this mobile sensor was reliable and exhibited at least 100-cm liquid level measurement capacity. In addition, a reflective sensor consisting of five LPFGs in series with a reflective end has been developed to evaluate the liquid level and fluid-flow velocity. These five LPFGs were fabricated by the electrical arc discharge method and the reflective end was coated with silver by Tollen's test. After each liquid level experiment was performed five times, the average values of the resonance wavelength shifts for LPFG Nos. 1–5 were in the range of 1.35–9.14 nm. The experimental findings showed that the reflective sensor could be used to automatically monitor five fixed liquid levels. This reflective sensor also exhibited at least 100-cm liquid level measurement capacity. The mechanism of the fluid-flow velocity sensor was based on analyzing the relationship among the optical power, time, and the LPFG's length. There were two types of fluid-flow velocity measurements: inflow and drainage processes. The differences between the LPFG-based fluid-flow velocities and the measured average fluid-flow velocities were found in the range of 8.7–12.6%. For the first time to our knowledge, we have demonstrated the feasibility of liquid level and fluid-flow velocity sensing with a reflective LPFG-based sensor without modifying LPFGs or coating chemical compounds. PMID:22666046

  15. Long-period fiber grating sensors for the measurement of liquid level and fluid-flow velocity.

    Science.gov (United States)

    Wang, Jian-Neng; Luo, Ching-Ying

    2012-01-01

    This paper presents the development and assessment of two types of Long Period Fiber Grating (LPFG)-based sensors including a mobile liquid level sensor and a reflective sensor for the measurement of liquid level and fluid-flow velocity. Shewhart control charts were used to assess the liquid level sensing capacity and reliability of the mobile CO(2)-laser engraved LPFG sensor. There were ten groups of different liquid level experiment and each group underwent ten repeated wavelength shift measurements. The results showed that all measurands were within the control limits; thus, this mobile sensor was reliable and exhibited at least 100-cm liquid level measurement capacity. In addition, a reflective sensor consisting of five LPFGs in series with a reflective end has been developed to evaluate the liquid level and fluid-flow velocity. These five LPFGs were fabricated by the electrical arc discharge method and the reflective end was coated with silver by Tollen's test. After each liquid level experiment was performed five times, the average values of the resonance wavelength shifts for LPFG Nos. 1-5 were in the range of 1.35-9.14 nm. The experimental findings showed that the reflective sensor could be used to automatically monitor five fixed liquid levels. This reflective sensor also exhibited at least 100-cm liquid level measurement capacity. The mechanism of the fluid-flow velocity sensor was based on analyzing the relationship among the optical power, time, and the LPFG's length. There were two types of fluid-flow velocity measurements: inflow and drainage processes. The differences between the LPFG-based fluid-flow velocities and the measured average fluid-flow velocities were found in the range of 8.7-12.6%. For the first time to our knowledge, we have demonstrated the feasibility of liquid level and fluid-flow velocity sensing with a reflective LPFG-based sensor without modifying LPFGs or coating chemical compounds.

  16. The Secret Lives of Cepheids: Evolution, Mass-Loss, and Ultraviolet Emission of the Long-period Classical Cepheid

    Science.gov (United States)

    Neilson, Hilding R.; Engle, Scott G.; Guinan, Edward F.; Bisol, Alexandra C.; Butterworth, Neil

    2016-06-01

    The classical Cepheid l Carinae is an essential calibrator of the Cepheid Leavitt Law as a rare long-period Galactic Cepheid. Understanding the properties of this star will also constrain the physics and evolution of massive (M ≥ 8 M ⊙) Cepheids. The challenge, however, is precisely measuring the star's pulsation period and its rate of period change. The former is important for calibrating the Leavitt Law and the latter for stellar evolution modeling. In this work, we combine previous time-series observations spanning more than a century with new observations to remeasure the pulsation period and compute the rate of period change. We compare our new rate of period change with stellar evolution models to measure the properties of l Car, but find models and observations are, at best, marginally consistent. The results imply that l Car does not have significantly enhanced mass-loss rates like that measured for δ Cephei. We find that the mass of l Car is about 8-10 M ⊙. We present Hubble Space Telescope Cosmic Origins Spectrograph observations that also differ from measurements for δ Cep and β Dor. These measurements further add to the challenge of understanding the physics of Cepheids, but do hint at the possible relation between enhanced mass-loss and ultraviolet emission, perhaps both due to the strength of shocks propagating in the atmospheres of Cepheids. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555. These observations are associated with program #13019. This work is also based on observations obtained with XMM-Newton, an ESA science mission with instruments and contributions directly funded by ESA Member States and the USA (NASA), associated with program #060374.

  17. A CAUTIONARY TALE: MARVELS BROWN DWARF CANDIDATE REVEALS ITSELF TO BE A VERY LONG PERIOD, HIGHLY ECCENTRIC SPECTROSCOPIC STELLAR BINARY

    International Nuclear Information System (INIS)

    Mack, Claude E. III; Stassun, Keivan G.; De Lee, Nathan; Ge, Jian; Fleming, Scott W.; Deshpande, Rohit; Mahadevan, Suvrath; Wisniewski, John P.; Gaudi, B. Scott; Eastman, Jason; Beatty, Thomas G.; Ghezzi, Luan; González Hernández, Jonay I.; Femenía, Bruno; Mata Sánchez, Daniel; Ferreira, Letícia; Porto de Mello, Gustavo; Crepp, Justin R.; Agol, Eric; Bizyaev, Dmitry

    2013-01-01

    We report the discovery of a highly eccentric, double-lined spectroscopic binary star system (TYC 3010-1494-1), comprising two solar-type stars that we had initially identified as a single star with a brown dwarf companion. At the moderate resolving power of the MARVELS spectrograph and the spectrographs used for subsequent radial-velocity (RV) measurements (R ∼ Jup ) to a solar-type primary. At least three properties of this system allow it to masquerade as a single star with a very-low-mass companion: its large eccentricity (e ∼ 0.8), its relatively long period (P ∼ 238 days), and the approximately perpendicular orientation of the semi-major axis with respect to the line of sight (ω ∼ 189°). As a result of these properties, for ∼95% of the orbit the two sets of stellar spectral lines are completely blended, and the RV measurements based on centroiding on the apparently single-lined spectrum is very well fit by an orbit solution indicative of a brown dwarf companion on a more circular orbit (e ∼ 0.3). Only during the ∼5% of the orbit near periastron passage does the true, double-lined nature and large RV amplitude of ∼15 km s –1 reveal itself. The discovery of this binary system is an important lesson for RV surveys searching for substellar companions; at a given resolution and observing cadence, a survey will be susceptible to these kinds of astrophysical false positives for a range of orbital parameters. Finally, for surveys like MARVELS that lack the resolution for a useful line bisector analysis, it is imperative to monitor the peak of the cross-correlation function for suspicious changes in width or shape, so that such false positives can be flagged during the candidate vetting process.

  18. A glucose concentration and temperature sensor based on long period fiber gratings induced by electric-arc discharge

    Science.gov (United States)

    Du, Chao; Wang, Qi

    2017-10-01

    As one of the key parameters in biological and chemical reactions, glucose concentration objectively reflects the characteristics of reactions, so the real-time monitoring of glucose concentration is important in the field of biochemical. Meanwhile, the influence from temperature should be considered. The fiber sensors have been studied extensively for decades due to the advantages of small size, immunity to electromagnetic interference and high sensitivity, which are suitable for the application of biochemical sensing. A long period fiber grating (LPFG) sensor induced by electric-arc discharge has been fabricated and demonstrated for simultaneous measurement of glucose concentration and temperature. The proposed sensor was fabricated by inscribing a sing mode fiber (SMF) with periodic electric-arc discharge technology. During the fabrication process, the electric-arc discharge technology was produced by a commercial fusion splicer, and the period of inscribed LPFG was determined by the movement of translation stages. A serials of periodic geometrical deformations would be formed in SMF after the fabrication, and the discharge intensity and discharge time can be adjusted though the fusion splicer settings screen. The core mode can be coupled into the cladding modes at certain wavelength when they satisfy the phase-matching conditions, and there will be several resonance dips in the transmission spectrum in LPFG. The resonance dips formed by the coupling between cladding modes and core mode have different sensitivity responses, so the simultaneous measurement for multi-parameter can be realized by monitoring the wavelength shifts of the resonance dips. Compared with the LPFG based on conventional SMF, the glucose concentration sensitivity has been obviously enhanced by etching the cladding with hydrofluoric acid solution. Based on the independent measured results, a dual-parameter measurement matrix has been built for signal demodulation. Because of the easy

  19. Nanofilm-coated long-period fiber grating humidity sensors for corrosion detection in structural health monitoring

    Science.gov (United States)

    Zheng, Shijie; Zhu, Yinian; Krishnaswamy, Sridhar

    2011-04-01

    Long-period gratings (LPGs) have shown their significant promising applications in sensors owing to the attractive features that they posses such as small size, immunity for electromagnetic interference, geometric versatility, multiplexing capability, and resistance to corrosive and hazardous environments. Recent researches have revealed that LPGs written on the standard optical fibers could be used as a powerful sensing platform for structural health monitoring. In this work, we inscribe LPGs into SMF-28 optical fiber by focused-beam CO2 laser, demonstrating as a refractive index sensor for nondestructive chemical detections in the civil infrastructures. Although evanescent-field based LPG sensors have been applied in quantitatively monitoring chemical analytes including moisture, chloride, and corrosion by-product, etc., the sensitivity, selectivity, and response time as well as thermo-stability of such sensors are still the issues for some special purposes. In order to improve those characteristics of the sensors, we propose two types of nano-film to be coated in grating region by electrostatic self-assembly (ESA) deposition processing. The primary coating does not affect on LPG transmission parameters such as resonance wavelength and its intensity that can be used for sensing, but it increases the sensitivity to refractive index change of surrounding material. The secondary coating is for selectively absorption of analyte molecule of interest. Response time of the nanofilm-coated LPG sensor is dependent on the analyte absorption and de-absorption rates as well as the thicknesses of the coating materials, which is also investigated. Multi-channel sensor system is being designed to monitor different analytes simultaneously, which is continuing to further explore the monitoring of structural health conditions through in situ measurements of corrosion in the concrete structures.

  20. AusLAMP long period magnetotellurics: progress update and new insights into Victorian geology and mineral prospectivity

    Science.gov (United States)

    Chopping, R. G.; Duan, J.; Czarnota, K.; Kemp, T.

    2016-12-01

    It is becoming generally accepted that world-class mineral deposits have a footprint on a scale of the lithosphere. For this reason, Australia has embarked on the Australian Lithospheric Architecture Magnetotelluric Project (AusLAMP) to map the conductivity of the mid to lower crust and the lithospheric mantle. AusLAMP is a collaborative project between Geoscience Australia, State and Territory Geological Surveys and Universities. The project aims to collect long-period magnetotelluric data across the Australian continent on a nominal 0.5x0.5° ( 55x55 km) grid. To date, more than 450 sites have been acquired including all sites for the state of Victoria, two-thirds of sites in South Australia and Tasmania, and approximately 25 stations in Western Australia. Progress is ramping up with acquisition to turn to the state of New South Wales, the remainder of South Australia and also acquisition in northern Australia. To support this increasing acquisition activity, additional instruments have been purchased to add to those already in Australia. 3D inversion results are now available for AusLAMP Victoria. In collaboration with the National Computational Infrastructure (NCI), the 3D ModEM codes were optimised for use on the NCI's supercomputer, speeding up large-scale inversions by an order of magnitude. The results of these inversions indicate anomalously conductive lithospheric mantle associated with the central region of Victoria which contains significant mineral deposits and prospectivity, and also anomalous resistive lithosphere associated with the southern extension of the dynamically supported Australian Alps and the Newer Volcanics Province. Modelled conductivities are also consistent with mantle xenolith data from central Victoria. Within the crust, the dominant trend of the data is along elongate north-eastern corridors of conductive material. These results shed new questions on the geological history of this region and the lithospheric architecture of the

  1. The correspondence between dayside long-period geomagnetic pulsations and the open-closed field line boundary

    Science.gov (United States)

    Pilipenko, V. A.; Kozyreva, O. V.; Lorentzen, D. A.; Baddeley, L. J.

    2018-05-01

    Long-period pulsations in the nominal Pc5-6 band (periods about 3-15 min) have been known to be a persistent feature of dayside high latitudes. A mixture of broadband Irregular Pulsations at Cusp Latitudes (IPCL) and narrowband P≿5 waves is often observed. The mechanism and origin of IPCL have not been firmly established yet. Magnetopause surface eigenmodes were suggested as a potential source of high-latitude ULF waves with frequencies less than 2 mHz. A ground response to these modes is expected to be beneath the ionospheric projection of the open-closed field line boundary (OCB). To unambiguously resolve a possible association of IPCL with the magnetopause surface modes, multi-instrument observation data from Svalbard have been analyzed. We examine the latitudinal structure of high-latitude pulsations in the Pc5-6 band recorded by magnetometers covering near-cusp latitudes. This structure is compared with an instant location of the equatorward boundary of the cusp aurora, assumed to be a proxy of the OCB. The optical OCB latitude has been identified by an automatic algorithm, using data from the meridian scanning photometer at Longyearbyen, Svalbard. The comparison has shown that the latitudinal maximum of the broadband IPCL maximizes about 2°-3° deeper in the magnetosphere than the OCB optical proxy. Therefore, these pulsations cannot be associated with the ground image of the magnetopause surface modes. It is likely that an essentially non-dipole geometry of field lines and a high variability of the magnetopause region may suppress the excitation efficiency. The obtained result imposes important limitations on possible mechanisms of high-latitude dayside ULF variations.

  2. [Spectral analysis of fiber bragg grating modulated by double long period grating and its application in smart structure monitoring].

    Science.gov (United States)

    Lu, Ji-Yun; Liang, Da-Kai; Zhang, Xiao-Li; Zhu, Zhu

    2009-12-01

    Spectrum of fiber bragg grating (FBG) sensor modulated by double long period grating (LPFG) is proposed in the paper. Double LPFG consists of two LPFGS whose center wavelengths are the same and reflection spectrum of FBG sensor is located in linear range of double LPFG transmission spectrum. Based on spectral analysis of FBG and double LPFG, reflection spectrum of FBG modulated by double LPFG is obtained and studied by use of band-hider filter characteristics for double LPFG. An FBG sensor is attached on the surface of thin steel beam, which is strained by bending, and the center wavelength of FBG sensor will shift. The spectral peak of FBG sensor modulated by double LPFG is changed correspondingly, and the spectral change will lead to variation in exit light intensity from double LPFG. Experiment demonstrates that the relation of filtering light intensity from double LPFG monitored by optical power meter to center wavelength change of FBG sensor is linear and the minimum strain of material (steel beam) detected by the modulation and demodulation system is 1.05 microepsilon. This solution is used in impact monitoring of optical fibre smart structure, and FBG sensor is applied for impulse response signal monitoring induced by low-velocity impact, when impact pendulum is loaded to carbon fiber-reinforced plastics (CFP). The acquired impact response signal and fast Fourier transform of the signal detected by FBG sensor agree with the measurement results of eddy current displacement meter attached to the FBG sensor. From the results, the present method using FBG sensor is found to be effective for monitoring the impact. The research provides a practical reference in dynamic monitoring of optical fiber smart structure field.

  3. Long periods (1 -10 mHz) geomagnetic pulsations variation with solar cycle in South Atlantic Magnetic Anomaly

    Science.gov (United States)

    Rigon Silva, Willian; Schuch, Nelson Jorge; Guimarães Dutra, Severino Luiz; Babulal Trivedi, Nalin; Claudir da Silva, Andirlei; Souza Savian, Fernando; Ronan Coelho Stekel, Tardelli; de Siqueira, Josemar; Espindola Antunes, Cassio

    The occurrence and intensity of the geomagnetic pulsations Pc-5 (2-7 mHz) and its relationship with the solar cycle in the South Atlantic Magnetic Anomaly -SAMA is presented. The study of geomagnetic pulsations is important to help the understanding of the physical processes that occurs in the magnetosphere region and help to predict geomagnetic storms. The fluxgate mag-netometers H, D and Z, three axis geomagnetic field data from the Southern Space Observatory -SSO/CRS/INPE -MCT, São Martinho da Serra (29.42° S, 53.87° W, 480m a.s.l.), RS, Brasil, a were analyzed and correlated with the solar wind parameters (speed, density and temperature) from the ACE and SOHO satellites. A digital filtering to enhance the 2-7 mHz geomagnetic pulsations was used. Five quiet days and five perturbed days in the solar minimum and in the solar maximum were selected for this analysis. The days were chosen based on the IAGA definition and on the Bartels Musical Diagrams (Kp index) for 2001 (solar maximum) and 2008 (solar minimum). The biggest Pc-5 amplitude averages differences between the H-component is 78,35 nT for the perturbed days and 1,60nT for the quiet days during the solar maximum. For perturbed days the average amplitude during the solar minimum is 8,32 nT, confirming a direct solar cycle influence in the geomagnetic pulsations intensity for long periods.

  4. Physical and chemical properties of MgO ceramics treated in molten K2SO4 for a long period

    International Nuclear Information System (INIS)

    Iwasa, Mikio; Kose, Saburo; Korenaga, Sadayoshi; Furukawa, Mitsuhiko.

    1978-01-01

    The wall materials of MHD power generating channel are exposed to thermally, physically and chemically severe conditions, so that they have to withstand great damages, especially the attack of seed materials. Several kinds of ceramics proposed as the wall materials have been tested in the simulated MHD environment. In this paper, MgO ceramics were treated in molten K 2 SO 4 , a typical seed material, and the changes in their physical and chemical properties were investigated in comparison with those of Al 2 O 3 ceramics. four kinds of MgO ceramics, three sintered and one electric fused, were immersed in molten K 2 SO 4 at 1300 0 C for the periods up to 1000 h, and weight, volume, surface roughness, bending strength and hardness were measured. The changes in the microstructures and chemical compositions due to the K 2 SO 4 treatment were also investigated. MgO ceramics were attacked by molten K 2 SO 4 only at the grain boundaries on the surface, in contrast at Al 2 O 3 ceramics which were severely damaged to form β-Al 2 O 3 . It was found that SiO 2 and CaO in the grain boundaries had played important roles to the attack of K 2 SO 4 . Generally, the changes in the properties of MgO ceramics by the K 2 SO 4 treatment were very small compared with those of Al 2 O 3 ceramics. It was concluded that MgO ceramics are more stable than Al 2 O 3 ceramics in molten K 2 SO 4 and their properties do not show substantial drops for long periods. (author)

  5. Cervical Proprioception in a Young Population Who Spend Long Periods on Mobile Devices: A 2-Group Comparative Observational Study.

    Science.gov (United States)

    Portelli, Andrew; Reid, Susan A

    2018-02-01

    The purpose of this study was to evaluate if young people with insidious-onset neck pain who spend long periods on mobile electronic devices (known as "text neck") have impaired cervical proprioception and if this is related to time on devices. A 2-group comparative observational study was conducted at an Australian university. Twenty-two participants with text neck and 22 asymptomatic controls, all of whom were 18 to 35 years old and spent ≥4 hours per day on unsupported electronic devices, were assessed using the head repositioning accuracy (HRA) test. Differences between groups were calculated using independent sample t-tests, and correlations between neck pain intensity, time on devices, and HRA test were performed using Pearson's bivariate analysis. During cervical flexion, those with text neck (n = 22, mean age ± standard deviation [SD]: 21 ± 4 years, 59% female) had a 3.9° (SD: 1.4°) repositioning error, and the control group (n = 22, 20 ± 1 years, 68% female) had a 2.9° (SD: 1.2°) error. The mean difference was 1° (95% confidence interval: 0-2, P = .02). For other cervical movements, there was no difference between groups. There was a moderately significant correlation (P ≤ .05) between time spent on electronic devices and cervical pain intensity and between cervical pain intensity and HRA during flexion. The participants with text neck had a greater proprioceptive error during cervical flexion compared with controls. This could be related to neck pain and time spent on electronic devices. Copyright © 2018. Published by Elsevier Inc.

  6. Dicty_cDB: FC-AI01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI01 (Link to dictyBase) - - - Contig-U15592-1 FC-AI01E (Li...nk to Original site) - - - - - - FC-AI01E 307 Show FC-AI01 Library FC (Link to library) Clone ID FC-AI01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI01Q.Seq.d/ Representative seq. ID FC-AI...01E (Link to Original site) Representative DNA sequence >FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq....uences producing significant alignments: (bits) Value FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq.d/ 68 8e

  7. Dicty_cDB: FC-AI13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI13 (Link to dictyBase) - - - Contig-U16263-1 FC-AI13F (Li...nk to Original site) FC-AI13F 507 - - - - - - Show FC-AI13 Library FC (Link to library) Clone ID FC-AI13 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI13Q.Seq.d/ Representative seq. ID FC-AI...13F (Link to Original site) Representative DNA sequence >FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq....nificant alignments: (bits) Value FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq.d/ 963 0.0 VSA730 (VSA730Q)

  8. Developing Pokemon AI For Finding Comfortable Settings

    OpenAIRE

    Panumate, Chetprayoon; Iida, Hiroyuki

    2016-01-01

    This paper explores an innovative way to find a comfortable setting of video games. Pokemon is chosen as benchmark and game refinement measure is employed for the assessment. The number of Pokemon that one trainer can carry (i.e., setting with n=6) has never been changed after the first episode of Pokemon was released in 1996. Pokemon battle is simulated and various AIs are developed for the experiments. The results show that the original setting is the best for many players of various levels.

  9. Long-Period Fiber Grating Sensors for the Measurement of Liquid Level and Fluid-Flow Velocity

    Directory of Open Access Journals (Sweden)

    Jian-Neng Wang

    2012-04-01

    Full Text Available This paper presents the development and assessment of two types of Long Period Fiber Grating (LPFG-based sensors including a mobile liquid level sensor and a reflective sensor for the measurement of liquid level and fluid-flow velocity. Shewhart control charts were used to assess the liquid level sensing capacity and reliability of the mobile CO2-laser engraved LPFG sensor. There were ten groups of different liquid level experiment and each group underwent ten repeated wavelength shift measurements. The results showed that all measurands were within the control limits; thus, this mobile sensor was reliable and exhibited at least 100-cm liquid level measurement capacity. In addition, a reflective sensor consisting of five LPFGs in series with a reflective end has been developed to evaluate the liquid level and fluid-flow velocity. These five LPFGs were fabricated by the electrical arc discharge method and the reflective end was coated with silver by Tollen’s test. After each liquid level experiment was performed five times, the average values of the resonance wavelength shifts for LPFG Nos. 1–5 were in the range of 1.35–9.14 nm. The experimental findings showed that the reflective sensor could be used to automatically monitor five fixed liquid levels. This reflective sensor also exhibited at least 100-cm liquid level measurement capacity. The mechanism of the fluid-flow velocity sensor was based on analyzing the relationship among the optical power, time, and the LPFG’s length. There were two types of fluid-flow velocity measurements: inflow and drainage processes. The differences between the LPFG-based fluid-flow velocities and the measured average fluid-flow velocities were found in the range of 8.7–12.6%. For the first time to our knowledge, we have demonstrated the feasibility of liquid level and fluid-flow velocity sensing with a reflective LPFG-based sensor without modifying LPFGs or coating chemical compounds.

  10. A CAUTIONARY TALE: MARVELS BROWN DWARF CANDIDATE REVEALS ITSELF TO BE A VERY LONG PERIOD, HIGHLY ECCENTRIC SPECTROSCOPIC STELLAR BINARY

    Energy Technology Data Exchange (ETDEWEB)

    Mack, Claude E. III; Stassun, Keivan G.; De Lee, Nathan [Department of Physics and Astronomy, Vanderbilt University, Nashville, TN 37235 (United States); Ge, Jian; Fleming, Scott W. [Department of Astronomy, University of Florida, 211 Bryant Space Science Center, Gainesville, FL, 32611-2055 (United States); Deshpande, Rohit; Mahadevan, Suvrath [Department of Astronomy and Astrophysics, The Pennsylvania State University, 525 Davey Laboratory, University Park, PA 16802 (United States); Wisniewski, John P. [Homer L Dodge Department of Physics and Astronomy, University of Oklahoma, 440 W Brooks St, Norman, OK 73019 (United States); Gaudi, B. Scott; Eastman, Jason; Beatty, Thomas G. [Department of Astronomy, The Ohio State University, 140 West 18th Avenue, Columbus, OH 43210 (United States); Ghezzi, Luan [Observatorio Nacional, Rua Gal. Jose Cristino 77, Rio de Janeiro, RJ 20921-400 (Brazil); Gonzalez Hernandez, Jonay I.; Femenia, Bruno; Mata Sanchez, Daniel [Instituto de Astrofisica de Canarias (IAC), E-38205 La Laguna, Tenerife (Spain); Ferreira, Leticia; Porto de Mello, Gustavo [Laboratorio Interinstitucional de e-Astronomia-LIneA, Rua Gal. Jose Cristino 77, Rio de Janeiro, RJ 20921-400 (Brazil); Crepp, Justin R. [Department of Physics, University of Notre Dame, 225 Nieuwland Science Hall, Notre Dame, IN 46556 (United States); Agol, Eric [Astronomy Department, University of Washington, Box 351580, Seattle, WA 98195 (United States); Bizyaev, Dmitry, E-mail: claude.e.mack@vanderbilt.edu [Apache Point Observatory, P.O. Box 59, Sunspot, NM 88349-0059 (United States); and others

    2013-05-15

    We report the discovery of a highly eccentric, double-lined spectroscopic binary star system (TYC 3010-1494-1), comprising two solar-type stars that we had initially identified as a single star with a brown dwarf companion. At the moderate resolving power of the MARVELS spectrograph and the spectrographs used for subsequent radial-velocity (RV) measurements (R {approx}< 30, 000), this particular stellar binary mimics a single-lined binary with an RV signal that would be induced by a brown dwarf companion (Msin i {approx} 50 M{sub Jup}) to a solar-type primary. At least three properties of this system allow it to masquerade as a single star with a very-low-mass companion: its large eccentricity (e {approx} 0.8), its relatively long period (P {approx} 238 days), and the approximately perpendicular orientation of the semi-major axis with respect to the line of sight ({omega} {approx} 189 Degree-Sign ). As a result of these properties, for {approx}95% of the orbit the two sets of stellar spectral lines are completely blended, and the RV measurements based on centroiding on the apparently single-lined spectrum is very well fit by an orbit solution indicative of a brown dwarf companion on a more circular orbit (e {approx} 0.3). Only during the {approx}5% of the orbit near periastron passage does the true, double-lined nature and large RV amplitude of {approx}15 km s{sup -1} reveal itself. The discovery of this binary system is an important lesson for RV surveys searching for substellar companions; at a given resolution and observing cadence, a survey will be susceptible to these kinds of astrophysical false positives for a range of orbital parameters. Finally, for surveys like MARVELS that lack the resolution for a useful line bisector analysis, it is imperative to monitor the peak of the cross-correlation function for suspicious changes in width or shape, so that such false positives can be flagged during the candidate vetting process.

  11. AI techniques in geomagnetic storm forecasting

    Science.gov (United States)

    Lundstedt, Henrik

    This review deals with how geomagnetic storms can be predicted with the use of Artificial Intelligence (AI) techniques. Today many different Al techniques have been developed, such as symbolic systems (expert and fuzzy systems) and connectionism systems (neural networks). Even integrations of AI techniques exist, so called Intelligent Hybrid Systems (IHS). These systems are capable of learning the mathematical functions underlying the operation of non-linear dynamic systems and also to explain the knowledge they have learned. Very few such powerful systems exist at present. Two such examples are the Magnetospheric Specification Forecast Model of Rice University and the Lund Space Weather Model of Lund University. Various attempts to predict geomagnetic storms on long to short-term are reviewed in this article. Predictions of a month to days ahead most often use solar data as input. The first SOHO data are now available. Due to the high temporal and spatial resolution new solar physics have been revealed. These SOHO data might lead to a breakthrough in these predictions. Predictions hours ahead and shorter rely on real-time solar wind data. WIND gives us real-time data for only part of the day. However, with the launch of the ACE spacecraft in 1997, real-time data during 24 hours will be available. That might lead to the second breakthrough for predictions of geomagnetic storms.

  12. Dissecting phenotypic variation among AIS patients

    International Nuclear Information System (INIS)

    Wang Minghua; Wang Jiucun; Zhang Zhen; Zhao Zhimin; Zhang Rongmei; Hu Xiaohua; Tan Tao; Luo Shijing; Luo Zewei

    2005-01-01

    We have created genital skin fibroblast cell lines directly from three patients in a Chinese family affected by androgen insensitivity syndrome (AIS). All patients in the family share an identical AR Arg 840 Cys mutant but show different disease phenotypes. By using the cell lines, we find that the mutation has not influenced a normal androgen-binding capacity at 37 deg C but has reduced the affinity for androgens and may cause thermolability of the androgen-receptor complex. The impaired nuclear trafficking of the androgen receptor in the cell lines is highly correlated with the severity of donors' disease phenotype. The transactivity of the mutant is substantially weakened and the extent of the reduced transactivity reflects severity of the donors' disease symptom. Our data reveal that although etiology of AIS is monogenic and the mutant may alter the major biological functions of its wild allele, the function of the mutant AR can also be influenced by the different genetic backgrounds and thus explains the divergent disease phenotypes

  13. Monitoring Severe Accidents Using AI Techniques

    International Nuclear Information System (INIS)

    No, Young Gyu; Kim, Ju Hyun; Na, Man Gyun; Ahn, Kwang Il

    2011-01-01

    It is very difficult for nuclear power plant operators to monitor and identify the major severe accident scenarios following an initiating event by staring at temporal trends of important parameters. The objective of this study is to develop and verify the monitoring for severe accidents using artificial intelligence (AI) techniques such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH) and fuzzy neural network (FNN). The SVC and PNN are used for event classification among the severe accidents. Also, GMDH and FNN are used to monitor for severe accidents. The inputs to AI techniques are initial time-integrated values obtained by integrating measurement signals during a short time interval after reactor scram. In this study, 3 types of initiating events such as the hot-leg LOCA, the cold-leg LOCA and SGTR are considered and it is verified how well the proposed scenario identification algorithm using the GMDH and FNN models identifies the timings when the reactor core will be uncovered, when CET will exceed 1200 .deg. F and when the reactor vessel will fail. In cases that an initiating event develops into a severe accident, the proposed algorithm showed accurate classification of initiating events. Also, it well predicted timings for important occurrences during severe accident progression scenarios, which is very helpful for operators to perform severe accident management

  14. AI model for computer games based on case based reasoning and AI planning

    NARCIS (Netherlands)

    Menkovski, V.; Metafas, D.

    2008-01-01

    Making efficient AI models for games with imperfect information can be a particular challenge. Considering the large number of possible moves and the incorporated uncertainties building game trees for these games becomes very difficult due to the exponential growth of the number of nodes at each

  15. AI Based Personal Learning Environments: Directions for Long Term Research. AI Memo 384.

    Science.gov (United States)

    Goldstein, Ira P.; Miller, Mark L.

    The application of artificial intelligence (AI) techniques to the design of personal learning environments is an enterprise of both theoretical and practical interest. In the short term, the process of developing and testing intelligent tutoring programs serves as a new experimental vehicle for exploring alternative cognitive and pedagogical…

  16. Long-period structures in gold-copper alloys; Structures a longues periodes dans les alliages or-cuivre

    Energy Technology Data Exchange (ETDEWEB)

    Jehanno, G [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1965-07-01

    We first proceed to reevaluation of the gold-copper equilibrium diagram for alloys between Au{sub 20}Cu{sub 80} and Au{sub 65}Cu{sub 35}. The identification of the various phases was performed by X-rays diffraction on quenched polycrystalline samples. We next study the structure of the phase AuCuII. X-ray data collected from bulk single crystals show that this long-period structure must be described with the help of two correlated periodic functions: an 'order function' and a 'displacement function'. The 'order function' conciliates the non-integer value of the period with its rigorous definition. The 'displacement function' accounts for the dis-symmetries of the observed intensities for the antiphase homologous reflections as the appearance of satellites around the fundamental reflections. These two functions are remarkably well defined at long distance in carefully annealed samples and, in some conditions, can be obtained independently. We observe that the improvement of the degree of order increases the 'modulation of position'. In the case of non stoichiometric alloys, the excess of gold atoms (gold rich alloys) is distributed at random whereas the excess of copper (copper rich alloys) is distributed in a preferential manner close to the antiphase boundaries. (author) [French] Nous procedons, tout d'abord, a une reevaluation du diagramme d'equilibre des alliages or-cuivre compris entre Au{sub 20}Cu{sub 80} et Au{sub 65}Cu{sub 35}. L'identification des differentes phases s'est faite par diffraction de rayons X sur des echantillons polycristallins trempes. Nous etudions ensuite, aux rayons X, la structure de la phase AuCuII. Les donnees rassemblees sur monocristaux massifs indiquent que cette structure a longue periode doit etre decrite a l'aide de deux fonctions periodiques correlees: une fonction d'ordre et une fonction de deplacement des atomes. La fonction d'ordre concilie le caractere non entier de la periode avec sa rigoureuse definition. La fonction de

  17. Multi-scale 3D characterization of long period stacking ordered structure in Mg-Zn-Gd cast alloys.

    Science.gov (United States)

    Ishida, Masahiro; Yoshioka, Satoru; Yamamoto, Tomokazu; Yasuda, Kazuhiro; Matsumura, Syo

    2014-11-01

    Magnesium alloys containing rare earth elements are attractive as lightweight structural materials due to their low density, high-specific strength and recycling efficiency. Mg-Zn-Gd system is one of promising systems because of their high creep-resistant property[1]. It is reported that the coherent precipitation formation of the 14H long period stacking ordered structure (LPSO) in Mg-Zn-Gd system at temperatures higher than 623 K[2,3]. In this study, the 14H LPSO phase formed in Mg-Zn-Gd alloys were investigated by multi-scale characterization with X-ray computer tomography (X-CT), focused ion beam (FIB) tomography and aberration-corrected STEM observation for further understanding of the LPSO formation mechanism.The Mg89.5 Zn4.5 Gd6 alloy ingots were cast using high-frequency induction heating in argon atmosphere. The specimens were aged at 753 K for 24 h in air. The aged specimen were cut and polished mechanically for microstructural analysis. The micrometer resolution X-CT observation was performed by conventional scaner (Bruker SKY- SCAN1172) at 80 kV. The FIB tomography and energy dispersive x-ray spectroscopy (EDS) were carried out by a dual beam FIB-SEM system (Hitachi MI-4000L) with silicon drift detector (SDD) (Oxford X-Max(N)). The electron acceleration voltages were used with 3 kV for SEM observation and 10 kV for EDX spectroscopy. The 3D reconstruction from image series was performed by Avizo Fire 8.0 software (FEI). TEM/STEM observations were also performed by transmission electron microscopes (JEOL JEM 2100, JEM-ARM 200F) at the acceleration voltage of 200 keV.The LPSO phase was observed clearly in SEM image of the Mg89.5Zn4.5Gd6 alloy at 753 K for 2h (Fig.1 (a)). The atomic structure of LPSO phase observed as white gray region of SEM image was also confirmed as 14H LPSO structure by using selected electron diffraction patterns and high-resolution STEM observations. The elemental composition of LPSO phase was determined as Mg97Zn1Gd2 by EDS analyses

  18. Risk Reducing Effect of AIS Implementation on Collision Risk

    DEFF Research Database (Denmark)

    Lützen, Marie; Friis-Hansen, Peter

    2003-01-01

    AIS (Automatic Identification System) is a transponder system developed for sea traffic purposes. The system sends and receives important ship information and other safety-related information between other ships and shore-based AIS stations. The implementation of AIS has now been initiated and......, as a result, the community will undoubtedly observe an increase in navigational safety. However, to the authors? knowledge, no study has so far rigorously quantified the risk reducing effect of using AIS as an integrated part of the navigational system. The objective of this study is to fill this gap....... The risk reducing effect of AIS is quantified by building a Bayesian network facilitating an evaluation of the effect of AIS on the navigational officer?s reaction ability in a potential, critical collision situation. The time-dependent change in the risk reducing effect on ship collisions is analysed...

  19. Core-cladding mode coupling and recoupling in photonic crystal fiber for enhanced overlap of evanescent field using long-period gratings

    Czech Academy of Sciences Publication Activity Database

    He, Z.; Zhu, Y.; Kaňka, Jiří; Du, H.

    2010-01-01

    Roč. 18, č. 2 (2010), s. 507-512 ISSN 1094-4087 R&D Projects: GA ČR GA102/08/1719 Institutional research plan: CEZ:AV0Z20670512 Keywords : Photonic crystal fiber * Long-period grating * Fiber-optic evanescent sensor Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 3.749, year: 2010

  20. Role of silica nanoparticles in monitoring and prolonging release of drug-eluting polyelectrolyte coatings using long-period fiber grating platform

    Czech Academy of Sciences Publication Activity Database

    Tian, F.; Kaňka, Jiří; Yang, F.; Min, J.; Hammond, P. T.

    2017-01-01

    Roč. 252, November (2017), s. 831-839 ISSN 0925-4005 R&D Projects: GA ČR(CZ) GBP205/12/G118 Institutional support: RVO:67985882 Keywords : Long period gratings * Sensor * Layer-by-layer assembly Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering OBOR OECD: Electrical and electronic engineering Impact factor: 5.401, year: 2016

  1. Long-period gratings in photonic crystal fibers operating near the phase-matching turning point for evanescent chemical and biochemical sensing

    Czech Academy of Sciences Publication Activity Database

    Tian, F.; Kaňka, Jiří; Du, H.

    2012-01-01

    Roč. 20, č. 19 (2012), s. 20952-20961 ISSN 1094-4087 R&D Projects: GA MŠk(CZ) LH11038 Institutional support: RVO:67985882 Keywords : Photonic crystal fiber * Long-period grating * Optical sensors Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 3.546, year: 2012

  2. Expression of scavenger receptor‐AI promotes alternative activation of murine macrophages to limit hepatic inflammation and fibrosis

    Science.gov (United States)

    Labonte, Adam C.; Sung, Sun‐Sang J.; Jennelle, Lucas T.; Dandekar, Aditya P.

    2016-01-01

    The liver maintains an immunologically tolerant environment as a result of continuous exposure to food and bacterial constituents from the digestive tract. Hepatotropic pathogens can take advantage of this niche and establish lifelong chronic infections causing hepatic fibrosis and hepatocellular carcinoma. Macrophages (Mϕ) play a critical role in regulation of immune responses to hepatic infection and regeneration of tissue. However, the factors crucial for Mϕ in limiting hepatic inflammation or resolving liver damage have not been fully understood. In this report, we demonstrate that expression of C‐type lectin receptor scavenger receptor‐AI (SR‐AI) is crucial for promoting M2‐like Mϕ activation and polarization during hepatic inflammation. Liver Mϕ uniquely up‐regulated SR‐AI during hepatotropic viral infection and displayed increased expression of alternative Mϕ activation markers, such as YM‐1, arginase‐1, and interleukin‐10 by activation of mer receptor tyrosine kinase associated with inhibition of mammalian target of rapamycin. Expression of these molecules was reduced on Mϕ obtained from livers of infected mice deficient for the gene encoding SR‐AI (msr1). Furthermore, in vitro studies using an SR‐AI‐deficient Mϕ cell line revealed impeded M2 polarization and decreased phagocytic capacity. Direct stimulation with virus was sufficient to activate M2 gene expression in the wild‐type (WT) cell line, but not in the knockdown cell line. Importantly, tissue damage and fibrosis were exacerbated in SR‐AI–/– mice following hepatic infection and adoptive transfer of WT bone‐marrow–derived Mϕ conferred protection against fibrosis in these mice. Conclusion: SR‐AI expression on liver Mϕ promotes recovery from infection‐induced tissue damage by mediating a switch to a proresolving Mϕ polarization state. (Hepatology 2017;65:32‐43). PMID:27770558

  3. Towards a science of integrated AI and Robotics

    OpenAIRE

    Rajan, Kanna; Saffiotti, Alessandro

    2017-01-01

    The early promise of the impact of machine intelligence did not involve the partitioning of the nascent field of Artificial Intelligence. The founders of AI envisioned the notion of embedded intelligence as being conjoined between perception, reasoning and actuation. Yet over the years the fields of AI and Robotics drifted apart. Practitioners of AI focused on problems and algorithms abstracted from the real world. Roboticists, generally with a background in mechanical and electrical engineer...

  4. Discussion on AI Technology in Information Library Design

    OpenAIRE

    日比野, 省三; Shozo, HIBINO; 中京大学社会学部

    1987-01-01

    This paper deals with the discussion on the importance of AI (Artificial Intelligence) Technology in planning and designing a library information system in the near future. First of all, the history of Library and Information Science is reviewed and it is identified that the key technology in the future library will be AI as a mega-trend. After reviewing the concepts of AI technology, a model of a Knowledge-Base system is discussed as a case study, using micro-PROLOG.

  5. Humans and Machines in the Evolution of AI in Korea

    OpenAIRE

    Zhang, Byoung-Tak

    2016-01-01

    Artificial intelligence in Korea is currently prospering. The media is regularly reporting AI-enabled products such as smart advisors, personal robots, autonomous cars, and human-level intelligence machines. The IT industry is investing in deep learning and AI to maintain the global competitive edge in their services and products. The Ministry of Science, ICT, and Future Planning (MSIP) has launched new funding programs in AI and cognitive science to implement the government’s newly adopted e...

  6. Automatic Identification System (AIS) Transmit Testing in Louisville Phase 2

    Science.gov (United States)

    2014-08-01

    Firewall Louisville QM 65.206.28.x NAIS Site Controller PC RS232 Serial cable TV32 Computer Cmd Center Serial splitter SAAB R40 AIS Base Station...172.17.14.6 Rack mount computer AIS Radio Interface Ethernet Switch 192.168.0.x Firewall Cable Modem 192.168.0.1 VTS Accred. Boundary serial connection...Automatic Identification System ( AIS ) Transmit Testing in Louisville Phase 2 Distribution Statement A: Approved for public release

  7. The implementation of AI technologies in computer wargames

    Science.gov (United States)

    Tiller, John A.

    2004-08-01

    Computer wargames involve the most in-depth analysis of general game theory. The enumerated turns of a game like chess are dwarfed by the exponentially larger possibilities of even a simple computer wargame. Implementing challenging AI is computer wargames is an important goal in both the commercial and military environments. In the commercial marketplace, customers demand a challenging AI opponent when they play a computer wargame and are frustrated by a lack of competence on the part of the AI. In the military environment, challenging AI opponents are important for several reasons. A challenging AI opponent will force the military professional to avoid routine or set-piece approaches to situations and cause them to think much deeper about military situations before taking action. A good AI opponent would also include national characteristics of the opponent being simulated, thus providing the military professional with even more of a challenge in planning and approach. Implementing current AI technologies in computer wargames is a technological challenge. The goal is to join the needs of AI in computer wargames with the solutions of current AI technologies. This talk will address several of those issues, possible solutions, and currently unsolved problems.

  8. Little AI: Playing a constructivist robot

    Science.gov (United States)

    Georgeon, Olivier L.

    Little AI is a pedagogical game aimed at presenting the founding concepts of constructivist learning and developmental Artificial Intelligence. It primarily targets students in computer science and cognitive science but it can also interest the general public curious about these topics. It requires no particular scientific background; even children can find it entertaining. Professors can use it as a pedagogical resource in class or in online courses. The player presses buttons to control a simulated "baby robot". The player cannot see the robot and its environment, and initially ignores the effects of the commands. The only information received by the player is feedback from the player's commands. The player must learn, at the same time, the functioning of the robot's body and the structure of the environment from patterns in the stream of commands and feedback. We argue that this situation is analogous to how infants engage in early-stage developmental learning (e.g., Piaget (1937), [1]).

  9. AI tools in computer based problem solving

    Science.gov (United States)

    Beane, Arthur J.

    1988-01-01

    The use of computers to solve value oriented, deterministic, algorithmic problems, has evolved a structured life cycle model of the software process. The symbolic processing techniques used, primarily in research, for solving nondeterministic problems, and those for which an algorithmic solution is unknown, have evolved a different model, much less structured. Traditionally, the two approaches have been used completely independently. With the advent of low cost, high performance 32 bit workstations executing identical software with large minicomputers and mainframes, it became possible to begin to merge both models into a single extended model of computer problem solving. The implementation of such an extended model on a VAX family of micro/mini/mainframe systems is described. Examples in both development and deployment of applications involving a blending of AI and traditional techniques are given.

  10. Dicty_cDB: FC-AI17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI17 (Link to dictyBase) - - - Contig-U15690-1 FC-AI17P (Li...nk to Original site) FC-AI17F 587 FC-AI17Z 626 FC-AI17P 1212 - - Show FC-AI17 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI17Q.Seq.d/ Representative seq. ID FC-AI...17P (Link to Original site) Representative DNA sequence >FC-AI17 (FC-AI17Q) /CSM/FC/FC-AI/FC-AI...slated Amino Acid sequence ANIATVGDFLKADTVVPKMIITYNKRKQGTDYLKAVIGPILSNVIKQELNLELKPNLVYA AIISEQEIRTGEKSTLDRNV

  11. Dicty_cDB: FC-AI18 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI18 (Link to dictyBase) - - - Contig-U15590-1 FC-AI18P (Li...nk to Original site) FC-AI18F 621 FC-AI18Z 703 FC-AI18P 1324 - - Show FC-AI18 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI18Q.Seq.d/ Representative seq. ID FC-AI...18P (Link to Original site) Representative DNA sequence >FC-AI18 (FC-AI18Q) /CSM/FC/FC-AI/FC-AI...AVWPLIPGYERA DGEKQYPVAAMLCNFTKPTPTTPSLLTHDEVVTFFHEFGHVMHNMSTKVHYSMFSGTSVE RDFVECPSQLFEFWCWNKDVLVNKLSGHXKDHSKKLPTDLVERMIAAKNLNVAI

  12. Dicty_cDB: FC-AI03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI03 (Link to dictyBase) - - - Contig-U15833-1 FC-AI03P (Li...nk to Original site) FC-AI03F 690 FC-AI03Z 651 FC-AI03P 1341 - - Show FC-AI03 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI03Q.Seq.d/ Representative seq. ID FC-AI...03P (Link to Original site) Representative DNA sequence >FC-AI03 (FC-AI03Q) /CSM/FC/FC-AI/FC-AI...li*l*ivtlskv*qswyqvfcslmrftcwi*nv fht*ivhwsqhwhql*flqpivaiv*skapitifnlhmaslwif*ivl*sfvpfhiitmk sfkfspfvpqlki

  13. AI technology and automobile. ; Toward vehicle autonomy. AI gijutsu to jidosha. ; Sharyo no jiritsuka ni mukatte

    Energy Technology Data Exchange (ETDEWEB)

    Okuno, A. (Mazda Motor Corp., Hiroshima (Japan))

    1991-01-01

    This report describes the vehicle autonomy by using artificial intelligence (AI) technology. Owing to a remarkable progress of AI technology, it is forecasted that driving support system will be introduced into the market till 2000, and higher autonomous navigation system will be introduced since about 2010. Autonomous vehicles have capacities of recognizing the outside world and of navigating roads by themselves, and with their enfanced environment adaptability the road transportation in the future is expected to be much more safer than in the present. The autonomous vehicle can warn its driver of potential dangers and correct operational errors of the driver. In order to realize such autonomous vehicles, extensive researches on perception systems, decision making systems and driving support systems are needed. 9 refs., 10 figs., 1 tab.

  14. Ada in AI or AI in Ada. On developing a rationale for integration

    Science.gov (United States)

    Collard, Philippe E.; Goforth, Andre

    1988-01-01

    The use of Ada as an Artificial Intelligence (AI) language is gaining interest in the NASA Community, i.e., by parties who have a need to deploy Knowledge Based-Systems (KBS) compatible with the use of Ada as the software standard for the Space Station. A fair number of KBS and pseudo-KBS implementations in Ada exist today. Currently, no widely used guidelines exist to compare and evaluate these with one another. The lack of guidelines illustrates a fundamental problem inherent in trying to compare and evaluate implementations of any sort in languages that are procedural or imperative in style, such as Ada, with those in languages that are functional in style, such as Lisp. Discussed are the strengths and weakness of using Ada as an AI language and a preliminary analysis provided of factors needed for the development of criteria for the integration of these two families of languages and the environments in which they are implemented. The intent for developing such criteria is to have a logical rationale that may be used to guide the development of Ada tools and methodology to support KBS requirements, and to identify those AI technology components that may most readily and effectively be deployed in Ada.

  15. Ai Weiwei - 21. sajandi märter? / Tanel Veenre

    Index Scriptorium Estoniae

    Veenre, Tanel, 1977-

    2011-01-01

    Hiina kunstniku, inimõiguslase ja teisitimõtleja Ai Weiwei elust, õpingutest, loomingust ja tegevusest. Hiinas kunstniku tagakiusamisest, arreteerimisest, maksupettuses süüdistamisest jm. Kunstniku toetajatest. Inglise kunstileht Art Review valis Ai Weiwei 2011. a. kõige mõjuvõimsamaks kunstitegelaseks

  16. Integrating the Wall Street Journal into AIS Courses

    Science.gov (United States)

    Kohlmeyer, James M., III

    2008-01-01

    While it is important for accounting information systems (AIS) students to understand computer technology, internal controls and business processes, such knowledge is of little use without reference to appropriate contexts. Integrating Wall Street Journal (WSJ) readings and discussions into AIS classes can enrich learning by stimulating…

  17. Brosimacutins A-I, nine new flavonoids from Brosimum acutifolium.

    Science.gov (United States)

    Takashima, Junko; Ohsaki, Ayumi

    2002-12-01

    Nine new flavonoids, brosimacutins A-I (1-9), and four known flavonoids were isolated from the bark of Brosimum acutifolium, a Brazilian folk medicine ("Mururé"). Their structures were elucidated by spectroscopic methods, including 2D NMR. Brosimacutins A-I possess differentially functionalized isoprene units at C-8.

  18. An Immune Agent for Web-Based AI Course

    Science.gov (United States)

    Gong, Tao; Cai, Zixing

    2006-01-01

    To overcome weakness and faults of a web-based e-learning course such as Artificial Intelligence (AI), an immune agent was proposed, simulating a natural immune mechanism against a virus. The immune agent was built on the multi-dimension education agent model and immune algorithm. The web-based AI course was comprised of many files, such as HTML…

  19. the Lexique kikongo–français by

    African Journals Online (AJOL)

    Gilles-Maurice de Schryver

    français by the Jesuit missionary Charles Polis, is analysed in great detail. Section 1 expounds on the goal and ... dictionary manuscript for Kikongo: the Lexique kikongo–français by Charles Polis. s.j. (1885–†1943). .... Inkisi River, and all but one (Leverville, the present Lusanga) are close to that river, which thus strongly ...

  20. Radioimmunoassay of apolipoprotein A-I of rat serum

    International Nuclear Information System (INIS)

    Fainaru, M.; Havel, R.J.; Felker, T.E.

    1976-01-01

    A double antibody radioimmunoassay technique was developed for quantification of apolipoprotein A-I, the major apoprotein of rat high density lipoprotein. Apo A-I was labelled with 125 I by the chloramine-T method. 125 I-labeled apo A-I had the same electrophoretic mobility as unlabeled apo A-I and more than 80% of the 125 I was precipitated by rabbit anti apo A-I antibodies. The assay is sensitive at the level of 0.5-5 ng, and has intraassay and interassay coefficients of variation of 4.5 and 6.5% respectively. The specificity of the assay was established by competitive displacement of 125 I-labeled apo A-I from its antibody by apo A-I and lipoproteins containing apo A-I, but not by rat albumin and other apoproteins. Immunoreactivity of high density lipoprotein and serum was only about 35% of that of their delipidated forms when Veronal buffer was used as a diluent. Inclusion of 5 mM sodium decyl sulfate in the incubation mixture brought out reactivity equivalent to that found after delipidation. Completeness of the reaction was verified by comparison with the amount of apo A-I in chromatographic fractions of the total apoprotein of high density lipoprotein. Content (weight %, mean values +- S.D.) of immunoassayable apo A-I was: 62.3 +- 5.9 in high density lipoprotein; 1.7 +- 0.3 in low density lipoprotein; 0.09 +- 0.03 in very low density lipoprotein and 25.0 +- 5.0 in lymph chylomicrons. Concentration in whole serum was 51.4 +- 8.9 mg/dl and 33.6 +- 4.1 mg/dl for female and male rats, respectively (p 1.21 g/ml and <1% in lipoproteins of d<1.063 g/ml

  1. Observations of long-period waves in the nearshore waters of central west coast of India during the fall inter-monsoon period

    Digital Repository Service at National Institute of Oceanography (India)

    Amrutha, M.M.; SanilKumar, V.; Jesbin, G.

    variability in both long period waves and short period waves need more detailed study. Acknowledgments The authors acknowledge the Earth System Science Organization, Ministry of Earth Sciences, New Delhi for providing the financial support to conduct part... Geraldton. Proceedings of the 2009 Pacific Coasts and Ports Conference, Wellington, New Zealand. Mehta, A. V., & Krishnamurti, T. N., 1988. Interannual variability of the 30 to 50 day wave motions. Journal of the Meteorological Society of Japan, 66...

  2. Little AI: Playing a constructivist robot

    Directory of Open Access Journals (Sweden)

    Olivier L. Georgeon

    2017-01-01

    Full Text Available Little AI is a pedagogical game aimed at presenting the founding concepts of constructivist learning and developmental Artificial Intelligence. It primarily targets students in computer science and cognitive science but it can also interest the general public curious about these topics. It requires no particular scientific background; even children can find it entertaining. Professors can use it as a pedagogical resource in class or in online courses. The player presses buttons to control a simulated “baby robot”. The player cannot see the robot and its environment, and initially ignores the effects of the commands. The only information received by the player is feedback from the player’s commands. The player must learn, at the same time, the functioning of the robot’s body and the structure of the environment from patterns in the stream of commands and feedback. We argue that this situation is analogous to how infants engage in early-stage developmental learning (e.g., Piaget (1937, [1].

  3. [Artificial intelligence] AI for protection systems

    Energy Technology Data Exchange (ETDEWEB)

    Aggarwal, R.; Johns, A.

    1997-12-31

    The reliable operation of large power systems with small stability margins is highly dependent on control systems and protection devices. Progress in the field of microprocessor systems and demanding requirements in respect of the performance of protective relays are the reasons for digital device applications to power system protection. The superiority of numeric protection over its analogue alternatives is attributed to such factors as accurate extraction of the fundamental voltage and current components through filtering, functional benefits resulting from multi-processor design and extensive self-monitoring, etc. However, all these reasons have not led to a major impact on speed, sensitivity and selectivity of primary protective relays, and the gains are only marginal; this is so because conventional digital relays still rely on deterministic signal models and a heuristic approach for decision making, so that only a fraction of the information contained within voltage and current signals as well as knowledge about the plant to be protected is used. The performance of digital relays may be substantially improved if the decision making is based on elements of artificial intelligence (AI). (Author)

  4. Data of evolutionary structure change: 1AIFB-2AI0K [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available ignment> 0 n> 1AIF n>B 1AI... CA 272 n> 2AI0 n>K ...n>2AI0Kn> VAHPASSTKVD EEE EEEE...1AIFB-2AI0K 1AIF 2AI0 B K EVKLQESGGGLVQPGGSMKLSCVASGFTFNNYWMSWVRQ...SCAASGFTFRNYGMSWVRQTPEKRLEWVAAIS--GNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARH

  5. Polarization developments

    International Nuclear Information System (INIS)

    Prescott, C.Y.

    1993-07-01

    Recent developments in laser-driven photoemission sources of polarized electrons have made prospects for highly polarized electron beams in a future linear collider very promising. This talk discusses the experiences with the SLC polarized electron source, the recent progress with research into gallium arsenide and strained gallium arsenide as a photocathode material, and the suitability of these cathode materials for a future linear collider based on the parameters of the several linear collider designs that exist

  6. Polarization and collision velocity dependence of associative ionization in cold Na (3p)-Na(3p) collisions

    NARCIS (Netherlands)

    Meijer, H.A.J.

    1990-01-01

    We studied the polarization dependence of the associative ionization (AI) process Na(3p) + Na(3p) → Na2+ at collision velocities between 100 and 700 m/s (5 and 200 K), using linearly and circularly polarized light for the excitation. We found that the polarization dependence varies strongly in the

  7. Dicty_cDB: FC-AI12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI12 (Link to dictyBase) - - - Contig-U15484-1 FC-AI12Z (Li...nk to Original site) - - FC-AI12Z 614 - - - - Show FC-AI12 Library FC (Link to library) Clone ID FC-AI12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI12Q.Seq.d/ Representative seq. ID FC-AI...12Z (Link to Original site) Representative DNA sequence >FC-AI12 (FC-AI12Q) /CSM/FC/FC-AI/FC-AI12Q.Seq....EKIVRRI ELLDGITCYRNEKAKDEIVLTGNSLELLSQSCATIQLRSAIKYKDVRKFLDGIYVSERNV LESN*in*riys

  8. Dicty_cDB: FC-AI07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI07 (Link to dictyBase) - - - Contig-U15296-1 | Contig-U15756-1 FC-AI...07P (Link to Original site) FC-AI07F 580 FC-AI07Z 723 FC-AI07P 1303 - - Show FC-AI07 Library FC (...Link to library) Clone ID FC-AI07 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15296-1 | Contig-U15756-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...07Q.Seq.d/ Representative seq. ID FC-AI07P (Link to Original site) Representative DNA sequence >FC-AI07 (FC-AI

  9. Dicty_cDB: FC-AI19 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI19 (Link to dictyBase) - - - Contig-U15115-1 FC-AI19Z (Li...nk to Original site) - - FC-AI19Z 661 - - - - Show FC-AI19 Library FC (Link to library) Clone ID FC-AI19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI19Q.Seq.d/ Representative seq. ID FC-AI...19Z (Link to Original site) Representative DNA sequence >FC-AI19 (FC-AI19Q) /CSM/FC/FC-AI/FC-AI19Q.Seq....lmrqswvkkiesi*lvl krrkkkknnkkkkkkkkkkklfn*lvnkkn*ik*kkllcnqkk Frame B: ---*ekaieilsklfsin*kfn**ysiiigkkstkyq

  10. Dicty_cDB: FC-AI14 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI14 (Link to dictyBase) - - - Contig-U16280-1 FC-AI14Z (Li...nk to Original site) - - FC-AI14Z 671 - - - - Show FC-AI14 Library FC (Link to library) Clone ID FC-AI14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI14Q.Seq.d/ Representative seq. ID FC-AI...14Z (Link to Original site) Representative DNA sequence >FC-AI14 (FC-AI14Q) /CSM/FC/FC-AI/FC-AI14Q.Seq....nqrllv*lvvlskklqllnsnqsfkfkkvq rmkknsvkntkn*rfvllt*nlkslkrmpksknsptkliifilkly Frame B: ---lkdl*krtphl*stcfhhptlcssrrfclwslnai

  11. Dicty_cDB: FC-AI15 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI15 (Link to dictyBase) - G01730 DDB0214993 Contig-U15123-1 FC-AI...15E (Link to Original site) - - - - - - FC-AI15E 856 Show FC-AI15 Library FC (Link to library) Clone ID FC-AI...3-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI15Q.Se...q.d/ Representative seq. ID FC-AI15E (Link to Original site) Representative DNA sequence >FC-AI15 (FC-AI15Q) /CSM/FC/FC-AI/FC-AI...AAAAAAAATA sequence update 1996.12.24 Translated Amino Acid sequence kt*riyi*KMMIKYITIAILFIASLVKADLQFSLCPTCV

  12. Dicty_cDB: FC-AI24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI24 (Link to dictyBase) - - - - FC-AI24Z (Link to Original site) - - FC-AI...24Z 693 - - - - Show FC-AI24 Library FC (Link to library) Clone ID FC-AI24 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...24Q.Seq.d/ Representative seq. ID FC-AI24Z (Link to Original s...ite) Representative DNA sequence >FC-AI24 (FC-AI24Q) /CSM/FC/FC-AI/FC-AI24Q.Seq.d/ XXXXXXXXXXAAATTAGAAAACAAA

  13. Dicty_cDB: FC-AI06 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI06 (Link to dictyBase) - - - Contig-U16465-1 FC-AI06E (Li...nk to Original site) - - - - - - FC-AI06E 1138 Show FC-AI06 Library FC (Link to library) Clone ID FC-AI06 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI06Q.Seq.d/ Representative seq. ID FC-AI...06E (Link to Original site) Representative DNA sequence >FC-AI06 (FC-AI06Q) /CSM/FC/FC-AI/FC-AI06Q.Seq...FGRGIDIERVNVVINYDMAESADTYLHRVGRAGRFGTK GLAISFVPSKEDPVLEQVQSKFVVSIKELVATPDPSTYMSG*kkkkkkkknlfvlksikk k*kkk*in

  14. Dicty_cDB: FC-AI09 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI09 (Link to dictyBase) - - - Contig-U16149-1 FC-AI09Z (Li...nk to Original site) - - FC-AI09Z 591 - - - - Show FC-AI09 Library FC (Link to library) Clone ID FC-AI09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI09Q.Seq.d/ Representative seq. ID FC-AI...09Z (Link to Original site) Representative DNA sequence >FC-AI09 (FC-AI09Q) /CSM/FC/FC-AI/FC-AI09Q.Seq....*tkl ik*ilifykiknnkkkkkk Frame B: ---gt*kvpeflailfkrmasrsvlwy*rcltkakkglkapqtltik

  15. Dicty_cDB: FC-AI22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI22 (Link to dictyBase) - - - Contig-U15369-1 | Contig-U15732-1 FC-AI...22P (Link to Original site) FC-AI22F 583 FC-AI22Z 683 FC-AI22P 1266 - - Show FC-AI22 Library FC (...Link to library) Clone ID FC-AI22 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15369-1 | Contig-U15732-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...22Q.Seq.d/ Representative seq. ID FC-AI22P (Link to Original site) Representative DNA sequence >FC-AI22 (FC-AI

  16. Dicty_cDB: FC-AI08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI08 (Link to dictyBase) - G01729 DDB0233148 Contig-U14939-1 FC-AI...08P (Link to Original site) FC-AI08F 654 FC-AI08Z 563 FC-AI08P 1217 - - Show FC-AI08 Library FC (Link... to library) Clone ID FC-AI08 (Link to dictyBase) Atlas ID - NBRP ID G01729 dictyBase ID DDB0233148 Link to ...Contig Contig-U14939-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...08Q.Seq.d/ Representative seq. ID FC-AI08P (Link to Original site) Representative DNA sequence >FC-AI08 (FC-AI

  17. Neutron polarization

    International Nuclear Information System (INIS)

    Firk, F.W.K.

    1976-01-01

    Some recent experiments involving polarized neutrons are discussed; they demonstrate how polarization studies provide information on fundamental aspects of nuclear structure that cannot be obtained from more traditional neutron studies. Until recently, neutron polarization studies tended to be limited either to very low energies or to restricted regions at higher energies, determined by the kinematics of favorable (p, vector n) and (d, vector n) reactions. With the advent of high intensity pulsed electron and proton accelerators and of beams of vector polarized deuterons, this is no longer the case. One has entered an era in which neutron polarization experiments are now being carried out, in a routine way, throughout the entire range from thermal energies to tens-of-MeV. The significance of neutron polarization studies is illustrated in discussions of a wide variety of experiments that include the measurement of T-invariance in the β-decay of polarized neutrons, a search for the effects of meson exchange currents in the photo-disintegration of the deuteron, the determination of quantum numbers of states in the fission of aligned 235 U and 237 Np induced by polarized neutrons, and the double- and triple-scattering of fast neutrons by light nuclei

  18. Recent progresses on AI-2 bacterial quorum sensing inhibitors.

    Science.gov (United States)

    Zhu, Peng; Li, Minyong

    2012-01-01

    Quorum sensing (QS) is a communication procedure that predominates gene expression in response to cell density and fluctuations in the neighboring environment as a result of discerning molecules termed autoinducers (AIs). It has been embroiled that QS can govern bacterial behaviors such as the secretion of virulence factors, biofilm formation, bioluminescence production, conjugation, sporulation and swarming motility. Autoinducer 2 (AI-2), a QS signaling molecule brought up to be involved in interspecies communication, exists in both gram-negative and -positive bacteria. Therefore, novel approaches to interrupt AI-2 quorum sensing are being recognized as next generation antimicrobials. In the present review article, we summarized recent progresses on AI-2 bacterial quorum sensing inhibitors and discussed their potential as the antibacterial agents.

  19. Expanding the Possibilities of AIS Data with Heuristics

    Directory of Open Access Journals (Sweden)

    Bjørnar Brende Smestad

    2017-06-01

    Full Text Available Automatic Identification System (AIS is primarily used as a tracking system for ships, but with the launch of satellites to collect these data, new and previously untested possibilities are emerging. This paper presents the development of heuristics for establishing the specific ship type using information retrieved from AIS data alone. These heuristics expand the possibilities of AIS data, as the specific ship type is vital for several transportation research cases, such as emission analyses of ship traffic and studies on slow steaming. The presented method for developing heuristics can be used for a wider range of vessels. These heuristics may form the basis of large-scale studies on ship traffic using AIS data when it is not feasible or desirable to use commercial ship data registers.

  20. Creating an AI modeling application for designers and developers

    Science.gov (United States)

    Houlette, Ryan; Fu, Daniel; Jensen, Randy

    2003-09-01

    Simulation developers often realize an entity's AI by writing a program that exhibits the intended behavior. These behaviors are often the product of design documents written by designers. These individuals, while possessing a vast knowledge of the subject matter, might not have any programming knowledge whatsoever. To address this disconnect between design and subsequent development, we have created an AI application whereby a designer or developer sketches an entity's AI using a graphical "drag and drop" interface to quickly articulate behavior using a UML-like representation of state charts. Aside from the design-level benefits, the application also features a runtime engine that takes the application's data as input along with a simulation or game interface, and makes the AI operational. We discuss our experience in creating such an application for both designer and developer.

  1. 4th June: AIS and NICE/MAIL unique authentication

    CERN Multimedia

    AIS and NICE teams

    2007-01-01

    Over the past few years, the IT department has been in the process of streamlining CERN users' access to all central computing services. The long term goal is to converge on a unique computer account, which will increase computer security and simplify account maintenance. The next step of this process will occur on 4th June 2007, as of when authenticating on the AIS applications (EDH, HRT, CET, APT, ERT, CRA, Foundation, ...) and on NICE (Windows) and MAIL will be done using the same username and password. As a reminder, this account can also be used on EDMS, INDICO, CDS and SIMBA. So starting on 4th June 2007, authentication on the AIS applications must be done using your AIS username and your MAIL/NICE password. Thanks for your understanding, The AIS and NICE teams

  2. 4th June: AIS and NICE/MAIL unique authentication

    CERN Multimedia

    The AIS and NICE teams

    2007-01-01

    Over the past few years, the IT department has been in the process of streamlining CERN users' access to all central computing services. The long term goal is to converge on a unique computer account, which will increase computer security and simplify account maintenance. The next step of this process will occur on the 4th June 2007, as of when authenticating on the AIS applications (EDH, HRT, CET, APT, ERT, CRA, Foundation, ...) and on NICE (Windows) and MAIL will be done using the same username and password. As a reminder, this account can also be used on EDMS, INDICO, CDS and SIMBA. Thus starting on the 4th June 2007, authentication on the AIS applications must be done using your AIS username and your MAIL/NICE password. Thanks for your understanding, The AIS and NICE teams

  3. Quality measures and assurance for AI (Artificial Intelligence) software

    Science.gov (United States)

    Rushby, John

    1988-01-01

    This report is concerned with the application of software quality and evaluation measures to AI software and, more broadly, with the question of quality assurance for AI software. Considered are not only the metrics that attempt to measure some aspect of software quality, but also the methodologies and techniques (such as systematic testing) that attempt to improve some dimension of quality, without necessarily quantifying the extent of the improvement. The report is divided into three parts Part 1 reviews existing software quality measures, i.e., those that have been developed for, and applied to, conventional software. Part 2 considers the characteristics of AI software, the applicability and potential utility of measures and techniques identified in the first part, and reviews those few methods developed specifically for AI software. Part 3 presents an assessment and recommendations for the further exploration of this important area.

  4. Liquid Robotics Wave Glider, Honey Badger (G3), 2015, AIS

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Liquid Robotics Wave Glider, Honey Badger (G3), 2015, AIS. The MAGI mission is to use the Wave Glider to sample the late summer chlorophyll bloom that develops near...

  5. Polarization holography

    DEFF Research Database (Denmark)

    Nikolova, L.; Ramanujam, P.S.

    Current research into holography is concerned with applications in optically storing, retrieving, and processing information. Polarization holography has many unique properties compared to conventional holography. It gives results in high efficiency, achromaticity, and special polarization...... properties. This books reviews the research carried out in this field over the last 15 years. The authors provide basic concepts in polarization and the propagation of light through anisotropic materials, before presenting a sound theoretical basis for polarization holography. The fabrication...... and characterization of azobenzene based materials, which remain the most efficient for the purpose, is described in detail. This is followed by a description of other materials that are used in polarization holography. An in-depth description of various applications, including display holography and optical storage...

  6. Long-period variables in the Magellanic Clouds: Supergiants, AGB stars, supernova precursors, planetary nebula precursors, and enrichment of the interstellar medium

    International Nuclear Information System (INIS)

    Wood, P.; Bessell, M.S.; Fox, M.W.

    1983-01-01

    Infrared JHK magnitudes and low-dispersion red spectra have been obtained for 90 long-period variables (LPVs) in the Small and Large Magellanic Clouds. The LPVs fall into two distinct groups, core helium (or carbon) burning supergiants and stars on the asymptotic giant branch (AGB). The supergiants have small pulsation amplitudes in K ( or approx. =5 M/sub sun/ produce supernovae while less massive stars produce planetary nebulae with nebula masses from approx.0.1--2.1 M/sub sun/. The coreburning red supergiants appear highly overluminous for their pulsation mass, indicating that they have lost up to half their mass since the main-sequence phase

  7. About swarms of long-period earthquakes at volcano Nyamuragira of the Virunga region, Western Rift Valley of Africa (D.R. Congo

    Directory of Open Access Journals (Sweden)

    Rusangiza B.K.

    2012-01-01

    Full Text Available Swarms of Long Period earthquakes generated by the Nyamuragira volcano for the period from January 2000 to November 2006 before 21 January 2000, 5 February 2001, 25 July 2002, 8 May 2004 and 27 November 2006 Nyamuragira eruptions have been analyzed. Interest is focused on the frequency distribution of these earthquakes and on the variation of the m-value of observed earthquake swarms. It is found that m-values which generally vary between 0.9 and 1.6, and shifts towards larger values of 1.7 to 3.23 two to four months prior to eruptions of the volcano.

  8. Short-wavelength multiline erbium-doped fiber ring laser by a broadband long-period fiber grating inscribed in a taper transition

    International Nuclear Information System (INIS)

    Anzueto-Sánchez, G; Martínez-Rios, A

    2014-01-01

    A stable multiwavelength all-fiber erbium-doped fiber ring laser (EDFRL) based on a broadband long-period fiber grating (LPFG) inscribed in a fiber taper transition is presented. The LPFG’s characteristics were engineered to provide a higher loss at the natural lasing wavelength of the laser cavity. The LPFG inscribed on a taper transition provided a depth greater than 25 dB, and posterior chemical etching provided a broad notch band to inhibit laser generation on the long-wavelength side of the EDF gain. Up to four simultaneous laser wavelengths are generated in the range of 1530–1535 nm. (paper)

  9. Toward 2D Seismic Wavefield Monitoring: Seismic Gradiometry for Long-Period Seismogram and Short-Period Seismogram Envelope applied to the Hi-net Array

    Science.gov (United States)

    Maeda, T.; Nishida, K.; Takagi, R.; Obara, K.

    2015-12-01

    The high-sensitive seismograph network Japan (Hi-net) operated by National Research Institute for Earth Science and Disaster Prevention (NIED) has about 800 stations with average separation of 20 km. We can observe long-period seismic wave propagation as a 2D wavefield with station separations shorter than wavelength. In contrast, short-period waves are quite incoherent at stations, however, their envelope shapes resemble at neighbor stations. Therefore, we may be able to extract seismic wave energy propagation by seismogram envelope analysis. We attempted to characterize seismic waveform at long-period and its envelope at short-period as 2D wavefield by applying seismic gradiometry. We applied the seismic gradiometry to a synthetic long-period (20-50s) dataset prepared by numerical simulation in realistic 3D medium at the Hi-net station layout. Wave amplitude and its spatial derivatives are estimated by using data at nearby stations. The slowness vector, the radiation pattern and the geometrical spreading are extracted from estimated velocity, displacement and its spatial derivatives. For short-periods at shorter than 1 s, seismogram envelope shows temporal and spatial broadening through scattering by medium heterogeneity. It is expected that envelope shape may be coherent among nearby stations. Based on this idea, we applied the same method to the time-integration of seismogram envelope to estimate its spatial derivatives. Together with seismogram envelope, we succeeded in estimating the slowness vector from the seismogram envelope as well as long-period waveforms by synthetic test, without using phase information. Our preliminarily results show that the seismic gradiometry suits the Hi-net to extract wave propagation characteristics both at long and short periods. This method is appealing that it can estimate waves at homogeneous grid to monitor seismic wave as a wavefield. It is promising to obtain phase velocity variation from direct waves, and to grasp wave

  10. NASA space station automation: AI-based technology review

    Science.gov (United States)

    Firschein, O.; Georgeff, M. P.; Park, W.; Neumann, P.; Kautz, W. H.; Levitt, K. N.; Rom, R. J.; Poggio, A. A.

    1985-01-01

    Research and Development projects in automation for the Space Station are discussed. Artificial Intelligence (AI) based automation technologies are planned to enhance crew safety through reduced need for EVA, increase crew productivity through the reduction of routine operations, increase space station autonomy, and augment space station capability through the use of teleoperation and robotics. AI technology will also be developed for the servicing of satellites at the Space Station, system monitoring and diagnosis, space manufacturing, and the assembly of large space structures.

  11. Human-Assisted AI: an Intelligence Augmentation Approach

    OpenAIRE

    Alicea, Bradly

    2018-01-01

    As a flavor of Human-Computer Interaction (HCI), Human-Assisted AI can serve to both augment both human performance and artificial systems. This talk will feature a discussion of Human-assisted AI as an instance of Intelligence Augmentation (IA). We will discuss instances of weak and strong IA, in addition to contemporary examples of and paths forward for such systems. In the variety of models presented, data plays a critical role in the structure of interactions between human and artificial ...

  12. Emotion Oriented Programming: Computational Abstractions for AI Problem Solving

    OpenAIRE

    Darty , Kevin; Sabouret , Nicolas

    2012-01-01

    International audience; In this paper, we present a programming paradigm for AI problem solving based on computational concepts drawn from Affective Computing. It is believed that emotions participate in human adaptability and reactivity, in behaviour selection and in complex and dynamic environments. We propose to define a mechanism inspired from this observation for general AI problem solving. To this purpose, we synthesize emotions as programming abstractions that represent the perception ...

  13. It Takes Two to Tango: Towards Theory of AI's Mind

    OpenAIRE

    Chandrasekaran, Arjun; Yadav, Deshraj; Chattopadhyay, Prithvijit; Prabhu, Viraj; Parikh, Devi

    2017-01-01

    Theory of Mind is the ability to attribute mental states (beliefs, intents, knowledge, perspectives, etc.) to others and recognize that these mental states may differ from one's own. Theory of Mind is critical to effective communication and to teams demonstrating higher collective performance. To effectively leverage the progress in Artificial Intelligence (AI) to make our lives more productive, it is important for humans and AI to work well together in a team. Traditionally, there has been m...

  14. AI, Native Supercomputing and The Revival of Moore's Law

    OpenAIRE

    Lu, Chien-Ping

    2017-01-01

    Based on Alan Turing's proposition on AI and computing machinery, which shaped Computing as we know it today, the new AI computing machinery should comprise a universal computer and a universal learning machine. The later should understand linear algebra natively to overcome the slowdown of Moore's law. In such a universal learnig machine, a computing unit does not need to keep the legacy of a universal computing core. The data can be distributed to the computing units, and the results can be...

  15. AI-2 of Aggregatibacter actinomycetemcomitans Inhibits Candida albicans Biofilm Formation

    Directory of Open Access Journals (Sweden)

    Endang W. Bachtiar

    2014-07-01

    Full Text Available Aggregatibacter actinomycetemcomitans, a Gram-negative bacterium, and Candida albicans, a polymorphic fungus, are both commensals of the oral cavity but both are opportunistic pathogens that can cause oral diseases. A. actinomycetemcomitans produces a quorum-sensing molecule called autoinducer-2 (AI-2, synthesized by LuxS, that plays an important role in expression of virulence factors, in intra- but also in interspecies communication. The aim of this study was to investigate the role of AI-2 based signaling in the interactions between C. albicans and A. actinomycetemcomitans. A. actinomycetemcomitans adhered to C. albicans and inhibited biofilm formation by means of a molecule that was secreted during growth. C. albicans biofilm formation increased significantly when co-cultured with A. actinomycetemcomitans luxS, lacking AI-2 production. Addition of wild-type-derived spent medium or synthetic AI-2 to spent medium of the luxS strain, restored inhibition of C. albicans biofilm formation to wild-type levels. Addition of synthetic AI-2 significantly inhibited hypha formation of C. albicans possibly explaining the inhibition of biofilm formation. AI-2 of A. actinomycetemcomitans is synthesized by LuxS, accumulates during growth and inhibits C. albicans hypha- and biofilm formation. Identifying the molecular mechanisms underlying the interaction between bacteria and fungi may provide important insight into the balance within complex oral microbial communities.

  16. Highlights on artificial insemination (AI technology in the pig

    Directory of Open Access Journals (Sweden)

    Tarek Khalifa

    2014-03-01

    Full Text Available Over the past decade, there has been a tremendous increase in the development of field AI services in the majority of countries concerned with pig production. The objective of this paper is to review: (a the current status of swine AI in the world, (b significance and limitation of AI with liquid and frozen semen, (c the biological traits of porcine semen in relation to in-vitro sperm storage, (d the criteria used for selection of a boar stud as a semen supplier, (e how to process boar semen for liquid and frozen storage in the commercial settings and (f how to improve fertility and prolificacy of boar semen. More than 99% of the inseminations conducted worldwide are made with liquid-stored semen. AI with frozen semen is used only for upgrading the genetic base in a particular country or herd. Determining the initial quality of semen ejaculates along with the selection of the optimum storage extender has a profound effect on the quality and fertility of AI doses. Different procedures have been used for improving the fertility of preserved spermatozoa including colloidal centrifugation of the semen, intrauterine insemination and modulation of the uterine defense mechanism after AI. Development of an efficient protocol for synchronizing the time of ovulation in sows and gilts coupled with improving uterine horn insemination technique will make a breakthrough in the commercial use of frozen boar semen.

  17. Calibrating AIS images using the surface as a reference

    Science.gov (United States)

    Smith, M. O.; Roberts, D. A.; Shipman, H. M.; Adams, J. B.; Willis, S. C.; Gillespie, A. R.

    1987-01-01

    A method of evaluating the initial assumptions and uncertainties of the physical connection between Airborne Imaging Spectrometer (AIS) image data and laboratory/field spectrometer data was tested. The Tuscon AIS-2 image connects to lab reference spectra by an alignment to the image spectral endmembers through a system gain and offset for each band. Images were calibrated to reflectance so as to transform the image into a measure that is independent of the solar radiant flux. This transformation also makes the image spectra directly comparable to data from lab and field spectrometers. A method was tested for calibrating AIS images using the surface as a reference. The surface heterogeneity is defined by lab/field spectral measurements. It was found that the Tuscon AIS-2 image is consistent with each of the initial hypotheses: (1) that the AIS-2 instrument calibration is nearly linear; (2) the spectral variance is caused by sub-pixel mixtures of spectrally distinct materials and shade, and (3) that sub-pixel mixtures can be treated as linear mixtures of pure endmembers. It was also found that the image can be characterized by relatively few endmembers using the AIS-2 spectra.

  18. Application of AI methods to aircraft guidance and control

    Science.gov (United States)

    Hueschen, Richard M.; Mcmanus, John W.

    1988-01-01

    A research program for integrating artificial intelligence (AI) techniques with tools and methods used for aircraft flight control system design, development, and implementation is discussed. The application of the AI methods for the development and implementation of the logic software which operates with the control mode panel (CMP) of an aircraft is presented. The CMP is the pilot control panel for the automatic flight control system of a commercial-type research aircraft of Langley Research Center's Advanced Transport Operating Systems (ATOPS) program. A mouse-driven color-display emulation of the CMP, which was developed with AI methods and used to test the AI software logic implementation, is discussed. The operation of the CMP was enhanced with the addition of a display which was quickly developed with AI methods. The display advises the pilot of conditions not satisfied when a mode does not arm or engage. The implementation of the CMP software logic has shown that the time required to develop, implement, and modify software systems can be significantly reduced with the use of the AI methods.

  19. Long-Period Solar Variability

    Energy Technology Data Exchange (ETDEWEB)

    GAUTHIER,JOHN H.

    2000-07-20

    Terrestrial climate records and historical observations of the Sun suggest that the Sun undergoes aperiodic oscillations in radiative output and size over time periods of centuries and millenia. Such behavior can be explained by the solar convective zone acting as a nonlinear oscillator, forced at the sunspot-cycle frequency by variations in heliomagnetic field strength. A forced variant of the Lorenz equations can generate a time series with the same characteristics as the solar and climate records. The timescales and magnitudes of oscillations that could be caused by this mechanism are consistent with what is known about the Sun and terrestrial climate.

  20. Ionic polarization

    International Nuclear Information System (INIS)

    Mahan, G.D.

    1992-01-01

    Ferroelectricity occurs in many different kinds of materials. Many of the technologically important solids, which are ferroelectric, can be classified as ionic. Any microscopic theory of ferroelectricity must contain a description of local polarization forces. We have collaborated in the development of a theory of ionic polarization which is quite successful. Its basic assumption is that the polarization is derived from the properties of the individual ions. We have applied this theory successfully to diverse subjects as linear and nonlinear optical response, phonon dispersion, and piezoelectricity. We have developed numerical methods using the local Density approximation to calculate the multipole polarizabilities of ions when subject to various fields. We have also developed methods of calculating the nonlinear hyperpolarizability, and showed that it can be used to explain light scattering experiments. This paper elaborates on this polarization theory

  1. Polarization experiments

    International Nuclear Information System (INIS)

    Halzen, F.

    1977-02-01

    In a theoretical review of polarization experiments two important points are emphasized: (a) their versatility and their relevance to a large variety of aspects of hadron physics (tests of basic symmetries; a probe of strong interaction dynamics; a tool for hadron spectroscopy); (b) the wealth of experimental data on polarization parameters in pp and np scattering in the Regge language and in the diffraction language. (author)

  2. Polarization measurement for internal polarized gaseous targets

    International Nuclear Information System (INIS)

    Ye Zhenyu; Ye Yunxiu; Lv Haijiang; Mao Yajun

    2004-01-01

    The authors present an introduction to internal polarized gaseous targets, polarization method, polarization measurement method and procedure. To get the total nuclear polarization of hydrogen atoms (including the polarization of the recombined hydrogen molecules) in the target cell, authors have measured the parameters relating to atomic polarization and polarized hydrogen atoms and molecules. The total polarization of the target during our measurement is P T =0.853 ± 0.036. (authors)

  3. 77 FR 68150 - Meeting of the SANE/SART AI/AN Initiative Committee

    Science.gov (United States)

    2012-11-15

    .../SART AI/AN Initiative Committee AGENCY: Office for Victims of Crime, Justice. ACTION: Notice of meeting... Response Team (SART) American Indian/Alaskan Native (AI/AN) Initiative (``SANE/SART AI/AN Initiative... violence within AI/AN communities. Dates and Locations: The meeting will be held on the reservation of the...

  4. Data of evolutionary structure change: 1AIFL-2AI0L [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available /ss_2> 0 n> 1AIF L...n> 1AIFLn> VSSSI----SSSNL 2AI0 Ln> 2AI0L...1AIFL-2AI0L 1AIF 2AI0 L L DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...line> SER CA 273 SER CA 260 ASN CA 337 LEU CA 408

  5. Data of evolutionary structure change: 1AIFA-2AI0O [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available s_2> 0 n> 1AIF A...n> 1AIFAn> VSSSI----SSSNL n> 2AI0 n>O 2AI...1AIFA-2AI0O 1AIF 2AI0 A O DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...e>SER CA 251 SER CA 276 SER CA 258 ASN CA 337 LEU CA 410

  6. Data of evolutionary structure change: 1AIFH-2AI0K [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available > 0 n> 1AIF n>H ...n>1AIFHn> VAHPA-SSTKV n> 2AI0 n>K 2AI...1AIFH-2AI0K 1AIF 2AI0 H K EVKLQESGGGLVQPGGSMKLSCVASGFTFNNYWMSWVRQ...SCAASGFTFRNYGMSWVRQTPEKRLEWVAAIS--GNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARH

  7. Data of evolutionary structure change: 1AIFA-2AI0L [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 2> 0 n> 1AIF n>A ...n>1AIFAn> VSSSI----SSSNL...n> 2AI0 n>L 2AI...1AIFA-2AI0L 1AIF 2AI0 A L DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...SER CA 251 SER CA 276 SER CA 258 ASN CA 337 LEU CA 410

  8. Response to long-period seismic waves recorded by broadband seismometer and pore pressure sensor at IODP Site C0002, Nankai Trough

    Science.gov (United States)

    Kitada, K.; Araki, E.; Kimura, T.; Saffer, D. M.

    2013-12-01

    Long term in situ monitoring of seismic activity, slow slip event, and pore fluid behavior around mega earthquake zone is important for understanding the processes of earthquake generation and strain accumulation. In order to characterize the response to long-period seismic waves, we compared waveforms and hydroseismograms recorded by broadband seismometer and pore pressure transducers, respectively, which were installed at IODP Site C0002 in the Nankai Trough Kumano Basin. The borehole monitoring system sensor array at Site C0002 is designed to collect multiparameter observations covering a dynamic range of events, including local microearthquakes, low frequency earthquakes, and large-scale earthquakes similar to the Tonankai earthquake. The suite of sensors for the downhole portion of the observatory includes a broadband seismometer (CMG3TBD, Guralp Systems Ltd.) with sampling rate of 100Hz at the depth of 907mbsf, and four pressure ports connected to pressure gauges located at 948mbsf, 917mbsf, 766mbsf, and at the seafloor. The sampling rate of the data logger was set to 1Hz after successful connection to the DONET seafloor cable network for real-time monitoring on 24 Jan 2013. Since then, we processed 12 earthquakes between a moment magnitude of 6.5 to 8.3. In addition to the comparison of long-period surface waves waveform and pressure data, we compared the records with theoretical strain seismograms. The latter were calculated by normal mode summation using the earth model PREM of Dziewonski and Anderson (1981). A Butterworth bandpass filter was applied to the records with cut-off frequencies of 0.003 and 0.1 Hz. Our initial results indicate that the hydroseismograms correspond well with the vertical rather than the horizontal (radial and transverse) components in seismic data. The observed hydroseismogram have a good correlation with the predicted volumetric strain seismogram, especially for the Okhotsk (2013/05/24 14:17UT, Mw8.3, 632km depth), the Chishima

  9. Long-period amplification in deep alluvial basins and consequences for site-specific probabilistic seismic-hazard: the case of Castelleone in the Po Plain (Northern Italy)

    Science.gov (United States)

    Barani, S.; Mascandola, C.; Massa, M.; Spallarossa, D.

    2017-12-01

    The recent Emilia seismic sequence (Northern Italy) occurred at the end of the first half of 2012 with main shock of Mw6.1 highlighted the importance of studying site effects in the Po Plain, the larger and deeper sedimentary basin in Italy. As has long been known, long-period amplification related to deep sedimentary basins can significantly affect the characteristics of the ground-motion induced by strong earthquakes. It follows that the effects of deep sedimentary deposits on ground shaking require special attention during the definition of the design seismic action. The work presented here analyzes the impact of deep-soil discontinuities on ground-motion amplification, with particular focus on long-period probabilistic seismic-hazard assessment. The study focuses on the site of Castelleone, where a seismic station of the Italian National Seismic Network has been recording since 2009. Our study includes both experimental and numerical site response analyses. Specifically, extensive active and passive geophysical measurements were carried out in order to define a detailed shear-wave velocity (VS) model to be used in the numerical analyses. These latter are needed to assess the site-specific ground-motion hazard. Besides classical seismic refraction profiles and multichannel analysis of surface waves, we analyzed ambient vibration measurements in both single and array configurations. The VS profile was determined via joint inversion of the experimental phase-velocity dispersion curve with the ellipticity curve derived from horizontal-to-vertical spectral ratios. The profile shows two main discontinuities at depths of around 160 and 1350 m, respectively. The probabilistic site-specific hazard was assessed in terms of both spectral acceleration and displacement. A partially non-ergodic approach was adopted. We have found that the spectral acceleration hazard is barely sensitive to long-period (up to 10 s) amplification related to the deeper discontinuity whereas the

  10. Long-period seismicity reveals magma pathways above a laterally propagating dyke during the 2014-15 Bárðarbunga rifting event, Iceland

    Science.gov (United States)

    Woods, Jennifer; Donaldson, Clare; White, Robert S.; Caudron, Corentin; Brandsdóttir, Bryndís; Hudson, Thomas S.; Ágústsdóttir, Thorbjörg

    2018-05-01

    The 2014-15 Bárðarbunga-Holuhraun rifting event comprised the best-monitored dyke intrusion to date and the largest eruption in Iceland in 230 years. A huge variety of seismicity was produced, including over 30,000 volcano-tectonic earthquakes (VTs) associated with the dyke propagation at ∼6 km depth below sea level, and large-magnitude earthquakes accompanying the collapse of Bárðarbunga caldera. We here study the long-period seismicity associated with the rifting event. We systematically detect and locate both long-period events (LPs) and tremor during the dyke propagation phase and the first week of the eruption. We identify clusters of highly similar, repetitive LPs, which have a peak frequency of ∼1 Hz and clear P and S phases followed by a long-duration coda. The source mechanisms are remarkably consistent between clusters and also fundamentally different to those of the VTs. We accurately locate LP clusters near each of three ice cauldrons (depressions formed by basal melting) that were observed on the surface of Dyngjujökull glacier above the path of the dyke. Most events are in the vicinity of the northernmost cauldron, at shallower depth than the VTs associated with lateral dyke propagation. At the two northerly cauldrons, periods of shallow seismic tremor following the clusters of LPs are also observed. Given that the LPs occur at ∼4 km depth and in swarms during times of dyke-stalling, we infer that they result from excitation of magmatic fluid-filled cavities and indicate magma ascent. We suggest that the tremor is the climax of the vertical melt movement, arising from either rapid, repeated excitation of the same LP cavities, or sub-glacial eruption processes. This long-period seismicity therefore represents magma pathways between the depth of the dyke-VT earthquakes and the surface. Notably, we do not detect tremor associated with each cauldron, despite melt reaching the base of the overlying ice cap, a concern for hazard monitoring.

  11. Proceedings of conference on AI applications in physical sciences

    International Nuclear Information System (INIS)

    1993-01-01

    A Conference cum workshop on AI applications in Physical Sciences was organised by the Indian Physics Association at Bhabha Atomic Research Centre, Bombay during January 15-17, 1992. It was held in memory of Late Shri S.N. Seshadri, who was the moving spirit behind self reliance in instrumentation development for research and industry. The two day conference which was followed by one day workshop covered the following broad spectrum of topics in Artificial Intelligence: AI Tools and Techniques, Neural Networks, Robotics and Machine Vision, Fuzzy Control and Applications, Natural Language and Speech Processing, Knowledge based Systems, and AI and Allied applications. The conference dealt with recent advances and achievements in AI. It provided a forum for the exchange of valuable information and expertise in this fast emerging field. Over 200 scientists, engineers and computer professionals from various universities, R and D institutes and industries actively participated. 45 contributed papers and 8 invited talks were presented in the symposium. The volume contains selected papers which were contributed by the participants. Some of them dealt with AI applications in nuclear science and technology. (original)

  12. Present status of application of AI in nuclear industry

    International Nuclear Information System (INIS)

    Kitamura, Masaharu

    1989-01-01

    Artificial intelligence (AL) techniques have been introduced actively in the nuclear industry in pursuit of increased safety and efficiency. The present report outlines some AI techniques currently used in nuclear facilities. This type of techniques have increasingly been introduced to such areas as design, construction, operation, maintenance, quality control and analysis. Most of them use knowledge engineering techniques including expert systems. Positive efforts at research and application of various more advance AI techniaues have started recently. For application of AI techniques, activities in nuclear power plants can be divided into two groups. One includes 'analytical' activities such as operation, maintenance and analysis, while the other includes 'synthetic' activities such as design, construction and fuel control. The most important AI technology for the analytical activities is diagnosis. Thus the report outlines major processes to which diagnostic techniques are applicable, and knowledge description and inference methods used for diagnosis. For AI techniques for synthetic activities, some problems and possible solutions are addressed. Development efforts in and outside Japan are also outlined. (Nogami, K.)

  13. Discovering Knowledge from AIS Database for Application in VTS

    Science.gov (United States)

    Tsou, Ming-Cheng

    The widespread use of the Automatic Identification System (AIS) has had a significant impact on maritime technology. AIS enables the Vessel Traffic Service (VTS) not only to offer commonly known functions such as identification, tracking and monitoring of vessels, but also to provide rich real-time information that is useful for marine traffic investigation, statistical analysis and theoretical research. However, due to the rapid accumulation of AIS observation data, the VTS platform is often unable quickly and effectively to absorb and analyze it. Traditional observation and analysis methods are becoming less suitable for the modern AIS generation of VTS. In view of this, we applied the same data mining technique used for business intelligence discovery (in Customer Relation Management (CRM) business marketing) to the analysis of AIS observation data. This recasts the marine traffic problem as a business-marketing problem and integrates technologies such as Geographic Information Systems (GIS), database management systems, data warehousing and data mining to facilitate the discovery of hidden and valuable information in a huge amount of observation data. Consequently, this provides the marine traffic managers with a useful strategic planning resource.

  14. Response of Aspergillus niger Inoculated on Tomatoes Exposed to Vapor Phase Mustard Essential Oil for Short or Long Periods and Sensory Evaluation of Treated Tomatoes

    Directory of Open Access Journals (Sweden)

    Ana Elena Aguilar-González

    2017-01-01

    Full Text Available The inhibitory effect of mustard essential oil (EO in vapor phase against Aspergillus niger was evaluated in vitro and in vivo (in tomatoes. Mold response in tomatoes exposed for short or long periods to selected concentrations of mustard EO was also evaluated. Furthermore, a sensory evaluation was also performed among treated tomatoes and compared with nontreated ones. Minimum inhibitory concentration (MIC for the studied EO was determined by the inverted Petri dish method. MIC for the in vitro and in vivo tests for mustard EO was of 3.08 μL/Lair. In vitro and in vivo results demonstrate the effectiveness of vapors of mustard EO against A. niger. The studied EO contains highly volatile organic compounds with strong inhibitory effects, even when applied for short periods, and can consequently be considered a good alternative to traditional synthetic antimicrobials without detriment of selected sensory attributes.

  15. Fabrication of Long Period Gratings by Periodically Removing the Coating of Cladding-Etched Single Mode Optical Fiber Towards Optical Fiber Sensor Development

    Directory of Open Access Journals (Sweden)

    Joaquin Ascorbe

    2018-06-01

    Full Text Available Here, we present a novel method to fabricate long period gratings using standard single mode optical fibers (SMF. These optical devices were fabricated in a three-step process, which consisted of etching the SMF, then coating it with a thin-film and, the final step, which involved removing sections of the coating periodically by laser ablation. Tin dioxide was chosen as the material for this study and it was sputtered using a pulsed DC sputtering system. Theoretical simulations were performed in order to select the appropriate parameters for the experiments. The responses of two different devices to different external refractive indices was studied, and the maximum sensitivity obtained was 6430 nm/RIU for external refractive indices ranging from 1.37 to 1.39.

  16. High sensitive reflection type long period fiber grating biosensor for real time detection of thyroglobulin, a differentiated thyroid cancer biomarker: the Smart Health project

    Science.gov (United States)

    Quero, G.; Severino, R.; Vaiano, P.; Consales, M.; Ruvo, M.; Sandomenico, A.; Borriello, A.; Giordano, M.; Zuppolini, S.; Diodato, L.; Cutolo, A.; Cusano, A.

    2015-09-01

    We report the development of a reflection-type long period fiber grating (LPG) biosensor able to perform the real time detection of thyroid cancer markers in the needle washout of fine-needle aspiration biopsy. A standard LPG is first transformed in a practical probe working in reflection mode, then it is coated by an atactic-polystyrene overlay in order to increase its surrounding refractive index sensitivity and to provide, at the same time, the desired interfacial properties for a stable bioreceptor immobilization. The results provide a clear demonstration of the effectiveness and sensitivity of the developed biosensing platform, allowing the in vitro detection of human Thyroglobulin at sub-nanomolar concentrations.

  17. Optical pulse multiplication and temporal coding using true time delay achieved by long-period fiber gratings in dispersion compensating fiber.

    Science.gov (United States)

    Eom, Tae Joong; Kim, Sun-Jong; Kim, Tae-Young; Park, Chang-Soo; Lee, Byeong

    2004-12-27

    We present an optical pulse multiplication and a temporal coding method for OCDMA systems. The true time delay among the pulses was obtained by utilizing the difference in the propagation speeds of the core and the co-propagating cladding modes coupled by long-period fiber gratings. By cascadin gratings we could get an equally spaced 40 GHz pulse train from a 10 GHz train. Various coding and decoding of a pulse train were possible by controlling the separations among the gratings. The dispersion compensating fiber having an inner cladding structure enabled to have the gratings that were not sensitive to the polymer jacket of the fiber and allowed shortening the device length.

  18. Fabrication of Long Period Gratings by Periodically Removing the Coating of Cladding-Etched Single Mode Optical Fiber Towards Optical Fiber Sensor Development.

    Science.gov (United States)

    Ascorbe, Joaquin; Corres, Jesus M; Del Villar, Ignacio; Matias, Ignacio R

    2018-06-07

    Here, we present a novel method to fabricate long period gratings using standard single mode optical fibers (SMF). These optical devices were fabricated in a three-step process, which consisted of etching the SMF, then coating it with a thin-film and, the final step, which involved removing sections of the coating periodically by laser ablation. Tin dioxide was chosen as the material for this study and it was sputtered using a pulsed DC sputtering system. Theoretical simulations were performed in order to select the appropriate parameters for the experiments. The responses of two different devices to different external refractive indices was studied, and the maximum sensitivity obtained was 6430 nm/RIU for external refractive indices ranging from 1.37 to 1.39.

  19. An application of A.I. to organizational learning in an operating NPP

    International Nuclear Information System (INIS)

    Poumadere, M.

    1990-01-01

    An A.I. type approach is developed in order to rapidly and systematically integrate the various elements of human and structural learning (e.g. cognitive representations, feedback and interactions within an operating NPP. The objective followed is to develop throughout a functioning plant and over a relatively brief period (6 weeks), a measurement and diagnostic program involving all plant personnel. Measurements are positioned within a three-dimensional polarized factor space and feedback to participants with the transfer of analytic tools. This program has been applied in a French nuclear power plant. The gain in organizational knowledge is tested. One year after first-wave measures, measurement is repeated with the same population and the same objects. Interim evolutions along NPP criteria (e.g. lost-time accident rate) are observed. The parallel evolutions between participant diagnostic data and operating criteria seem to indicate an improved level of organizational learning

  20. Identification and quality assessment of beverages using a long period grating fibre-optic sensor modified with a mesoporous thin film

    Directory of Open Access Journals (Sweden)

    Sergiy Korposh

    2014-08-01

    Full Text Available In this study, an optical fibre long period grating (LPG sensor functionalised with a mesoporous thin film was employed for the identification and quality assessment of beverages. The principle of the discrimination of beverages using an LPG sensor is based on the measurement of the change in refractive index of a sensitive film, induced by the binding of the chemical compounds present in the beverage. The sensitive film deposited onto the LPG consisted of poly(allylamine hydrochloride (PAH and silica nanospheres (SiO2 NPs with diameters ranging from 40 nm to 50 nm. PAH imparts selectivity, while the SiO2 NPs endow the film with high porosity and enhanced sensitivity. In this study, five different types of beverages, red and white wines, brandy, nihonshyu (sake, a Japanese rice wine, and shochu (a Japanese distilled beverage, prepared via distillation and fermentation, were used to assess the capability of the sensor to identify the origin of the beverages. In addition, a selection of red wines was used to evaluate the use of the sensor in the assessment of the quality of beverages. The results obtained were benchmarked against those obtained using gas chromatography–mass spectrometry for the determination of volatile compounds contributing to the flavours of a set of red wines. Principal component analysis (PCA was employed for data analysis. This approach enabled both quality assessment of beverages and identification of the methods and materials used for their preparation. Keywords: Long period grating, Mesoporous thin film, Layer-by-layer, Quality assessment, Beverages

  1. A new look inside planetary nebula LoTr 5: a long-period binary with hints of a possible third component

    Science.gov (United States)

    Aller, A.; Lillo-Box, J.; Vučković, M.; Van Winckel, H.; Jones, D.; Montesinos, B.; Zorotovic, M.; Miranda, L. F.

    2018-05-01

    LoTr 5 is a planetary nebula with an unusual long-period binary central star. As far as we know, the pair consists of a rapidly rotating G-type star and a hot star, which is responsible for the ionization of the nebula. The rotation period of the G-type star is 5.95 d and the orbital period of the binary is now known to be ˜2700 d, one of the longest in central star of planetary nebulae. The spectrum of the G central star shows a complex H α double-peaked profile which varies with very short time-scales, also reported in other central stars of planetary nebulae and whose origin is still unknown. We present new radial velocity observations of the central star which allow us to confirm the orbital period for the long-period binary and discuss the possibility of a third component in the system at ˜129 d to the G star. This is complemented with the analysis of archival light curves from Super Wide Angle Search for Planets, All Sky Automated Survey, and Optical Monitoring Camera. From the spectral fitting of the G-type star, we obtain an effective temperature of Teff = 5410 ± 250 K and surface gravity of log g = 2.7 ± 0.5, consistent with both giant and subgiant stars. We also present a detailed analysis of the H α double-peaked profile and conclude that it does not present correlation with the rotation period and that the presence of an accretion disc via Roche lobe overflow is unlikely.

  2. A Simple Response Evaluation Method for Base-Isolation Building-Connection Hybrid Structural System under Long-Period and Long-Duration Ground Motion

    Directory of Open Access Journals (Sweden)

    Kohei Hayashi

    2018-02-01

    Full Text Available An innovative hybrid control building system of base-isolation and building-connection has been proposed in the previous study. This system has two advantages, (i to resist an impulsive earthquake input through the base-isolation system and (ii to withstand a long-duration earthquake input through the building-connection system. A simple response evaluation method without the need of non-linear time–history response analysis is proposed here for this hybrid building system under a long-period and long-duration ground motion. An analytical expression is derived in the plastic deformation of an elastic–perfectly plastic single-degree-of-freedom (SDOF model with viscous damping under the multi-impulse, which is the representative of long-period and long-duration ground motions. A transformation procedure of a base-isolation building-connection hybrid structural system into an SDOF model is proposed by introducing two steps, one is the reduction of the main base-isolated building to an SDOF system, and the other is the reduction of the connecting oil dampers supported on a free-wall to an oil damper with a newly introduced compensation factor on a rigid wall. Application of the analytical expression of the plastic deformation to the reduced SDOF model including the compensation factor on the connecting oil dampers enables the development of a simplified, but rather accurate response evaluation method. The time–history response analysis of the multi-degree-of-freedom model and the comparison with the proposed simplified formula make clear the accuracy and reliability of the proposed simplified response evaluation method.

  3. Sources of polarized neutrons

    International Nuclear Information System (INIS)

    Walter, L.

    1983-01-01

    Various sources of polarized neutrons are reviewed. Monoenergetic source produced with unpolarized or polarized beams, white sources of polarized neutrons, production by transmissions through polarized hydrogen targets and polarized thermal neutronsare discussed, with appropriate applications included. (U.K.)

  4. A framework for AI-based nuclear design support system

    International Nuclear Information System (INIS)

    Furuta, Kazuo; Kondo, Shunsuke

    1991-01-01

    Nowadays many computer programs are being developed and used for the analytic tasks in nuclear reactor design, but experienced designers are still responsible for most of the synthetic tasks which are not amenable to algorithmic computer processes. Artificial intelligence (AI) is a promising technology to deal with these intractable tasks in design. In development of AI-based design support systems, it is desirable to choose a comprehensive framework based on the scientific theory of design. In this work a framework for AI-based design support systems for nuclear reactor design will be proposed based on an exploration model of design. The fundamental architectures of this framework will be described especially on knowledge representation, context management and design planning. (author)

  5. Analysis of raw AIS spectrum recordings from a LEO satellite

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter

    2014-01-01

    The AAUSAT3 satellite is a 1U cubesat, which has been developed by students at Aalborg University, Denmark in collaboration with the Danish Maritime Authority. The satellite was launched in February 2013 on a mission to monitor ships from space using their AIS broadcast signals as an indication...... of position. The SDR receiver developed to listen for these AIS signals also allows for sampling and storing of the raw intermediate frequency spectrum, which has been used in order to map channel utilization over the areas of interest for the mission, which is mainly the arctic regions. The SDR based...... receiver used onboard the satellite is using a single chip front-end solution, which down converts the AIS signal located around 162 MHz into an intermediate frequency, with a up to 200 kHz bandwidth. This I/F signal is sampled with a 750 kSPS A/D converter and further processed by an Analog Devices DSP...

  6. Framework for AI-based nuclear reactor design support system

    International Nuclear Information System (INIS)

    Furuta, Kazuo; Kondo, Shunsuke

    1992-01-01

    Nowadays many computer programs are being developed and used for the analytic tasks in nuclear reactor design, but experienced designers are still responsible for most of the synthetic tasks which are not amenable to algorithmic computer processes. Artificial intelligence (AI) is a promising technology to deal with these intractable tasks in design. In development of AI-based design support systems, it is desirable to choose a comprehensive framework based on the scientific theory of design. In this work a framework for AI-based design support systems for nuclear reactor design will be proposed based on an explorative abduction model of design. The fundamental architectures of this framework will be described especially on knowledge representation, context management and design planning. (author)

  7. Towards AI-powered personalization in MOOC learning

    Science.gov (United States)

    Yu, Han; Miao, Chunyan; Leung, Cyril; White, Timothy John

    2017-12-01

    Massive Open Online Courses (MOOCs) represent a form of large-scale learning that is changing the landscape of higher education. In this paper, we offer a perspective on how advances in artificial intelligence (AI) may enhance learning and research on MOOCs. We focus on emerging AI techniques including how knowledge representation tools can enable students to adjust the sequence of learning to fit their own needs; how optimization techniques can efficiently match community teaching assistants to MOOC mediation tasks to offer personal attention to learners; and how virtual learning companions with human traits such as curiosity and emotions can enhance learning experience on a large scale. These new capabilities will also bring opportunities for educational researchers to analyse students' learning skills and uncover points along learning paths where students with different backgrounds may require different help. Ethical considerations related to the application of AI in MOOC education research are also discussed.

  8. AI-guided parameter optimization in inverse treatment planning

    International Nuclear Information System (INIS)

    Yan Hui; Yin Fangfang; Guan Huaiqun; Kim, Jae Ho

    2003-01-01

    An artificial intelligence (AI)-guided inverse planning system was developed to optimize the combination of parameters in the objective function for intensity-modulated radiation therapy (IMRT). In this system, the empirical knowledge of inverse planning was formulated with fuzzy if-then rules, which then guide the parameter modification based on the on-line calculated dose. Three kinds of parameters (weighting factor, dose specification, and dose prescription) were automatically modified using the fuzzy inference system (FIS). The performance of the AI-guided inverse planning system (AIGIPS) was examined using the simulated and clinical examples. Preliminary results indicate that the expected dose distribution was automatically achieved using the AI-guided inverse planning system, with the complicated compromising between different parameters accomplished by the fuzzy inference technique. The AIGIPS provides a highly promising method to replace the current trial-and-error approach

  9. Procedure for Marine Traffic Simulation with AIS Data

    Directory of Open Access Journals (Sweden)

    Rina Miyake

    2015-03-01

    Full Text Available It is essential to evaluate safety of marine traffic for the improvement of efficiency and safety of marine traffic. Spread of AIS makes observation of actual marine traffic more easily and faster than before. Besides, description of collision avoidance behaviours of ships are indispensable to simulate a realistic marine traffic. It is important to develop and implement an algorithm of collision avoidance corresponding to a target traffic or target area into the marine traffic simulation because actual actions for collision avoidance depend on circumstances where ships are sailing. The authors developed an automated marine traffic simulation system with AIS data. And in this paper, we proposed a series of systematic procedures for marine traffic simulation including analysing for collision avoidance behaviours using AIS data.

  10. Application of AI technology to nuclear plant operations

    International Nuclear Information System (INIS)

    Sackett, J.I.

    1988-01-01

    In this paper, applications of Artificial Intelligence (AI) Technology to nuclear-power plant operation are reviewed. AI Technology is advancing rapidly and in the next five years is expected to enjoy widespread application to operation, maintenance, management and safety. Near term emphasis on a sensor validation, scheduling, alarm handling, and expert systems for procedural assistance. Ultimate applications are envisioned to culminate in autonomous control such as would be necessary for a power system in space, where automatic control actions are taken based upon reasoned conclusions regarding plant conditions, capability and control objectives

  11. AiGERM: A logic programming front end for GERM

    Science.gov (United States)

    Hashim, Safaa H.

    1990-01-01

    AiGerm (Artificially Intelligent Graphical Entity Relation Modeler) is a relational data base query and programming language front end for MCC (Mission Control Center)/STP's (Space Test Program) Germ (Graphical Entity Relational Modeling) system. It is intended as an add-on component of the Germ system to be used for navigating very large networks of information. It can also function as an expert system shell for prototyping knowledge-based systems. AiGerm provides an interface between the programming language and Germ.

  12. Mission secrète polar : adapté en français facile

    CERN Document Server

    Pouy, Jean-Bernard

    1998-01-01

    Un homme, condamné à sept ans de prison pour escroquerie à l'informatique, est provisoirement libéré par des agents de l'Etat pour retrouver son ex-femme, devenue entre-temps l'ennemie publique numéro 1.

  13. Coup de coeur polar : adapté en français facile

    CERN Document Server

    Delteil, Gérard

    1998-01-01

    Personne n'est éternel, y compris les grands patrons de société. Les employés de la Soficad le savent bien. Un matin, ils découvrent leur directeur mort dans son bureau. Apparemment, il s'agit d'une crise cardiaque. Cependant, l'inspecteur Buzet n'est pas tout à fait convaincu. Certains détails lui font penser à un meurtre soigneusement préparé. D'ailleurs, la victime n'avait pas que des amis. À commencer par sa propre femme. Mais Buzet le sait le meurtrier n'est pas toujours celui qu'on croit.

  14. The enhanced nodal equilibrium ocean tide and polar motion

    Science.gov (United States)

    Sanchez, B. V.

    1979-01-01

    The tidal response of the ocean to long period forcing functions was investigated. The results indicate the possibility of excitation of a wobble component with the amplitude and frequency indicated by the data. An enhancement function for the equilibrium tide was postulated in the form of an expansion in zonal harmonics and the coefficients of such an expansion were estimated so as to obtain polar motion components of the required magnitude.

  15. Polarization study

    International Nuclear Information System (INIS)

    Nurushev, S.B.

    1989-01-01

    Brief review is presented of the high energy polarization study including experimental data and the theoretical descriptions. The mostimportant proposals at the biggest accelerators and the crucial technical developments are also listed which may become a main-line of spin physics. 35 refs.; 10 figs.; 4 tabs

  16. Polar Stratigraphy

    Science.gov (United States)

    1999-01-01

    These three images were taken on three different orbits over the north polar cap in April 1999. Each shows a different part of the same ice-free trough. The left and right images are separated by a distance of more than 100 kilometers (62 miles). Note the similar layers in each image.

  17. A Note on the Lithuanian 2nd Sg. Ending "-ai."

    Science.gov (United States)

    Schmalstieg, William R.

    1980-01-01

    Discusses an attempt by Chr. S. Stang to establish a proto-Lithuanian present paradigm for the verb "megti" (to like), questioning the existence of the second singular form "-ai." Argues that the few examples of this form, all from a single Bible translation source, afford shaky support for its existence. (Executive Office of the AABS, 231 Miller…

  18. Exploring AI Language Assistants with Primary EFL Students

    Science.gov (United States)

    Underwood, Joshua

    2017-01-01

    The main objective of this study was to identify ways to incorporate voice-driven Artificial Intelligence (AI) effectively in classroom language learning. This nine month teacher-led design research study employed technology probes (Amazon's Alexa, Apple's Siri, Google voice search) and co-design methods with a class of primary age English as a…

  19. Archiving AIS messages in a Geo-DBMS

    NARCIS (Netherlands)

    Meijers, B.M.; Quak, C.W.; van Oosterom, P.J.M.; Bregt, Arnold; Sarjakoski, Tapani; Lammeren, Ron van; Rip, Frans

    2017-01-01

    This paper reports on the result of two studies for using a geographical database management system for archiving Automated Identification System (AIS) message data. In this paper, we analyse the storage (using MongoDB and PostgreSQL) and we give a more in-depth description of a possible data model

  20. PASTURE ffPROVEMENT POSSIBILTTIES IN EFFECTIVE AI{IMAL ...

    African Journals Online (AJOL)

    PASTURE ffPROVEMENT POSSIBILTTIES IN EFFECTIVE AI{IMAL PRODUCTION SYSTEMS. P. de V. Booysen. University of Natal, King George V Avenue, Durban. (Key words: .... inherent in biotic simplification is the danger of increased susceptibility of the abiotic component to degradation. So as the agriculturalist ...

  1. The hidden dangers of experimenting in distributed AI

    NARCIS (Netherlands)

    Meyer, A.P.; Smit, A.; Kempen, M.; Wijngaards, N.

    2006-01-01

    Research on multi-agent systems often involves experiments, also in situations where humans interact with agents. Consequently, the field of experimental (human) sciences becomes more and more relevant. This paper clarifies how things can and often do go wrong in distributed AI experiments. We show

  2. The 2010 Mario AI Championship: Level Generation Track

    DEFF Research Database (Denmark)

    Shaker, Noor; Togelius, Julian; Yannakakis, Georgios N.

    2011-01-01

    The Level Generation Competition, part of the IEEE CIS-sponsored 2010 Mario AI Championship, was to our knowledge the world’s first procedural content generation competition. Competitors participated by submitting level generators — software that generates new levels for a version of Super Mario...

  3. AIS reception from a CubeSat in LEO

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Nielsen, Jens Frederik Dalsgaard

    2013-01-01

    The primary payloads on board the AAUSAT3 satellite are two different AIS receivers, one is a traditional hardware-based receiver, the other one is a software-defined radio receiver. The hardware-based receiver has been developed around an ADF-7020 transceiver, with an appropriate LNA in front...... into a low-Earth orbit with a semi-major axis of 7156 km, i.e. 800 km altitude, near circular, dusk-dawn Sun-synchronous orbit. From this orbit the AIS antenna system, which consists of a dipole antenna, has a foot print diameter of approximately 6000 km. During the first pass over the primary ground station...... at Aalborg University, basic telemetry and the first few AIS messages were downloaded. During the first 14 days of the mission, the two receivers managed to detect more than 100,000 different AIS messages from ships all around the world, and more than 35,000 of these messages have been successfully...

  4. AI/Simulation Fusion Project at Lawrence Livermore National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Erickson, S.A.

    1984-04-25

    This presentation first discusses the motivation for the AI Simulation Fusion project. After discussing very briefly what expert systems are in general, what object oriented languages are in general, and some observed features of typical combat simulations, it discusses why putting together artificial intelligence and combat simulation makes sense. We then talk about the first demonstration goal for this fusion project.

  5. AI/Simulation Fusion Project at Lawrence Livermore National Laboratory

    International Nuclear Information System (INIS)

    Erickson, S.A.

    1984-01-01

    This presentation first discusses the motivation for the AI Simulation Fusion project. After discussing very briefly what expert systems are in general, what object oriented languages are in general, and some observed features of typical combat simulations, it discusses why putting together artificial intelligence and combat simulation makes sense. We then talk about the first demonstration goal for this fusion project

  6. Measuring the Value of AI in Space Science and Exploration

    Science.gov (United States)

    Blair, B.; Parr, J.; Diamond, B.; Pittman, B.; Rasky, D.

    2017-10-01

    FDL is tackling knowledge gaps useful to the space program by forming small teams of industrial partners, cutting-edge AI researchers and space science domain experts, and tasking them to solve problems that are important to NASA as well as humanity's future.

  7. On the homotopy equivalence of simple AI-algebras

    International Nuclear Information System (INIS)

    Aristov, O Yu

    1999-01-01

    Let A and B be simple unital AI-algebras (an AI-algebra is an inductive limit of C*-algebras of the form BigOplus i k C([0,1],M N i ). It is proved that two arbitrary unital homomorphisms from A into B such that the corresponding maps K 0 A→K 0 B coincide are homotopic. Necessary and sufficient conditions on the Elliott invariant for A and B to be homotopy equivalent are indicated. Moreover, two algebras in the above class having the same K-theory but not homotopy equivalent are constructed. A theorem on the homotopy of approximately unitarily equivalent homomorphisms between AI-algebras is used in the proof, which is deduced in its turn from a generalization to the case of AI-algebras of a theorem of Manuilov stating that a unitary matrix almost commuting with a self-adjoint matrix h can be joined to 1 by a continuous path consisting of unitary matrices almost commuting with h

  8. Artificial Intelligence: Is the Future Now for A.I.?

    Science.gov (United States)

    Ramaswami, Rama

    2009-01-01

    In education, artificial intelligence (AI) has not made much headway. In the one area where it would seem poised to lend the most benefit--assessment--the reliance on standardized tests, intensified by the demands of the No Child Left Behind Act of 2001, which holds schools accountable for whether students pass statewide exams, precludes its use.…

  9. Predicting Vessel Trajectories from Ais Data Using R

    Science.gov (United States)

    2017-06-01

    Source: Hampton (2009). A vessel operator with AIS is able to get useful information about the other vessels in the area by selecting a vessel icon ...random forest model on our computer. All calculations are done on a MacBook-Pro with 2.7GHz quad-core Intel Core i7, and 16GB of memory . H2O allows us

  10. LIVER FUNCTION CHANGES IN PATIENTS WITH SPONDYLOARTHRITIS TAKING NONSTEROIDAL ANTI-INFLAMMATORY DRUGS OVER A LONG PERIOD: RESULTS OF A 10-YEAR PROGRESS PROSPECTIVE STUDY

    Directory of Open Access Journals (Sweden)

    A. P. Rebrov

    2016-01-01

    Full Text Available Objective: to assess liver function changes in patients with spondyloarthritis (SpA taking NSAIDs regularly over a long period.Patients and methods. The data obtained during a 10-year PROGRESS prospective single-center cohort study of functional status, activity, and comorbidity (including gastrointestinal tract diseases in patients with SpA were analyzed. The data of 363 SpA patients receiving NSAIDs regularly over a long period and followed up for 10 years were also explored. The changes that had occurred over a decade in the liver enzyme levels, the number of discontinued NSAID treatments because of a persistent increase in liver enzyme levels, and the number of prescriptions of hepatoprotective agents were analyzed.Results. For 10 years, 18 patients with SpA discontinued their NSAID intake due to elevated liver enzyme levels (≥3 times greater than the reference value; during that time, the same increase in enzyme levels was observed in 2 healthy individuals (χ2 =1.39; p=0.2. In the patients with SpA as compared to the healthy individuals, the relative risk of abnormal liver function was 1.19 (95% CI, 1.009–1.405; odds ratio was 2.9 (95% CI, 0.65–12.95. There was no increased risk for discontinuation of some NSAIDs, including nimesulide (χ2 =0.03, p=0.85, the frequency of using hepatoprotective drugs was proved to be highest for diclofenac sodium, ibuprofen, nimesulide, and ketoprofen.Conclusion. The regular long-term (as long as 10 years use of NSAIDs to treat SpA is associated with treatment discontinuation because of elevated enzyme levels in every 10 patients. The maximum rate of discontinuation of NSAIDs due to a persistent increase in liver enzyme levels is observed 6–8 years after their regular use, so long-term NSAID therapy requires continuous monitoring of hepatic safety. The longterm intake of nimesulide, as compared with other NSAIDs, is shown to be unassociated with the higher rate of its discontinuation because of

  11. Formation of an 18R long-period stacking ordered structure in rapidly solidified Mg88Y8Zn4 alloy

    International Nuclear Information System (INIS)

    Garcés, Gerardo; Requena, Guillermo; Tolnai, Domonkos; Pérez, Pablo; Medina, Judit; Stark, Andreas; Schell, Norbert; Adeva, Paloma

    2016-01-01

    The formation of the long-period stacking ordered structure (LPSO) in a Mg 88 Y 8 Zn 4 (at%) ribbon produced by melt spinning was studied using high energy X-ray synchrotron radiation diffraction during in-situ isochronal heating and transmission electron microscopy. The microstructure of the rapidly solidified ribbons is characterised by fine magnesium grains with yttrium and zinc in solid solution and primary 18R LPSO-phase segregated at grain boundaries. Using differential scanning calorimetry, a strong exothermal peak was observed around 300 °C which was associated with the development of the 18R-type LPSO-phase in the magnesium grains. The apparent activation energy calculated using the Kissinger model was 125 KJmol −1 and it is related to simultaneous diffusion of Y and Zn through magnesium basal plane. - Highlights: •The formation of the LPSO phase in rapidly solidified ribbons was studied. •The formation of the 18R LPSO starts at around 300 °C. •LPSO formation have to steps: Stacking faults along basal plane and then growth of 18R structure along the c direction.

  12. Microfracture behaviour of extruded Mg–Zn–Y alloys containing long-period stacking ordered structure at room and elevated temperatures

    International Nuclear Information System (INIS)

    Mine, Yoji; Yoshimura, Hajime; Matsuda, Mitsuhiro; Takashima, Kazuki; Kawamura, Yoshihito

    2013-01-01

    We studied the fracture behaviour of extruded Mg–Zn–Y alloys at room temperature (RT) and at 523 K using microfracture testing. An Mg 97 Zn 1 Y 2 alloy was used to obtain two-phase specimens consisting of α-Mg and long-period stacking ordered (LPSO) structure phases, and an Mg 88 Zn 5 Y 7 alloy was used to obtain specimens consisting of an LPSO phase. The microfracture testing of the two-phase specimen revealed that the fracture behaviour changed from brittle to ductile as the testing temperature increased. By contrast, the LPSO-phase specimen remained brittle even at the elevated temperature and the intrinsic fracture toughness values obtained at both testing temperatures were nearly identical. Ex situ transmission electron microscopy of the two-phase specimen showed that mechanical twinning in the α-Mg phase did not occur at the elevated temperature, although it was activated at RT. This suggests that the plastic deformation mode in the α-Mg phase plays a crucial part in the enhanced crack growth resistance of the two-phase alloy at the elevated temperature

  13. Field observation of morpho-dynamic processes during storms at a Pacific beach, Japan: role of long-period waves in storm-induced berm erosion.

    Science.gov (United States)

    Mizuguchi, Masaru; Seki, Katsumi

    2015-01-01

    Many ultrasonic wave gages were placed with a small spacing across the swash zone to monitor either sand level or water level. Continuous monitoring conducted for a few years enabled the collection of data on the change in wave properties as well as swash-zone profiles. Data sets including two cases of large-scale berm erosion were analyzed. The results showed that 1) shoreline erosion started when high waves with significant power in long-period (1 to 2 min.) waves reached the top of a well-developed berm with the help of rising tide; 2) the beach in the swash zone was eroded with higher elevation being more depressed, while the bottom elevation just outside the swash zone remained almost unchanged; and 3) erosion stopped in a few hours after the berm was completely eroded or the swash-zone slope became uniformly mild. These findings strongly suggest that long waves play a dominant role in the swash-zone dynamics associated with these erosional events.

  14. Manufacturing a Long-Period Grating with Periodic Thermal Diffusion Technology on High-NA Fiber and Its Application as a High-Temperature Sensor.

    Science.gov (United States)

    Shen, Xiang; Dai, Bin; Xing, Yingbin; Yang, Luyun; Li, Haiqing; Li, Jinyan; Peng, Jingang

    2018-05-08

    We demonstrated a kind of long-period fiber grating (LPFG), which is manufactured with a thermal diffusion treatment. The LPFG was inscribed on an ultrahigh-numerical-aperture (UHNA) fiber, highly doped with Ge and P, which was able to easily diffuse at high temperatures within a few seconds. We analyzed how the elements diffused at a high temperature over 1300 °C in the UHNA fiber. Then we developed a periodically heated technology with a CO₂ laser, which was able to cause the diffusion of the elements to constitute the modulations of an LPFG. With this technology, there is little damage to the outer structure of the fiber, which is different from the traditional LPFG, as it is periodically tapered. Since the LPFG itself was manufactured under high temperature, it can withstand higher temperatures than traditional LPFGs. Furthermore, the LPFG presents a higher sensitivity to high temperature due to the large amount of Ge doping, which is approximately 100 pm/°C. In addition, the LPFG shows insensitivity to the changing of the environment’s refractive index and strain.

  15. Array measurements of long-period microtremors in southwestern Kanto plain, Japan; Kanto heiya nanseibu ni okeru yaya choshuki bido no array kansoku

    Energy Technology Data Exchange (ETDEWEB)

    Yamanaka, H; Sato, H; Kurita, K; Seo, K [Tokyo Institute of Technology, Tokyo (Japan)

    1997-05-27

    Array measurements of long-period microtremors were carried out in the southwestern part of Kanto Plain, Japan, to obtain S-wave velocity structures in sedimentary beds as fundamental data for estimating long-term strong ground motion in Kanto Plain. The major component in a long-term seismic motion observed in Kanto Plain is the surface wave. According to the result of observations on Love wave by Kinoshita et al, the wavelengths of the surface waves of a long-term cycle are 10 to 20 km. Therefore, if an array observation is to be performed at intervals of about two wavelengths, about 40 points will be required to cover the entire Kanto plain. The final phase velocity is decided by averaging phase velocities of each cycle obtained for each data set. The acquired phase velocities are analyzed inversely by using a genetic algorithm to derive the S-wave velocities at each observation point. The present microtremor array observation has used 13 points in the southwestern part of Kanto Plain to acquire S-wave velocity (Vs) distribution in sedimentary beds. It was made clear that beds with Vs of 1.0 km/s and Vs of 1.5 km/s exist in this area between the surface bed and the seismic foundation with Vs of about 3 km/s. 10 refs., 10 figs., 1 tab.

  16. Tuning properties of long-period gratings by plasma post-processing of their diamond-like carbon nano-overlays

    Science.gov (United States)

    Smietana, M.; Koba, M.; Mikulic, P.; Bock, W. J.

    2014-11-01

    This work presents an application of reactive ion etching (RIE) for effective tuning of spectral response and the refractive index (RI) sensitivity of diamond-like carbon (DLC) nano-coated long-period gratings (LPGs). When oxygen plasma is applied the technique allows for an efficient and well controlled etching of hard and chemically resistant DLC films deposited on optical fibers. We show that optical properties of DLC, especially its refractive index, strongly depend on thickness of the film when it is thinner than 150 nm. The effect of DLC nano-coating deposition and etching on spectral properties of the LPGs is discussed. We have correlated the DLC properties with the shift of the LPG resonance wavelength and have found that both deposition and etching processes took place less effectively than on the electrode when the LPG sample was held above the electrode in the plasma reactor. An advantage of plasma-based etching is a capability for post-processing of the nano-coated structures with a good precision, as well as cleaning the samples and their re-coating according to requested needs. Moreover, the application of RIE allows for post-fabrication tuning of RI sensitivity of the DLC nano-coated LPGs.

  17. Tuning properties of long-period gratings by plasma post-processing of their diamond-like carbon nano-overlays

    International Nuclear Information System (INIS)

    Smietana, M; Koba, M; Mikulic, P; Bock, W J

    2014-01-01

    This work presents an application of reactive ion etching (RIE) for effective tuning of spectral response and the refractive index (RI) sensitivity of diamond-like carbon (DLC) nano-coated long-period gratings (LPGs). When oxygen plasma is applied the technique allows for an efficient and well controlled etching of hard and chemically resistant DLC films deposited on optical fibers. We show that optical properties of DLC, especially its refractive index, strongly depend on thickness of the film when it is thinner than 150 nm. The effect of DLC nano-coating deposition and etching on spectral properties of the LPGs is discussed. We have correlated the DLC properties with the shift of the LPG resonance wavelength and have found that both deposition and etching processes took place less effectively than on the electrode when the LPG sample was held above the electrode in the plasma reactor. An advantage of plasma-based etching is a capability for post-processing of the nano-coated structures with a good precision, as well as cleaning the samples and their re-coating according to requested needs. Moreover, the application of RIE allows for post-fabrication tuning of RI sensitivity of the DLC nano-coated LPGs. (paper)

  18. THE McDONALD OBSERVATORY PLANET SEARCH: NEW LONG-PERIOD GIANT PLANETS AND TWO INTERACTING JUPITERS IN THE HD 155358 SYSTEM

    International Nuclear Information System (INIS)

    Robertson, Paul; Endl, Michael; Cochran, William D.; MacQueen, Phillip J.; Brugamyer, Erik J.; Barnes, Stuart I.; Caldwell, Caroline; Wittenmyer, Robert A.; Horner, J.; Simon, Attila E.

    2012-01-01

    We present high-precision radial velocity (RV) observations of four solar-type (F7-G5) stars—HD 79498, HD 155358, HD 197037, and HD 220773—taken as part of the McDonald Observatory Planet Search Program. For each of these stars, we see evidence of Keplerian motion caused by the presence of one or more gas giant planets in long-period orbits. We derive orbital parameters for each system and note the properties (composition, activity, etc.) of the host stars. While we have previously announced the two-gas-giant HD 155358 system, we now report a shorter period for planet c. This new period is consistent with the planets being trapped in mutual 2:1 mean-motion resonance. We therefore perform an in-depth stability analysis, placing additional constraints on the orbital parameters of the planets. These results demonstrate the excellent long-term RV stability of the spectrometers on both the Harlan J. Smith 2.7 m telescope and the Hobby-Eberly telescope.

  19. Real-time monitoring and massive inversion of source parameters of very long period seismic signals: An application to Stromboli Volcano, Italy

    Science.gov (United States)

    Auger, E.; D'Auria, L.; Martini, M.; Chouet, B.; Dawson, P.

    2006-01-01

    We present a comprehensive processing tool for the real-time analysis of the source mechanism of very long period (VLP) seismic data based on waveform inversions performed in the frequency domain for a point source. A search for the source providing the best-fitting solution is conducted over a three-dimensional grid of assumed source locations, in which the Green's functions associated with each point source are calculated by finite differences using the reciprocal relation between source and receiver. Tests performed on 62 nodes of a Linux cluster indicate that the waveform inversion and search for the best-fitting signal over 100,000 point sources require roughly 30 s of processing time for a 2-min-long record. The procedure is applied to post-processing of a data archive and to continuous automatic inversion of real-time data at Stromboli, providing insights into different modes of degassing at this volcano. Copyright 2006 by the American Geophysical Union.

  20. Deep long-period earthquakes west of the volcanic arc in Oregon: evidence of serpentine dehydration in the fore-arc mantle wedge

    Science.gov (United States)

    Vidale, John E.; Schmidt, David A.; Malone, Stephen D.; Hotovec-Ellis, Alicia J.; Moran, Seth C.; Creager, Kenneth C.; Houston, Heidi

    2014-01-01

    Here we report on deep long-period earthquakes (DLPs) newly observed in four places in western Oregon. The DLPs are noteworthy for their location within the subduction fore arc: 40–80 km west of the volcanic arc, well above the slab, and near the Moho. These “offset DLPs” occur near the top of the inferred stagnant mantle wedge, which is likely to be serpentinized and cold. The lack of fore-arc DLPs elsewhere along the arc suggests that localized heating may be dehydrating the serpentinized mantle wedge at these latitudes and causing DLPs by dehydration embrittlement. Higher heat flow in this region could be introduced by anomalously hot mantle, associated with the western migration of volcanism across the High Lava Plains of eastern Oregon, entrained in the corner flow proximal to the mantle wedge. Alternatively, fluids rising from the subducting slab through the mantle wedge may be the source of offset DLPs. As far as we know, these are among the first DLPs to be observed in the fore arc of a subduction-zone system.

  1. Comparative study of long-period gratings written in a boron co-doped fiber by an electric arc and UV irradiation

    International Nuclear Information System (INIS)

    Smietana, M; Bock, W J; Mikulic, P

    2010-01-01

    The paper presents for the first time a comparative study of long-period gratings (LPGs) written by point-by-point UV irradiation and by electrical arc discharges. These gratings were inscribed in a highly photosensitive boron co-doped fiber that can be considered as a suitable platform for LPG writing using either technology. The experimental transmission data for the manufactured LPG devices fit well when compared to the simulations we carried out in parallel. As a result of each of these writing processes, we were able to obtain a remarkably good quality of grating. Two reasons could explain the observed small differences between the spectra: a slight mismatch of the period of the gratings and an unintentional tapering of the fiber during the arc-based processes. We also found that the UV irradiation at λ = 248 nm can cause clearly visible damage to the fiber's surface. As a result of the UV writing, a coupling to the asymmetrical cladding modes can take place. Moreover, the gratings written using the two technologies show a very similar refractive index and temperature-sensing properties. The only differences between them can come from a physical deformation of the fiber induced by the electric arc discharges

  2. Long-period gratings in photonic crystal fibers operating near the phase-matching turning point for evanescent chemical and biochemical sensing

    Science.gov (United States)

    Kanka, Jiri

    2012-06-01

    Fiber-optic long-period grating (LPG) operating near the dispersion turning point in its phase matching curve (PMC), referred to as a Turn Around Point (TAP) LPG, is known to be extremely sensitive to external parameters. Moreover, in a TAP LPG the phase matching condition can be almost satisfied over large spectral range, yielding a broadband LPG operation. TAP LPGs have been investigated, namely for use as broadband mode convertors and biosensors. So far TAP LPGs have been realized in specially designed or post-processed conventional fibers, not yet in PCFs, which allow a great degree of freedom in engineering the fiber's dispersion properties through the control of the PCF structural parameters. We have developed the design optimization technique for TAP PCF LPGs employing the finite element method for PCF modal analysis in a combination with the Nelder-Mead simplex method for minimizing the objective function based on target-specific PCF properties. Using this tool we have designed TAP PCF LPGs for specified wavelength ranges and refractive indices of medium in the air holes. Possible TAP PCF-LPG operational regimes - dual-resonance, broadband mode conversion and transmitted intensity-based operation - will be demonstrated numerically. Potential and limitations of TAP PCF-LPGs for evanescent chemical and biochemical sensing will be assessed.

  3. Measurement of product rotational alignment in associative-ionization collisions between polarized Na(3p) atoms

    International Nuclear Information System (INIS)

    Wang, M.; de Vries, M.S.; Weiner, J.

    1986-01-01

    We have studied the effect of reactant Na(3p) polarization on the rotational angular momentum alignment of product Na 2 + ions arising from associative-ionization (AI) collisions. Our results show that sensitivity of the AI rate constant to initial atomic polarization persists even when all hyperfine states are populated with broadband (3 cm -1 ) pulsed laser excitation of Na( 2 P/sub 3/2/) and that the spatial distribution of product rotational angular momentum vectors is anisotropic. We discuss a qualitative description of the collision process consistent with our measurements which indicates that sigma-orbital symmetry is preferred to π-orbital symmetry as the colliding partners approach

  4. Heme and non-heme iron transporters in non-polarized and polarized cells

    Directory of Open Access Journals (Sweden)

    Yasui Yumiko

    2010-06-01

    Full Text Available Abstract Background Heme and non-heme iron from diet, and recycled iron from hemoglobin are important products of the synthesis of iron-containing molecules. In excess, iron is potentially toxic because it can produce reactive oxygen species through the Fenton reaction. Humans can absorb, transport, store, and recycle iron without an excretory system to remove excess iron. Two candidate heme transporters and two iron transporters have been reported thus far. Heme incorporated into cells is degraded by heme oxygenases (HOs, and the iron product is reutilized by the body. To specify the processes of heme uptake and degradation, and the reutilization of iron, we determined the subcellular localizations of these transporters and HOs. Results In this study, we analyzed the subcellular localizations of 2 isoenzymes of HOs, 4 isoforms of divalent metal transporter 1 (DMT1, and 2 candidate heme transporters--heme carrier protein 1 (HCP1 and heme responsive gene-1 (HRG-1--in non-polarized and polarized cells. In non-polarized cells, HCP1, HRG-1, and DMT1A-I are located in the plasma membrane. In polarized cells, they show distinct localizations: HCP1 and DMT1A-I are located in the apical membrane, whereas HRG-1 is located in the basolateral membrane and lysosome. 16Leu at DMT1A-I N-terminal cytosolic domain was found to be crucial for plasma membrane localization. HOs are located in smooth endoplasmic reticulum and colocalize with NADPH-cytochrome P450 reductase. Conclusions HCP1 and DMT1A-I are localized to the apical membrane, and HRG-1 to the basolateral membrane and lysosome. These findings suggest that HCP1 and DMT1A-I have functions in the uptake of dietary heme and non-heme iron. HRG-1 can transport endocytosed heme from the lysosome into the cytosol. These localization studies support a model in which cytosolic heme can be degraded by HOs, and the resulting iron is exported into tissue fluids via the iron transporter ferroportin 1, which is

  5. Artemisiae Argyi Folium and its geo-authentic crude drug qi ai

    Directory of Open Access Journals (Sweden)

    Diangang Liu

    2017-01-01

    Conclusion: The superior quality of qi ai compared with general AAF may be due to relatively higher contents of bioactive components. This study provides basic information for further study and utilization of AAF and qi ai.

  6. Long-period Ground Motion Characteristics Inside and Outside of the Osaka Basin during the 2011 Great Tohoku Earthquake and Its Largest Aftershock

    Science.gov (United States)

    Sato, K.; Iwata, T.; Asano, K.; Kubo, H.; Aoi, S.

    2013-12-01

    The 2011 great Tohoku earthquake (Mw 9.0) occurred on March 11, 2011, and the largest aftershock (Mw 7.7) at the region adjacent to south boundary of the mainshock's source region. Long-period ground motions (1-10s) of large amplitude were observed in the Osaka sedimentary basin about 550-800km away from the source regions during both events. We studied propagation and site characteristics of these ground motions, and found some common features between these two events in the Osaka basin. (1) The amplitude of horizontal components of the ground motion at the site-specific period is amplified at each sedimentary station. The predominant period is around 7s in the bayside area where the largest pSv were observed. (2) The velocity Fourier spectra have their peak values around 7s at the bedrock sites surrounding the Osaka basin. (3) Two remarkable wave packets separated by 30s propagating from stations around the Nobi plain to the bedrock sites near the Osaka basin were seen in the pasted-up velocity waveforms from the source regions to the Osaka basin for both events (Sato et al., 2012). Therefore, large long-period ground motions in the Osaka basin are generated by the combination of propagation-path and basin effects. Firstly, we simulate ground motions due to the largest aftershock using three-dimensional FDM (GMS; Aoi and Fujiwara, 1999). The reason we focus on the largest aftershock is that this event has a relatively small rupture area and simple rupture process compared to the mainshock. The source model is based on the model estimated by Kubo et al. (2013). The velocity structure model is a three-dimensional velocity structure based on the Japan Integrated Velocity Structure Model (Koketsu et al., 2012) and the layer of Vs 350m/s in this model is replaced with one of Vs 500m/s. The minimum effective period in this computation is 3s. Then, we compare synthetic waveforms with observed ones. At CHBH14, the nearest station to the source and 60km away from the

  7. Formation of long-period stacking ordered structures in Mg88M5Y7 (M = Ti, Ni and Pb) casting alloys

    International Nuclear Information System (INIS)

    Jin, Qian-Qian; Fang, Can-Feng; Mi, Shao-Bo

    2013-01-01

    Highlights: •Apart from 18R-LPSO, 14H-LPSO structure was determined in the Mg-Ni-Y alloys. •The appearance of twin-related structure in 18R-LPSO structure results from the stacking faults in the stacking sequence of the closely packed planes. •A new (Pb, Mg) 2 Y phase with a body-centered orthorhombic structure was determined in the Mg-Pb-Y alloy. •No LPSO structures were found in the Mg-Pb-Y and Mg-Ti-Y casting alloys. -- Abstract: Formation of long-period stacking ordered (LPSO) structures is investigated in Mg 88 M 5 Y 7 (M = Ti, Ni and Pb) casting alloys by means of electron microscopy and X-ray diffraction. In the Mg 88 Ni 5 Y 7 casting alloy, 14H-LPSO structure is observed in a small amount, which coexists with 18R-LPSO structure. The appearance of stacking faults in 18R-LPSO structure results in twin-related structure in the stacking sequence of the closely packed planes. A new (Pb, Mg) 2 Y phase with a body-centered orthorhombic structure is determined in the Mg 88 Pb 5 Y 7 alloy. No LPSO structures are found in the Mg 88 Pb 5 Y 7 and Mg 88 Ti 5 Y 7 casting alloys. In terms of the atomic radius and heat of mixing, the formation ability of LPSO structure in the present alloys is discussed

  8. The rationale for sitting elderly patients in hospital out of bed for long periods is medically unsubstantiated and detrimental to their recovery.

    Science.gov (United States)

    Bliss, Mary Rose

    2004-01-01

    The notorious statement by Asher about the dangers of bed rest [Brit Med J 1947; ii: 967-8] which continues to be quoted out of context in leading medical journals today is inapplicable to modern short stay elderly hospital patients and has little medical foundation. 'Blood clotting in the veins' is more likely to result from venous stasis during sitting than from lying down. 'Lime draining from the bones' refers to subjects' spending weeks, not hours, in the horizontal position and similar losses have been shown to occur in healthy people immobilised in chairs for long periods during the day. Constipation is common in sick old people and there is no evidence that 'scybala stacking up the colon' is more likely to occur in bed than in a chair. The 'flesh rotting from the seat', or pressure sores, occur as frequently or more frequently, in sick patients nursed in chairs as in bed. 'Urine leaking from the distended bladder' may be reduced in very debilitated old people sitting in chairs, but at the expense of impaired renal function associated with reduced perfusion in the upright posture and exacerbated incontinence due to a compensatory diuresis at night. The 'spirit evaporating from the soul' today is more likely to afflict old patients who are exhausted by prolonged chair nursing and orthostatic hypotension due to age or illness. Recent studies in intensive care patients have highlighted the hypotension due to vasodilatation which can occur in infection and trauma. There is no evidence that nosocomial pneumonia is reduced by sitting patients out of bed, and lack of sleep is likely to exacerbate infection and delay recovery. Preventing patients from lying down when they feel the need is a violation of their rights and has been shown to be probably as injurious as the Victorian practice of preventing healthy patients from getting up. Physiotherapy is obviously important but patients should be allowed to decide for themselves how long they spend in or out of bed.

  9. Effect of Long Period Cooling Storage on the Nucleic Acid of Harvested Cowpea Seeds ( Vigna Sinensis L.) Treated by Gamma Irradiation and Micro Elements

    International Nuclear Information System (INIS)

    Saleh, O.I.; Salama, I.M.

    2015-01-01

    Cowpea seeds ( Vigna sinensis L.) were exposed to 40 and 80 Gy gamma radiation, in order to study the effect of long period under cooling storage by using RAPD and ISSR PCR facilities. The obtained results indicated that RAPD protocol gave 65% monomorphic and 56% polymorphic fragments between the samples as compared to storage and non-storage controls. While , ISSR protocol gave 83% monomorphic and 85% polymorphic fragments. It should be mentioned that other percentage s 86% and 91% were found among samples in case of using another primers. The results could be summarized as follow: 1-Primer OP - B01 gave 7 monomorphic and 13 polymorphic fragments (65%). 2 - The Primer OP - B02 and Primer OP - B05 gave 4 monomorphic fragments with 14 polymorphic fragments (79%). 3 - The Primer HA-98 gave 4 monomorphic fragments with 19 detected polymorphic 83%. 4 - The Primer HA - 99 and HB-12 gave 3 monomorphic fragments and 17 polymorphic 85 and 86%, respectively. 5 - The Primer HB - 13 gave 2 monomorphic fragments with 21 detected polymorphic fragments 91%. 6 - The primer HA-98 gave 83% while the primer HA - 99 gave 85%. The previous results showed some polymorphism differences among the samples, while the primer HB-12 gave 86% and the primer HB-13 91% exhibited high levels of polymorphism. The DNA of stored cowpea seeds which were exposed to 80 Gy in the presence of zinc showed the highest differentiation , while radiation dose 40 Gy treated with zinc or boron, 80 Gy with boron and 40 or 80 Gy treatment alone compared to the two controls (storage and non storage)

  10. Source mechanism of small long-period events at Mount St. Helens in July 2005 using template matching, phase-weighted stacking, and full-waveform inversion

    Science.gov (United States)

    Matoza, Robin S.; Chouet, Bernard A.; Dawson, Phillip B.; Shearer, Peter M.; Haney, Matthew M.; Waite, Gregory P.; Moran, Seth C.; Mikesell, T. Dylan

    2015-01-01

    Long-period (LP, 0.5-5 Hz) seismicity, observed at volcanoes worldwide, is a recognized signature of unrest and eruption. Cyclic LP “drumbeating” was the characteristic seismicity accompanying the sustained dome-building phase of the 2004–2008 eruption of Mount St. Helens (MSH), WA. However, together with the LP drumbeating was a near-continuous, randomly occurring series of tiny LP seismic events (LP “subevents”), which may hold important additional information on the mechanism of seismogenesis at restless volcanoes. We employ template matching, phase-weighted stacking, and full-waveform inversion to image the source mechanism of one multiplet of these LP subevents at MSH in July 2005. The signal-to-noise ratios of the individual events are too low to produce reliable waveform-inversion results, but the events are repetitive and can be stacked. We apply network-based template matching to 8 days of continuous velocity waveform data from 29 June to 7 July 2005 using a master event to detect 822 network triggers. We stack waveforms for 359 high-quality triggers at each station and component, using a combination of linear and phase-weighted stacking to produce clean stacks for use in waveform inversion. The derived source mechanism pointsto the volumetric oscillation (~10 m3) of a subhorizontal crack located at shallow depth (~30 m) in an area to the south of Crater Glacier in the southern portion of the breached MSH crater. A possible excitation mechanism is the sudden condensation of metastable steam from a shallow pressurized hydrothermal system as it encounters cool meteoric water in the outer parts of the edifice, perhaps supplied from snow melt.

  11. Capability for Fine Tuning of the Refractive Index Sensing Properties of Long-Period Gratings by Atomic Layer Deposited Al2O3 Overlays

    Directory of Open Access Journals (Sweden)

    Mateusz Śmietana

    2013-11-01

    Full Text Available This work presents an application of thin aluminum oxide (Al2O3 films obtained using atomic layer deposition (ALD for fine tuning the spectral response and refractive-index (RI sensitivity of long-period gratings (LPGs induced in optical fibers. The technique allows for an efficient and well controlled deposition at monolayer level (resolution ~ 0.12 nm of excellent quality nano-films as required for optical sensors. The effect of Al2O3 deposition on the spectral properties of the LPGs is demonstrated experimentally and numerically. We correlated both the increase in Al2O3 thickness and changes in optical properties of the film with the shift of the LPG resonance wavelength and proved that similar films are deposited on fibers and oxidized silicon reference samples in the same process run. Since the thin overlay effectively changes the distribution of the cladding modes and thus also tunes the device’s RI sensitivity, the tuning can be simply realized by varying number of cycles, which is proportional to thickness of the high-refractive-index (n > 1.6 in infrared spectral range Al2O3 film. The advantage of this approach is the precision in determining the film properties resulting in RI sensitivity of the LPGs. To the best of our knowledge, this is the first time that an ultra-precise method for overlay deposition has been applied on LPGs for RI tuning purposes and the results have been compared with numerical simulations based on LP mode approximation.

  12. The phase equilibria and thermal stability of the long-period stacking ordered phase in the Mg–Cu–Y system

    International Nuclear Information System (INIS)

    Jiang, Min; Su, Xiulan; Li, Hongxiao; Ren, Yuping; Qin, Gaowu

    2014-01-01

    Highlights: • 14H LPSO structure has been confirmed to be stable in the Mg–Cu–Y system. • Partial isothermal sections of the Mg–Cu–Y system from 300 to 450 °C have been established. • Reaction L + α-Mg ↔ 14H + Mg 2 Cu has been determined in the Mg–Cu–Y system. • The thermal stability of the 14H phase in the Mg–Cu–Y system has been well studied. - Abstract: Phase equilibria in the Mg-rich Mg–Cu–Y system at 300, 400 and 450 °C have been experimentally investigated by X-ray diffraction (XRD), scanning electron microscopy (SEM), differential scanning calorimetry (DSC), electron probe micro-analyzer (EPMA) and transmission electron microscope (TEM). The results show that a long-period stacking ordered (LPSO) phase 14H is stable in the Mg–Cu–Y system, which is the only one ternary intermetallic compound that gets a thermodynamic equilibrium with the a-Mg phase. The equilibrium 14H phase has a very limited solid solution range, and can be nearly regarded as a ternary stoichiometric compound with a formulae as Mg 91 Cu 4 Y 5 . The thermal stability of the 14H phase in the Mg–Cu–Y system has been well studied, which shows that the 14H phase disappears varying from 442 °C to 490 °C depending on the alloy composition. The isothermal sections of the Mg-rich Mg–Cu–Y system at 300, 400 and 450 °C have been finally established, and moreover, a quasi-peritectic reaction L + α-Mg ↔ 14H + Mg 2 Cu has been determined occurring at 442 °C with an estimated liquid composition of Mg 77 Cu 18 Y 5

  13. Enzyme-functionalized thin-cladding long-period fiber grating in transition mode at dispersion turning point for sugar-level and glucose detection

    Science.gov (United States)

    Badmos, Abdulyezir A.; Sun, Qizhen; Sun, Zhongyuan; Zhang, Junxi; Yan, Zhijun; Lutsyk, Petro; Rozhin, Alex; Zhang, Lin

    2017-02-01

    Enzyme-functionalized dual-peak long-period fiber grating (LPFG) inscribed in 80-μm-cladding B/Ge codoped single-mode fiber is presented for sugar-level and specific glucose detection. Before enzyme functionalization, the dual-peak LPFG was employed for refractive index sensing and sugar-level detection and high sensitivities of ˜4298.20 nm/RIU and 4.6696 nm/% were obtained, respectively. Glucose detection probe was attained by surface functionalization of the dual-peak LPFG via covalent binding with aminopropyl triethoxysilane used as a binding site. Optical micrographs confirmed the presence of enzyme. The surface-functionalized dual-peak LPFG was tested with D-(+)-glucose solution of different concentrations. While the peak 2 at the longer wavelength was suitable only to measure lower glucose concentration (0.1 to 1.6 mg/ml) recording a high sensitivity of 12.21±0.19 nm/(mg/ml), the peak 1 at the shorter wavelength was able to measure a wider range of glucose concentrations (0.1 to 3.2 mg/ml) exhibiting a maximum resonance wavelength shift of 7.12±0.12 nm/mg/ml. The enzyme-functionalized dual-peak LPFG has the advantage of direct inscription of highly sensitive grating structures in thin-cladding fibre without etching, and most significantly, its sensitivity improvement of approximately one order of magnitude higher than previously reported LPFG and excessively tilted fibre grating (Ex-TFG) for glucose detection.

  14. Correlation between SiO v = 3 J = 1 → 0 maser excitation and the light curve of a long-period variable star

    Science.gov (United States)

    Oyadomari, Miyako; Imai, Hiroshi; Nagayama, Takumi; Oyama, Tomoaki; Matsumoto, Naoko; Nakashima, Jun-ichi; Cho, Se-Hyung

    2018-03-01

    In order to understand the excitation mechanisms of silicon monoxide (SiO) masers around long-period variables (LPVs), we have investigated distributions of the SiO v = 2 and v = 3 J = 1 → 0 masers around 12 LPVs by very long baseline interferometry (VLBI) observations with the VLBI Exploration of Radio Astrometry (VERA) and the Nobeyama 45 m telescopes. VLBI fringes of the v = 3 maser emission were detected for five LPVs. The composite maps of the v = 2 and v = 3 masers were made for T Cep, W Hya, WX Psc, and R Leo using the spectral line phase-referencing technique. The v = 2 maser spots were distributed in a ring-like form around the central stars, while it is difficult to recognize any specific morphology in the v = 3 maser distributions due to the small number of v = 3 spots detected. However in T Cep, we find that the distribution of the v = 3 maser spots correlates well with the v = 2 masers within a few milliarcseconds (0.2-0.3 au) in position and 1 km s-1 in line-of-sight velocity at the light curve phase of ϕ = 0.28 (ϕ = 0.0 and 1.0 correspond to the visible light maxima). This correlation implies that the mechanism of line-overlapping between the mid-infrared lines of H2O and SiO molecules works in T Cep at ϕ = 0.28. We discuss the possibility that the line-overlapping may work at the limited duration from the maximum to the minimum of the stellar light curve.

  15. Future role of AI/Robotics in physical security

    International Nuclear Information System (INIS)

    Jacobs, J.

    1986-01-01

    Manpower requirements for physical security systems place a heavy burden on operating security budgets. Technology innovations which free personnel or which make security personnel more efficient in carrying out their tasks is an important means of dealing with budget and manpower constraints. It is believed that AI/Robotics will be important technologies to alleviate these problems in the future. There are three types of applications for AI and Robotics technology that may: (l) help security personnel perform their tasks more effectively or efficiently, (2) perform tasks that security personnel would otherwise perform (free up people), and (3) perform tasks that cannot be performed by security personnel at this time. This paper discusses the various types of security applications that are presently being considered for the above areas and briefly describes a few examples of the application of this technology

  16. AI mass spectrometers for space shuttle health monitoring

    Science.gov (United States)

    Adams, F. W.

    1991-01-01

    The facility Hazardous Gas Detection System (HGDS) at Kennedy Space Center (KSC) is a mass spectrometer based gas analyzer. Two instruments make up the HGDS, which is installed in a prime/backup arrangement, with the option of using both analyzers on the same sample line, or on two different lines simultaneously. It is used for monitoring the Shuttle during fuel loading, countdown, and drainback, if necessary. The use of complex instruments, operated over many shifts, has caused problems in tracking the status of the ground support equipment (GSE) and the vehicle. A requirement for overall system reliability has been a major force in the development of Shuttle GSE, and is the ultimate driver in the choice to pursue artificial intelligence (AI) techniques for Shuttle and Advanced Launch System (ALS) mass spectrometer systems. Shuttle applications of AI are detailed.

  17. Polar Polygons

    Science.gov (United States)

    2005-01-01

    18 August 2005 This Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) image shows dark-outlined polygons on a frost-covered surface in the south polar region of Mars. In summer, this surface would not be bright and the polygons would not have dark outlines--these are a product of the presence of seasonal frost. Location near: 77.2oS, 204.8oW Image width: width: 3 km (1.9 mi) Illumination from: upper left Season: Southern Spring

  18. Oil spills and AI: How to manage resources through simulation

    International Nuclear Information System (INIS)

    Giribone, P.; Bruzzone, A.G.; Caddeo, S.

    1995-01-01

    Today, in the Mediterranean theater of the Upper Tyrrhenian, the ecological risk involving oil installations is still quite high. This is due to the fact that valuable environmental and tourist areas exist together with large industrial and port structures; in particular, recent events have demonstrated the danger involving oil spills along the Ligurian coastline. This study proposes an approach to plan the operations that should be performed when accidents occur, based on the use of AI techniques

  19. Companion Cognitive Systems: A Step toward Human-Level AI

    OpenAIRE

    Forbus, Kenneth D.; Hinrichs, Thomas R.

    2006-01-01

    We are developing Companion Cognitive Systems, a new kind of software that can be effectively treated as a collaborator. Aside from their potential utility, we believe this effort is important because it focuses on three key problems that must be solved to achieve human-level AI: Robust reasoning and learning, interactivity, and longevity. We describe the ideas we are using to develop the first architecture for Companions: analogical processing, grounded in cognitive science for reasoning and...

  20. Conversational AI: The Science Behind the Alexa Prize

    OpenAIRE

    Ram, Ashwin; Prasad, Rohit; Khatri, Chandra; Venkatesh, Anu; Gabriel, Raefer; Liu, Qing; Nunn, Jeff; Hedayatnia, Behnam; Cheng, Ming; Nagar, Ashish; King, Eric; Bland, Kate; Wartick, Amanda; Pan, Yi; Song, Han

    2018-01-01

    Conversational agents are exploding in popularity. However, much work remains in the area of social conversation as well as free-form conversation over a broad range of domains and topics. To advance the state of the art in conversational AI, Amazon launched the Alexa Prize, a 2.5-million-dollar university competition where sixteen selected university teams were challenged to build conversational agents, known as socialbots, to converse coherently and engagingly with humans on popular topics ...

  1. General Video Game AI: Learning from Screen Capture

    OpenAIRE

    Kunanusont, Kamolwan; Lucas, Simon M.; Perez-Liebana, Diego

    2017-01-01

    General Video Game Artificial Intelligence is a general game playing framework for Artificial General Intelligence research in the video-games domain. In this paper, we propose for the first time a screen capture learning agent for General Video Game AI framework. A Deep Q-Network algorithm was applied and improved to develop an agent capable of learning to play different games in the framework. After testing this algorithm using various games of different categories and difficulty levels, th...

  2. Artificial intelligence (AI) systems for interpreting complex medical datasets.

    Science.gov (United States)

    Altman, R B

    2017-05-01

    Advances in machine intelligence have created powerful capabilities in algorithms that find hidden patterns in data, classify objects based on their measured characteristics, and associate similar patients/diseases/drugs based on common features. However, artificial intelligence (AI) applications in medical data have several technical challenges: complex and heterogeneous datasets, noisy medical datasets, and explaining their output to users. There are also social challenges related to intellectual property, data provenance, regulatory issues, economics, and liability. © 2017 ASCPT.

  3. Annealing Induced Softening in Deformed AI-4043 Alloy

    International Nuclear Information System (INIS)

    Saad, G.; Fawzy, A.; Soliman, H.N.; Mohammed, Gh.; Fayek, S.A.

    2011-01-01

    The present paper is devoted to study the effect of annealing temperature for different annealing periods of time on the structure and consequently on the tensile properties of Al-4043 alloy. The obtained results showed that the microstructure of AI-4043 alloy is characterized by the presence of spherically shaped Si-particles, which were found to be uniformly distributed within the AI-matrix. Stress-strain characterizations of AI-4043 samples annealed at different temperatures (T a = 573, 673 and 773 K) for different periods of time (t a = 0.5, 1,2.5,5 and 10 h), showed that the tensile parameters; yield stress ε y 0.2 and fracture stress ε f were decreased with increasing Ta and/or ta while the total strain ε T was increased. This was interpreted in terms of growth of Si-particles with increasing T a and/or t a . Attention has been also paid to the role of the minor elements Fe, Cu and Ti on the structure and tensile response behavior of the alloy under investigation

  4. The deep learning AI playbook strategy for disruptive artificial intelligence

    CERN Document Server

    Perez, Carlos E

    2017-01-01

    Deep Learning Artificial Intelligence involves the interplay of Computer Science, Physics, Biology, Linguistics and Psychology. In addition to that, it is technology that can be extremely disruptive. The ramifications to society and even our own humanity will be profound. There are few subjects that are as captivating and as consequential as this. Surprisingly, there is very little that is written about this new technology in a more comprehensive and cohesive way. This book is an opinionated take on the developments of Deep Learning AI. One question many have will be "how to apply Deep Learning AI in a business context?" Technology that is disruptive does not automatically imply that its application to valuable use cases will be apparent. For years, many people could not figure out how to monetize the World Wide Web. We are in a similar situation with Deep Learning AI. The developments may be mind-boggling but its monetization is far from being obvious. This book presents a framework to address this shortcomi...

  5. Artificial Intelligence (AI) Based Tactical Guidance for Fighter Aircraft

    Science.gov (United States)

    McManus, John W.; Goodrich, Kenneth H.

    1990-01-01

    A research program investigating the use of Artificial Intelligence (AI) techniques to aid in the development of a Tactical Decision Generator (TDG) for Within Visual Range (WVR) air combat engagements is discussed. The application of AI programming and problem solving methods in the development and implementation of the Computerized Logic For Air-to-Air Warfare Simulations (CLAWS), a second generation TDG, is presented. The Knowledge-Based Systems used by CLAWS to aid in the tactical decision-making process are outlined in detail, and the results of tests to evaluate the performance of CLAWS versus a baseline TDG developed in FORTRAN to run in real-time in the Langley Differential Maneuvering Simulator (DMS), are presented. To date, these test results have shown significant performance gains with respect to the TDG baseline in one-versus-one air combat engagements, and the AI-based TDG software has proven to be much easier to modify and maintain than the baseline FORTRAN TDG programs. Alternate computing environments and programming approaches, including the use of parallel algorithms and heterogeneous computer networks are discussed, and the design and performance of a prototype concurrent TDG system are presented.

  6. Accretion in Radiative Equipartition (AiRE) Disks

    Energy Technology Data Exchange (ETDEWEB)

    Yazdi, Yasaman K.; Afshordi, Niayesh, E-mail: yyazdi@pitp.ca, E-mail: nafshordi@pitp.ca [Perimeter Institute for Theoretical Physics, 31 Caroline Street N, Waterloo, ON N2L 2Y5 (Canada)

    2017-07-01

    Standard accretion disk theory predicts that the total pressure in disks at typical (sub-)Eddington accretion rates becomes radiation pressure dominated. However, radiation pressure dominated disks are thermally unstable. Since these disks are observed in approximate steady state over the instability timescale, our accretion models in the radiation-pressure-dominated regime (i.e., inner disk) need to be modified. Here, we present a modification to the Shakura and Sunyaev model, where the radiation pressure is in equipartition with the gas pressure in the inner region. We call these flows accretion in radiative equipartition (AiRE) disks. We introduce the basic features of AiRE disks and show how they modify disk properties such as the Toomre parameter and the central temperature. We then show that the accretion rate of AiRE disks is limited from above and below, by Toomre and nodal sonic point instabilities, respectively. The former leads to a strict upper limit on the mass of supermassive black holes as a function of cosmic time (and spin), while the latter could explain the transition between hard and soft states of X-ray binaries.

  7. AIS Algorithm for Smart Antenna Application in WLAN

    Directory of Open Access Journals (Sweden)

    Evizal Abdul Kadir

    2015-07-01

    Full Text Available Increasing numbers of wireless local area networks (WLAN replacing wired networks have an impact on wireless network systems, causing issues such as interference. The smart antenna system is a method to overcome interference issues in WLANs. This paper proposes an artificial immune system (AIS for a switch beam smart antenna system. A directional antenna is introduced to aim the beam at the desired user. The antenna consists of 8 directional antennas, each of which covers 45 degrees, thus creating an omnidirectional configuration of which the beams cover 360 degrees. To control the beam switching, an inexpensive PIC 16F877 microchip was used. An AIS algorithm was implemented in the microcontroller, which uses the received radio signal strength of the mobile device as reference. This is compared for each of the eight beams, after which the AIS algorithm selects the strongest signal received by the system and the microcontroller will then lock to the desired beam. In the experiment a frequency of 2.4 GHz (ISM band was used for transmitting and receiving. A test of the system was conducted in an outdoor environment. The results show that the switch beam smart antenna worked fine based on locating the mobile device.

  8. Functional subdivisions in low-frequency primary auditory cortex (AI).

    Science.gov (United States)

    Wallace, M N; Palmer, A R

    2009-04-01

    We wished to test the hypothesis that there are modules in low-frequency AI that can be identified by their responsiveness to communication calls or particular regions of space. Units were recorded in anaesthetised guinea pig AI and stimulated with conspecific vocalizations and a virtual motion stimulus (binaural beats) presented via a closed sound system. Recording tracks were mainly oriented orthogonally to the cortical surface. Some of these contained units that were all time-locked to the structure of the chutter call (14/22 tracks) and/or the purr call (12/22 tracks) and/or that had a preference for stimuli from a particular region of space (8/20 tracks with four contralateral, two ipsilateral and two midline), or where there was a strong asymmetry in the response to beats of different direction (two tracks). We conclude that about half of low-frequency AI is organized into modules that are consistent with separate "what" and "where" pathways.

  9. 76 FR 44045 - Establishment of the SANE/SART AI/AN Initiative Committee

    Science.gov (United States)

    2011-07-22

    ... SANE/SART AI/AN Initiative Committee AGENCY: Office for Victims of Crime, Justice. ACTION: Notice of... Nurse Examiner (SANE) Sexual Assault Response Team (SART) American Indian/Alaskan Native (AI/AN) Initiative (``SANE/SART AI/AN Initiative Committee'' or ``Committee'') is being established in accordance...

  10. 78 FR 17232 - Meeting of the SANE/SART AI/AN Initiative Committee

    Science.gov (United States)

    2013-03-20

    .../SART AI/AN Initiative Committee AGENCY: Office for Victims of Crime, Justice. ACTION: Notice of meeting. SUMMARY: The National Coordination Committee on the American Indian/ Alaska Native (AI/AN) Sexual Assault... violence within AI/AN communities. DATES AND LOCATIONS: The meeting will be held via webinar on Wednesday...

  11. 10 CFR 1017.28 - Processing on Automated Information Systems (AIS).

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Processing on Automated Information Systems (AIS). 1017.28... UNCLASSIFIED CONTROLLED NUCLEAR INFORMATION Physical Protection Requirements § 1017.28 Processing on Automated Information Systems (AIS). UCNI may be processed or produced on any AIS that complies with the guidance in OMB...

  12. Strategic Polarization.

    Science.gov (United States)

    Kalai, Adam; Kalai, Ehud

    2001-08-01

    In joint decision making, similarly minded people may take opposite positions. Consider the example of a marriage in which one spouse gives generously to charity while the other donates nothing. Such "polarization" may misrepresent what is, in actuality, a small discrepancy in preferences. It may be that the donating spouse would like to see 10% of their combined income go to charity each year, while the apparently frugal spouse would like to see 8% donated. A simple game-theoretic analysis suggests that the spouses will end up donating 10% and 0%, respectively. By generalizing this argument to a larger class of games, we provide strategic justification for polarization in many situations such as debates, shared living accommodations, and disciplining children. In some of these examples, an arbitrarily small disagreement in preferences leads to an arbitrarily large loss in utility for all participants. Such small disagreements may also destabilize what, from game-theoretic point of view, is a very stable equilibrium. Copyright 2001 Academic Press.

  13. Source mechanism of Vulcanian degassing at Popocatépetl Volcano, Mexico, determined from waveform inversions of very long period signals

    Science.gov (United States)

    Chouet, Bernard A.; Dawson, Phillip B.; Arciniega-Ceballos, Alejandra

    2005-01-01

    The source mechanism of very long period (VLP) signals accompanying volcanic degassing bursts at Popocatépetl is analyzed in the 15–70 s band by minimizing the residual error between data and synthetics calculated for a point source embedded in a homogeneous medium. The waveforms of two eruptions (23 April and 23 May 2000) representative of mild Vulcanian activity are well reproduced by our inversion, which takes into account volcano topography. The source centroid is positioned 1500 m below the western perimeter of the summit crater, and the modeled source is composed of a shallow dipping crack (sill with easterly dip of 10°) intersecting a steeply dipping crack (northeast striking dike dipping 83° northwest), whose surface extension bisects the vent. Both cracks undergo a similar sequence of inflation, deflation, and reinflation, reflecting a cycle of pressurization, depressurization, and repressurization within a time interval of 3–5 min. The largest moment release occurs in the sill, showing a maximum volume change of 500–1000 m3, pressure drop of 3–5 MPa, and amplitude of recovered pressure equal to 1.2 times the amplitude of the pressure drop. In contrast, the maximum volume change in the dike is less (200–300 m3), with a corresponding pressure drop of 1–2 MPa and pressure recovery equal to the pressure drop. Accompanying these volumetric sources are single-force components with magnitudes of 108 N, consistent with melt advection in response to pressure transients. The source time histories of the volumetric components of the source indicate that significant mass movement starts within the sill and triggers a mass movement response in the dike within a few seconds. Such source behavior is consistent with the opening of a pathway for escape of pent-up gases from slow pressurization of the sill driven by magma crystallization. The opening of this pathway and associated rapid evacuation of volcanic gases induces the pressure drop. Pressure

  14. An anisotropic shear velocity model of the Earth's mantle using normal modes, body waves, surface waves and long-period waveforms

    Science.gov (United States)

    Moulik, P.; Ekström, G.

    2014-12-01

    We use normal-mode splitting functions in addition to surface wave phase anomalies, body wave traveltimes and long-period waveforms to construct a 3-D model of anisotropic shear wave velocity in the Earth's mantle. Our modelling approach inverts for mantle velocity and anisotropy as well as transition-zone discontinuity topographies, and incorporates new crustal corrections for the splitting functions that are consistent with the non-linear corrections we employ for the waveforms. Our preferred anisotropic model, S362ANI+M, is an update to the earlier model S362ANI, which did not include normal-mode splitting functions in its derivation. The new model has stronger isotropic velocity anomalies in the transition zone and slightly smaller anomalies in the lowermost mantle, as compared with S362ANI. The differences in the mid- to lowermost mantle are primarily restricted to features in the Southern Hemisphere. We compare the isotropic part of S362ANI+M with other recent global tomographic models and show that the level of agreement is higher now than in the earlier generation of models, especially in the transition zone and the lower mantle. The anisotropic part of S362ANI+M is restricted to the upper 300 km in the mantle and is similar to S362ANI. When radial anisotropy is allowed throughout the mantle, large-scale anisotropic patterns are observed in the lowermost mantle with vSV > vSH beneath Africa and South Pacific and vSH > vSV beneath several circum-Pacific regions. The transition zone exhibits localized anisotropic anomalies of ˜3 per cent vSH > vSV beneath North America and the Northwest Pacific and ˜2 per cent vSV > vSH beneath South America. However, small improvements in fits to the data on adding anisotropy at depth leave the question open on whether large-scale radial anisotropy is required in the transition zone and in the lower mantle. We demonstrate the potential of mode-splitting data in reducing the trade-offs between isotropic velocity and

  15. Polarized secondary radioactive beams

    International Nuclear Information System (INIS)

    Zaika, N.I.

    1992-01-01

    Three methods of polarized radioactive nuclei beam production: a) a method nuclear interaction of the non-polarized or polarized charged projectiles with target nuclei; b) a method of polarization of stopped reaction radioactive products in a special polarized ion source with than following acceleration; c) a polarization of radioactive nuclei circulating in a storage ring are considered. Possible life times of the radioactive ions for these methods are determined. General schemes of the polarization method realizations and depolarization problems are discussed

  16. Polar crane

    International Nuclear Information System (INIS)

    Makosinski, S.

    1981-01-01

    In many applications polar cranes have to be repeatedly positioned with high accuracy. A guidance system is disclosed which has two pairs of guides. Each guide consists of two rollers carried by a sheave rotatable mounted on the crane bridge, the rollers being locatable one on each side of a guideway, e.g. the circular track on which the bridge runs. The pairs of guides are interconnected by respective rope loops which pass around and are locked to the respective pairs of sheaves in such a manner that movement of one guide results in equal movement of the other guide in a sense to maintain the repeatability of positioning of the centre of the bridge. A hydraulically-linked guide system is also described. (author)

  17. QML-AiNet: An immune network approach to learning qualitative differential equation models.

    Science.gov (United States)

    Pang, Wei; Coghill, George M

    2015-02-01

    In this paper, we explore the application of Opt-AiNet, an immune network approach for search and optimisation problems, to learning qualitative models in the form of qualitative differential equations. The Opt-AiNet algorithm is adapted to qualitative model learning problems, resulting in the proposed system QML-AiNet. The potential of QML-AiNet to address the scalability and multimodal search space issues of qualitative model learning has been investigated. More importantly, to further improve the efficiency of QML-AiNet, we also modify the mutation operator according to the features of discrete qualitative model space. Experimental results show that the performance of QML-AiNet is comparable to QML-CLONALG, a QML system using the clonal selection algorithm (CLONALG). More importantly, QML-AiNet with the modified mutation operator can significantly improve the scalability of QML and is much more efficient than QML-CLONALG.

  18. Beyond AI: Multi-Intelligence (MI Combining Natural and Artificial Intelligences in Hybrid Beings and Systems

    Directory of Open Access Journals (Sweden)

    Stephen Fox

    2017-06-01

    Full Text Available Framing strongly influences actions among technology proponents and end-users. Underlying much debate about artificial intelligence (AI are several fundamental shortcomings in its framing. First, discussion of AI is atheoretical, and therefore has limited potential for addressing the complexity of causation. Second, intelligence is considered from an anthropocentric perspective that sees human intelligence, and intelligence developed by humans, as superior to all other intelligences. Thus, the extensive post-anthropocentric research into intelligence is not given sufficient consideration. Third, AI is discussed often in reductionist mechanistic terms. Rather than in organicist emergentist terms as a contributor to multi-intelligence (MI hybrid beings and/or systems. Thus, current framing of AI can be a self-validating reduction within which AI development is focused upon AI becoming the single-variable mechanism causing future effects. In this paper, AI is reframed as a contributor to MI.

  19. STAR - A computer language for hybrid AI applications

    Science.gov (United States)

    Borchardt, G. C.

    1986-01-01

    Constructing Artificial Intelligence application systems which rely on both symbolic and non-symbolic processing places heavy demands on the communication of data between dissimilar languages. This paper describes STAR (Simple Tool for Automated Reasoning), a computer language for the development of AI application systems which supports the transfer of data structures between a symbolic level and a non-symbolic level defined in languages such as FORTRAN, C and PASCAL. The organization of STAR is presented, followed by the description of an application involving STAR in the interpretation of airborne imaging spectrometer data.

  20. Pavlovian, Skinner, and Other Behaviourists' Contributions to AI. Chapter 9

    Science.gov (United States)

    Kosinski, Withold; Zaczek-Chrzanowska, Dominika

    2007-01-01

    A version of the definition of intelligent behaviour will be supplied in the context of real and artificial systems. Short presentation of principles of learning, starting with Pavlovian s classical conditioning through reinforced response and operant conditioning of Thorndike and Skinner and finishing with cognitive learning of Tolman and Bandura will be given. The most important figures within behaviourism, especially those with contribution to AI, will be described. Some tools of artificial intelligence that act according to those principles will be presented. An attempt will be made to show when some simple rules for behaviour modifications can lead to a complex intelligent behaviour.

  1. Alarm processing system using AI techniques for nuclear power plant

    International Nuclear Information System (INIS)

    Yang, Joon On; Chang, Soon Heung

    1990-01-01

    An alarm processing system (APS) has been developed using artificial intelligence (AI) techniques. The alarms of nuclear power plants (NPP's) are classified into the generalized and special alarms. The generalized alarms are also classified into the global and local alarms. For each type of alarms, the specific processing rules are applied to filter and suppress unnecessary and potentially misleading alarms. The local processing are based on 'model-based reasoning.' The global and special alarms are processed by using the general cause-consequence check rules. The priorities of alarms are determined according to the plant state and the consistencies between them

  2. Deep Learning Neural Networks in Cybersecurity - Managing Malware with AI

    OpenAIRE

    Rayle, Keith

    2017-01-01

    There’s a lot of talk about the benefits of deep learning (neural networks) and how it’s the new electricity that will power us into the future. Medical diagnosis, computer vision and speech recognition are all examples of use-cases where neural networks are being applied in our everyday business environment. This begs the question…what are the uses of neural-network applications for cyber security? How does the AI process work when applying neural networks to detect malicious software bombar...

  3. How AI turned the chess world upside down

    KAUST Repository

    Polgar, Susan

    2018-01-22

    Man vs. Machine! In 1977 an IBM supercomputer \\'Deep Blue\\' beat the reigning World Chess Champion Gary Kasparov in a 6 game chess match played under tournament conditions. This was the first time a machine beat a human at chess. It symbolized the emergence of Artificial Intelligence (AI) and the potential for great good (and great harm) from machines that have aspects of human intelligence. During this lecture Susan Polgar, a pioneer for Women in Chess, will share her remarkable story as well as how technology has changed the world of chess.

  4. Nuclear polarization and neutrons

    International Nuclear Information System (INIS)

    Glaettli, H.

    1985-01-01

    Different possibilities for the use of polarized nuclei in thermal neutron scattering on condensed matter are reviewed. Highly polarized nuclei are the starting point for studying dipolar magnetic order. Systematic measurement of spin-dependent scattering lengths is possible on samples with polarized nuclei. Highly polarized hydrogen should help to unravel complicated structures in chemistry and biology. The use of polarized proton targets as an energy-independent neutron polarizer in the thermal and epithermal region should be considered afresh. (author)

  5. Future role of AI/Robotics in physical security

    International Nuclear Information System (INIS)

    Jacobs, J.

    1986-06-01

    Manpower requirements for physical security systems place a heavy burden on operating security budgets. Technology innovations which free personnel or which make security personnel more efficient in carrying out their tasks is an important means of dealing with budget and manpower constraints. It is believed that AI/Robotics will be important technologies to alleviate these problems in the future. There are three types of applications for AI and Robotics technology that may: (1) help security personnel perform their tasks more effectively or efficiently, (2) perform tasks that security personnel would otherwise perform (free up people), and (3) perform tasks that cannot be performed by security personnel at this time. This paper will discuss the various types of security applications that are presently being considered for the above areas and will briefly describe a few examples of the application of this technology. Examples will include ground mobile platforms carrying alarm assessment and/or surveillance sensors and operating either autonomously or with telepresence by a remote operator. An airborne platform performing similar functions will also be discussed. An application of a type of robot sentry that would be fixed and incorporate very simple portable displays will also be described. A third type of robot, an interior robot, that could be used in sensitive or hazardous areas to do detection and assessment functions will be reviewed

  6. Sensor assignment to mission in AI-TECD

    Science.gov (United States)

    Ganger, Robert; de Mel, Geeth; Pham, Tien; Rudnicki, Ronald; Schreiber, Yonatan

    2016-05-01

    Sensor-mission assignment involves the allocation of sensors and other information-providing resources to missions in order to cover the information needs of the individual tasks within each mission. The importance of efficient and effective means to find appropriate resources for tasks is exacerbated in the coalition context where the operational environment is dynamic and a multitude of critically important tasks need to achieve their collective goals to meet the objectives of the coalition. The Sensor Assignment to Mission (SAM) framework—a research product of the International Technology Alliance in Network and Information Sciences (NIS-ITA) program—provided the first knowledge intensive resource selection approach for the sensor network domain so that contextual information could be used to effectively select resources for tasks in coalition environments. Recently, CUBRC, Inc. was tasked with operationalizing the SAM framework through the use of the I2WD Common Core Ontologies for the Communications-Electronics Research, Development and Engineering Center (CERDEC) sponsored Actionable Intelligence Technology Enabled Capabilities Demonstration (AI-TECD). The demonstration event took place at Fort Dix, New Jersey during July 2015, and this paper discusses the integration and the successful demonstration of the SAM framework within the AI-TECD, lessons learned, and its potential impact in future operations.

  7. Evidence for Excitation of Polar Motion by Fortnightly Ocean Tides

    Science.gov (United States)

    Gross, Richard S.; Hamdan, Kamal H.; Boggs, Dale H.

    1996-01-01

    The second-degree zonal tide raising potential, which is responsible for tidal changes in the Earth's rotation rate and length-of-day, is symmetric about the polar axis and hence can excite the Earth's polar motion only through its action upon nonaxisymmetric features of the Earth such as the oceans. Ocean tidal excitation of polar motion in the diurnal and semidiurnal tidal bands has been previously detected and examined. Here, the detection of ocean tidal excitation of polar motion in the long-period tidal band, specifically at the Mf' (13.63-day) and Mf (13.66-day) tidal frequencies, is reported. Spectra of the SPACE94 polar motion excitation series exhibit peaks at the prograde and retrograde fortnightly tidal periods. After removing effects of atmospheric wind and pressure changes, an empirical model for the effect of the fortnightly ocean tides upon polar motion excitation is obtained by least-squares fitting periodic terms at the Mf and Mf' tidal frequencies to the residual polar motion excitation series. The resulting empirical model is then compared with the predictions of two hydrodynamic ocean tide models.

  8. Neutron polarization in polarized 3He targets

    International Nuclear Information System (INIS)

    Friar, J.L.; Gibson, B.F.; Payne, G.L.; Bernstein, A.M.; Chupp, T.E.

    1990-01-01

    Simple formulas for the neutron and proton polarizations in polarized 3 He targets are derived assuming (1) quasielastic final states; (2) no final-state interactions; (3) no meson-exchange currents; (4) large momentum transfers; (5) factorizability of 3 He SU(4) response-function components. Numerical results from a wide variety of bound-state solutions of the Faddeev equations are presented. It is found that this simple model predicts the polarization of neutrons in a fully polarized 3 He target to be 87%, while protons should have a slight residual polarization of -2.7%. Numerical studies show that this model works very well for quasielastic electron scattering

  9. Applying AI tools to operational space environmental analysis

    Science.gov (United States)

    Krajnak, Mike; Jesse, Lisa; Mucks, John

    1995-01-01

    The U.S. Air Force and National Oceanic Atmospheric Agency (NOAA) space environmental operations centers are facing increasingly complex challenges meeting the needs of their growing user community. These centers provide current space environmental information and short term forecasts of geomagnetic activity. Recent advances in modeling and data access have provided sophisticated tools for making accurate and timely forecasts, but have introduced new problems associated with handling and analyzing large quantities of complex data. AI (Artificial Intelligence) techniques have been considered as potential solutions to some of these problems. Fielding AI systems has proven more difficult than expected, in part because of operational constraints. Using systems which have been demonstrated successfully in the operational environment will provide a basis for a useful data fusion and analysis capability. Our approach uses a general purpose AI system already in operational use within the military intelligence community, called the Temporal Analysis System (TAS). TAS is an operational suite of tools supporting data processing, data visualization, historical analysis, situation assessment and predictive analysis. TAS includes expert system tools to analyze incoming events for indications of particular situations and predicts future activity. The expert system operates on a knowledge base of temporal patterns encoded using a knowledge representation called Temporal Transition Models (TTM's) and an event database maintained by the other TAS tools. The system also includes a robust knowledge acquisition and maintenance tool for creating TTM's using a graphical specification language. The ability to manipulate TTM's in a graphical format gives non-computer specialists an intuitive way of accessing and editing the knowledge base. To support space environmental analyses, we used TAS's ability to define domain specific event analysis abstractions. The prototype system defines

  10. Computing Facilities for AI: A Survey of Present and Near-Future Options

    OpenAIRE

    Fahlman, Scott

    1981-01-01

    At the recent AAAI conference at Stanford, it became apparent that many new AI research centers are being established around the country in industrial and governmental settings and in universities that have not paid much attention to AI in the past. At the same time, many of the established AI centers are in the process of converting from older facilities, primarily based on Decsystem-10 and Decsystem-20 machines, to a variety of newer options. At present, unfortunately, there is no simple an...

  11. A Review of Future and Ethical Perspectives of Robotics and AI

    OpenAIRE

    Jim Torresen

    2018-01-01

    In recent years, there has been increased attention on the possible impact of future robotics and AI systems. Prominent thinkers have publicly warned about the risk of a dystopian future when the complexity of these systems progresses further. These warnings stand in contrast to the current state-of-the-art of the robotics and AI technology. This article reviews work considering both the future potential of robotics and AI systems, and ethical considerations that need to be taken in order to ...

  12. Off The Beaten Lane: AI Challenges In MOBAs Beyond Player Control

    OpenAIRE

    Cook, Michael; Summerville, Adam; Colton, Simon

    2017-01-01

    MOBAs represent a huge segment of online gaming and are growing as both an eSport and a casual genre. The natural starting point for AI researchers interested in MOBAs is to develop an AI to play the game better than a human - but MOBAs have many more challenges besides adversarial AI. In this paper we introduce the reader to the wider context of MOBA culture, propose a range of challenges faced by the community today, and posit concrete AI projects that can be undertaken to begin solving them.

  13. Validation of the Avoidance and Inflexibility Scale (AIS) among Treatment-Seeking Smoker

    OpenAIRE

    Farris, Samantha G.; Zvolensky, Michael J.; DiBello, Angelo M.; Schmidt, Norman B.

    2015-01-01

    The Avoidance and Inflexibility Scale (AIS; Gifford et al., 2004) was derived as smoking-specific measure of experiential avoidance. However, there has been little investigation of the psychometric proprieties of the AIS and no published work on the topic. The current study aimed to test the reliability and validity of the AIS among a sample of adult treatment-seeking daily smokers (n = 465; 48.1% female, 17.8 [SD = 9.60] cigarettes per day). The AIS was administered at three time points (Bas...

  14. Fully automatic AI-based leak detection system

    Energy Technology Data Exchange (ETDEWEB)

    Tylman, Wojciech; Kolczynski, Jakub [Dept. of Microelectronics and Computer Science, Technical University of Lodz in Poland, ul. Wolczanska 221/223, Lodz (Poland); Anders, George J. [Kinectrics Inc., 800 Kipling Ave., Toronto, Ontario M8Z 6C4 (Canada)

    2010-09-15

    This paper presents a fully automatic system intended to detect leaks of dielectric fluid in underground high-pressure, fluid-filled (HPFF) cables. The system combines a number of artificial intelligence (AI) and data processing techniques to achieve high detection capabilities for various rates of leaks, including leaks as small as 15 l per hour. The system achieves this level of precision mainly thanks to a novel auto-tuning procedure, enabling learning of the Bayesian network - the decision-making component of the system - using simulated leaks of various rates. Significant new developments extending the capabilities of the original leak detection system described in and form the basis of this paper. Tests conducted on the real-life HPFF cable system in New York City are also discussed. (author)

  15. Planning chemical syntheses with deep neural networks and symbolic AI

    Science.gov (United States)

    Segler, Marwin H. S.; Preuss, Mike; Waller, Mark P.

    2018-03-01

    To plan the syntheses of small organic molecules, chemists use retrosynthesis, a problem-solving technique in which target molecules are recursively transformed into increasingly simpler precursors. Computer-aided retrosynthesis would be a valuable tool but at present it is slow and provides results of unsatisfactory quality. Here we use Monte Carlo tree search and symbolic artificial intelligence (AI) to discover retrosynthetic routes. We combined Monte Carlo tree search with an expansion policy network that guides the search, and a filter network to pre-select the most promising retrosynthetic steps. These deep neural networks were trained on essentially all reactions ever published in organic chemistry. Our system solves for almost twice as many molecules, thirty times faster than the traditional computer-aided search method, which is based on extracted rules and hand-designed heuristics. In a double-blind AB test, chemists on average considered our computer-generated routes to be equivalent to reported literature routes.

  16. Le français de la communication professionnelle

    CERN Document Server

    Danilo, Michel; Lincoln, M

    A partir de 150 heures de français. - Pour acquérir une bonne maîtrise des pratiques professionnelles. - Pour améliorer ses connaissances de la langue tout en se familiarisant avec les pratiques langagières spécifiques du monde du travail. - Pour préparer les examens de la Chambre de Commerce et d'Industrie de Paris. Dix dossiers : - La communication dans les affaires - Le travail administratif - Le téléphone - La communication interne - Le courrier de l'entreprise - L'offre et la commande - Livraison, transport, assurance - La facturation et le règlement - La communication avec les partenaires - Les nouveaux outils de communication Une cassette audio ainsi que des corrigés accompagnent ce livre.

  17. Age and helium content of the eclipsing binary AI Phoenicis

    International Nuclear Information System (INIS)

    VandenBerg, D.A.; Hrivnak, B.J.

    1985-01-01

    Comparisons of new theoretical isochrones for heavy-element abundances Z = 0.0169 (solar) and Z = 0.04 with recently published parameters of AI Phoenicis suggest that this system has an age of approximately (3.6 +- 0.7) x 10 9 yr and a helium content of Y = 0.38 +- 0.05. The indicated uncertainty is largely due to the lack of precise knowledge about the metallicity of the binary, since the fits to the data by both sets of isochrones are exceedingly good. The high helium content, which is required in order to reproduce the observed mass-luminosity relation, is suggested to be comparable with the values generally derived for binaries if the latter are adjusted to take into account the effect of the new Los Alamos opacities

  18. Conjugaison progressive du français avec 400 exercices

    CERN Document Server

    Boularès, Michèle

    1999-01-01

    La Conjugaison progressive du français s'adresse aux grands adolescents et aux adultes de tous niveaux. C'est un ouvrage d'apprentissage des formes verbales. On trouve sur la page de gauche : - la règle de formation de chaque temps ; - les verbes types présentés en tableaux et accompagnés d'une liste de verbes conjugués sur le même modèle ; - des remarques phonétiques ou orthographiques ; - des explications sur les difficultés particulières. La page de droite propose des exercices et des activités de difficulté progressive. C'est également un ouvrage de référence grâce aux nombreux tableaux de conjugaison qu'il contient.

  19. Applying AI techniques to improve alarm display effectiveness

    International Nuclear Information System (INIS)

    Gross, J.M.; Birrer, S.A.; Crosberg, D.R.

    1987-01-01

    The Alarm Filtering System (AFS) addresses the problem of information overload in a control room during abnormal operations. Since operators can miss vital information during these periods, systems which emphasize important messages are beneficial. AFS uses the artificial intelligence (AI) technique of object-oriented programming to filter and dynamically prioritize alarm messages. When an alarm's status changes, AFS determines the relative importance of that change according to the current process state. AFS bases that relative importance on relationships the newly changed alarm has with other activated alarms. Evaluations of a alarm importance take place without regard to the activation sequence of alarm signals. The United States Department of Energy has applied for a patent on the approach used in this software. The approach was originally developed by EG and G Idaho for a nuclear reactor control room

  20. Development of an advanced educational system using AI techniques

    International Nuclear Information System (INIS)

    Yoshimura, Seiichi

    1990-01-01

    This paper describes an advanced educational system that realizes effective education using AI techniques. The system is composed of three devices. One is a knowledge-processing computer that evaluates the operator's knowledge level and presents educational materials. Another is a computer for displaying transients. The other is a computer for voice input and output. The educational materials utilize cause-and-effect relationships. The relationships enable to perform effective education by pointing out the parts the operator failed to understand. An evaluation test was performed by actually operating the system. As a result, the system's fundamental characteristics, such as the ease of understanding the relationships, and the usefulness of the advanced evaluation of the operator's knowledge level, were evaluated highly. (author)

  1. Orthogonally Evolved AI to Improve Difficulty Adjustment in Video Games

    DEFF Research Database (Denmark)

    Hintze, Arend; Olson, Randal; Lehman, Joel Anthony

    2016-01-01

    Computer games are most engaging when their difficulty is well matched to the player's ability, thereby providing an experience in which the player is neither overwhelmed nor bored. In games where the player interacts with computer-controlled opponents, the difficulty of the game can be adjusted...... not only by changing the distribution of opponents or game resources, but also through modifying the skill of the opponents. Applying evolutionary algorithms to evolve the artificial intelligence that controls opponent agents is one established method for adjusting opponent difficulty. Less-evolved agents...... (i.e. agents subject to fewer generations of evolution) make for easier opponents, while highly-evolved agents are more challenging to overcome. In this publication we test a new approach for difficulty adjustment in games: orthogonally evolved AI, where the player receives support from collaborating...

  2. Polarized electron sources

    International Nuclear Information System (INIS)

    Prepost, R.

    1994-01-01

    The fundamentals of polarized electron sources are described with particular application to the Stanford Linear Accelerator Center. The SLAC polarized electron source is based on the principle of polarized photoemission from Gallium Arsenide. Recent developments using epitaxially grown, strained Gallium Arsenide cathodes have made it possible to obtain electron polarization significantly in excess of the conventional 50% polarization limit. The basic principles for Gallium and Arsenide polarized photoemitters are reviewed, and the extension of the basic technique to strained cathode structures is described. Results from laboratory measurements of strained photocathodes as well as operational results from the SLAC polarized source are presented

  3. Polarized electron sources

    Energy Technology Data Exchange (ETDEWEB)

    Prepost, R. [Univ. of Wisconsin, Madison, WI (United States)

    1994-12-01

    The fundamentals of polarized electron sources are described with particular application to the Stanford Linear Accelerator Center. The SLAC polarized electron source is based on the principle of polarized photoemission from Gallium Arsenide. Recent developments using epitaxially grown, strained Gallium Arsenide cathodes have made it possible to obtain electron polarization significantly in excess of the conventional 50% polarization limit. The basic principles for Gallium and Arsenide polarized photoemitters are reviewed, and the extension of the basic technique to strained cathode structures is described. Results from laboratory measurements of strained photocathodes as well as operational results from the SLAC polarized source are presented.

  4. GPU: the biggest key processor for AI and parallel processing

    Science.gov (United States)

    Baji, Toru

    2017-07-01

    Two types of processors exist in the market. One is the conventional CPU and the other is Graphic Processor Unit (GPU). Typical CPU is composed of 1 to 8 cores while GPU has thousands of cores. CPU is good for sequential processing, while GPU is good to accelerate software with heavy parallel executions. GPU was initially dedicated for 3D graphics. However from 2006, when GPU started to apply general-purpose cores, it was noticed that this architecture can be used as a general purpose massive-parallel processor. NVIDIA developed a software framework Compute Unified Device Architecture (CUDA) that make it possible to easily program the GPU for these application. With CUDA, GPU started to be used in workstations and supercomputers widely. Recently two key technologies are highlighted in the industry. The Artificial Intelligence (AI) and Autonomous Driving Cars. AI requires a massive parallel operation to train many-layers of neural networks. With CPU alone, it was impossible to finish the training in a practical time. The latest multi-GPU system with P100 makes it possible to finish the training in a few hours. For the autonomous driving cars, TOPS class of performance is required to implement perception, localization, path planning processing and again SoC with integrated GPU will play a key role there. In this paper, the evolution of the GPU which is one of the biggest commercial devices requiring state-of-the-art fabrication technology will be introduced. Also overview of the GPU demanding key application like the ones described above will be introduced.

  5. Polarized neutron spectrometer

    International Nuclear Information System (INIS)

    Abov, Yu.G.; Novitskij, V.V.; Alfimenkov, V.P.; Galinskij, E.M.; Mareev, Yu.D.; Pikel'ner, L.B.; Chernikov, A.N.; Lason', L.; Tsulaya, V.M.; Tsulaya, M.I.

    2000-01-01

    The polarized neutron spectrometer, intended for studying the interaction of polarized neutrons with nuclei and condensed media in the area of energies from thermal up to several electron-volt, is developed at the IBR-2 reactor (JINR, Dubna). Diffraction on the Co(92%)-Fe(8%) magnetized monocrystals is used for the neutron polarization and polarization analysis. The neutron polarization within the whole energy range equals ∼ 95% [ru

  6. Apolipoprotein A-I metabolism in cynomolgus monkey. Identification and characterization of beta-migrating pools

    International Nuclear Information System (INIS)

    Melchior, G.W.; Castle, C.K.

    1989-01-01

    Fresh plasma from control (C) and hypercholesterolemic (HC) cynomolgus monkeys was analyzed by agarose electrophoresis-immunoblotting with antibody to cynomolgus monkey apolipoprotein (apo) A-I. Two bands were evident on the autoradiogram: an alpha-migrating band (high density lipoprotein) and a beta-migrating band that comigrated exactly with cynomolgus monkey low density lipoprotein (LDL). The presence of beta-migrating apo A-I in the plasma of these monkeys was confirmed by Geon-Pevikon preparative electrophoresis, crossed immunoelectrophoresis, and isotope dilution studies in which radiolabeled apo A-I was found to equilibrate also with alpha- and beta-migrating pools of apo A-I in the plasma. Subfractionation of C and HC plasma by agarose column chromatography (Bio-Gel A-0.5M and A-15M) followed by agarose electrophoresis-immunoblotting indicated that the beta-migrating apo A-I in C was relatively homogeneous and eluted with proteins of Mr approximately 50 kD [apo A-I(50 kD)], whereas two beta-migrating fractions were identified in HC, one that eluted with the 50-kD proteins, and the other that eluted in the LDL Mr range [apo A-I(LDL)]. The apo A-I(LDL) was precipitated by antibody to cynomolgus monkey apo B. The apo A-I(50 kD) accounted for 5 +/- 1% (mean +/- SD) of the plasma apo A-I in C plasma, and 15 +/- 7% in HC plasma. No apo A-I(LDL) was detected in C plasma, but that fraction accounted for 9 +/- 7% of the apo A-I in HC plasma. These data establish the presence of multiple pools of apo A-I in the cynomolgus monkey, which must be taken into consideration in any comprehensive model of apo A-I metabolism in this species

  7. Analysis of received AIS data from a LEO Cubesat

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Tausen, Mathias

    2014-01-01

    The AAUSAT3 satellite is a 1U cubesat, which has been developed by students at Aalborg Uni- versity, Denmark in collaboration with the Danish Maritime Authority. The satellite was launched into a polar DD-SSO orbit of 800 km altitude on February 25th 2013 on a mission to monitor ships from space...

  8. Penetration of geomagnetic pulsations from one polar cao cap to the other one

    International Nuclear Information System (INIS)

    Mal'tsev, Yu.P.; Lyatskij, V.B.

    1982-01-01

    A theoretical study is made of penetration of geomagnetic pulsations, excited in one polar cap in the region of open field lines, into the other one. The geomagnetic pulsations excited in a polar cap in the region of open field lines are also observed in the opposite polar cap. This is connected with the flow of ionospheric perturbation currents from one hemisphere to another over the boundary of the region with closed magnetic lines. In case of long-period oscillations under symmetrical conditions, both in the north and south polar caps, the ionospheric effect of the opposite hemisphere results in the fact that the electrical currents flowing from a source to the polar cap boundary grow 1.5 times as high. In case of short-period oscillations a portion of longitudinal current flowing between the hemispheres is branched away for polarization currents. As a result, the electrical field and currents in the ionosphere of the opposite hemisphere can substantially decrease as compared to the long-period oscillations

  9. Polarized targets and beams

    International Nuclear Information System (INIS)

    Meyer, W.

    1985-01-01

    First the experimental situation of the single-pion photoproduction and the photodisintegration of the deuteron is briefly discussed. Then a description of the Bonn polarization facilities is given. The point of main effort is put on the polarized target which plays a vital role in the program. A facility for photon induced double polarization experiments at ELSA will be presented in section 4. Properties of a tensor polarized deuteron target are discussed in section 5. The development in the field of polarized targets, especially on new target materials, enables a new generation of polarized target experiments with (polarized) electrons. Some comments on the use of a polarized target in combination with electron beams will be discussed in section 6. Electron deuteron scattering from a tensor polarized deuteron target is considered and compared with other experimental possibilities. (orig./HSI)

  10. Squeeze Casting Method Of AI-Si Alloy For Piston Material

    International Nuclear Information System (INIS)

    Wagiyo, H.; Dani, Muhammad; Sulistioso, G.S.; Pardede, Elman; Handayani, Ari; Teguh, Yulius S.P.P.

    2001-01-01

    The AI-Si alloy is an alloy used as piston material. This alloys could be as AI-Si hypereutectic alloy (Si content more than 12.5 % wt.), as AI-Si eutectic alloy (Si cuntent 12.5 % wt, and as AI-Si hypoeutectic alloy (Si content less than 12.5 % wt.). The synthesize of AI-Si alloy piston generally using the technique of gravity casting in a dies. This method is causing high porousity. By using the squeeze technique, amount ofporousity in AI-Si alloy is possibly reduced and the density of this alloy should be higher. The other factors such as alloying elements of AI-Si alloy (Mg. Cu, Zn) would increase the mechanical properties especially the hardness. The focuses of this research are the microstructure and the maximum hardness during the heat treatment of AI-Si alloy which was added by alloying elments. The result of hardness at test shows the maximum hardness at 94.7 kg/mm 2 obtained at aging temperature of 210 o C for hours with homogenous dendritic microstructure

  11. Activity of autoinducer two (AI-2) in bacteria isolated from surface ripened cheeses

    DEFF Research Database (Denmark)

    Gori, Klaus; Jespersen, Lene

    2007-01-01

    ). Corynebacterium casei, Microbacterium barkeri, Microbacterium gubbeenense and S. equorum subsp. linens (all isolated from the smear of surface ripened cheeses) using the AI-2 bioluminescence assay. This indicates that AI-2 signaling could take place between bacteria found in the smear of surface ripened cheeses....

  12. Explanation and trust: what to tell the user in security and AI?

    NARCIS (Netherlands)

    Pieters, Wolter

    2010-01-01

    There is a common problem in artificial intelligence (AI) and information security. In AI, an expert system needs to be able to justify and explain a decision to the user. In information security, experts need to be able to explain to the public why a system is secure. In both cases, the goal of

  13. Explanation and trust: what to tell the user in security and AI?

    NARCIS (Netherlands)

    Pieters, Wolter

    There is a common problem in artificial intelligence (AI) and information security. In AI, an expert system needs to be able to justify and explain a decision to the user. In information security, experts need to be able to explain to the public why a system is secure. In both cases, an important

  14. On how AI & Law can help autonomous systems obey the law: a position paper

    NARCIS (Netherlands)

    Prakken, Hendrik

    2016-01-01

    In this position paper I discuss to what extent current and past AI & law research is relevant for research on autonomous intelligent systems that exhibit legally relevant behaviour. After a brief review of the history of AI & law, I will compare the problems faced by autonomous intelligent systems

  15. In Orbit Validation of the AAUSAT3 SDR based AIS receiver

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter

    2013-01-01

    During the past years, there has been a high interest in monitoring the global ship traffic from space. The recently launched AAUSAT3 satellite carries an SDR based AIS receiver, which during the past months have been transmitting space based AIS data down to the Aalborg University Ground Station...

  16. Development and application of AI technology to plant operation and support

    International Nuclear Information System (INIS)

    Sackett, J.I.; Mott, J.E.

    1989-01-01

    This paper discusses a framework for the development and application of artificial intelligence (AI) technology in existing nuclear facilities and reviews the status of development. We consider those areas best addressed by AI technology, e.g., equipment diagnostics, sensor validation, and expert systems for procedural response or planning. A brief discussion of work in computer displays is also given. (orig./GL)

  17. Teaching AI Search Algorithms in a Web-Based Educational System

    Science.gov (United States)

    Grivokostopoulou, Foteini; Hatzilygeroudis, Ioannis

    2013-01-01

    In this paper, we present a way of teaching AI search algorithms in a web-based adaptive educational system. Teaching is based on interactive examples and exercises. Interactive examples, which use visualized animations to present AI search algorithms in a step-by-step way with explanations, are used to make learning more attractive. Practice…

  18. Study on AI-2 signaling molecules activity and the effect of matrine on AI-2 in Staphylococcus epidermidis LuxS/AI-2 quorum sensing%产膜表皮葡萄球菌LuxS/AI-2型密度感应系统AI-2的活性及苦参碱对其的影响

    Institute of Scientific and Technical Information of China (English)

    李雪; 何芳; 卢金霞; 管翠萍; 周学章

    2017-01-01

    [Objective] This study investigated the activity of AI-2 signaling molecules in Staphylococcus epidermidis planktonic bacteria and biofilm bacteria and the effect of matrine.[Method] The growth curve of Staphylococcus epidermidis planktonic bacteria and biofilm bacteria was drawn and AI-2 concentration was measured using the V.harveyi bioluminescence assay.The transcription level of luxS gene was analyzed using real-time PCR.The AI-2 signaling molecules of Staphylococcus epidermidis ATCC35984 were treated with matrine and the changes of AI-2 signaling molecules activity were determined.[Result] In Staphylococcus epidermidis planktonic bacteria growth process,AI-2 signaling molecule activity and the relative expression quantity of luxS gene reached the maximum in the logarithmic phase before decreasing gradually.Their change curves were similar with planktonic growth curve.However,in the growth process of Staphylococcus epidermidis biofilm bacteria,the activity trend was similar with the biofilm growth.The relative expression quantity of luxS gene had an opposite trend to biofilm growth.Matrine had inhibitory effect on AI-2 signaling molecule activity in planktonic and biofilm bacteria,and the inhibitory effect was stronger to planktonic bacteria.[Conclusion] AI-2 signaling molecule activity and relative expression quantity of luxS gene highly correlated with the growth of Staphylococcus epidermidis and its biofilm formation.Matrine significantly reduced the AI-2 signaling molecule activity of Staphylococcus epidermidis.%[目的]研究产膜表皮葡萄球菌生物被膜菌和液相浮游菌LuxS/AI-2型密度感应系统中AI-2信号分子的活性及苦参碱对其的影响.[方法]绘制产膜表皮葡萄球菌ATCC35984液相浮游菌及生物被膜菌的生长曲线;利用哈维氏弧菌BB170(Vibrio harveyi BB170)作为报告菌株检测表皮葡萄球菌AI-2信号分子的活性;用荧光定量PCR法检测luxS基因的转录水平;用苦参碱

  19. Artificial Intelligence (AI), Operations Research (OR), and Decision Support Systems (DSS): A conceptual framework

    Science.gov (United States)

    Parnell, Gregory S.; Rowell, William F.; Valusek, John R.

    1987-01-01

    In recent years there has been increasing interest in applying the computer based problem solving techniques of Artificial Intelligence (AI), Operations Research (OR), and Decision Support Systems (DSS) to analyze extremely complex problems. A conceptual framework is developed for successfully integrating these three techniques. First, the fields of AI, OR, and DSS are defined and the relationships among the three fields are explored. Next, a comprehensive adaptive design methodology for AI and OR modeling within the context of a DSS is described. These observations are made: (1) the solution of extremely complex knowledge problems with ill-defined, changing requirements can benefit greatly from the use of the adaptive design process, (2) the field of DSS provides the focus on the decision making process essential for tailoring solutions to these complex problems, (3) the characteristics of AI, OR, and DSS tools appears to be converging rapidly, and (4) there is a growing need for an interdisciplinary AI/OR/DSS education.

  20. Enabling technologies and methods for the retro-fitting of AI software into NPPS

    International Nuclear Information System (INIS)

    Pymm, P.

    1994-01-01

    Scottish Nuclear have a number of plant monitoring and training applications at their operational nuclear power plant which could benefit from the introduction of artificial intelligence (AI) software. An outline of early work on two current AI developments in the areas of advanced operator aids and intelligent training is given. A generic workstation based engineering simulator (WES) which provides a prototyping environment for AI product application development and evaluation and development of human-computer interface (HCI) designs for plant installation is described. It is concluded that the WES architecture facilitates both migration of the prototype AI application to the plant and collaboration in the AI field between Scottish Nuclear and other organizations. (author). 1 ref., 6 figs

  1. LuxS-independent formation of AI-2 from ribulose-5-phosphate

    Directory of Open Access Journals (Sweden)

    Hardie Kim R

    2008-06-01

    Full Text Available Abstract Background In many bacteria, the signal molecule AI-2 is generated from its precursor S-ribosyl-L-homocysteine in a reaction catalysed by the enzyme LuxS. However, generation of AI-2-like activity has also been reported for organisms lacking the luxS gene and the existence of alternative pathways for AI-2 formation in Escherichia coli has recently been predicted by stochastic modelling. Here, we investigate the possibility that spontaneous conversion of ribulose-5-phosphate could be responsible for AI-2 generation in the absence of luxS. Results Buffered solutions of ribulose-5-phosphate, but not ribose-5-phosphate, were found to contain high levels of AI-2 activity following incubation at concentrations similar to those reported in vivo. To test whether this process contributes to AI-2 formation by bacterial cells in vivo, an improved Vibrio harveyi bioassay was used. In agreement with previous studies, culture supernatants of E. coli and Staphylococcus aureus luxS mutants were found not to contain detectable levels of AI-2 activity. However, low activities were detected in an E. coli pgi-eda-edd-luxS mutant, a strain which degrades glucose entirely via the oxidative pentose phosphate pathway, with ribulose-5-phosphate as an obligatory intermediate. Conclusion Our results suggest that LuxS-independent formation of AI-2, via spontaneous conversion of ribulose-5-phosphate, may indeed occur in vivo. It does not contribute to AI-2 formation in wildtype E. coli and S. aureus under the conditions tested, but may be responsible for the AI-2-like activities reported for other organisms lacking the luxS gene.

  2. The AI&M procedure for learning from incomplete data

    DEFF Research Database (Denmark)

    Jaeger, Manfred

    2006-01-01

    We investigate methods for parameter learning from incomplete data that is not missing at random. Likelihood-based methods then require the optimization of a profile likelihood that takes all possible missingness mechanisms into account. Optimizing this profile likelihood poses two main difficult......We investigate methods for parameter learning from incomplete data that is not missing at random. Likelihood-based methods then require the optimization of a profile likelihood that takes all possible missingness mechanisms into account. Optimizing this profile likelihood poses two main...... by operations in the space of data completions, rather than directly in the parameter space of the profile likelihood. We apply the AI\\&M method to learning parameters for Bayesian networks. The method is compared against conservative inference, which takes into account each possible data completion......, and against EM. The results indicate that likelihood-based inference is still feasible in the case of unknown missingness mechanisms, and that conservative inference is unnecessarily weak. On the other hand, our results also provide evidence that the EM algorithm is still quite effective when the data...

  3. Building regional early flood warning systems by AI techniques

    Science.gov (United States)

    Chang, F. J.; Chang, L. C.; Amin, M. Z. B. M.

    2017-12-01

    Building early flood warning system is essential for the protection of the residents against flood hazards and make actions to mitigate the losses. This study implements AI technology for forecasting multi-step-ahead regional flood inundation maps during storm events. The methodology includes three major schemes: (1) configuring the self-organizing map (SOM) to categorize a large number of regional inundation maps into a meaningful topology; (2) building dynamic neural networks to forecast multi-step-ahead average inundated depths (AID); and (3) adjusting the weights of the selected neuron in the constructed SOM based on the forecasted AID to obtain real-time regional inundation maps. The proposed models are trained, and tested based on a large number of inundation data sets collected in regions with the most frequent and serious flooding in the river basin. The results appear that the SOM topological relationships between individual neurons and their neighbouring neurons are visible and clearly distinguishable, and the hybrid model can continuously provide multistep-ahead visible regional inundation maps with high resolution during storm events, which have relatively small RMSE values and high R2 as compared with numerical simulation data sets. The computing time is only few seconds, and thereby leads to real-time regional flood inundation forecasting and make early flood inundation warning system. We demonstrate that the proposed hybrid ANN-based model has a robust and reliable predictive ability and can be used for early warning to mitigate flood disasters.

  4. Computational intelligence from AI to BI to NI

    Science.gov (United States)

    Werbos, Paul J.

    2015-05-01

    This paper gives highlights of the history of the neural network field, stressing the fundamental ideas which have been in play. Early neural network research was motivated mainly by the goals of artificial intelligence (AI) and of functional neuroscience (biological intelligence, BI), but the field almost died due to frustrations articulated in the famous book Perceptrons by Minsky and Papert. When I found a way to overcome the difficulties by 1974, the community mindset was very resistant to change; it was not until 1987/1988 that the field was reborn in a spectacular way, leading to the organized communities now in place. Even then, it took many more years to establish crossdisciplinary research in the types of mathematical neural networks needed to really understand the kind of intelligence we see in the brain, and to address the most demanding engineering applications. Only through a new (albeit short-lived) funding initiative, funding crossdisciplinary teams of systems engineers and neuroscientists, were we able to fund the critical empirical demonstrations which put our old basic principle of "deep learning" firmly on the map in computer science. Progress has rightly been inhibited at times by legitimate concerns about the "Terminator threat" and other possible abuses of technology. This year, at SPIE, in the quantum computing track, we outline the next stage ahead of us in breaking out of the box, again and again, and rising to fundamental challenges and opportunities still ahead of us.

  5. AI empowered context-aware smart system for medication adherence

    Directory of Open Access Journals (Sweden)

    Qiong Wu

    2017-06-01

    Full Text Available Purpose – Poor medication adherence leads to high hospital admission rate and heavy amount of health-care cost. To cope with this problem, various electronic pillboxes have been proposed to improve the medication adherence rate. However, most of the existing electronic pillboxes use time-based reminders which may often lead to ineffective reminding if the reminders are triggered at inopportune moments, e.g. user is sleeping or eating. Design/methodology/approach – In this paper, the authors propose an AI-empowered context-aware smart pillbox system. The pillbox system collects real-time sensor data from a smart home environment and analyzes the user’s contextual information through a computational abstract argumentation-based activity classifier. Findings – Based on user’s different contextual states, the smart pillbox will generate reminders at appropriate time and on appropriate devices. Originality/value – This paper presents a novel context-aware smart pillbox system that uses argumentation-based activity recognition and reminder generation.

  6. Dictionnaire étymologique du français

    CERN Document Server

    Picoche, Jacqueline

    1979-01-01

    Cette nouvelle édition du Dictionnaire étymologique du français, largement enrichie, présente l'arbre généalogique de près de 35 000 mots. Savez-vous que concerto, décret et discernement ont la même racine que crible ?. Que chauvin, espiègle et rocambolesque viennent de noms de personnages de la littérature ?. Que le sens premier de amadouer est " frotter avec de l'amadou " pour se jaunir le teint ?. Pour chaque mot, retrouvez sa famille, son origine, son sens originel ou le sens de sa racine, les diverses formes qu'il a prises depuis sa première attestation et les règles phonétiques expliquant son évolution. Des annexes traitent plus particulièrement des mots à syllabes redoublées (coco, zigzag), de ceux formés sur des onomatopées (hennir, ouistiti) et de ceux venant de noms de personnes (dahlia, praline) ou de lieux (bougie, rugby).

  7. AI and simulation: What can they learn from each other

    Science.gov (United States)

    Colombano, Silvano P.

    1988-01-01

    Simulation and Artificial Intelligence share a fertile common ground both from a practical and from a conceptual point of view. Strengths and weaknesses of both Knowledge Based System and Modeling and Simulation are examined and three types of systems that combine the strengths of both technologies are discussed. These types of systems are a practical starting point, however, the real strengths of both technologies will be exploited only when they are combined in a common knowledge representation paradigm. From an even deeper conceptual point of view, one might even argue that the ability to reason from a set of facts (i.e., Expert System) is less representative of human reasoning than the ability to make a model of the world, change it as required, and derive conclusions about the expected behavior of world entities. This is a fundamental problem in AI, and Modeling Theory can contribute to its solution. The application of Knowledge Engineering technology to a Distributed Processing Network Simulator (DPNS) is discussed.

  8. CURRENT ISSUES IN OUTSOURCING: MIS, AIS AND BEYOND

    Directory of Open Access Journals (Sweden)

    AIDA SY

    2012-01-01

    Full Text Available En años recientes, el outsourcing se ha venido convirtiendo en una tendencia tanto en empresas de Europa y los Estados Unidos. Ni siquiera, trabajadores muy calificados se salvan de este asalto.La vanidad de los intelectuales y los profesionales que ejecutan tanto sistemas de información contable(AIS, como sistemas de información de gestión (MIS es su creencia de que están exentos de estosprocesos de outsourcing. Algunos creen que disfrutan de una vida de ensueño, que la demanda de sus servicios está asegurada. Se consuelan pensando que el aumento de su dominiotécnico les ofrece una defensa suficiente contra los ataques provenientes del mercado laboral y de productos.Una interpretación desde los estudios críticos indicará que esta posición es un acto dearrogancia, siendo esto el eje de la discusión de este documento. Tal actitud de los profesionales contables es una reminiscencia del Rey Canuto esperando que la marea retroceda.

  9. Scattering with polarized neutrons

    International Nuclear Information System (INIS)

    Schweizer, J.

    2007-01-01

    In the history of neutron scattering, it was shown very soon that the use of polarized neutron beams brings much more information than usual scattering with unpolarized neutrons. We shall develop here the different scattering methods that imply polarized neutrons: 1) polarized beams without polarization analysis, the flipping ratio method; 2) polarized beams with a uniaxial polarization analysis; 3) polarized beams with a spherical polarization analysis. For all these scattering methods, we shall give examples of the physical problems which can been solved by these methods, particularly in the field of magnetism: investigation of complex magnetic structures, investigation of spin or magnetization densities in metals, insulators and molecular compounds, separation of magnetic and nuclear scattering, investigation of magnetic properties of liquids and amorphous materials and even, for non magnetic material, separation between coherent and incoherent scattering. (author)

  10. Polarized Light Corridor Demonstrations.

    Science.gov (United States)

    Davies, G. R.

    1990-01-01

    Eleven demonstrations of light polarization are presented. Each includes a brief description of the apparatus and the effect demonstrated. Illustrated are strain patterns, reflection, scattering, the Faraday Effect, interference, double refraction, the polarizing microscope, and optical activity. (CW)

  11. Techniques in polarization physics

    International Nuclear Information System (INIS)

    Clausnitzer, G.

    1974-01-01

    A review of the current status of the technical tools necessary to perform different kinds of polarization experiments is presented, and the absolute and relative accuracy with which data can be obtained is discussed. A description of polarized targets and sources of polarized fast neutrons is included. Applications of polarization techniques to other fields is mentioned briefly. (14 figures, 3 tables, 110 references) (U.S.)

  12. Polarized Moessbauer transitions

    International Nuclear Information System (INIS)

    Barb, D.

    1975-01-01

    Theoretical aspects of the emission, absorption and scattering of polarized gamma rays are reviewed for a general case of combined magnetic and electric hyperfine interactions; various possibilities of obtaining polarized gamma sources are described and examples are given of the applications of Moessbauer spectroscopy with polarized gamma rays in solving problems of solid state physics. (A.K.)

  13. Geographical Income Polarization

    DEFF Research Database (Denmark)

    Azhar, Hussain; Jonassen, Anders Bruun

    inter municipal income inequality. Counter factual simulations show that rising property prices to a large part explain the rise in polarization. One side-effect of polarization is tendencies towards a parallel polarization of residence location patterns, where low skilled individuals tend to live...

  14. Calculation of polarization effects

    International Nuclear Information System (INIS)

    Chao, A.W.

    1983-09-01

    Basically there are two areas of accelerator applications that involve beam polarization. One is the acceleration of a polarized beam (most likely a proton beam) in a synchrotron. Another concerns polarized beams in an electron storage ring. In both areas, numerical techniques have been very useful

  15. Novel cross-linked alcohol-insoluble solid (CL-AIS) affinity gel from pea pod for pectinesterase purification.

    Science.gov (United States)

    Wu, Ming-Chang; Lin, Guan-Hui; Wang, Yuh-Tai; Jiang, Chii-Ming; Chang, Hung-Min

    2005-10-05

    Alcohol-insoluble solids (AIS) from pea pod were cross-linked (CL-AIS) and used as an affinity gel matrix to isolate pectin esterases (PEs) from tendril shoots of chayote (TSC) and jelly fig achenes (JFA), and the results were compared with those isolated by ion-exchange chromatography with a commercial resin. CL-AIS gel matrix in a column displayed poor absorption and purification fold of PE; however, highly methoxylated CL-AIS (HM-CL-AIS), by exposing CL-AIS to methanolic sulfuric acid to increase the degree of esterification (DE) to 92%, facilitated the enzyme purification. The purified TSC PE and JFA PE by the HM-CL-AIS column were proofed as a single band on an SDS-PAGE gel, showing that the HM-CL-AIS column was a good matrix for purification of PE, either with alkaline isoelectric point (pI) (TSC PE) or with acidic pI (JFA PE).

  16. Magnetic field reversals, polar wander, and core-mantle coupling.

    Science.gov (United States)

    Courtillot, V; Besse, J

    1987-09-04

    True polar wander, the shifting of the entire mantle relative to the earth's spin axis, has been reanalyzed. Over the last 200 million years, true polar wander has been fast (approximately 5 centimeters per year) most of the time, except for a remarkable standstill from 170 to 110 million years ago. This standstill correlates with a decrease in the reversal frequency of the geomagnetic field and episodes of continental breakup. Conversely, true polar wander is high when reversal frequency increases. It is proposed that intermittent convection modulates the thickness of a thermal boundary layer at the base of the mantle and consequently the core-to-mantle heat flux. Emission of hot thermals from the boundary layer leads to increases in mantle convection and true polar wander. In conjunction, cold thermals released from a boundary layer at the top of the liquid core eventually lead to reversals. Changes in the locations of subduction zones may also affect true polar wander. Exceptional volcanism and mass extinctions at the Cretaceous-Tertiary and Permo-Triassic boundaries may be related to thermals released after two unusually long periods with no magnetic reversals. These environmental catastrophes may therefore be a consequence of thermal and chemical couplings in the earth's multilayer heat engine rather than have an extraterrestrial cause.

  17. A model of lipid-free apolipoprotein A-I revealed by iterative molecular dynamics simulation.

    Directory of Open Access Journals (Sweden)

    Xing Zhang

    Full Text Available Apolipoprotein A-I (apo A-I, the major protein component of high-density lipoprotein, has been proven inversely correlated to cardiovascular risk in past decades. The lipid-free state of apo A-I is the initial stage which binds to lipids forming high-density lipoprotein. Molecular models of lipid-free apo A-I have been reported by methods like X-ray crystallography and chemical cross-linking/mass spectrometry (CCL/MS. Through structural analysis we found that those current models had limited consistency with other experimental results, such as those from hydrogen exchange with mass spectrometry. Through molecular dynamics simulations, we also found those models could not reach a stable equilibrium state. Therefore, by integrating various experimental results, we proposed a new structural model for lipid-free apo A-I, which contains a bundled four-helix N-terminal domain (1-192 that forms a variable hydrophobic groove and a mobile short hairpin C-terminal domain (193-243. This model exhibits an equilibrium state through molecular dynamics simulation and is consistent with most of the experimental results known from CCL/MS on lysine pairs, fluorescence resonance energy transfer and hydrogen exchange. This solution-state lipid-free apo A-I model may elucidate the possible conformational transitions of apo A-I binding with lipids in high-density lipoprotein formation.

  18. Validation of the Avoidance and Inflexibility Scale (AIS) among treatment-seeking smokers.

    Science.gov (United States)

    Farris, Samantha G; Zvolensky, Michael J; DiBello, Angelo M; Schmidt, Norman B

    2015-06-01

    The Avoidance and Inflexibility Scale (AIS; Gifford et al., 2004) was derived as a smoking-specific measure of experiential avoidance. However, there has been little investigation of the psychometric proprieties of the AIS and no published work on the topic. The current study aimed to test the reliability and validity of the AIS among a sample of adult treatment-seeking daily smokers (n = 465; 48.2% female, 17.8 [SD = 9.60] cigarettes per day). The AIS was administered at 3 time points (baseline, quit-day, and 1 month postquit) as part of a larger smoking cessation trial. An exploratory factor analysis indicated a 2-factor solution, described by inflexibility and avoidance because of smoking related "thoughts/feelings" (9 items) and "somatic sensations" (4 items). Results revealed that the AIS-total and factor scores demonstrated high internal consistency and test-retest reliability. The AIS total and factor scores also displayed high convergent, discriminant, and incremental predictive validity with theoretically relevant smoking and affective variables. The present data suggest that the AIS measure appears to be a valid and reliable smoking-specific index of experiential avoidance. (c) 2015 APA, all rights reserved).

  19. Validation of the Avoidance and Inflexibility Scale (AIS) among Treatment-Seeking Smoker

    Science.gov (United States)

    Farris, Samantha G.; Zvolensky, Michael J.; DiBello, Angelo M.; Schmidt, Norman B.

    2015-01-01

    The Avoidance and Inflexibility Scale (AIS; Gifford et al., 2004) was derived as smoking-specific measure of experiential avoidance. However, there has been little investigation of the psychometric proprieties of the AIS and no published work on the topic. The current study aimed to test the reliability and validity of the AIS among a sample of adult treatment-seeking daily smokers (n = 465; 48.1% female, 17.8 [SD = 9.60] cigarettes per day). The AIS was administered at three time points (Baseline, Quit day, 1 month post-quit) as part of a larger smoking cessation trial. An exploratory factor analysis indicated a two-factor solution, described by inflexibility and avoidance due to smoking related “thoughts/feelings” (9 items) and “somatic sensations” (4 items). Results revealed that the AIS-total and factor scores demonstrated high internal consistency and test-retest reliability. The AIS total and factor scores also displayed high convergent, discriminant, and incremental predictive validity with theoretically-relevant smoking and affective variables. The present data suggest that the AIS measure appears to be a valid and reliable smoking-specific index of experiential avoidance. PMID:25642937

  20. Rapid and simple colorimetric method for the quantification of AI-2 produced from Salmonella Typhimurium.

    Science.gov (United States)

    Wattanavanitchakorn, Siriluck; Prakitchaiwattana, Cheunjit; Thamyongkit, Patchanita

    2014-04-01

    The aim of this study was to evaluate the feasibility of Fe(III) ion reduction for the simple and rapid quantification of autoinducer-2 (AI-2) produced from bacteria using Salmonella Typhimurium as a model. Since the molecular structure of AI-2 is somewhat similar to ascorbic acid it was expected that AI-2 would also act as a reducing agent and reduce Fe(III) ions in the presence of 1,10-phenanthroline to form the colored [(o-phen)3 Fe(II)]SO4 ferroin complex that could be quantified colorimetrically. In support of this, colony rinses and cell free supernatants from cultures of all tested AI-2 producing strains, but not the AI-2 negative Sinorhizobium meliloti, formed a colored complex with a λmax of 510nm. The OD510 values of these culture supernatants or colony rinses were in broad agreement with the % activity observed in the same samples using the standard Vibrio harveyi bioluminescence assay for AI-2 detection, and with previously reported results. This methodology could potentially be developed as an alternative method for the simple and rapid quantification of AI-2 levels produced in bacterial cultures. Copyright © 2014 Elsevier B.V. All rights reserved.

  1. Long-period ground motions at near-regional distances caused by the PL wave from, inland earthquakes: Observation and numerical simulation of the 2004 Mid-Niigata, Japan, Mw6.6 earthquake

    Science.gov (United States)

    Furumura, T.; Kennett, B. L. N.

    2017-12-01

    We examine the development of large, long-period ground motions at near-regional distances (D=50-200 km) generated by the PL wave from large, shallow inland earthquakes, based on the analysis of strong motion records and finite-difference method (FDM) simulations of seismic wave propagation. PL wave can be represented as leaking modes of the crustal waveguide and are commonly observed at regional distances between 300 to 1000 km as a dispersed, long-period signal with a dominant period of about 20 s. However, observations of recent earthquakes at the dense K-NET and KiK-net strong motion networks in Japan demonstrate the dominance of the PL wave at near-regional (D=50-200 km) distances as, e.g., for the 2004 Mid Niigata, Japan, earthquake (Mw6.6; h=13 km). The observed PL wave signal between P and S wave shows a large, dispersed wave packet with dominant period of about T=4-10 s with amplitude almost comparable to or larger than the later arrival of the S and surface waves. Thus, the early arrivals of the long-period PL wave immediately after P wave can enhance resonance with large-scale constructions such as high-rise buildings and large oil-storage tanks etc. with potential for disaster. Such strong effects often occurred during the 2004 Mid Niigata earthquakes and other large earthquakes which occurred nearby the Kanto (Tokyo) basin. FDM simulation of seismic wave propagation employing realistic 3-D sedimentary structure models demonstrates the process by which the PL wave develops at near-regional distances from shallow, crustal earthquakes by constructive interference of the P wave in the long-period band. The amplitude of the PL wave is very sensitive to low-velocity structure in the near-surface. Lowered velocities help to develop large SV-to-P conversion and weaken the P-to-SV conversion at the free surface. Both effects enhance the multiple P reflections in the crustal waveguide and prevent the leakage of seismic energy into the mantle. However, a very

  2. Demonstration of two-user, 10-Gbits/s optical code-division multiple-access system implemented by using cascaded long-period fiber gratings formed in dispersion-compensating fiber with inner-cladding structure

    Science.gov (United States)

    Kim, Sun-Jong; Eom, Tae-Jung; Kim, Tae-Young; Lee, Byeong Ha; Park, Chang-Soo

    2005-09-01

    A two-user, 10-Gbits/s optical code-division multiple-access system implemented by using cascaded long-period fiber gratings formed in a dispersion-compensating fiber (DCF) is demonstrated. Our results show that the sensitivity of cladding modes to the refractive index change on the cladding surface is greatly reduced by utilizing the inner-cladding mode of the DCF. Two pairs of encoder/decoder are constructed and the performance is evaluated by measuring bit error rate (BER). With an interferer, a BER of 1.5×10-12 is measured at a received optical power of -6 dBm.

  3. Acceleration of polarized particles

    International Nuclear Information System (INIS)

    Buon, J.

    1992-05-01

    The spin kinetics of polarized beams in circular accelerators is reviewed in the case of spin-1/2 particles (electrons and protons) with emphasis on the depolarization phenomena. The acceleration of polarized proton beams in synchrotrons is described together with the cures applied to reduce depolarization, including the use of 'Siberian Snakes'. The in-situ polarization of electrons in storage rings due to synchrotron radiation is studied as well as depolarization in presence of ring imperfections. The applications of electron polarization to accurately calibrate the rings in energy and to use polarized beams in colliding-beam experiments are reviewed. (author) 76 refs., 19 figs., 1 tab

  4. The Atomics International (AI) prototype large breeder reactor (PLBR)

    International Nuclear Information System (INIS)

    McDonald, J.S.; Campise, A.V.; Brunings, J.

    1978-01-01

    The AI-PLBR breeder plant design prepared for ERDA and EPRI is of 1000 MWe size, utilizing a loop-type sodium system configuration and producing 2200 psig/850 0 F steam. A 'bullseye' core geometry type sodium system configuration and is employed with Pu0 2 -UO 2 fuel and UO 2 fertile material. The reactor outlet coolant temperature is 930 0 F. A modified 'A'-frame refueling system is employed, which is capable of handling 1/3 of a core loading in 12 days. An inducer-type mechanical pump is used in the primary circuit because of its excellent NPSH characteristics. Hockey sticks steam generators are used to produce near-fossil steam conditions at the turbine throttle. The balance of plant (BOP) design was developed by the architectural-engineering firm of Burns and Roe. It includes Allis-Chalmers - KWU 1800-rpm tandem-compound turbine, selected with high-,intermediate-, and two double-flow low-pressure cylinders equipped with two moisture separator cyclones. A design feature to enhance the licensability of the reference design is the three-level Decay Heat Removal System (DHRS), which consists of normal, backup, and diverse decay heat removal paths. The Atomics International PLBR design illustrated the technical soundness of the LMFBR system for meeting the world's long-term electrical energy supply needs. The design includes design features to assure licensability and innovative engineering features to enhance reliability, constructability, economics, and U.S. utility grid compatibility. The design concept provides a sound basis for the future detailed design of a prototype plant and subsequent development of larger LMFBR plants. (author)

  5. Man-machine communication in reactor control using AI methods

    International Nuclear Information System (INIS)

    Klebau, J.; Lindner, A.; Fiedler, U.

    1987-01-01

    In the last years the interest in process control has expecially focused on problems of man-machine communication. It depends on its great importance to process performance and user acceptance. Advanced computerized operator aids, e.g. in nuclear power plants, are as well as their man-machine interface. In the Central Institute for Nuclear Research in Rossendorf a computerized operator support system for nuclear power plants is designed, which is involved in a decentralized process automation system. A similar but simpler system, the Hierarchical Informational System (HIS) at the Rossendorf Research Reactor, works with a computer controlled man-machine interface, based on menu. In the special case of the disturbance analysis program SAAP-2, which is included in the HIS, the limits of menu techniques are obviously. Therefore it seems to be necessary and with extended hard- and software possible to realize an user controlled natural language interface using Artificial Intelligence (AI) methods. The draft of such a system is described. It should be able to learn during a teaching phase all phrases and their meanings. The system will work on the basis of a self-organizing, associative data structure. It is used to recognize a great amount of words which are used in language analysis. Error recognition and, if possible, correction is done by means of a distance function in the word set. Language analysis should be carried out with a simplified word class controlled functional analysis. With this interface it is supposed to get experience in intelligent man-machine communication to enhance operational safety in future. (author)

  6. AI Techniques in a Context-Aware Ubiquitous Environment

    Science.gov (United States)

    Coppola, Paolo; Mea, Vincenzo Della; di Gaspero, Luca; Lomuscio, Raffaella; Mischis, Danny; Mizzaro, Stefano; Nazzi, Elena; Scagnetto, Ivan; Vassena, Luca

    Nowadays, the mobile computing paradigm and the widespread diffusion of mobile devices are quickly changing and replacing many common assumptions about software architectures and interaction/communication models. The environment, in particular, or more generally, the so-called user context is claiming a central role in everyday’s use of cellular phones, PDAs, etc. This is due to the huge amount of data “suggested” by the surrounding environment that can be helpful in many common tasks. For instance, the current context can help a search engine to refine the set of results in a useful way, providing the user with a more suitable and exploitable information. Moreover, we can take full advantage of this new data source by “pushing” active contents towards mobile devices, empowering the latter with new features (e.g., applications) that can allow the user to fruitfully interact with the current context. Following this vision, mobile devices become dynamic self-adapting tools, according to the user needs and the possibilities offered by the environment. The present work proposes MoBe: an approach for providing a basic infrastructure for pervasive context-aware applications on mobile devices, in which AI techniques (namely a principled combination of rule-based systems, Bayesian networks and ontologies) are applied to context inference. The aim is to devise a general inferential framework to make easier the development of context-aware applications by integrating the information coming from physical and logical sensors (e.g., position, agenda) and reasoning about this information in order to infer new and more abstract contexts.

  7. Polarization effects. Volume 2

    Energy Technology Data Exchange (ETDEWEB)

    Courant, E.

    1981-01-01

    The use of polarized proton beams in ISABELLE is important for several general reasons: (1) With a single longitudinally polarized proton beam, effects involving parity violation can be identified and hence processes involving weak interactions can be separated from those involving strong and electromagnetic interactions. (2) Spin effects are important in the strong interactions and can be useful for testing QCD. The technique for obtaining polarized proton beams in ISABELLE appears promising, particularly in view of the present development of a polarized proton beam for the AGS. Projections for the luminosity in ISABELLE for collisions of polarized protons - one or both beams polarized with longitudinal or transverse polarization - range from 1/100 to 1 times the luminosity for unpolarized protons.

  8. The Physics of Polarization

    Science.gov (United States)

    Landi Degl'Innocenti, Egidio

    2015-10-01

    The introductory lecture that has been delivered at this Symposium is a condensed version of an extended course held by the author at the XII Canary Island Winter School from November 13 to November 21, 2000. The full series of lectures can be found in Landi Degl'Innocenti (2002). The original reference is organized in 20 Sections that are here itemized: 1. Introduction, 2. Description of polarized radiation, 3. Polarization and optical devices: Jones calculus and Muller matrices, 4. The Fresnel equations, 5. Dichroism and anomalous dispersion, 6. Polarization in everyday life, 7. Polarization due to radiating charges, 8. The linear antenna, 9. Thomson scattering, 10. Rayleigh scattering, 11. A digression on Mie scattering, 12. Bremsstrahlung radiation, 13. Cyclotron radiation, 14. Synchrotron radiation, 15. Polarization in spectral lines, 16. Density matrix and atomic polarization, 17. Radiative transfer and statistical equilibrium equations, 18. The amplification condition in polarized radiative transfer, and 19. Coupling radiative transfer and statistical equilibrium equations.

  9. Using experimental game theory to transit human values to ethical AI

    OpenAIRE

    Wang, Yijia; Wan, Yan; Wang, Zhijian

    2017-01-01

    Knowing the reflection of game theory and ethics, we develop a mathematical representation to bridge the gap between the concepts in moral philosophy (e.g., Kantian and Utilitarian) and AI ethics industry technology standard (e.g., IEEE P7000 standard series for Ethical AI). As an application, we demonstrate how human value can be obtained from the experimental game theory (e.g., trust game experiment) so as to build an ethical AI. Moreover, an approach to test the ethics (rightness or wrongn...

  10. How AI localisation in plant tissues determines the targeted pest spectrum of different chemistries

    DEFF Research Database (Denmark)

    Buchholz, Anke; Trapp, Stefan

    penetration as first crucial step can be modified by formulation whereas the active ingredient (AI) distribution within cells is usually solely determined by physicochemical properties. This passive AI distribution was calculated with the Fick-Nernst-Planck equation implemented in a cell model....... The predictions were compared to the measured biological effects against three different arthropods. Test compounds differed in log P (-0.1 to 4.3) and pKa (4.1 to 10.7). Efficacies in different bioassays are discussed with the postulated cellular AI localisation and the individual feeding behaviour...

  11. Combining AI Methods for Learning Bots in a Real-Time Strategy Game

    OpenAIRE

    Robin Baumgarten; Simon Colton; Mark Morris

    2009-01-01

    We describe an approach for simulating human game-play in strategy games using a variety of AI techniques, including simulated annealing, decision tree learning, and case-based reasoning. We have implemented an AI-bot that uses these techniques to form a novel approach for planning fleet movements and attacks in DEFCON, a nuclear war simulation strategy game released in 2006 by Introversion Software Ltd. The AI-bot retrieves plans from a case-base of recorded games, then uses these to generat...

  12. A Review of Future and Ethical Perspectives of Robotics and AI

    Directory of Open Access Journals (Sweden)

    Jim Torresen

    2018-01-01

    Full Text Available In recent years, there has been increased attention on the possible impact of future robotics and AI systems. Prominent thinkers have publicly warned about the risk of a dystopian future when the complexity of these systems progresses further. These warnings stand in contrast to the current state-of-the-art of the robotics and AI technology. This article reviews work considering both the future potential of robotics and AI systems, and ethical considerations that need to be taken in order to avoid a dystopian future. References to recent initiatives to outline ethical guidelines for both the design of systems and how they should operate are included.

  13. Selective oxidation of methionine residues in apolipoprotein A-I and its potential biological consequences

    International Nuclear Information System (INIS)

    Panzenboeck, U.; Waldeck, R.; Rye, K.A.; Sloane, T.; Kritharides, L.; Stocker, R.

    1998-01-01

    The earliest stages of HDL oxidation are accompanied by the oxidation of specific Met residues in apolipoprotein AI and AII and the formation of Met sulfoxides (Met(O)) has been proposed to play a significant role in the reduction and hence detoxification of lipid hydroperoxides associated with HDL. Oxidation of HDL may generally decrease the anti-atherogenic properties of this lipoprotein, although both, the inhibition and the enhancement of cholesterol removal from cells has been reported for different types of oxidation. In light of these findings we have investigated the secondary structure, lipid affinity, LCAT activation and cholesterol-efflux promoting properties of native and selectively oxidized apo A-I(apo A-I +32 , containing Met(O) at Met l12 and Met l48 ) in purified or reconstituted forms. Data obtained by circular dichroism revealed that selective oxidation of Met residues 112 and 148 does not alter alpha helicity of the protein in solution, indicating that this oxidation is not sufficient to influence significantly this type of secondary structure of apo A-I in its 'lipid-free' form. The lipid affinity of native apo A-I and apo A-I +32 was determined as the rate of clearance of DMPC multilamellar to small unilamellar vesicles. Compared with the native protein, apo A-I +32 induced a 2-3 fold faster rate of clearance, suggesting that the increased hydrophilicity due Met(O) increased the rate for protein-lipid interactions. Met residues 112 and 148 reside in the hydrophobic faces of helices 5 and 7, and both these regions have been suggested to be important for both, LCAT activation and cholesterol efflux. Kinetic experiments have revealed that the affinity for LCAT is comparable for HDL reconstituted with either apo A-I or apo A-I +32 . Efflux of [ 3 H]-cholesterol from lipid-laden human monocytederived macrophages to isolated apolipoproteins was enhanced for apo A-I +32 compared with apo A-I, consistent with the DMPC clearance data. Together these

  14. Detection of possible AI-2-mediated quorum sensing system in commensal intestinal bacteria.

    Science.gov (United States)

    Lukás, F; Gorenc, G; Kopecný, J

    2008-01-01

    The Vibrio harveyi strain BB170-autoinducer bioassay was used to detect possible quorum sensing autoinducer-2 molecule (AI-2) in culture fluids of commensal intestinal bacteria. Culture fluids of Bacteroides vulgatus, Clostridium proteoclasticum, Escherichia coli, Eubacterium rectale, Lachnospira multipara, Pseudobutyrivibrio ruminis, Roseburia intestinalis, Ruminococcus albus and Ruminococcus flavefaciens contained AI-2-like molecules. The PCR bands from some of the tested strains could be also amplified using primers designed for the luxS gene. These findings suggest that AI-2 is present in the gastrointestinal tract; however, it has not yet been proved whether it is used for bacterial cell-to-cell communication.

  15. 78 FR 63494 - Meeting of the National Coordination Committee on the AI/AN SANE-SART Initiative

    Science.gov (United States)

    2013-10-24

    ... National Coordination Committee on the AI/AN SANE--SART Initiative AGENCY: Office for Victims of Crime.../ Alaska Native (AI/AN) Sexual Assault Nurse Examiner (SANE)--Sexual Assault Response Team (SART..., victim-centered responses to sexual violence within AI/AN communities. DATES: The meeting will be held...

  16. Workshop on polarized neutron filters and polarized pulsed neutron experiments

    International Nuclear Information System (INIS)

    Itoh, Shinichi

    2004-07-01

    The workshop was held in KEK by thirty-three participants on April 26, 2004. The polarized neutron filter method was only discussed. It consists of three parts; the first part was discussed on the polarized neutron methods, the second part on the polarized neutron experiments and the third on the pulse neutron spectrometer and polarized neutron experiments. The six papers were presented such as the polarized 3 He neutron spin filter, neutron polarization by proton polarized filter, soft master and neutron scattering, polarized neutron in solid physics, polarization experiments by chopper spectroscope and neutron polarization system in superHRPD. (S.Y.)

  17. Instrumentation with polarized neutrons

    International Nuclear Information System (INIS)

    Boeni, P.; Muenzer, W.; Ostermann, A.

    2009-01-01

    Neutron scattering with polarization analysis is an indispensable tool for the investigation of novel materials exhibiting electronic, magnetic, and orbital degrees of freedom. In addition, polarized neutrons are necessary for neutron spin precession techniques that path the way to obtain extremely high resolution in space and time. Last but not least, polarized neutrons are being used for fundamental studies as well as very recently for neutron imaging. Many years ago, neutron beam lines were simply adapted for polarized beam applications by adding polarizing elements leading usually to unacceptable losses in neutron intensity. Recently, an increasing number of beam lines are designed such that an optimum use of polarized neutrons is facilitated. In addition, marked progress has been obtained in the technology of 3 He polarizers and the reflectivity of large-m supermirrors. Therefore, if properly designed, only factors of approximately 2-3 in neutron intensity are lost. It is shown that S-benders provide neutron beams with an almost wavelength independent polarization. Using twin cavities, polarized beams with a homogeneous phase space and P>0.99 can be produced without significantly sacrificing intensity. It is argued that elliptic guides, which are coated with large m polarizing supermirrors, provide the highest flux.

  18. Near Field Small Earthquake Long Period Spectrum

    Science.gov (United States)

    1976-04-01

    L. Fredrickson, personal communication). The main shock occurred eight seconds after a magnitude 4.5 foreshock , and according to T. V. McEvilly...the strike (but rat the dip) of this plar^e is in good agreenant with that (IT C90 W) obtained from a faultplane solution for a large foreshock 0

  19. Long period pseudo random number sequence generator

    Science.gov (United States)

    Wang, Charles C. (Inventor)

    1989-01-01

    A circuit for generating a sequence of pseudo random numbers, (A sub K). There is an exponentiator in GF(2 sup m) for the normal basis representation of elements in a finite field GF(2 sup m) each represented by m binary digits and having two inputs and an output from which the sequence (A sub K). Of pseudo random numbers is taken. One of the two inputs is connected to receive the outputs (E sub K) of maximal length shift register of n stages. There is a switch having a pair of inputs and an output. The switch outputs is connected to the other of the two inputs of the exponentiator. One of the switch inputs is connected for initially receiving a primitive element (A sub O) in GF(2 sup m). Finally, there is a delay circuit having an input and an output. The delay circuit output is connected to the other of the switch inputs and the delay circuit input is connected to the output of the exponentiator. Whereby after the exponentiator initially receives the primitive element (A sub O) in GF(2 sup m) through the switch, the switch can be switched to cause the exponentiator to receive as its input a delayed output A(K-1) from the exponentiator thereby generating (A sub K) continuously at the output of the exponentiator. The exponentiator in GF(2 sup m) is novel and comprises a cyclic-shift circuit; a Massey-Omura multiplier; and, a control logic circuit all operably connected together to perform the function U(sub i) = 92(sup i) (for n(sub i) = 1 or 1 (for n(subi) = 0).

  20. Interrupting long periods of sitting: good STUFF

    Directory of Open Access Journals (Sweden)

    Rutten Geert M

    2013-01-01

    Full Text Available Abstract There is increasing evidence that sedentary behaviour is in itself a health risk, regardless of the daily amount of moderate to vigorous physical activity. Therefore, sedentary behaviour should be targeted as important health behaviour. It is known that even relatively small changes of health behaviour often require serious efforts from an individual and from people in their environment to become part of their lifestyle. Therefore, interventions to promote healthy behaviours should ideally be simple, easy to perform and easily available. Since sitting is likely to be highly habitual, confrontation with an intervention should almost automatically elicit a reaction of getting up, and thus break up and reduce sitting time. One important prerequisite for successful dissemination of such an intervention could be the use of a recognisable term relating to sedentary behaviour, which should have the characteristics of an effective brand name. To become wide spread, this term may need to meet three criteria: the “Law of the few”, the “Stickiness factor”, and the “Power of context”. For that purpose we introduce STUFF: Stand Up For Fitness. STUFF can be defined as “interrupting long sitting periods by short breaks”, for instance, interrupting sitting every 30 min by standing for at least five minutes. Even though we still need evidence to test the health-enhancing effects of interrupted sitting, we hope that the introduction of STUFF will facilitate the testing of the social, psychological and health effects of interventions to reduce sitting time.