WorldWideScience

Sample records for loevskog mot svampar

  1. La physique mot à mot

    CERN Document Server

    Diu, Bernard

    2005-01-01

    Comment comprendre la physique ? Comment savoir pourquoi il y a des particules et des antiparticules, ou dans quel état se trouve le chat de Schrödinger ? Comment découvrir ce qui se conserve dans la nature ? Comment s'initier aux théories à la pointe de notre connaissance de l'Univers ? Ce livre veut aider à parler la physique, à apprendre son vocabulaire. Chaque mot est défini dans son sens immédiat comme dans ses significations plus complexes. Et les renvois d'un mot à l'autre permettent de saisir la physique en bloc. Après Les atomes existent-ils vraiment ? et Traité de physique à l'usage des profanes, Bernard Diu fait partager, sous une nouvelle forme, sa passion pour la physique. A le lire, il ne fait aucun doute qu'Einstein avait raison : " Subtil est le Créateur. "

  2. CASA-Mot in mammals: an update.

    Science.gov (United States)

    Yániz, J L; Silvestre, M A; Santolaria, P; Soler, C

    2018-03-08

    Sperm motility is one of the most widely used parameters of sperm quality. Computer-aided sperm motility analysis (CASA-Mot) systems were developed to reduce the subjectivity of sperm motility assessment, and have had broad scientific and practical acceptance. In this review, the sources of variation and current applications of this technology and its relationships with other sperm quality tests are described in detail. Despite remarkable advances in the technique, there is still great need for standardisation in many species, and the numerous factors that affect the results make it difficult to provide universally accepted criteria for classifying semen samples based on sperm motility characteristics. The main fields for CASA-Mot include the study of male fertility and pathologies, evaluation of the effects of physical and chemical agents, improvement of epidemiological survey studies, more precise calculation of seminal doses for farm animals, realisation of basic studies about sperm function, improvement of sperm technologies such as cryopreservation and quality control analysis. Numerous relationships have been established between CASA-Mot and other sperm quality tests, although most of these parameters are complementary. Future CASA-Mot systems will probably be able to integrate several sperm quality parameters with motility.

  3. Periodic vehicle inspection (MOT). [previously: Periodic Vehicle Inspection of cars (MOT).

    NARCIS (Netherlands)

    2010-01-01

    In the 1980s the periodic vehicle inspection (MOT) of various categories of vehicles was introduced in the Netherlands. This fact sheet will discuss the legal framework of this measure and the research carried out into its effects on road safety, also in an international context. For instance, the

  4. Periodic vehicle inspection (MOT). [previously: Periodic Vehicle Inspection of cars (MOT).

    OpenAIRE

    2010-01-01

    In the 1980s the periodic vehicle inspection (MOT) of various categories of vehicles was introduced in the Netherlands. This fact sheet will discuss the legal framework of this measure and the research carried out into its effects on road safety, also in an international context. For instance, the technical conditions of cars at inspection as well as that of cars involved in crashes were studied. Tyre pressure will also be discussed in this fact sheet.

  5. Accurate absolute measurement of trapped Cs atoms in a MOT

    International Nuclear Information System (INIS)

    Talavera O, M.; Lopez R, M.; Carlos L, E. de; Jimenez S, S.

    2007-01-01

    A Cs-133 Magneto-Optical Trap (MOT) has been developed at the Time and Frequency Division of the Centro Nacional de Metrologia, CENAM, in Mexico. This MOT is part of a primary frequency standard based on ultra-cold Cs atoms, called CsF-1 clock, under development at CENAM. In this Cs MOT, we use the standard configuration (σ + - σ - ) 4-horizontal 2-vertical laser beams 1.9 cm in diameter, with 5 mW each. We use a 852 nm, 5 mW, DBR laser as a master laser which is stabilized by saturation spectroscopy. Emission linewidth of the master laser is l MHz. In order to amplify the light of the master laser, a 50 mW, 852 nm AlGaAs laser is used as slave laser. This slave laser is stabilized by light injection technique. A 12 MHz red shift of the light is performed by two double passes through two Acusto-Optic Modulators (AOMs). The optical part of the CENAMs MOT is very robust against mechanical vibration, acoustic noise and temperature changes in our laboratory, because none of our diode lasers use an extended cavity to reduce the linewidth. In this paper, we report results of our MOT characterization as a function of several operation parameters such as the intensity of laser beams, the laser beam diameter, the red shift of light, and the gradient of the magnetic field. We also report accurate absolute measurement of the number of Cs atoms trapped in our Cs MOT. We found up to 6 x 10 7 Cs atoms trapped in our MOT measured with an uncertainty no greater than 6.4%. (Author)

  6. An N-terminal Region of Mot-2 Binds to p53 In Vitro

    Directory of Open Access Journals (Sweden)

    Sunil C. Kaul

    2001-01-01

    Full Text Available The mouse mot-2 protein was earlier shown to bind to the tumor suppressor protein, p53. The mot-2 binding site of p53 was mapped to C-terminal amino acid residues 312–352, which includes the cytoplasmic sequestration domain. In the present study, we have found that both mot-1 and mot-2 bind to p53 in vitro. By using His-tagged deletion mutant proteins, the p53-binding domain of mot-2 was mapped to its Nterminal amino acid residues 253–282, which are identical in mot-1 and mot-2 proteins. Some peptides containing the p53-binding region of mot-2 were able to compete with the full-length protein for p53 binding. The data provided rationale for in vitro binding of mot-1 and mot-2 proteins to p53 and supported the conclusion that inability of mot-1 protein to bind p53 in vivo depends on secondary structure or its binding to other cellular factors. Most interestingly, the p53-binding region of mot-2 was common to its MKT-077, a cationic dye that exhibits antitumor activity, binding region. Therefore it is most likely that MKT-077-induced nuclear translocation and restoration of wild-type p53 function in transformed cells takes place by a competitional mechanism.

  7. Mitochondria related peptide MOTS-c suppresses ovariectomy-induced bone loss via AMPK activation

    Energy Technology Data Exchange (ETDEWEB)

    Ming, Wei, E-mail: weiming@xiyi.edu.cn [State Key Laboratory of Cancer Biology, Department of Pharmacogenomics, Fourth Military Medical University, Xi’an 710032 (China); Department of Pharmacology, Xi’an Medical University, Xi’an 710021 (China); Lu, Gan, E-mail: leonming99@163.com [Department of Gynecology of Shaanxi Provincial People’s Hospital, Xi’an, 710068 (China); Xin, Sha, E-mail: 248967979@qq.com [Institute of Orthopedic Surgery, Xijing Hospital, Fourth Military Medical University, Xi’an 710032 (China); Huanyu, Lu, E-mail: 2366927258@qq.com [Department of Occupational and Environmental Health and the Ministry of Education Key Lab of Hazard Assessment and Control in Special Operational Environment, School of Public Health, Fourth Military Medical University, Xi’an 710032 (China); Yinghao, Jiang, E-mail: jiangyh@fmmu.edu.cn [State Key Laboratory of Cancer Biology, Department of Pharmacogenomics, Fourth Military Medical University, Xi’an 710032 (China); Xiaoying, Lei, E-mail: leixiaoy@fmmu.edu.cn [State Key Laboratory of Cancer Biology, Department of Pharmacogenomics, Fourth Military Medical University, Xi’an 710032 (China); Chengming, Xu, E-mail: chengmingxu@yeah.net [State Key Laboratory of Cancer Biology, Department of Pharmacogenomics, Fourth Military Medical University, Xi’an 710032 (China); Banjun, Ruan, E-mail: running@163.com [State Key Laboratory of Cancer Biology, Department of Pharmacogenomics, Fourth Military Medical University, Xi’an 710032 (China); Li, Wang, E-mail: wanglifw@fmmu.edu.cn [State Key Laboratory of Cancer Biology, Department of Pharmacogenomics, Fourth Military Medical University, Xi’an 710032 (China); and others

    2016-08-05

    Therapeutic targeting bone loss has been the focus of the study in osteoporosis. The present study is intended to evaluate whether MOTS-c, a novel mitochondria related 16 aa peptide, can protect mice from ovariectomy-induced osteoporosis. After ovary removal, the mice were injected with MOTS-c at a dose of 5 mg/kg once a day for 12 weeks. Our results showed that MOTS-c treatment significantly alleviated bone loss, as determined by micro-CT examination. Mechanistically, we found that the receptor activator of nuclear factor-κB ligand (RANKL) induced osteoclast differentiation was remarkably inhibited by MOTS-c. Moreover, MOTS-c increased phosphorylated AMPK levels, and compound C, an AMPK inhibitor, could partially abrogate the effects of the MOTS-c on osteoclastogenesis. Thus, our findings provide evidence that MOTS-c may exert as an inhibitor of osteoporosis via AMPK dependent inhibition of osteoclastogenesis. -- Highlights: •MOTS-c decreases OVX-induced bone loss in vivo. •MOTS-c inhibits RANKL-induced osteoclast formation. •MOTS-c inhibits RANKL-induced osteoclast-specific gene expression. •MOTS-c represses osteoclast differentiation via the activation of AMPK.

  8. Mitochondria related peptide MOTS-c suppresses ovariectomy-induced bone loss via AMPK activation

    International Nuclear Information System (INIS)

    Ming, Wei; Lu, Gan; Xin, Sha; Huanyu, Lu; Yinghao, Jiang; Xiaoying, Lei; Chengming, Xu; Banjun, Ruan; Li, Wang

    2016-01-01

    Therapeutic targeting bone loss has been the focus of the study in osteoporosis. The present study is intended to evaluate whether MOTS-c, a novel mitochondria related 16 aa peptide, can protect mice from ovariectomy-induced osteoporosis. After ovary removal, the mice were injected with MOTS-c at a dose of 5 mg/kg once a day for 12 weeks. Our results showed that MOTS-c treatment significantly alleviated bone loss, as determined by micro-CT examination. Mechanistically, we found that the receptor activator of nuclear factor-κB ligand (RANKL) induced osteoclast differentiation was remarkably inhibited by MOTS-c. Moreover, MOTS-c increased phosphorylated AMPK levels, and compound C, an AMPK inhibitor, could partially abrogate the effects of the MOTS-c on osteoclastogenesis. Thus, our findings provide evidence that MOTS-c may exert as an inhibitor of osteoporosis via AMPK dependent inhibition of osteoclastogenesis. -- Highlights: •MOTS-c decreases OVX-induced bone loss in vivo. •MOTS-c inhibits RANKL-induced osteoclast formation. •MOTS-c inhibits RANKL-induced osteoclast-specific gene expression. •MOTS-c represses osteoclast differentiation via the activation of AMPK.

  9. Architecture of the bacteriophage T4 activator MotA/promoter DNA interaction during sigma appropriation.

    Science.gov (United States)

    Hsieh, Meng-Lun; James, Tamara D; Knipling, Leslie; Waddell, M Brett; White, Stephen; Hinton, Deborah M

    2013-09-20

    Gene expression can be regulated through factors that direct RNA polymerase to the correct promoter sequence at the correct time. Bacteriophage T4 controls its development in this way using phage proteins that interact with host RNA polymerase. Using a process called σ appropriation, the T4 co-activator AsiA structurally remodels the σ(70) subunit of host RNA polymerase, while a T4 activator, MotA, engages the C terminus of σ(70) and binds to a DNA promoter element, the MotA box. Structures for the N-terminal (NTD) and C-terminal (CTD) domains of MotA are available, but no structure exists for MotA with or without DNA. We report the first molecular map of the MotA/DNA interaction within the σ-appropriated complex, which we obtained by using the cleaving reagent, iron bromoacetamidobenzyl-EDTA (FeBABE). We conjugated surface-exposed, single cysteines in MotA with FeBABE and performed cleavage reactions in the context of stable transcription complexes. The DNA cleavage sites were analyzed using ICM Molsoft software and three-dimensional physical models of MotA(NTD), MotA(CTD), and the DNA to investigate shape complementarity between the protein and the DNA and to position MotA on the DNA. We found that the unusual "double wing" motif present within MotA(CTD) resides in the major groove of the MotA box. In addition, we have used surface plasmon resonance to show that MotA alone is in a very dynamic equilibrium with the MotA element. Our results demonstrate the utility of fine resolution FeBABE mapping to determine the architecture of protein-DNA complexes that have been recalcitrant to traditional structure analyses.

  10. Rigidity of outermost MOTS: the initial data version

    Science.gov (United States)

    Galloway, Gregory J.

    2018-03-01

    In the paper Commun Anal Geom 16(1):217-229, 2008, a rigidity result was obtained for outermost marginally outer trapped surfaces (MOTSs) that do not admit metrics of positive scalar curvature. This allowed one to treat the "borderline case" in the author's work with R. Schoen concerning the topology of higher dimensional black holes (Commun Math Phys 266(2):571-576, 2006). The proof of this rigidity result involved bending the initial data manifold in the vicinity of the MOTS within the ambient spacetime. In this note we show how to circumvent this step, and thereby obtain a pure initial data version of this rigidity result and its consequence concerning the topology of black holes.

  11. MOT solution of the PMCHWT equation for analyzing transient scattering from conductive dielectrics

    KAUST Repository

    Uysal, Ismail Enes

    2015-01-01

    Transient electromagnetic interactions on conductive dielectric scatterers are analyzed by solving the Poggio-Miller-Chan-Harrington-Wu-Tsai (PMCHWT) surface integral equation with a marching on-in-time (MOT) scheme. The proposed scheme, unlike the previously developed ones, permits the analysis on scatterers with multiple volumes of different conductivity. This is achieved by maintaining an extra temporal convolution that only depends on permittivity and conductivity of these volumes. Its discretization and computation come at almost no additional cost and do not change the computational complexity of the resulting MOT solver. Accuracy and applicability of the MOT-PMCHWT solver are demonstrated by numerical examples.

  12. Beskytter røyking mot Parkinsons sykdom

    Directory of Open Access Journals (Sweden)

    Trond Peder Flaten

    2009-10-01

    Full Text Available  SAMMENDRAGDen negative sammenhengen mellom røyking og Parkinsons sykdom i epidemiologiske studier er robust.Det er prosentvis færre røykere og eks-røykere blant Parkinson-pasienter enn blant kontrollpersoner.Videre har røykere en lavere insidens og en lavere dødelighet enn andre av Parkinsons sykdom. Det er etåpent spørsmål om dette skyldes en beskyttende virkning av nikotin eller andre stoffer i tobakksrøyk somhydrazin eller karbonmonoksid, eller om det skyldes andre, underliggende faktorer. De mest aktuelle slikefaktorer er (1 selektiv dødelighet, altså at mange røykere ikke overlever lenge nok til å utvikleParkinsons sykdom, og (2 at personer som utvikler Parkinsons sykdom ofte har karaktertrekk som gjørdet mindre sannsynlig at de begynner å røyke. Det vitenskapelige grunnlaget er i alle fall for tynt for åanbefale røyking som et forebyggende virkemiddel mot Parkinsons sykdom. Og selv om det skulle viseseg at røyking virkelig beskytter mot sykdommen, veier de negative helsevirkningene av røyking myetyngre i folkehelsesammenheng. Allikevel bør denne assosiasjonen forfølges videre, ikke minst forpotensialet for en bedret forståelse av de underliggende patofysiologiske mekanismene bak sykdommen.Flaten TP. Does smoking protect against Parkinson’s disease? Nor J Epidemiol 1995; 5 (2: 145-150. ENGLISH SUMMARYIt is epidemiologically well established that Parkinson's disease is about twice as common among nonsmokers as among smokers. Whether this is due to a protective effect of nicotine or other compounds in cigarette smoke like hydrazine or carbon monoxide, or whether it is due to some other, confounding factor(s, remains to be established. The most relevant confounding factors are (1 selective mortality, that is, many smokers do not survive long enough to develop Parkinson's disease, and (2 that persons who eventually develop Parkinson's disease tend to have a preclinical personality type that makes them less likely

  13. On spurious resonant modes in the MOT solution of time domain EFIE

    KAUST Repository

    Shi, Yifei; Bagci, Hakan; Lu, Mingyu

    2013-01-01

    Theoretically, internal resonant modes should not be induced in the marching-on-in-time (MOT) solution of the time domain electric field integral equation since zero initial conditions are enforced at the beginning of time marching and the internal

  14. Upgradation of MOT and its Relevance to WET Campaigns Alisher S ...

    Indian Academy of Sciences (India)

    instrumentation of the telescope and how the system can be used in future campaigns. .... After the upgrade, the MOT should have computer control of pointing, tracking and focus, with ... For this purpose we plan to use portable GPS station.

  15. Transient analysis of plasmonic nanostructures using an MOT-PMCHWT solver

    KAUST Repository

    Uysal, Ismail Enes; Ulku, Huseyin Arda; Bagci, Hakan

    2015-01-01

    A marching on in time (MOT) scheme for solving the Poggio-Miller-Chan-Harrington-Wu-Tsai (PMCHWT) surface integral equation on plasmonic nanostructures is described. The proposed scheme calls for temporal convolutions of the permittivity and Green

  16. An Explicit MOT-TD-VIE Solver for Time Varying Media

    KAUST Repository

    Sayed, Sadeed Bin; Ulku, Huseyin Arda; Bagci, Hakan

    2016-01-01

    An explicit marching on-in-time (MOT) scheme for solving the time domain electric field integral equation enforced on volumes with time varying dielectric permittivity is proposed. Unknowns of the integral equation and the constitutive relation, i

  17. Quasi-exact evaluation of time domain MFIE MOT matrix elements

    KAUST Repository

    Shi, Yifei

    2013-07-01

    A previously proposed quasi-exact scheme for evaluating matrix elements resulting from the marching-on-in-time (MOT) discretization of the time domain electric field integral equation (EFIE) is extended to matrix entries resulting from the discretization of its magnetic field integral equation (MFIE) counterpart. Numerical results demonstrate the accuracy of the scheme as well as the late-time stability of the resulting MOT-MFIE solver. © 2013 IEEE.

  18. Quasi-exact evaluation of time domain MFIE MOT matrix elements

    KAUST Repository

    Shi, Yifei; Bagci, Hakan; Shanker, Balasubramaniam; Lu, Mingyu; Michielssen, Eric

    2013-01-01

    A previously proposed quasi-exact scheme for evaluating matrix elements resulting from the marching-on-in-time (MOT) discretization of the time domain electric field integral equation (EFIE) is extended to matrix entries resulting from the discretization of its magnetic field integral equation (MFIE) counterpart. Numerical results demonstrate the accuracy of the scheme as well as the late-time stability of the resulting MOT-MFIE solver. © 2013 IEEE.

  19. GOOFRE version 2: voir et traiter 600 milliards de mots

    Directory of Open Access Journals (Sweden)

    Etienne Brunet

    2014-12-01

    Full Text Available http://dx.doi.org/10.5007/1807-9288.2014v10n2p75 Les données de Google Books ont doublé en deux ans, en franchissant le cap des 500 milliards de mots. Un  nouveau traitement a repris les images scannées pour en proposer une lecture  plus fidèle. Et pour la première fois les textes enregistrés ont bénéficié de la désambiguïsation  et de la lemmatisation. Enfin le site Culturomics a fourni les outils nécessaires pour en assurer la diffusion. Il convenait donc de procéder à une nouvelle expertise et de créer une nouvelle base, pourvue de tout  l’appareillage statistique qu’exige, en réseau ou en local, l’exploitation des grands corpus.

  20. ProMot: a decision support tool for electric motor users; ProMot: ein Werkzeug zur Entscheidungsfindung fuer Motorenbetreiber

    Energy Technology Data Exchange (ETDEWEB)

    Tanner, T

    2006-07-01

    Being supported by an international collaboration the project ProMot has developed and disseminated in the European Union a decision support tool for electric motor users helping them to choose energy efficient motor systems. During the first phase all necessary components to build the decision support tool have been selected, developed or improved and adapted. At the beginning it was assumed that the contribution of the author's company, Semafor would be the integration of the company's OPAL software components developed for pumps and variable speed drives (VSD) into the EuroDEEM package. In view of the deficiencies of EuroDEEM it was soon agreed to abandon this approach. Instead, the package IMSSA (International Motor Selection and Saving Analysis), developed at the Washington State University on the basis of MotorMaster was selected. IMSSA - which has been renamed to EuroDEEM International - and the pump and VSD module can now be used as standalone applications. The second phase integrated all collected and developed material into a comprehensive and user-friendly web site that was then demonstrated to key actors in the participating countries. Several requirements had to be considered. The platform had to allow the publication of the web pages in several languages and to enable the team members to place and modify their content without disturbing ongoing operation. It was therefore decided to evaluate a suitable Web Content Management System (CMS) which lead to Plone, a powerful and adaptable open-source system already in use at many web sites. The pages have then been created and published with this system. With some support from Semafor, German and French translations were created. Also a hardcopy brochure that gives an overview of the web site has been produced and distributed in the participating countries. (author)

  1. ProMot: a decision support tool for electric motor users; ProMot: ein Werkzeug zur Entscheidungsfindung fuer Motorenbetreiber

    Energy Technology Data Exchange (ETDEWEB)

    Tanner, T.

    2006-07-01

    Being supported by an international collaboration the project ProMot has developed and disseminated in the European Union a decision support tool for electric motor users helping them to choose energy efficient motor systems. During the first phase all necessary components to build the decision support tool have been selected, developed or improved and adapted. At the beginning it was assumed that the contribution of the author's company, Semafor would be the integration of the company's OPAL software components developed for pumps and variable speed drives (VSD) into the EuroDEEM package. In view of the deficiencies of EuroDEEM it was soon agreed to abandon this approach. Instead, the package IMSSA (International Motor Selection and Saving Analysis), developed at the Washington State University on the basis of MotorMaster was selected. IMSSA - which has been renamed to EuroDEEM International - and the pump and VSD module can now be used as standalone applications. The second phase integrated all collected and developed material into a comprehensive and user-friendly web site that was then demonstrated to key actors in the participating countries. Several requirements had to be considered. The platform had to allow the publication of the web pages in several languages and to enable the team members to place and modify their content without disturbing ongoing operation. It was therefore decided to evaluate a suitable Web Content Management System (CMS) which lead to Plone, a powerful and adaptable open-source system already in use at many web sites. The pages have then been created and published with this system. With some support from Semafor, German and French translations were created. Also a hardcopy brochure that gives an overview of the web site has been produced and distributed in the participating countries. (author)

  2. Further validation of the Motivation for Traumatic Brain Injury Rehabilitation Questionnaire (MOT-Q) in patients with acquired brain injury.

    Science.gov (United States)

    Boosman, Hileen; van Heugten, Caroline M; Winkens, Ieke; Smeets, Sanne M J; Visser-Meily, Johanna M A

    2016-01-01

    The Motivation for Traumatic Brain Injury Rehabilitation Questionnaire (MOT-Q) evaluates motivation for rehabilitation in four subscales: Interest in rehabilitation, Lack of anger, Lack of denial, and Reliance on professional help. The objective of this study was to further validate the MOT-Q in 122 inpatients and 92 outpatients with acquired brain injury (ABI). The main measures were motivation for rehabilitation (MOT-Q), self-awareness (Patient Competency Rating Scale), and treatment motivation (Visual Analogue Scale). The MOT-Q showed adequate feasibility in terms of few items with missing responses and few undecided responses. We found no floor or ceiling effects, and significant item-total MOT-Q correlations for 29 of 31 items. Internal consistency was good for the MOT-Q total and acceptable to good for the subscales. The MOT-Q scores were significantly intercorrelated except for the subscales Lack of denial and Reliance on professional help in the inpatient group. The MOT-Q total and subscales were significantly associated with treatment motivation. The Lack of denial subscale showed no significant association with treatment motivation and no to moderate significant associations with self-awareness. In conclusion, the overall MOT-Q is a valid instrument to assess motivation for rehabilitation in patients with ABI. Further research is needed to examine the validity of the subscales.

  3. On the DC loop modes in the MOT solution of the time domain EFIE

    KAUST Repository

    Shi, Yifei

    2014-07-01

    When marching-on-in-time (MOT) method is applied to solve the time domain electric field integral equation (TD-EFIE), DC loop modes are always observed in the solution. In theory these modes should not be observed since they do not satisfy the relaxed initial conditions. Their appearance is attributed to numerical errors. It is shown here that when Rao-Wilton-Glisson basis and Lagrange interpolation functions are used to discretize the TD-EFIE, errors due to this space-time discretization have zero impact on the DC loop modes. Numerical experiments demonstrate that the numerical errors due to approximate solution of the MOT matrix system have more dominant impact on DC loop modes in the MOT solution.

  4. On the DC loop modes in the MOT solution of the time domain EFIE

    KAUST Repository

    Shi, Yifei; Bagci, Hakan; Lu, Mingyu

    2014-01-01

    When marching-on-in-time (MOT) method is applied to solve the time domain electric field integral equation (TD-EFIE), DC loop modes are always observed in the solution. In theory these modes should not be observed since they do not satisfy the relaxed initial conditions. Their appearance is attributed to numerical errors. It is shown here that when Rao-Wilton-Glisson basis and Lagrange interpolation functions are used to discretize the TD-EFIE, errors due to this space-time discretization have zero impact on the DC loop modes. Numerical experiments demonstrate that the numerical errors due to approximate solution of the MOT matrix system have more dominant impact on DC loop modes in the MOT solution.

  5. An Explicit MOT-TD-VIE Solver for Time Varying Media

    KAUST Repository

    Sayed, Sadeed Bin

    2016-03-15

    An explicit marching on-in-time (MOT) scheme for solving the time domain electric field integral equation enforced on volumes with time varying dielectric permittivity is proposed. Unknowns of the integral equation and the constitutive relation, i.e., flux density and field intensity, are discretized using full and half Schaubert-Wilton-Glisson functions in space. Temporal interpolation is carried out using band limited approximate prolate spherical wave functions. The discretized coupled system of integral equation and constitutive relation is integrated in time using a PE(CE)m type linear multistep scheme. Unlike the existing MOT methods, the resulting explicit MOT scheme allows for straightforward incorporation of the time variation in the dielectric permittivity.

  6. Transient analysis of plasmonic nanostructures using an MOT-PMCHWT solver

    KAUST Repository

    Uysal, Ismail Enes

    2015-10-26

    A marching on in time (MOT) scheme for solving the Poggio-Miller-Chan-Harrington-Wu-Tsai (PMCHWT) surface integral equation on plasmonic nanostructures is described. The proposed scheme calls for temporal convolutions of the permittivity and Green function of the plasmonic medium with the temporal basis function. Time domain samples of the permittivity and the Green function required by these convolutions are computed using a fast relaxed vector fitting (FRVF) algorithm. Numerical results demonstrate the accuracy and applicability of the proposed MOT-PMCHWT solver.

  7. Hatefulle ytringer. Delrapport 3: Grenseoppgangen mellom ytringsfrihet og strafferettslig vern mot hatefulle ytringer

    OpenAIRE

    Wessel-Aas, Jon; Fladmoe, Audun; Nadim, Marjan

    2016-01-01

    De siste årene har hatefulle ytringer på internett fått økt oppmerksomhet i den offentlige debatten. Denne rapporten inneholder en juridisk utredning som har som formål å redegjøre for det strafferettslige vernet mot hatefulle ytringer, basert på gjeldende rett. Gjennomgangen synliggjør dessuten hvilke grupper som er gitt slikt vern. Et forbud mot hatefulle ytringer er et inngrep i ytringsfriheten. Spørsmålet om hvor grensen mellom ytringsfriheten og hva man skal slippe å tåle av hatefulle yt...

  8. An MOT-TDIE solver for analyzing transient fields on graphene-based devices

    KAUST Repository

    Shi, Yifei

    2016-11-02

    A marching on-in-time (MOT) scheme for analyzing transient electromagnetic wave interactions on devices consisting of graphene sheets and dielectric substrates is proposed. The MOT scheme discretizes time domain resistive boundary condition (TD-RBC) and Poggio-Miller-Chang-Harrington-Wu-Tsai (TD-PMCHWT) integral equation, which are enforced on the surfaces of the graphene and dielectric substrate, respectively. The expressions of the time domain resistivity and conductivity of the graphene sheet are obtained analytically from the intra-band contribution formulated in frequency domain. Numerical results, which demonstrate the applicability of the proposed scheme, are presented.

  9. Does 8-methacryloxyoctyl trimethoxy silane (8-MOTS) improve initial bond strength on lithium disilicate glass ceramic?

    Science.gov (United States)

    Maruo, Yukinori; Nishigawa, Goro; Yoshihara, Kumiko; Minagi, Shogo; Matsumoto, Takuya; Irie, Masao

    2017-03-01

    Dental ceramic surfaces are modified with silane coupling agents, such as γ-methacryloxypropyl trimethoxy silane (γ-MPTS), to improve bond strength. For bonding between lithium disilicate glass ceramic and resin cement, the objective was to investigate if 8-methacryloxyoctyl trimethoxy silane (8-MOTS) could yield a similar performance as the widely used γ-MPTS. One hundred and ten lithium disilicate glass ceramic specimens were randomly divided into 11 groups (n=10) according to pretreatment regime. All specimens were pretreated with a different solution composed of one or a combination of these agents: 10 or 20wt% silane coupling agent of γ-MPTS or 8-MOTS, followed by a hydrolysis solution of acetic acid or 10-methacryloyloxydecyl dihydrogen phosphate (10-MDP). Each pretreated surface was luted to a stainless steel rod of 3.6mm diameter and 2.0mm height with resin cement. Shear bond strength between ceramic and cement was measured after 24-h storage in 37°C distilled water. 8-MOTS produced the same bonding performance as γ-MPTS. Both silane coupling agents significantly increased the bond strength of resin cement, depending on their concentration. When activated by 10-MDP hydrolysis solution, 20wt% concentration produced the highest values (γ-MPTS: 24.9±5.1MPa; 8-MOTS: 24.6±7.4MPa). Hydrolysis with acetic acid produced lower bond strengths than with 10-MDP. Silane coupling pretreatment with 8-MOTS increased the initial bond strength between lithium disilicate glass ceramic and resin cement, rendering the same bonding effect as the conventional γ-MPTS. Copyright © 2016 The Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.

  10. SA-Mot: a web server for the identification of motifs of interest extracted from protein loops.

    Science.gov (United States)

    Regad, Leslie; Saladin, Adrien; Maupetit, Julien; Geneix, Colette; Camproux, Anne-Claude

    2011-07-01

    The detection of functional motifs is an important step for the determination of protein functions. We present here a new web server SA-Mot (Structural Alphabet Motif) for the extraction and location of structural motifs of interest from protein loops. Contrary to other methods, SA-Mot does not focus only on functional motifs, but it extracts recurrent and conserved structural motifs involved in structural redundancy of loops. SA-Mot uses the structural word notion to extract all structural motifs from uni-dimensional sequences corresponding to loop structures. Then, SA-Mot provides a description of these structural motifs using statistics computed in the loop data set and in SCOP superfamily, sequence and structural parameters. SA-Mot results correspond to an interactive table listing all structural motifs extracted from a target structure and their associated descriptors. Using this information, the users can easily locate loop regions that are important for the protein folding and function. The SA-Mot web server is available at http://sa-mot.mti.univ-paris-diderot.fr.

  11. Circulating MOTS-c levels are decreased in obese male children and adolescents and associated with insulin resistance.

    Science.gov (United States)

    Du, Caiqi; Zhang, Cai; Wu, Wei; Liang, Yan; Wang, Anru; Wu, Shimin; Zhao, Yue; Hou, Ling; Ning, Qin; Luo, Xiaoping

    2018-04-25

    A novel bioactive peptide, mitochondrial-derived peptide (MOTS-c), has recently attracted attention as a potential prevention or therapeutic option for obesity and type 2 diabetes mellitus (T2DM). MOTS-c profiles have not yet been reported in human obesity and T2DM. We aimed to determine circulating MOTS-c levels in obesity and explore the association between MOTS-c levels and various metabolic parameters. In this case-control study, 40 obese children and adolescents (27 males) and 57 controls (40 males) were recruited in the Hubei Province of China in 2017. Circulating MOTS-c levels were measured, clinical data (e.g., glucose, insulin and lipid profile) were recorded, and anthropometric measurements were performed. Finally, we investigated correlations between MOTS-c levels and related variables. MOTS-c levels were significantly decreased in the obese group compared with the control group (472.61 ± 22.83 ng/mL vs. 561.64 ± 19.19 ng/mL, p c levels were significantly decreased in obese male children and adolescents compared to their counterparts (465.26 ± 24.53 ng/mL vs. 584.07 ± 21.18 ng/mL, p 0.05). Further, MOTS-c levels were negatively correlated with body mass index (BMI), BMI standard deviation score, waist circumference, waist-to-hip ratio, fasting insulin level, HOMA-IR, and HbA1c in the male cohort. Circulating MOTS-c levels were decreased in obese male children and adolescents and correlated with markers of insulin resistance and obesity. This article is protected by copyright. All rights reserved.

  12. An explicit MOT-TDVIE scheme for analyzing electromagnetic field interactions on nonlinear scatterers

    KAUST Repository

    Ulku, Huseyin Arda

    2015-02-01

    An explicit marching on-in-time (MOT) based time domain electric field volume integral equation (TDVIE) solver for characterizing electromagnetic wave interactions on scatterers with nonlinear material properties is proposed. Discretization of the unknown electric field intensity and flux density is carried out by half and full Schaubert-Wilton-Glisson basis functions, respectively. Coupled system of spatially discretized TDVIE and the nonlinear constitutive relation between the field intensity and the flux density is integrated in time to compute the samples of the unknowns. An explicit PE(CE)m scheme is used for this purpose. Explicitness allows for \\'easy\\' incorporation of the nonlinearity as a function only to be evaluated on the right hand side of the coupled system of equations. A numerical example that demonstrates the applicability of the proposed MOT scheme to analyzing electromagnetic interactions on Kerr-nonlinear scatterers is presented. © 2015 IEEE.

  13. On spurious resonant modes in the MOT solution of time domain EFIE

    KAUST Repository

    Shi, Yifei

    2013-07-01

    Theoretically, internal resonant modes should not be induced in the marching-on-in-time (MOT) solution of the time domain electric field integral equation since zero initial conditions are enforced at the beginning of time marching and the internal resonant modes do not satisfy these initial conditions. However, these spurious modes are always observed in the MOT solution. It has been conjectured in the past that numerical errors might establish the necessary initial conditions and allow the incident field to induce the internal resonant modes. Systematic numerical experiments carried out in this work prove this conjecture by demonstrating that the internal resonant modes\\' amplitudes are indeed dictated by the numerical errors and the spectrum of the incident field. © 2013 IEEE.

  14. An explicit MOT scheme for solving the TD-EFVIE on nonlinear and dispersive scatterers

    KAUST Repository

    Sayed, Sadeed Bin; Ulku, H. Arda; Bagci, Hakan

    2017-01-01

    An explicit marching-on-in-time (MOT) scheme for solving the time domain electric field volume integral equation (TD-EFVIE) on nonlinear and dispersive scatterers is described. The unknown electric field intensity, electric flux density, and polarization densities representing Kerr nonlinearity along with Lorentz dispersion relation, all of which are induced inside the scatterer upon excitation, are expanded using half and full Schaubert-Wilton-Glisson functions in space. The TD-EFVIE and the constitutive relations between polarization, field, and flux terms are cast in the form of a first-order ordinary differential equation. The resulting matrix system is integrated in time using a predictor-corrector scheme to obtain the time dependent unknown expansion coefficients. The resulting MOT scheme is explicit and accounts for nonlinearity by simple function evaluations.

  15. BioMot exoskeleton - Towards a smart wearable robot for symbiotic human-robot interaction.

    Science.gov (United States)

    Bacek, Tomislav; Moltedo, Marta; Langlois, Kevin; Prieto, Guillermo Asin; Sanchez-Villamanan, Maria Carmen; Gonzalez-Vargas, Jose; Vanderborght, Bram; Lefeber, Dirk; Moreno, Juan C

    2017-07-01

    This paper presents design of a novel modular lower-limb gait exoskeleton built within the FP7 BioMot project. Exoskeleton employs a variable stiffness actuator in all 6 joints, a directional-flexibility structure and a novel physical humanrobot interfacing, which allows it to deliver the required output while minimally constraining user's gait by providing passive degrees of freedom. Due to modularity, the exoskeleton can be used as a full lower-limb orthosis, a single-joint orthosis in any of the three joints, and a two-joint orthosis in a combination of any of the two joints. By employing a simple torque control strategy, the exoskeleton can be used to deliver user-specific assistance, both in gait rehabilitation and in assisting people suffering musculoskeletal impairments. The result of the presented BioMot efforts is a low-footprint exoskeleton with powerful compliant actuators, simple, yet effective torque controller and easily adjustable flexible structure.

  16. An explicit MOT scheme for solving the TD-EFVIE on nonlinear and dispersive scatterers

    KAUST Repository

    Sayed, Sadeed Bin

    2017-10-25

    An explicit marching-on-in-time (MOT) scheme for solving the time domain electric field volume integral equation (TD-EFVIE) on nonlinear and dispersive scatterers is described. The unknown electric field intensity, electric flux density, and polarization densities representing Kerr nonlinearity along with Lorentz dispersion relation, all of which are induced inside the scatterer upon excitation, are expanded using half and full Schaubert-Wilton-Glisson functions in space. The TD-EFVIE and the constitutive relations between polarization, field, and flux terms are cast in the form of a first-order ordinary differential equation. The resulting matrix system is integrated in time using a predictor-corrector scheme to obtain the time dependent unknown expansion coefficients. The resulting MOT scheme is explicit and accounts for nonlinearity by simple function evaluations.

  17. Les mots d'identité et d'égalité dans les langues romanes

    NARCIS (Netherlands)

    Sneyders de Vogel, Kornelis

    1947-01-01

    La présente étude est en premier lieu une étude de mots que nous nous proposons de suivre dans leur formation, leurs modifications morphologiques et dans leur développement sémantique. Les problèmes de syntaxe ne nous occuperont guère. Pourtant on traitera des phrases indépendantes qui, exprimant

  18. A unitary ESPRIT scheme of joint angle estimation for MOTS MIMO radar.

    Science.gov (United States)

    Wen, Chao; Shi, Guangming

    2014-08-07

    The transmit array of multi-overlapped-transmit-subarray configured bistatic multiple-input multiple-output (MOTS MIMO) radar is partitioned into a number of overlapped subarrays, which is different from the traditional bistatic MIMO radar. In this paper, a new unitary ESPRIT scheme for joint estimation of the direction of departure (DOD) and the direction of arrival (DOA) for MOTS MIMO radar is proposed. In our method, each overlapped-transmit-subarray (OTS) with the identical effective aperture is regarded as a transmit element and the characteristics that the phase delays between the two OTSs is utilized. First, the measurements corresponding to all the OTSs are partitioned into two groups which have a rotational invariance relationship with each other. Then, the properties of centro-Hermitian matrices and real-valued rotational invariance factors are exploited to double the measurement samples and reduce computational complexity. Finally, the close-formed solution of automatically paired DOAs and DODs of targets is derived in a new manner. The proposed scheme provides increased estimation accuracy with the combination of inherent advantages of MOTS MIMO radar with unitary ESPRIT. Simulation results are presented to demonstrate the effectiveness and advantage of the proposed scheme.

  19. Sperm motility in fish: technical applications and perspectives through CASA-Mot systems.

    Science.gov (United States)

    Gallego, V; Asturiano, J F

    2018-03-09

    Although a relatively high number of sperm quality biomarkers have been reported over the years in several fish species, sperm motility is nowadays considered the best biomarker for fish spermatozoa. The first scientific reports focusing on fish sperm motility date from a century ago, but the objective assessment allowed by computer-aided sperm analysis (CASA-Mot) systems was not applied to fish species until the mid-1980s. Since then, a high number of sperm kinetic parameters from more than 170 fish species have been reported in more than 700 scientific articles, covering a wide range of topics, such as sperm physiology, sperm storage, broodstock management, the phenomenon of sperm competition, ecotoxicology and understanding the life cycle of the species. The sperm kinetic parameters provided by CASA-Mot systems can serve as powerful and useful tools for aquaculture and ecological purposes, and this review provides an overview of the major research areas in which fish sperm motility assessment by a CASA-Mot system has been used successfully.

  20. Mortality and reproduction of Sitophilus zeamais Mots. on irradiated macaroni and maize

    International Nuclear Information System (INIS)

    Wiendl, F.M.

    1975-11-01

    Maize weevils, Sitophilus zeamais Mots. were reared on irradiated macaroni and maize. Diets were treated with dosages of O (control), 20, 100, 500 and 1500 Krad of gamma radiation from a Cobalt 60 gamma source, with a supplementary doses of 5000 Krad on maize. The parent generation was checked for mortality and fecundity. The analysis of results indicated decrease of longevity on diets used. Also it could be observed that on maize, the doses of 100 Krad caused an increase of progeny, with no effects on other dosages

  1. Uudised : Tüür Frankfurdi "Auftaktil". Motörhead ja Manson Soomes

    Index Scriptorium Estoniae

    2007-01-01

    Frankfurdi Vana Ooperi uut hooaega traditsiooniliselt sissejuhatava festivali "Auftakt" tänavusteks külalisteks on Erkki-Sven Tüür ja inglise tšellist Steven Isserlis, 28. aug.-1. okt. kestval festivalil mängitakse Tüüri 6. ja 7. (4. sümfooniat dirigeerib Paavo Järvi), 12. sept. kavas "Fata Morgana" ja "Oxymoron" ning Helena Tulve "Lumineux..." Olari Eltsi juhatusel. Inglise ansambli Motörhead kontserdist 11. dets. ja USA rokkari Marilyn Mansoni kontserdist 20. dets. Helsingis

  2. Kunnskapsgrunnlag for handlingsplan mot vasspest (Elodea canadensis) og smal vasspest (Elodea nuttallii) i Norge

    OpenAIRE

    Mjelde, M.; Berge, D.; Edvardsen, H.

    2012-01-01

    Den foreliggende rapporten utgjør kunnskapsgrunnlaget for Handlingsplan mot vasspest (Elodea canadensis) og smal vasspest (Elodea nuttallii). Rapporten gir en oppdatert oversikt over de to artenes biologi og økologi, utbredelse og sprednings­veier, samt kjente effekter på vannøkosystemet. Kunnskapsbehov diskuteres, bl.a. knyttet til artenes økologiske krav og effekter på biologisk mangfold. Rapporten omtaler tiltak for å hindre videre spredning og tiltak for å redusere eller bekjempe bestande...

  3. SlyA regulates motA and motB, virulence and stress-related genes under conditions induced by the PhoP-PhoQ system in Dickeya dadantii 3937.

    Science.gov (United States)

    Haque, Md Manjurul; Hirata, Hisae; Tsuyumu, Shinji

    2015-01-01

    We previously showed that SlyA of Dickeya dadantii 3937 plays an important role in virulence toward plants, and that the ΔslyA mutant is hypermotile, whereas flagellum synthesis and flagellin production are indistinguishable from the wild type. Here we show that motility factors, including the distance of continuous directed movement, time for that movement and speed, were significantly higher in the ΔslyA mutant than in the wild type. Remarkably, transcription levels of motA and motB, that are involved in flagellar rotation, were elevated in the ΔslyA mutant, suggesting that the mutant's hypermotility was due to an increase in flagellar rotation. In low (10 μM) magnesium medium that activates the PhoP-PhoQ system, growth and virulence of the ΔslyA mutant were much lower than for the wild type; expression of motA, motB, mgtA, pelA, pelB, pelC, pelD, pelE, pelI, indA, tolC, sodC, acsA and hrpN were also reduced in the mutant. Interestingly, motA, motB, pelD, pelE, pelI, sodC and indA were also reduced in phoP and phoQ mutants. Because the SlyA protein directly binds to the promoter region of PhoP, SlyA regulates virulence by controlling multiple pathogenicity-related genes directly and/or at least by controlling PhoP in D. dadantii 3937 when magnesium is low. Copyright © 2015 Institut Pasteur. Published by Elsevier Masson SAS. All rights reserved.

  4. Simulation of a 3D MOT-Optical Molasses Hybrid for Potassium-41 Atoms

    Science.gov (United States)

    Peterson, W. A.; Wrubel, Jonathan

    2017-04-01

    We report a design and numerical model for a 3D magneto-optical trap (MOT)-optical molasses hybrid for potassium-41 atoms. In this arrangement, the usual quadrupole magnetic field is replaced by an octupole field. The octupole field has a central region of very low magnetic field where our simulations show that the atoms experience an optical molasses, resulting in sub-doppler cooling not possible in a quadrupole MOT. The simulations also show that the presence of the magneto-optical trapping force at the edge of the cooling beams provides a restoring force which cycles atoms through the molasses region. We plan to use this hybrid trap to directly load a far off-resonance optical dipole trap. Because the atoms are recycled for multiple passes through the molasses, we expect a higher phase-space density of atoms loaded into the dipole trap. Similar hybrid cooling schemes should be relevant for lithium-6 and lithium-7, which also have poorly resolved D2 hyperfine structure. Research Corporation for Science Advancement, Cottrell College Science Award.

  5. Estimating Household Willingness to Pay for Improved Solid Waste Management: A Case Study of Thu Dau Mot City, Binh Duong

    Directory of Open Access Journals (Sweden)

    Trang Pham Thi Thuy

    2017-01-01

    Full Text Available The main objective of this paper is to investigate the household willingness to pay (WTP for improved solid waste management in Thu Dau Mot city, Binh Duong by using Dichotomons choice Contingent Valuation Method. A questionnaire was designed to draw a sample of 330 respondents for the study. The results show that mean household willingness to pay for solid waste management system in Thu Dau Mot is about 24 thousand VND/ month/ household, higher than the current fee (20 thousand VND month/ household.The paper used a logistic regression to establish the factor affecting to the household willingness to pay for solid waste management system. The logit results show that those with a higher income and more educated is willing to pay more for improvement in management of their solid waste. Also, more environmental aware the person the more they are willing to pay. Moreover, females are less likely to give a positive response to WTP compare to male.

  6. ASSESSMENT OF MOVEMENT SKILL PERFORMANCE IN PRESCHOOL CHILDREN: CONVERGENT VALIDITY BETWEEN MOT 4-6 AND M-ABC

    Directory of Open Access Journals (Sweden)

    Wouter Cools

    2010-12-01

    Full Text Available The purpose was to determine the level of agreement between the Motoriktest für Vier- bis Sechsjährige Kinder [MOT 4-6] and the Movement Assessment Battery for Children [M-ABC]. 48 preschool children participated in the study (Mean age = 5 years, 6 months, SD = 3 months. There was high classification agreement (90% between both tests. A Kappa correlation coefficient (0.67 provided moderately strong support for convergent validity. Less agreement was shown in identification of motor difficulties (58%. This was reflected by lower correlation coefficients on the fine movement cluster and test item level. The MOT 4-6 showed values within the range of similar movement skill performance assessment protocols. Because of its specific focus it may be of meaningful value to assess movement skill competence in typically developing preschool children (ages 4 to 6.

  7. Crystallographic and molecular dynamics analysis of loop motions unmasking the peptidoglycan-binding site in stator protein MotB of flagellar motor.

    Directory of Open Access Journals (Sweden)

    Cyril F Reboul

    Full Text Available BACKGROUND: The C-terminal domain of MotB (MotB-C shows high sequence similarity to outer membrane protein A and related peptidoglycan (PG-binding proteins. It is believed to anchor the power-generating MotA/MotB stator unit of the bacterial flagellar motor to the peptidoglycan layer of the cell wall. We previously reported the first crystal structure of this domain and made a puzzling observation that all conserved residues that are thought to be essential for PG recognition are buried and inaccessible in the crystal structure. In this study, we tested a hypothesis that peptidoglycan binding is preceded by, or accompanied by, some structural reorganization that exposes the key conserved residues. METHODOLOGY/PRINCIPAL FINDINGS: We determined the structure of a new crystalline form (Form B of Helicobacter pylori MotB-C. Comparisons with the existing Form A revealed conformational variations in the petal-like loops around the carbohydrate binding site near one end of the β-sheet. These variations are thought to reflect natural flexibility at this site required for insertion into the peptidoglycan mesh. In order to understand the nature of this flexibility we have performed molecular dynamics simulations of the MotB-C dimer. The results are consistent with the crystallographic data and provide evidence that the three loops move in a concerted fashion, exposing conserved MotB residues that have previously been implicated in binding of the peptide moiety of peptidoglycan. CONCLUSION/SIGNIFICANCE: Our structural analysis provides a new insight into the mechanism by which MotB inserts into the peptidoglycan mesh, thus anchoring the power-generating complex to the cell wall.

  8. EFEITO RESIDUAL DE INSETICIDAS NATURAIS NO CONTROLE DE SITOPHILUS ZEAMAIS MOTS. EM MILHO ARMAZENADO

    Directory of Open Access Journals (Sweden)

    Rodrigo Leandro Braga de Castro Coitinho

    2006-01-01

    Full Text Available The residual effect of natural insecticides was evaluated on adults of Sitophilus zeamais Mots. (Coleoptera: Curculionidae on stored corn grains. Clove (Syzygium aromaticum L., white pepper (Piper nigrum L., neem (Azadirachta indica A. Juss and silica dioxide powders were tested as well as neem, eucalyptus (Eucaliptus globulus Labill and Eucaliptus citriodora Hook., eugenol, andiroba (Carapa guianensis Aubl., rosemary (Lippia gracillis HBK., cedar (Cedrela fissilis Vell. and pequi (Caryocar brasiliense Camb. oils. Powders were tested at concentration of 1kg/t in 50g-corn-plot and the oils at dosage of 50¿L in 20g-corn-plot. The plots infestation was accomplished using 20 and 8 adults (males and females of S. zeamais being 0 to 15 days old, respectively, in the experiments with powders and oils. Silica dioxide caused 46.7, 38.3 and 37.5% of mortality, respectively, in the initial (soon after the treatment with the powders or oils and at 60 and 120 days of storage periods, but the mortality induced by the other powders was inexpressive. In the three studied storage periods, silica dioxide was the more efficient in reducing adults emergency. At the initial storage period, all the oils caused mortality above 79%, however, after 60 and 120 days, mortality was lower than 2.5%. The adult emergency increased as stored period increased, although at 120 days the best performance was obtained using neem, followed by andiroba, cedar, rosemary and E. globulus oils.

  9. CASA-Mot technology: how results are affected by the frame rate and counting chamber.

    Science.gov (United States)

    Bompart, Daznia; García-Molina, Almudena; Valverde, Anthony; Caldeira, Carina; Yániz, Jesús; Núñez de Murga, Manuel; Soler, Carles

    2018-04-04

    For over 30 years, CASA-Mot technology has been used for kinematic analysis of sperm motility in different mammalian species, but insufficient attention has been paid to the technical limitations of commercial computer-aided sperm analysis (CASA) systems. Counting chamber type and frame rate are two of the most important aspects to be taken into account. Counting chambers can be disposable or reusable, with different depths. In human semen analysis, reusable chambers with a depth of 10µm are the most frequently used, whereas for most farm animal species it is more common to use disposable chambers with a depth of 20µm . The frame rate was previously limited by the hardware, although changes in the number of images collected could lead to significant variations in some kinematic parameters, mainly in curvilinear velocity (VCL). A frame rate of 60 frames s-1 is widely considered to be the minimum necessary for satisfactory results. However, the frame rate is species specific and must be defined in each experimental condition. In conclusion, we show that the optimal combination of frame rate and counting chamber type and depth should be defined for each species and experimental condition in order to obtain reliable results.

  10. ATIVIDADE INSETICIDA DE ÓLEOS VEGETAIS SOBRE Sitophilus zeamais MOTS. (COLEOPTERA: CURCULIONIDAE EM MILHO ARMAZENADO

    Directory of Open Access Journals (Sweden)

    Rodrigo Leandro Braga de Castro Coitinho

    2006-01-01

    Full Text Available Oils of andiroba (Carapa guianensis Aubl., copaiba (Copaifera sp., Eucaliptus globulus Labill. and Eucaliptus citriodora Hook., neem (Azadirachta indica A. Juss, eugenol, souari nut (Caryocar brasiliense Camb., rosemary (Lippia gracillis HBK., and cedar (Cedrela fissilis Vell. were evaluated in adults of Sitophilus zeamais Mots. (Coleoptera: Curculionidae. In the non-choice test, 20 g of corn grains per plot were treated with 50¿L of each oil and homogenized for two minutes. The plot was infested with eight 0 to 15 days-old S. zeamais adults. The E. globulus, eugenol, rosemary, and neem oils caused 100% mortality in S. zeamais adults. Except for copaiba, all oils caused mortality above 87% and the reduction in emergence of 100%. In the free-choice tests, arenas consisting of two plastic containers symmetrically interconnected to a central box by two plastic tubes were used. Twenty grams of non-treated corn (control were placed in one of the boxes and the same amount of grain treated with 50¿L of each oil comprised the other treatment. Sixteen non-sexed S. zeamais adults (0-15 days old were released in the central box. The rosemary, E. citriodora, eugenol and copaiba oils were the most repellent for S. zeamais adults, with repellence percentage varying from 97.3 to 87.7. Rosemary, andiroba, neem, and cedar reduced S. zeamais emergence in 100%, while the reduction caused by the other oils ranged from 72.7 to 97.9%.

  11. Contraintes de taille dans les mots composés : quand la phonologie entre en concurrence avec les contraintes morphologiques

    Directory of Open Access Journals (Sweden)

    Villoing Florence

    2012-07-01

    Full Text Available Cette communication porte sur les contraintes phonologiques qui pèsent sur la formation des mots construits dans le cadre théorique de la morphologie lexématique (Anderson 1992, Aronoff 1994, Fradin 2003. En étudiant les données du français, les travaux de Lignon (à paraître, Plénat (2009 & Roché (2003 ont montré que des contraintes de taille étaient à l’œuvre dans plusieurs constructions morphologiques. L’objectif de cet article est d’étudier cette hypothèse sur les mots composés Verbe-Nom du français (Villoing 2009. L’analyse quantitative des données du corpus montre clairement que les verbes des mots composés VN du français sont soumis à des contraintes de taille et doivent répondre au format d’un monosyllabe. La contrainte pèse moins lourdement sur les noms qui parviennent à s’imposer plus facilement que les verbes avec une taille supérieure. Cependant, la majorité des mots composés VN tend à ne pas dépasser trois syllabes (leur format optimal étant de deux ou trois syllabes, révélant ainsi l'influence des contraintes de taille sur le mot composé lui-même. La mise au jour de ces contraintes permet d'expliquer l’absence de certains verbes dans le corpus de composés VN, répondant pourtant bien aux propriétés sémantiques attendues : les verbes construits par affixation (absence de suffixés en -iser, -ifier; très rares cas de préfixés, les verbes du 2ème groupe, les verbes de taille supérieure à trois syllabes. En outre, cet article met au jour un cas de concurrence entre contrainte morphologique et contrainte phonologique au sein d'une construction morphologique, et montre comment la première l'emporte sur la dernière, bien que la contrainte phonologique contraigne fortement le choix du verbe et du nom de base. Il donne également à voir comment la contrainte phonologique parvient néanmoins à influencer le choix de bases sémantiquement peu conformes aux attentes de la règle.

  12. 3Cat-3/MOTS Nanosatellite Mission for Optical Multispectral and GNSS-R Earth Observation: Concept and Analysis

    OpenAIRE

    Castellví, Jordi; Camps, Adriano; Corbera, Jordi; Alamús, Ramon

    2018-01-01

    The 3Cat-3/MOTS (3: Cube, Cat: Catalunya, 3: 3rd CubeSat mission/Missió Observació Terra Satèl·lit) mission is a joint initiative between the Institut Cartogràfic i Geològic de Catalunya (ICGC) and the Universitat Politècnica de Catalunya-BarcelonaTech (UPC) to foster innovative Earth Observation (EO) techniques based on data fusion of Global Navigation Satellite Systems Reflectometry (GNSS-R) and optical payloads. It is based on a 6U CubeSat platform, roughly a 10 cm × 20 cm × 30 cm parallel...

  13. En liten høyskole som tenker stort: tiltak mot fusk og plagiat ved Høgskolen i Hedmark

    Directory of Open Access Journals (Sweden)

    Ellen Nierenberg

    2010-07-01

    Full Text Available Høgskolen i Hedmark har satt i gang en del tiltak mot fusk og plagiat, og vi vil gjerne dele våre ressurser og erfaringer med andre undervisningsinstitusjoner. Dette er relevant til to av konferansens temaer: fagreferentens rolle og undervisning i biblioteket. HH's tiltak mot fusk og plagiat inkluderer: • Undervisning i informasjonskompetanse - Høgskolebiblioteket • Kurs i kildebruk og plagiat, "Kilder og kildebruk" • Søkekurs • Synliggjøring av bibliotekressurser/-kurs • Brosjyre til ansatte • Bibliotekets websider om informasjonskompetanse • Nettressurser • Bibliotekets websider • Eksempelsamlingen i APA-standard • "Skriving av faglige tekster - En guide for studenter" • Webside om plagiat og opphavsrett • Fronter • Videoforelesning - "Kilder og kildebruk" • PowerPoint - "Kilder og kildebruk" • Tekstgjenkjenningsprogrammet Ephorus • Vurdering • Elektronisk prøve • Obligatorisk skriveoppgave • Rutinebeskrivelse for tiltak mot fusk og plagiat på Høgskolen • Oppfølging av ikke-møtte studenter på "Kilder og kildebruk" • Vurdering i etterkant av kurset • Bruk av Ephorus • Konsekvenser for fusk Høgskolens tiltak skal forebygge fusk og plagiat ved å gi alle nye studenter tilstrekkelig informasjon om kravene for riktig kildebruk og om konsekvensene for fusk. Høgskolebiblioteket har en sentral rolle i dette arbeidet. Vår Informasjonskompetansegruppe har utarbeidet mange nyttige ressurser, blant annet to-timers kurset "Kilder og kildebruk". Målet med kurset er å lære nye studenter å kritisk vurdere forskjellige typer kilder og bruke dem på korrekt måte i skriftlig arbeid. Kurset blir holdt av bibliotekarer på høgskolens fire campus, og etterfølges av et søkekurs tilpasset det enkelte studium. Antall plagiatsaker på HH har økt de siste årene, men dette kan skyldes bruk av Ephorus. Etter hvert som våre tiltak blir tatt i bruk ved alle studier, håper vi at antall saker blir

  14. Preliminary results of BRAVO project: brain computer interfaces for Robotic enhanced Action in Visuo-motOr tasks.

    Science.gov (United States)

    Bergamasco, Massimo; Frisoli, Antonio; Fontana, Marco; Loconsole, Claudio; Leonardis, Daniele; Troncossi, Marco; Foumashi, Mohammad Mozaffari; Parenti-Castelli, Vincenzo

    2011-01-01

    This paper presents the preliminary results of the project BRAVO (Brain computer interfaces for Robotic enhanced Action in Visuo-motOr tasks). The objective of this project is to define a new approach to the development of assistive and rehabilitative robots for motor impaired users to perform complex visuomotor tasks that require a sequence of reaches, grasps and manipulations of objects. BRAVO aims at developing new robotic interfaces and HW/SW architectures for rehabilitation and regain/restoration of motor function in patients with upper limb sensorimotor impairment through extensive rehabilitation therapy and active assistance in the execution of Activities of Daily Living. The final system developed within this project will include a robotic arm exoskeleton and a hand orthosis that will be integrated together for providing force assistance. The main novelty that BRAVO introduces is the control of the robotic assistive device through the active prediction of intention/action. The system will actually integrate the information about the movement carried out by the user with a prediction of the performed action through an interpretation of current gaze of the user (measured through eye-tracking), brain activation (measured through BCI) and force sensor measurements. © 2011 IEEE

  15. Resistance of irradiated and non-irradiated corn grain genotypes against the weevil Sitophilus zeamais Mots., 1855 (Coleoptera: Curculionidae)

    International Nuclear Information System (INIS)

    Oliveira, Carolina Natali de

    2005-01-01

    The resistance of 13 /////com grain genotypes was evaluated against the attack of Sitophilus zeamais (Mots.) by means of a no-choice test; 6 of them were selected (AGN 2012, AGN 30AOO, AGN 31A31, AGN 25A23, AGN 32A43, and AGN 35A42) and then submitted to a free-choice test where attractiveness and non preference for oviposition were assessed. The grain from the selected genotypes were later treated with Cobalt-60 gamma radiation at the doses of 0.0; 0.5; 1.0; and 1.5 kGy and submitted to the same tests. Based on the results, it was verified that genotypes AGN 2012 (30.6 eggs), AGN 31A31 (33.6 eggs), and AGN 30AOO (34.8 eggs) showed a non-preference for oviposition type of resistance, while non-preference for feeding and/or antibiosis were observed in the first two genotypes only. Genotypes AGN 25A23, AGN 32A43, and AGN 35A42 were the most susceptible to com weevil. The increasing gamma radiation ( 60 Co) doses reduced the mean mass of adults in genotype AGN 2012; however, the same parameter increased in genotype AGN 35A42; when treated at the dose of 1.5 kGy, genotypes AGN 2012 and AGN 31A31 showed a reduction in their mean masses of adults, while genotypes AGN 30AOO and AGN 35A42 showed higher mean mass of adults values. The increasing gamma radiation doses ( 60 Co) provided a reduction in mean grain dry mass consumed by the weevil; however, it was concluded that irradiation did not break com grain resistance and can be used for S. zeamais disinfestation prior to storage. (author)

  16. Kunnskapsgrunnlag for forslaget om et forbud mot synlig oppstilling av tobakksvarer. Evaluering av det offentlige tobakksforebyggende arbeid i Norge 2003-2007

    OpenAIRE

    Lund, Karl Erik; Rise, Jostein

    2008-01-01

    - I nasjonal strategiplan for det tobakksforebyggende arbeidet 2006-2010 ønsket Helse- og omsorgsdepartementet å få utredet forslaget om forbud mot synlig oppstilling av tobakksvarer. Departementet har allerede hatt forslaget på høring, og represen tanter fra tobakksindustrien og handelsnæringen hevdet i sine svar at tiltaket bl.a. var i strid med EØS- reglene og at det ikke kunne dokumenteres effekt. Før departementet eventuelt skal arbeide videre med et lo vfor...

  17. Aproximació a les conceptualitzacions gramaticals d’alumnes de secundària a propòsit de les classes de mots

    OpenAIRE

    Macià, Jaume

    2007-01-01

    El treball vol aprofundir en les conceptualitzacions gramaticals dels alumnes de secundària, particularment en els sabers que mobilitzen quan han de determinar la classe lèxica de certes paraules (els mots analitzats pertanyen a categories “simples” com les de nom, verb, adjectiu i adverbi). Per a tal fi s'han enquestat 141 alumnes i se n'han entrevistat 18 (es tracta d'estudiants de tots els nivells de secundària d'un mateix institut). L'estudi posa en evidència la diversitat de procediments...

  18. Controle de Sitophilus zeamais Mots., 1855 (Coleoptera: Curculionidae com inseticidas empregados em frutíferas temperadas

    Directory of Open Access Journals (Sweden)

    Faria João Luiz

    2005-01-01

    Full Text Available O gorgulho do milho Sitophilus zeamais Mots. tem sido relatado com freqüência atacando frutíferas temperadas em condições de campo, com destaque para o pessegueiro em Pelotas, RS, macieira em Fraiburgo, SC e videira na Serra Gaúcha, RS. Este trabalho avaliou, em laboratório, o efeito dos inseticidas deltametrina (Decis 25 CE, 40mL 100L-1, dimetoato (Dimetoato 400 CE, 150mL 100L-1, triclorfon (Dipterex 500 SNAqC, 300mL 100L-1, fosmet (Imidan 500 PM, 200g 100L-1, fention (Lebaycid 500 CE, 100mL 100L-1, clorpirifós (Lorsban 480 BR, 150mL 100L-1, malation (Malation 1000, 200mL 100L-1, carbaril (Sevin 480 SC, 360mL 100L-1, fenitrotion (Sumithion 500 CE, 150mL 100L-1 e metidation (Supracid 400 CE, 100mL 100L-1 atualmente empregados no controle de pragas em frutíferas temperadas e os novos inseticidas tiametoxam (Actara 250 WG, 15 e 30g 100L-1, benzoato de emamectina (Proclaim 5 SG, 10 e 20g 100L-1, imidacloprid (Provado 200 SC, 30 e 60mL 100L-1, spinosad (Tracer 480 CE, 10 e 20mL 100L-1 e etofenprox (Trebon 100 SC, 100 e 150mL 100L-1. No primeiro experimento, frutos de maçã foram mergulhados na calda inseticida por 10 segundos e oferecidos a adultos de S. zeamais sp (contato residual e, no segundo, os produtos foram aplicados diretamente sobre os insetos (contato direto em torre de pulverização. Os inseticidas triclorfon (150g 100L-1, fention (50g 100L-1, clorpirifós (72g 100L-1, malation (200g 100L-1, metidation (40g 100L-1 e tiametoxam (3,75 e 7,5g 100L-1 foram eficientes no controle do gorgulho do milho, via contato residual, enquanto fention (50g 100L-1, clorpirifós (72g 100L-1, malation (200g 100L-1, fenitrotion (75g 100L-1 e metidation (40g 100L-1 foram eficientes via contato direto.

  19. Mot eit moderne norskfag

    Directory of Open Access Journals (Sweden)

    Magne Rogne

    2008-06-01

    Full Text Available Artikkelen tek for seg tekstomgrepet i norskfaget gjennom læreplananalysar. Først kjem ein faghistorisk gjennomgang med vekt på spørsmålet om norskfaget kan seiast å vere dynamisk i den forstand at det tek opp i seg tekstkulturelle endringar i samfunnet, særleg knytt til medie- og kommunikasjonsutviklinga. Denne gjennomgangen endar opp i ei drøfting av om dagens norskfag kan seiast å ha eit føremålstenleg tekstomgrep i høve til den funksjonen faget skal ha i dagens skule, med eit særleg fokus på spenninga mellom danning og nytte. Artikkelen konkluderer med at norskfaget har endra seg i tråd med samfunnsutviklinga når det gjeld kva type tekstar det er viktig å arbeide med, men òg at dei svake krava til det å meistre tekstproduksjon i dagens plan ikkje er i samsvar med overordna målsetjingar for faget.

  20. Les mots du jazz

    OpenAIRE

    Roueff, Olivier

    2007-01-01

    L’ouvrage d’André Schaeffner constitue la première analyse savante du jazz (1926). Il a marqué une étape importante dans le processus de réinvention du jazz en France en contribuant notamment, par sa réception et les polémiques qu’il a suscitées, à transformer l’identification du jazz d’une musique « américaine » à une musique « noire-américaine » (c’est-à-dire aux « racines » africaines). Les analyses proposées dans cet ouvrage, alors qu’elles désignaient des musiques que la critique de jazz...

  1. Mot muet crie

    Directory of Open Access Journals (Sweden)

    Adelheid Koch-Didier

    2014-04-01

    Full Text Available Co-fondateur du dadaïsme à Berlin, Raoul Hausmann (1886-1971 est encore trop peu perçu comme écrivain de langue française. Ses archives conservées au musée d’Art contemporain de Rochechouart permettent cependant de découvrir cet artiste protéiforme qui fut peintre, photographe, poète, romancier, théoricien et danseur. Notre article se propose de retracer le lien entre le multilinguisme de Hausmann et sa créativité d’écrivain qui s’obstine à s’affranchir de toutes les normes linguistiques et artistiques.

  2. Effect of chamber characteristics, loading and analysis time on motility and kinetic variables analysed with the CASA-mot system in goat sperm.

    Science.gov (United States)

    Del Gallego, R; Sadeghi, S; Blasco, E; Soler, C; Yániz, J L; Silvestre, M A

    2017-02-01

    Several factors unrelated to the semen samples could be influencing in the sperm motility analysis. The aim of the present research was to study the effect of four chambers with different characteristics, namely; slide-coverslip, Spermtrack, ISAS D4C10, and ISAS D4C20 on the sperm motility. The filling procedure (drop or capillarity) and analysis time (0, 120 and 240s), depth of chamber (10 or 20μm) and field on motility variables were analysed by use of the CASA-mot system in goat sperm. Use of the drop-filling chambers resulted in greater values than capillarity-filling chambers for all sperm motility and kinetic variables, except for LIN (64.5% compared with 56.3% of motility for drop- and capillarity-filling chambers respectively, PCASA-mot system with a drop-loaded chamber within 2min after filling the chamber. Copyright © 2016 Elsevier B.V. All rights reserved.

  3. The Functional Fitness MOT Test Battery for Older Adults: Protocol for a Mixed-Method Feasibility Study.

    Science.gov (United States)

    de Jong, Lex D; Peters, Andy; Hooper, Julie; Chalmers, Nina; Henderson, Claire; Laventure, Robert Me; Skelton, Dawn A

    2016-06-20

    Increasing physical activity (PA) brings many health benefits, but engaging people in higher levels of PA after their 60s is not straightforward. The Functional Fitness MOT (FFMOT) is a new approach which aims to raise awareness about the importance of components of fitness (strength, balance, flexibility), highlight benefits of PA, engages older people in health behavior change discussions, and directs them to local activity resources. This battery of tests combined with a brief motivational interview has not been tested in terms of feasibility or effectiveness. To assess whether the FFMOT, provided in a health care setting, is appealing to older patients of a community physiotherapy service and to understand the views and perceptions of the older people undergoing the FFMOT regarding the intervention, as well as the views of the physiotherapy staff delivering the intervention. Secondary aims are to assess the feasibility of carrying out a phase 2 pilot randomized controlled trial of the FFMOT, in the context of a community physiotherapy service, by establishing whether enough patients can be recruited and retained in the study, and enough outcome data can be generated. A mixed-methods feasibility study will be conducted in two physiotherapy outpatient clinics in the United Kingdom. A total of 30 physically inactive, medically stable older adults over the age of 60 will be provided with an individual FFMOT, comprising a set of six standardized, validated, age-appropriate tests aimed at raising awareness of the different components of fitness. The results of these tests will be used to provide the participants with feedback on performance in comparison to sex and age-referenced norms. This will be followed by tailored advice on how to become more active and improve fitness, including advice on local opportunities to be more active. Subsequently, participants will be invited to attend a focus group to discuss barriers and motivators to being more active, health

  4. Tēli un motīvi Vladimira Novikova bērnu stāstu krājumā "Mīlestība un krēms brulē".

    OpenAIRE

    Fedjkina, Jeļena

    2017-01-01

    Bakalaura darbs ir veltīts tēlu un motīvu atklāšanai Vladimira Novikova bērnu stāstu krājumā “Mīlestība un krēms brulē”. Darba mērķis ir noteikt galvenos tēlus un motīvus no izvēlētā stāstu krājuma. Bakalaura darba autors secina, ka galvenie stāstu krājuma motīvi ir bērnības, ģimenes, skolas, skaistuma, pirmās mīlestības un draudzības motīvi, bet tēli – skolotāja un bērna tēls. Bakalaura darbs sastāv no trim daļām. Pirmajā nodaļā ir izklāstīts bērnu literatūras galvenās funkcijas un iezīmes. ...

  5. Les querelles de mots dans le discours politique : modèle d’analyse et étude de cas à partir d’une polémique sur le mot « rigueur » Verbal Disputes in Political Discourse: A Model of Analysis and a Case Study of a Controversy over the Word “Rigueur”

    Directory of Open Access Journals (Sweden)

    Raphaël Micheli

    2013-04-01

    Full Text Available L’objectif de cet article est de contribuer à la description d’un type particulier d’affrontement qui met régulièrement aux prises les acteurs politiques dans l’espace médiatique contemporain : la querelle de mots. Dans ce genre de cas, un mot particulier est érigé en objet du désaccord, sous l’effet d’un travail de cadrage médiatique opéré par les journalistes : les acteurs politiques sont amenés à prendre position quant à son usage et à justifier leur prise de position au moyen d’arguments. On esquisse un modèle d’analyse de ces querelles de mots et l’on teste ce modèle sur un corpus de discours constitué à partir d’une polémique ayant opposé plusieurs acteurs politiques français autour du mot « rigueur » entre mai et juillet 2010. Sur le plan méthodologique, la démarche se situe à la croisée de la linguistique, des théories de l’argumentation et des sciences de la communication et des médias : elle articule l’étude des formes du métalangage ordinaire à celle du fonctionnement argumentatif des discours et des enjeux contemporains de la médiatisation du politique.This paper aims to contribute to the description of a particular type of confrontation, often taking place between political actors in contemporary media, namely verbal disputes. In such confrontations, a particular word becomes the very object of disagreement. Under the effect of a framing process led by journalists, political actors are invited to take a stand as to whether the word should or should not be used and to justify their position by means of arguments. I propose a model of analysis for verbal disputes, and I test it using a data set composed of a controversy involving several French political actors over the use of the word “rigueur” between May and July, 2010. Methodologically, this paper is influenced by linguistics, argumentation theory and media studies. The paper is focused on describing forms of

  6. Instrumentelt turistspråk eller interkulturell dannelse? Om fremmedspråkfagets formål i dag og frem mot 2030

    Directory of Open Access Journals (Sweden)

    Eva Thue Vold

    2014-09-01

    Full Text Available Fremmedspråkfaget har lenge hatt et todelt formål: Det skal ha en nytteverdi, først og fremst i form av kommunikative ferdigheter, og det skal ha en allmenndannende funksjon, bl.a. gjennom tilegnelse av kunnskap om kultur og samfunn i målspråksområdet. Fra og med læreplanen for fremmedspråk i Kunnskapsløftet (2006 er det også tydelig uttrykt at dannelsesdimensjonen omfatter utvikling av interkulturell kompetanse. Denne artikkelen drøfter hvordan fagets todelte formål vil kunne forstås og realiseres i fremmedspråksundervisningen fram mot 2030. Drøftingen tar utgangspunkt i en analyse av dagens situasjon, der trenden med å stykke opp lærestoffet i håndterbare enheter og å vektlegge sterkest det som kan måles mest presist, kan gjøre at ikke-målbar kompetanse som interkulturell dannelse får en relativt svak posisjon. Det argumenteres for at pågående endringer i samfunnsutviklingen og i europeisk utdanningspolitikk vil kunne åpne for en jevnere balanse mellom nytte- og dannelsesperspektivet i faget i fremtiden. Blant disse endringene er 1 en dreining mot et mer holistisk kunnskapssyn, 2 en stadig økende heterogenitet i elevmassen, 3 større bredde i fremmedspråkstilbudet og 4 et økt fokus på flerspråklighet. Artikkelen ser nærmere på disse fire endringsprosessene og diskuterer på hvilken måte de kan og bør påvirke fortolkningen av fremmedspråkfagets todelte formål i årene som kommer.

  7. Pasenusi leksika ir naujažodžiai dvikalbiuose žodynuose. Les mots vieux et les neologismes dans les dictionnaires bilingues lituaniens

    Directory of Open Access Journals (Sweden)

    Danguolė Melnikienė

    2009-01-01

    décrire. Pourtant les mots ne se laissent pas facilement saisir sur l’axe de temps et l’auteur du dictionnaire se trouve souvent devant un dilemme difficile à résoudre. Quelle quantité de mots vieux et livresques doit être présente dans sa nomenclature? Est-ce qu’un mot nouveau qu’il avait recensé sera vraiment intégré au lexique de la langue décrite ? Le but de ce travail est donc d’essayer de répondre à ces questions, d’analyser la présence du lexique de ces deux types dans neuf grands dictionnaires bilingues, parus en Lituanie entre 2000 et 2006, et, enfin, définir leur rôle dans leurs macrostructures. On propose également certaines recommandations générales qui pourraient aider les futurs rédacteurs des dictionnaires à mieux équilibrer le lexique de différents types.

  8. LES VARIANTES LEXICALES POUR LE MOT ESPADRILLES AU PARANÁ ET DANS LA RÉGION NORD-EST DU BRÉSIL: UNE ETUDE ETHNOLINGUISTIQUE

    Directory of Open Access Journals (Sweden)

    Maranúbia Pereira Barbosa Doiron

    2014-03-01

    Full Text Available : Cette étude concerne les variantes lexicales pour le mot espadrilles dans l’Etat du Paraná et dans la région Nord-Est du Brésil, sous un regard ethnolinguistique. Le corpus est composé par les donnés obtenues à partir de la question numéro 276 du Questionnaire Semantique-Lexical de l’Atlas Linguistique du Paraná (ALPR, dont l’auteur est le professeur Vanderci de Andrade Aguilera (1994, de l’Université de l’Etat de Londrina, autant que les variantes lexicales pour le mot espadrilles trouvées dans deux ouvrages littéraires d’auteurs originaires du Nord-Est du Brésil – Fogo Morto, de José Lins do Rego (2009 et Vidas Secas, de Graciliano Ramos (1969. Dans ces livres, les espadrilles jouent un rôle fondamental, tout en reflétant son importance dans le vestiaire de cette région, du moins jusqu’à moitié du XXème siècle. On rechercha des éventuelles ressemblances ou différences existentes entre les variantes lexicales de la chaussure mentionnée par les informateurs “paranaenses” et le modèle cité dans les ouvrages des écrivains Rego et Ramos. Dans les deuxs sources – la linguistique et la littéraire – on privilégia l’analyse semantique des unités lexicales et le contexte dans lequel elles ont été enregistrées. L’étude démontra que l’unité lexicale espadrilles et ses variantes phonétiques similaires dans les deux corpora, aussi que les variantes lexicales populaires présentes dans l’Atlas Linguistique du Paraná (ALPR. En dépit des simitudes l’esthétique et la fonction des espadrilles ne sont pas les mêmes dans les localitées concernées.

  9. LES VARIANTES LEXICALES POUR LE MOT ESPADRILLES AU PARANÁ ET DANS LA RÉGION NORD-EST DU BRÉSIL: UNE ETUDE ETHNOLINGUISTIQUE

    Directory of Open Access Journals (Sweden)

    Vanderci de Andrade AGUILERA

    2013-12-01

    Full Text Available Cette étude concerne les variantes lexicales pour le mot espadrilles dans l’Etat du Paraná et dans la région Nord-Est du Brésil, sous un regard ethnolinguistique. Le corpus est composé par les donnés obtenues à partir de la question numéro 276 du Questionnaire Semantique-Lexical de l’Atlas Linguistique du Paraná (ALPR, dont l’auteur est le professeur Vanderci de Andrade Aguilera (1994, de l’Université de l’Etat de Londrina, autant que les variantes lexicales pour le mot espadrilles trouvées dans deux ouvrages littéraires d’auteurs originaires du Nord-Est du Brésil – Fogo Morto, de José Lins do Rego (2009 et Vidas Secas, de Graciliano Ramos (1969. Dans ces livres, les espadrilles jouent un rôle fondamental, tout en reflétant son importance dans le vestiaire de cette région, du moins jusqu’à moitié du XXème siècle. On rechercha des éventuelles ressemblances ou différences existentes entre les variantes lexicales de la chaussure mentionnée par les informateurs “paranaenses” et le modèle cité dans les ouvrages des écrivains Rego et Ramos. Dans les deuxs sources – la linguistique et la littéraire – on privilégia l’analyse semantique des unités lexicales et le contexte dans lequel elles ont été enregistrées. L’étude démontra que l’unité lexicale espadrilles et ses variantes phonétiques similaires dans les deux corpora, aussi que les variantes lexicales populaires présentes dans l’Atlas Linguistique du Paraná (ALPR. En dépit des simitudes l’esthétique et la fonction des espadrilles ne sont pas les mêmes dans les localitées concernées.

  10. Hvordan kan teknologi skape nye undervisnings- og læringsmåter i fremmedspråksundervisningen fram mot 2030?

    Directory of Open Access Journals (Sweden)

    Eli-Marie Danbolt Drange

    2014-09-01

    Full Text Available I denne artikkelen drøfter jeg hvordan teknologi kan skape nye undervisnings- og læringsmåter i fremmedspråksundervisningen fram mot 2030. Jeg starter med å skissere et mulig framtidsscenario i form av et blogginnlegg skrevet av en 15 åring i året 2030. Videre i artikkelen tar jeg utgangspunkt i dette framtidsscenarioet og sammenligner det med dagens situasjon, i tillegg til at jeg drøfter hva som må til for at scenarioet kan oppfylles. Læreren spiller en nøkkelrolle i utviklingen av nye undervisnings- og læringsmåter, og det er først når læreren integrerer teknologien i sin undervisning at nye praksiser oppstår. Jeg viser noen konkrete eksempler på bruk av teknologi på nye måter, samt refleksjon rundt utviklingen framover.

  11. Estimación de la incidencia de VIH en población adulta de Paraguay con el modelo matemático MoT

    Directory of Open Access Journals (Sweden)

    Margarita Samudio

    2015-03-01

    Full Text Available OBJETIVO: Estimar la incidencia del VIH en la población adulta del Paraguay para 2014, y analizar su distribución con la incertidumbre asociada según comportamiento de riesgo. MÉTODOS: Se aplicó el modelo de ONUSIDA según modos de transmisión (MoT. Los datos se obtuvieron de la revisión detallada de documentos elaborados entre 1996 y 2013. Se realizó el análisis de incertidumbre de los valores estimados. RESULTADOS: La incidencia estimada para 2014 fue 0,091% (3 081 nuevas infecciones. Tanto el porcentaje de nuevas infecciones (74,75%, intervalo de confianza de 95%: 64,19-81,47 como la tasa de incidencia por 10 000 personas (9 518 fueron mayores en el grupo de hombres que tienen sexo con hombres (HSH y el segundo grupo más afectado fue el de personas que tienen sexo heterosexual estable (9,9%. La transmisión heterosexual se produjo en 23% de nuevos casos y 8% de ellos corresponde a parejas (hombres y mujeres de personas con comportamiento de alto riesgo de transmisión del VIH. El 1% está relacionado con el trabajo sexual de mujeres y el uso de drogas inyectables. CONCLUSIONES: Los resultados de la estimación de la incidencia de VIH y su distribución entre los grupos en riesgo son congruentes con los de los informes a escala nacional y con la población de HSH, la que acumula más casos de la epidemia. Las acciones de prevención deben dirigirse a este grupo para producir un impacto importante en el curso de la epidemia en el país. Además, se recomienda ampliar y fortalecer las actividades preventivas en las parejas estables de grupos en riesgo y en la población general.

  12. Estimación y análisis de la incidencia de VIH en población adulta del Perú: resultados de la aplicación del modelo matemático MoT Estimation and analysis of HIV incidence in the adult population in Peru: results of application of the MoT mathematical model

    Directory of Open Access Journals (Sweden)

    Jorge O Alarcón

    2012-12-01

    Full Text Available Objetivos. Estimar la incidencia de VIH en la población adulta del Perú, 2010, y analizar su distribución según comportamientos de riesgo. Materiales y métodos. Se aplicó el modelo de ONUSIDA según modos de transmisión (MoT. Los datos fueron obtenidos de la revisión detallada de 59 documentos (1984 - 2008. También se analizó bases de datos nacionales para obtener datos específicos. La selección final de los datos fue validada por el grupo técnico y un grupo de expertos. Después de la consulta con expertos, se corrigieron los valores y se realizó un análisis de incertidumbre. El modelo fue ajustado a la prevalencia nacional del 2009 (0,45%. Resultados. La incidencia estimada para el 2010 fue de 0,03%, (4346 nuevas infecciones. El 84% de nuevas infecciones se concentra en grupos de mayor riesgo: hombres que tienen sexo con hombres (55% y personas que tienen sexo casual heterosexual (6,2%. El 16% restante corresponde a la población heterosexual de bajo riesgo. La transmisión heterosexual es el 43% de nuevos casos, y dentro de estos el 18% corresponde a parejas femeninas de sujetos de alto riesgo. Solo 2,2% de casos está relacionado al trabajo sexual femenino y 1,0% a usuarios de drogas inyectables. Conclusiones. El modelo proporciona una estimación de la incidencia y su distribución entre los grupos de riesgo según el modo de transmisión, consistente con los reportes de casos de VIH. El modelo permite crear escenarios para ayudar a la toma de decisiones y formulación de políticas, así como para vigilancia y planificación de la prevención y control.Objectives. To estimate HIV incidence in the adult population of Peru, 2010, and analyze its distribution based on risk behavior. Materials and methods. The UNAIDS model was applied based on the modes of transmission (MoT. The information was obtained from the review detailed in 59 documents (1984 - 2008. National databases were also analyzed to obtain specific data. Final

  13. Regeneration de Pat Barker (1991 : la gestion des maux/mots de la Grande Guerre par l’institution psychiatrique

    Directory of Open Access Journals (Sweden)

    Isabelle Gérardin

    2011-04-01

    Full Text Available Cet article se propose d’étudier une œuvre publiée en 1991 par la romancière anglaise Pat Barker : Regeneration. Ce roman, qui a pour toile de fond la Grande Guerre, ne dépeint ni combats ni scènes de la vie des tranchées. Barker préfère représenter toute la dimension agonistique de ce conflit mondial à travers la question de la prise en charge des traumatismes de guerre des soldats par l’institution psychiatrique. Ces traumatismes, ayant diverses manifestations psychosomatiques, témoignent d’une forte tension entre une profonde aversion de l’individu pour l’extrême violence des affrontements et un appel à se conformer à une certaine culture de guerre collective fondée sur un idéal fort de virilité martiale et patriotique. Face à ces traumatismes, ainsi que Pat Barker le met en lumière, la psychiatrie de guerre se révèle souvent fort ambiguë. En effet, l’institution psychiatrique œuvre en continuité avec l’institution militaire, désirant imposer un contrôle sur les âmes autant que sur les corps. Regeneration nous invite donc à lire combien les maux/mots de la Grande Guerre ont eu grand peine à se faire entendre.This article deals with a novel, entitled Regeneration, published in 1991 by the English female author Pat Barker. This novel, although set against the backdrop of World War One, depicts neither battles nor scenes of everyday life in the trenches. Instead, the agonistic dimension of this world conflict is tackled by Pat Barker through the prism of the way the psychiatric institution dealt with war traumas endured by soldiers, traumas of the body and of the mind. These traumas, causing a variety of psychosomatic symptoms, reveal a powerful tension between a deep individual aversion to the extreme violence of combat and an appeal to conform to some collective culture of war rooted in a strong ideal of soldierly and patriotic manliness. Wartime psychiatry, as Barker highlights, often turns out to

  14. Una aproximación a la realidad de las plataformas virtuales de las universidades españolas: el primer reto para una educación personalizada en personas con discapacidad motórica o visual

    Directory of Open Access Journals (Sweden)

    Sonia GUTIÉRREZ GÓMEZ-CALCERRADA

    2015-12-01

    Full Text Available El punto de partida para ofrecer una educación universitaria personalizada basada en entornos de educación online a personas con diversidad funcional debe centrarse en garantizar la óptima accesibilidad a su contenido web y a los recursos de aprendizaje. En la actualidad, la mayoría de las universidades disponen de plataformas virtuales de educación, con un importante peso para el correcto desarrollo de sus estudios y para la optimización del aprendizaje de su alumnado. Por otro lado, los entornos virtuales suponen un importante punto de acceso a la posible matriculación en dichas universidades del alumnado con discapacidad. Este trabajo tiene dos objetivos. El primero de ellos consiste en definir cuáles son las condiciones óptimas de accesibilidad web de las plataformas virtuales de educación y de los sitios web de las universidades para personas que presentan discapacidad visual o discapacidad motórica, de acuerdo a los estándares internacionales. El segundo objetivo del trabajo persigue ofrecer una breve aproximación al grado de accesibilidad de los sitios web de las universidades españolas para el alumnado con esas dos discapacidades. El trabajo sigue un diseño descriptivo basado en dos elementos de análisis. Por un lado, la revisión de estudios de accesibilidad y diversidad funcional y, por otro, el análisis de la accesibilidad web de los sitios web de las 78 universidades españolas. Se concluye que existen dificultades de accesibilidad web y navegación en los entornos virtuales de las universidades españolas, situación que, por lo tanto, redunda en limitaciones en el aprendizaje de los colectivos de estudiantes con limitaciones.

  15. Effekt av ulike desinfeksjonsstrategier mot Listeria monocytogenes

    OpenAIRE

    Fossmo, Sabine

    2013-01-01

    Kontroll med bakterier som Listeria utgjør en stor utfordring for mange matprodusenter. Listeria monocytogenes er hovedsakelig et produksjonshygienisk problem, forbedret hygiene kan derfor være tiltak for å redusere overlevelse og smitteoverføring av bakterien i produksjonsmiljø. Hensikten med forsøkene i oppgaven var å undersøke effekten av ulike desinfeksjonsstrategier på drap av L. monocytogenes, både når bakteriene var i biofilm og i suspensjon. Dette inkluderte bruk av tradisjonelle desi...

  16. Beskytter moderat alkoholforbruk mot hjerte-karsykdom?

    Directory of Open Access Journals (Sweden)

    Inger Stensvold

    2009-10-01

    Full Text Available  SAMMENDRAGTre store utenlandske oppfølgingsstudier fra 1994-95 har funnet en U-formet sammenheng mellom selvrapportertalkoholinntak og dødelighet av hjerte-karsykdom. For menn er det vist at tre alkoholenheter(drinker pr. dag og for kvinner én til to, kan redusere risikoen med opptil 50%. Det synes videre som omeffekten er størst hos eldre personer (over 50 år, og de med minst én viktig koronar risikofaktor. En nyoversiktsartikkel konkluderer med at den gunstige effekten er knyttet til alkoholinnholdet og ikke til andrekomponenter for de ulike alkoholtypene. Det er presentert norske spørreskjema fra 1977 og fram til i dagvedrørende alkohol. Disse er av svært ujevn kvalitet, bl.a. uten spørsmål om mengde alkohol eller type, ogspørsmålene har variert over tid og fra fylke til fylke. Tverrsnittsdata fra Oppland (1986-88 for menn ogkvinner 40-54 år viser en positiv sammenheng mellom alkoholinntak og HDL-kolesterol for begge kjønn ogfor systolisk blodtrykk for menn, sterkest for drikkere av brennevin og øl. For kvinner er det en U-formetsammenheng mellom drikkere av vin og øl og systolisk blodtrykk. Resultater fra en dødelighetsoppfølging(hjerte-kardød viser en forhøyet risiko for menn som har drukket øl siste uke og en gunstigere risiko for desom har drukket vin/brennevin siste uke i forhold til de som ikke har svart på alkoholspørsmålene.Stensvold I. Does moderate alcohol consumption protect against cardiovascular disease?Nor J Epidemiol ENGLISH SUMMARYThree large prospective population studies from 1994-95 have shown a U-shaped relationship betweenalcohol intake and mortality from cardiovascular disease. For men it was shown that three units a day and forwomen one to two units can reduce mortality risk with 50%. The effect was stronger in older people (above50 years and those at greater risk for coronary heart disease. The conclusion, in a recent review, was that thebenefit is from alcohol rather than from other components of each type of drink. Norwegian questionnairesfrom 1977 to 1995 on alcohol are commented upon. The quality of these questions varies; many do notaccount for the amount of intake or the type of alcohol, and they have not been identical from screening toscreening and between counties. Cross-sectional results from Oppland (1986-88 for men and women aged40-54 years, indicated a positive relation between alcohol intake and HDL-cholesterol for both sexes, forsystolic blood pressure in men, strongest for consumers of spirits and beer. A U-shaped association betweenintake of wine and beer with systolic blood pressure was seen in women. A follow-up study with cardiovasculardeath as endpoint indicated a higher risk for men drinking beer during the last week, and a lower risk forthose drinking wine/spirits, compared with men not answering the questions about alcohol intake.1996; 6 (1: 69-71.

  17. Jouer face à Deleuze, mot à mot…

    Directory of Open Access Journals (Sweden)

    Hervé Regnauld

    2009-11-01

    Full Text Available La pensée de Gilles Deleuze n’a pas la réputation d’être simple ni facile à comprendre. Cela n’empêche aucunement que certains de ses concepts soient largement tombés dans l’usage commun et que de très nombreuses publications scientifiques les utilisent. Certains artistes les mobilisent dans la conception de leurs œuvres. Ainsi le duo « territorialisation »-« déterritorialisation » est-il souvent employé par des géographes pour étudier des formes d’inscription ...

  18. Mot-croisé : Trafic.

    Directory of Open Access Journals (Sweden)

    Jacques Virchaux

    2006-05-01

    Full Text Available   Le point de vue de l’informatique. Le trafic est constitué des éléments d'informations qui circulent entre deux équipements — typiquement un ordinateur et un serveur — par l'intermédiaire du réseau. Ces informations sont structurées selon des protocoles pour permettre un dialogue harmonieux et ne pas se perdre. Elles sont organisées en différentes couches pour leur traitement jusqu'au niveau d'une application, seul résultat intéressant en fin de compte ...

  19. Mot et læringsorientert estetikkbegrep

    DEFF Research Database (Denmark)

    Austring, Bennyé D.; Sørensen, Merete

    2010-01-01

    Rundt omkring i den pædagogiske og didaktiske debat støder man i dag ofte på begrebet æstetik, formuleret som f.eks. den æstetiske dimension, æstetiske læreprocesser og æstetisk praksis. Når man ser nærmere på disse tekster og udsagn, kan man få det indtryk, at det æstetiske har udviklet sig til et...

  20. Bristande samsyn i lärares definition av hot och våld : En kvalitativ studie om förekomst av hot och våld mot lärare på högstadieskolor.

    OpenAIRE

    Eklund, Anton; Johansson, Tommy

    2017-01-01

    Denna kvalitativa studie syftar till att studera förekomsten av hot och våld mot lärare på högstadieskolor, hur man på de undersökta skolorna arbetar med att minimera förekomsten av hot och våld samt hur lärare definierar sin syn på vad som kan vara hot och våld från föräldrar och elever. Studien är baserad på ett riktat bekvämlighetsurval där skyddsombud på högstadieskolor i den undersökta kommunen valdes ut. I samband med analysen av studiens resultat har Lintons rollteori använts för att s...

  1. Consistency of eye movements in MOT using horizontally flipped trials

    Czech Academy of Sciences Publication Activity Database

    Děchtěrenko, F.; Lukavský, Jiří

    2013-01-01

    Roč. 42, Suppl (2013), s. 42-42 ISSN 0301-0066. [36th European Conference on Visual Perception. 25.08.2013.-29.08.2013, Brémy] R&D Projects: GA ČR GA13-28709S Institutional support: RVO:68081740 Keywords : eye movements * symmetry * consistency Subject RIV: AN - Psychology http://www.ecvp.uni-bremen.de/~ecvpprog/abstract164.html

  2. Evaluating Multiple Object Tracking Performance: The CLEAR MOT Metrics

    Directory of Open Access Journals (Sweden)

    Bernardin Keni

    2008-01-01

    Full Text Available Abstract Simultaneous tracking of multiple persons in real-world environments is an active research field and several approaches have been proposed, based on a variety of features and algorithms. Recently, there has been a growing interest in organizing systematic evaluations to compare the various techniques. Unfortunately, the lack of common metrics for measuring the performance of multiple object trackers still makes it hard to compare their results. In this work, we introduce two intuitive and general metrics to allow for objective comparison of tracker characteristics, focusing on their precision in estimating object locations, their accuracy in recognizing object configurations and their ability to consistently label objects over time. These metrics have been extensively used in two large-scale international evaluations, the 2006 and 2007 CLEAR evaluations, to measure and compare the performance of multiple object trackers for a wide variety of tracking tasks. Selected performance results are presented and the advantages and drawbacks of the presented metrics are discussed based on the experience gained during the evaluations.

  3. Perception of gamma radiation by adults of Sitophilus zeamais mots

    International Nuclear Information System (INIS)

    Wiendl, F.M.; Walder, J.M.M.

    1975-05-01

    Perception of gamma radiation by living organisms has been evidenced only a few times. The occurence of such perception with maize weevil, Sitophilus zeamais Motschulsky is presented. Tubes containing maize weevil were placed in a radial position to a gamma source. Counting of the insects inside the tubes at different distances from the source was made immediately after irradiation. It was noticed that the insects submitted to irradiation had been driven away from the source as compared with those not submitted (control). A possible relationship exists between this effect and the Cerenkov effect which affects directly the visual organs of the insect. This is probably due to the fact that the insects have a large quantity of water in the occular cells

  4. Valuable cure for cold plugs; Verdifull kur mot kalde plugger

    Energy Technology Data Exchange (ETDEWEB)

    Toenseth, Svein

    2010-07-01

    Direct electric pipeline heating (DEH) has replaced the 'anti-freeze' when cold constipation should be prevented in the oil's 'veins' on the seabed. It has saved billions for Statoil. (AG)

  5. Au-delà des mots, l’émotion

    DEFF Research Database (Denmark)

    Hahonou, Eric Komlavi

    2016-01-01

    and the classic scientific text. The reflection is structured around four components: the benefits of the audiovisual media as a complementary classical scientific text serving the dissemination of knowledge; the emotional dimension of social life and the use of empathy in the production of knowledge ; using...

  6. ProMot - A tool for making decisions when selecting drives; ProMot: ein Werkzeug zur Entscheidfindung fuer Motorenbetreiber

    Energy Technology Data Exchange (ETDEWEB)

    Tanner, R.

    2005-12-15

    This annual report for the Swiss Federal Office of Energy (SFOE) takes a look at the development of the software basis for a tool for making decisions when selecting electrical drives. Work in a three-phase project is described. The phases involve the integration of existing components in a software-system, the Europe-wide distribution of the tool and, finally, various marketing activities. The concept behind an Internet-based system is described and its Content Management System is discussed. Examples of web-pages are presented.

  7. «God save us from more revolutions»: the Aranjuez Mutiny and the Dos de Mayo uprising in the light of Count Fernán Núñez’s widow | «Dios nos libre de más revoluciones»: el Motín de Aranjuez y el Dos de Mayo vistos por la condesa viuda de Fernán Núñez

    Directory of Open Access Journals (Sweden)

    Antonio Calvo Maturana

    2011-12-01

    Full Text Available This essay’s objective is to analyse a direct and unpublished testimony of the two biggest Spanish historical events of 1808: the Mutiny of Aranjuez and Dos de Mayo Uprising. With this purpose we present to the public a collection of letters written by Maria Esclavitud Sarmiento, Countess of Fernan Nuñez, and found in the French National Archives of Paris. In this lady’s correspondence we can appreciate the fears, the hopes and the speculations lived and suffered by the people from Madrid during this period. Thanks to this source we have access to the impressions of an eyewitness (a woman, something even more interesting and unusual who was in constant relation with the current situation, gathering news and rumours, sometimes already obsolete in the next letter because of the frenetic political situation. By her contacts with well-informed people (such as her son, the count of Fernan Nuñez, or members of government like Pedro Cevallos or Eusebio Bardaji, the widow countess offers interesting information about the most important figures and events of this year: Ferdinand VII (his rise to the throne and the preparation for his trip to Bayonne, Napoleon (his arrival to Spain and his recognition, or not, of the new king, Manuel Godoy (his imprisonment and his delivery to French authorities, Charles IV (the renounce of his claim and his posterior regret and Marie Louise of Parme (many rumours related to her dark legend. | El objetivo de este trabajo es ofrecer al lector un testimonio directo e inédito de lo acontecido en Madrid durante los dos grandes hitos históricos españoles de 1808: el Motín de Aranjuez y el Dos de Mayo. Para ello utilizaremos principalmente unas cartas de María Esclavitud Sarmiento, condesa viuda de Fernán Núñez, encontradas en los Archivos Nacionales de París. Esta dama de la alta nobleza reflejó en su correspondencia los miedos, esperanzas y especulaciones que asaltaron a la sociedad madrileña del momento. De

  8. Quelques mots sur les contrats de vente de mots (Observations sur la condamnation judiciaire en France de Google pour son système Adwords

    Directory of Open Access Journals (Sweden)

    Cédric Manara

    2004-09-01

    Full Text Available A French court has ruled against Google France in an intellectual property dispute, saying the company infringed trademark laws for allowing advertisers to combine their text notices to trademarked search terms. This decision, which is not a temporary injunction, is unique, and it is also the first in the world to find Google liable for its AdWords program. This short analysis recaps the reason how the law applied to the search tool, and highlights that the judicial decision has probably no effect for the defendant: not because it has been ruled in France, but because advertisers who buy AdWords agree to indemnify Google for any liability and cause of action. Therefore, this shows that these conflicts of laws in cyberspace are not those we thought so

  9. Des mots pour voir et savoir - Le dictionnaire de voyage revisité

    DEFF Research Database (Denmark)

    Leroyer, Patrick; Rasmussen, Kirsten Wølch

    2017-01-01

    According to Hans Christian Andersen, to travel is to live. When crossing borders and cultures, travelers of modern times, tourists, need fast and easy access to relevant intercultural information in order to live out their travel dreams and augment their reality. They need words to guide them...... and help them see and know better. In this article, we will present a theoretical reflection on travel dictionaries, which by being transformed into functional lexicographic information tools should be able to provide the words making it possible to access this kind of information....

  10. De l’harmonie dans la construction des mots français

    Directory of Open Access Journals (Sweden)

    Roché Michel

    2016-01-01

    Full Text Available La formation des gentilés, particulièrement sensible aux contraintes d’euphonie, permet de mettre en évidence, pour le français, deux manifestations complémentaires de la contrainte dissimilative. L’une, négative, tend à éviter la consécution à faible distance du même phonème ou de deux phonèmes proches. Elle explique la sous-représentation des deux principaux suffixes, -ais et -ois, après une accroche en sifflante, à cause de la sifflante conte-nue par le suffixe au féminin, ainsi que la sous-représentation de -ais après /E/ et de -ois après /A/. L’autre, positive, favorise entre les voyelles une harmonie fondée sur les contrastes. De-vant les suffixes dont la voyelle est une voyelle d’avant moyenne ou haute (-ais, -ain, -in, -ier…, sont privilégiés les radicaux dont la dernière voyelle est une voyelle d’arrière moyenne ou basse, et de préférence un /O/ plutôt qu’un /A/. Devant les suffixes dont la voyelle est une voyelles d’arrière moyenne ou basse (-ois, -ot, -on, -and, -at, -ard…, sont privilégiés les radi-caux dont la dernière voyelle est une voyelle d’avant moyenne ou haute, et de préférence un /i/ plutôt qu’un /E/. Pour cela, un yod au contact du suffixe joue le même rôle qu’un /i/ dans la syllabe précédente. Cette harmonie est obtenue soit par la sélection du suffixe, soit par un aménagement – substitution, épenthèse, troncation, insertion d’un interfixe, etc. – du radical fourni par la base. On observe d’autre part une harmonisation de l’accroche consonantique du radical avec la voyelle du suffixe. Devant -ois, sont privilégiées les attaques en labiale ou en vélaire, en accord avec le double caractère du /w/ propre à ce suffixe. Devant -ais et -ain, ce sont les attaques en dentale. Devant -ot, -on, -and, -at, -ard, la tendance à rapprocher l’articu-lation de la consonne de celle de la voyelle peut aller jusqu’aux vélaires mais elle s’arrête sou-vent aux palatales à cause de la rareté des moyens offerts par les vélaires en français et de la contrainte portant sur les voyelles, qui privilégie devant ces suffixes une attaque en yod.

  11. Reconciliation with environmental quality and public health; Avstaemning mot miljoekvalitetsmaal och folkhaelsomaal

    Energy Technology Data Exchange (ETDEWEB)

    Malmlund, Anna (Structor Miljoebyraan Stockholm AB (Sweden))

    2010-12-15

    This report is an appendix to the 'Environmental Impact Assessment - Interim storage, encapsulation and disposal of spent nuclear fuel'. The report makes a reconciliation with how the national and regional environmental quality and public health objectives are met in the construction, operation and decommissioning of the encapsulation plant and final disposal facility, and the Clink (encapsulation facility combined with CLAB). The starting point for reconciliation is the Environmental Impact Assessment (EIA). This report provides reconciliations against how the environmental and health objectives are met. A more detailed description of the business and its environmental impacts is provided in the EIA.The disposal facility is planned to be constructed in Forsmark municipality, Oesthammar and the encapsulation is constructed, combined with CLAB, in Simpevarp in Oskarshamn municipality.

  12. Analysis of transient plasmonic interactions using an MOT-PMCHWT integral equation solver

    KAUST Repository

    Uysal, Ismail Enes; Ulku, Huseyin Arda; Bagci, Hakan

    2014-01-01

    that discretize only on the interfaces. Additionally, IE solvers implicitly enforce the radiation condition and consequently do not need (approximate) absorbing boundary conditions. Despite these advantages, IE solvers, especially in time domain, have not been

  13. Mot et europeisk regnskapsreguleringsregime : IASB-regelverket og det balanseorienterte konseptuelle rammeverket

    OpenAIRE

    Lundesgaard, Jon

    2005-01-01

    Norsk: Med tusenårsskiftet fikk vi også et skifte i hvordan en i Europa går videre i møtet med utfordringene på regnskapsreguleringsområdet. I stedet for å satse på en “har-monisering” ved direktiver (som det enkelte land i noen grad står fritt i forhold til) går en over på det som er omtalt som en forordningslinje. Dvs. retningslinjer som har karakteren av lov, og med dette får en i Europa et felles regnskapsreguleringsregime for “større” foretak (først og framst gjelder retningslinjene kons...

  14. Motýli voní i zpívají

    Czech Academy of Sciences Publication Activity Database

    Valterová, Irena; Kalinová, Blanka; Kindl, Jiří

    2016-01-01

    Roč. 95, č. 9 (2016), s. 506-507 ISSN 0042-4544 R&D Projects: GA MŠk LD15102 Institutional support: RVO:61388963 Keywords : wax moths * ultrasound communication * courtship behaviour Subject RIV: EG - Zoology

  15. Analysis of transient plasmonic interactions using an MOT-PMCHWT integral equation solver

    KAUST Repository

    Uysal, Ismail Enes

    2014-07-01

    Device design involving metals and dielectrics at nano-scales and optical frequencies calls for simulation tools capable of analyzing plasmonic interactions. To this end finite difference time domain (FDTD) and finite element methods have been used extensively. Since these methods require volumetric meshes, the discretization size should be very small to accurately resolve fast-decaying fields in the vicinity of metal/dielectric interfaces. This can be avoided using integral equation (IE) techniques that discretize only on the interfaces. Additionally, IE solvers implicitly enforce the radiation condition and consequently do not need (approximate) absorbing boundary conditions. Despite these advantages, IE solvers, especially in time domain, have not been used for analyzing plasmonic interactions.

  16. PsyMot : An instrument for psychomotor diagnosis and indications for psychomotor therapy in child psychiatry

    NARCIS (Netherlands)

    Emck, Claudia; Bosscher, Ruud J.

    2010-01-01

    Psychomotor therapy is a movement-oriented and body-oriented therapy which resembles dance movement psychotherapy, although some differences remain. Despite historical differences, theoretical backgrounds as well as practical methods of both therapies converge at large. Both fields are in need of

  17. Direction information acquired from attended objects not from distractors in MOT

    Czech Academy of Sciences Publication Activity Database

    Lukavský, Jiří

    2012-01-01

    Roč. 41, Supplement (2012), s. 140-140 ISSN 0301-0066. [European Conference on Visual Perception . 02.09.2012-06.09.2012, Alghero] R&D Projects: GA ČR GPP407/10/P607 Institutional support: RVO:68081740 Keywords : Multiple Object Tracking * random dot motion * visual attention Subject RIV: AN - Psychology http://www. perception web.com/ecvp/ecvp12_jkt_crop.pdf

  18. An MOT-TDIE solver for analyzing transient fields on graphene-based devices

    KAUST Repository

    Shi, Yifei; Li, Ping; Uysal, Ismail Enes; Ulku, Huseyin Arda; Bagci, Hakan

    2016-01-01

    -RBC) and Poggio-Miller-Chang-Harrington-Wu-Tsai (TD-PMCHWT) integral equation, which are enforced on the surfaces of the graphene and dielectric substrate, respectively. The expressions of the time domain resistivity and conductivity of the graphene sheet

  19. Le poids du mot genre dans les revendications de « l’écriture inclusive »

    OpenAIRE

    Selosse, Philippe

    2018-01-01

    For gender studies, concord with masculine gender refl ects sexism. This paper defi nes the signifi cation of the French word genre as a formal category, with a marking function in sentences, which has nothing to do with sex. Grammatical gender in language is arbitrary and artifi cial, as many historical examples can demonstrate, except among the prototypical group of animated and sexed beings. As the nomenclature of genders « masculin vs féminin » (masculine vs feminine gender) is the conseq...

  20. La perspective fonctionnelle de la phrase et l’ordre des mots en allemand

    Directory of Open Access Journals (Sweden)

    Maria Paola Tenchini

    2012-09-01

    Full Text Available In this paper, elaborating on Daneš’ idea of the “three-levels approach” to syntax, we advance the hypothesis that the global information structure of an utterance is the result of a synergistic action of semantic, syntactic and Theme-Rheme structures. In particular, we focus on the structural and formal factors of the functional sentence perspective, hence distinguishing between Theme-Rheme on the one hand and Given-New and Presupposition-Assertion on the other. The latter notions, though correlated to that of Theme-Rheme, are distinct from it. We apply this theoretical framework to the German language aiming at showing how, in this language, the linguistic means realizing the actual articulation in Theme and Rheme (particularly, word order and intonation together with syntax and semantics determine the structure of an utterance and make it a ‘communication unit’ apt to be placed within specific verbal exchange contexts.

  1. Mot du Directeur régional Pleins feux surla recherche des systèmes ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Gloria Lihemo

    Afrique sub-saharienne. Nous y parlons du travail que fait le. CRDI pour appuyer la recherche des systèmes sanitaires qui prend en compte une approche holistique, interdisciplinaire pour une meilleure santé. Le CRDI reconnaît ...

  2. Jak to bylo s Motýlem na anténě?

    Czech Academy of Sciences Publication Activity Database

    Jungmannová, Lenka

    2015-01-01

    Roč. 26, č. 3 (2015), s. 68-73 ISSN 0862-5409 Institutional support: RVO:68378068 Keywords : Havel, Václav * one-act play * Czech drama * Butterfly on the Aerial Subject RIV: AJ - Letters, Mass-media, Audiovision

  3. Evaluation of sperm motility with CASA-Mot: which factors may influence our measurements?

    Science.gov (United States)

    Yeste, Marc; Bonet, Sergi; Rodríguez-Gil, Joan E; Rivera Del Álamo, Maria M

    2018-03-14

    Computer-aided sperm analysis (CASA) is now routinely used in IVF clinics, animal breeding centres and research laboratories. Although CASA provides a more objective way to evaluate sperm parameters, a significant number of factors can affect these measurements. This paper classifies these factors into four categories: (1) sample and slide (e.g. preincubation time, type of specimen and type of chamber slide); (2) microscope (e.g. light source and microscope stage); (3) hardware and software, including the settings of each system; and (4) user-related factors. We review the effects of the different factors in each category on the measurements made and emphasise the need to take measures to standardise evaluations. The take-home message of the present article is that there are several commercial and useful CASA systems, and all are appropriate for routine analysis. Non-commercial systems may also be good choices when the user needs to adapt the device to specific experimental conditions. In both cases (commercial and non-commercial), it is important that standard protocols are put in place for evaluation, as well as methods to validate the system.

  4. Countermeasures to corrosion on water walls. Part 2; Aatgaerder mot eldstadskorrosion paa panntuber. Etapp 2

    Energy Technology Data Exchange (ETDEWEB)

    Storesund, Jan; Elger, Ragna; Nordling, Magnus; Viklund, Peter

    2011-01-15

    Background: The problems with water wall corrosion have been accelerating over the last years. There are a number of reasons for this. Originally mild steels were successfully used in power plant water walls. The magnetite layer that forms at the fire side of the tubes when the boiler is taken into operation protected from corrosion attack. The fuels at that time (oil, coal, gas) were not able to break down the magnetite by corrosion. In addition, there were no restrictions for pollutions and for the combustion itself that could contribute to corrosion attack. The usage of fossil fuels has decreased substantially over the last 25 years, not least by environmental reasons. As a replacement a number of different kinds of bio mass fuels are used. These are typically more or less corrosive and the magnetite layers are attacked. The corrosion is often supported by reducing conditions as a result of the restrictions of the NO{sub x}-pollution. Also the waste fuelled boilers have huge corrosion problems. This has been the case for the last 25 years but nowadays the number of such plants is so much higher and the service data have been turned up. Corrosion protection of the water wall tubes started to be successful in the beginning of the seventies by the introduction of the composite tube. Such tubes are fabricated by mild steel or a low alloy core and corrosion resistant austenite steel or nickel base as an about 2 mm thick corrosion protective coating. Weld cladding of the water wall tubes was introduced in the 1980's as a significantly cheaper alternative to the composite tubes. Thermal spraying and refractory protection are other methods. These corrosion protection methods have not always been effective. For example, depending on incorrect materials selection, incorrect performance and incorrect method selection for the current corrosion or erosion attack. Therefore, there is a need for increased knowledge of which protection method and material that will work economically for a given situation. In the first phase of the present project a literature survey concerning water wall corrosion protection methods was carried out [1]. Advantages, disadvantages and possibilities by the use of refractories, composite tubes, thermal spraying, hybrid coatings and weld cladding were investigated. An experience survey of problems with and protection of, water wall corrosion in Swedish plants was conducted as well. In an experimental part of the project six different weld clad materials were tested in water walls of five different boilers, representing different types of operation and fuel data. The test materials consisted of some conventional and newly developed weld clads for high temperature corrosion. These trials gave many interesting results but the exposure time was only one year of operation. A second phase of the project has now been carried out. In this study the test materials has been service exposed for another year. In addition, the literature and the experience surveys have been updated. Literature survey: There are some recent developments of water wall corrosion protection methods. One way is to flame spray relatively thick layers onto water wall sections. Then these sections were heat treated by induction heating such as the spray layers sintered see Figure 0.1 below. The sinter material consisted of 15 % Cr, 4,3 % Si, 3.1 % B and 2,5% Mo which gave very high hardness, HV 815. Three years service exposure of test panels gave no significant corrosion at all whereas carbon steel tubes exposed at the same time corroded 1.5 mm. In addition, the output of the boiler increased as a result of flame spray + sintering method. The reason is that refractory, with lower heat transfer properties, otherwise should be the solution for the water wall corrosion

  5. Countermeasures to corrosion on water walls; Aatgaerder mot eldstadskorrosion paa panntuber

    Energy Technology Data Exchange (ETDEWEB)

    Storesund, Jan; Sund, Goeran; Pettersson, Rachel; Nordling, Magnus; Hoegberg, Jan

    2007-12-15

    Corrosion of water walls is becoming a problem for an increasing number of boilers. Wider use of biomass and waste for fuel, as well as requirements of reduced NO{sub x} emissions, makes it much more difficult to avoid combustion in a reducing atmosphere adjacent to the water walls. This has increased the need for corrosion protection in many existing boilers. In addition, biomass and waste fuelled plants currently being planned or built require well-functioning water wall protection from the start. The traditional water wall materials - ferritic low alloyed steels - are not easy to replace because of their outstanding heat transfer properties, ability to form a protective oxide layer on the inside of the tubes and low thermal expansion. For this reason, corrosion protection generally involves the use of some kind of coating on the tubes. In this report, the state-of-the-art regarding water wall corrosion protection is described in a literature survey. Methods covered are the use of refractories, overlay weld cladding, composite tubes and thermal spraying. The interest for overlay welding has increased recently since it can offer similar corrosion protection to composite tubes at a significantly reduced cost. Test panels have been exposed and monitored in different boilers. Six weld overlay materials were tested: the well-proven Alloy 625, a modified Alloy 625 in which niobium has been replaced by tungsten, Alloy 59, Alloy 22, a cheaper nickel base alloy 650 which contains some iron and a 310 grade stainless steel. A total of six panels were exposed in the most vulnerable positions in three different boilers. These included waste and biomass combustion as well as different steam data, sizes and types of boilers. Two further facilities, in which the test materials Alloy 625 and Sanicro 28 had already been installed, were also included in the investigation. The duration of service exposure was one operating season. The weld cladding was measured with a thickness gauge before service exposure and at inspection intervals. Disc samples of each test material were also removed from the test panels for metallographic analysis. The results showed significant corrosion of all six weld overlay materials in the boiler with relatively high steam data and highly corrosive fuel. Metal losses were in the range 0.3 - 1.2 mm after one operating season. The 310 stainless steel suffered fairly uniform corrosion, while the nickel-base alloys exhibited localised pitting. Corrosion in the other boilers was much less pronounced, and in many cases no significant reduction in cladding thickness was observed. Chemical analyses of corrosion products and deposits showed large variations in composition, even within small areas, and indicated that the local environment fluctuates widely. Appreciable levels of chloride, alkali and heavy metals were present, and it was concluded that molten salt fluxing is a primary damage mechanism. The large variations in composition mean that more extensive sampling should be carried out to obtain a complete picture of the corrosion processes on water walls. Nevertheless, the results so far indicate that stainless steels of type 310 or Sanicro 28 can compete with the more expensive Ni-base alloys. Service exposure should be continued for another one or two operating seasons in order rank all the materials in relation to the different types of boilers and to draw more general conclusions

  6. L’impossible « dernier mot ». La maquette du journal : un outil partagé

    Directory of Open Access Journals (Sweden)

    Joël Langonné

    2014-04-01

    Full Text Available La maquette du journal occupe une place particulière dans le continuum de fabrication de l’information. Elle est située à l’interface de la matérialité du journal entre la salle de rédaction et le secteur du prépresse. Les discours et les prérogatives dont elle est capable de se charger font qu’elle porte en elle un potentiel stratégique organisationnel important. La maquette du journal demeure pourtant un acteur méconnu de la sociologie des médias. Cette étude, qui se situe au carrefour de la sociologie interactionniste et de la théorie de l’acteur-réseau, propose de donner toute sa place à la maquette et à ceux qui la construisent et l’utilisent au quotidien dans le journal. Nous montrons que c’est entre deux acteurs particuliers et leurs manières différenciées d’être à ce qu’ils font que la maquette est susceptible de révéler tout son potentiel : les journalistes secrétaires de rédaction (SR et les ouvriers typographes. Nous tentons tout d’abord de saisir pourquoi ces trois acteurs (maquette, SR et typographes sont demeurés invisibles au sein du journal. Il s’agit donc de repenser leur place et leur rôle, de les révéler au prisme d’une grille d’observation renouvelée, agrandie. Nous sommes ensuite en mesure d’observer la manière dont ces trois acteurs peuvent interagir, peuvent s’attacher au sein du processus de fabrication de l’information. Pour cela, nous développons trois exemples issus d’un travail de terrain au sein d’un titre de presse quotidienne régionale (PQR. Il s’agit en fait de comprendre les manières dont les journalistes SR et les ouvriers typographes sont plus ou moins parvenus — selon les époques retenues, et de manière non linéaire — à se saisir de l’objet maquette, pour faire ce qui est à faire — le journal — au plus près de la manière dont ils souhaitent le faire. The newspaper layout has a special place in the continuum of news production. It is located at the interface between conception and materiality - between newsroom and pre-press area. The discourses and prerogatives for which in can be responsible confer it an important strategic organizational potential. And yet, the newspaper layout remains a little-understood element in the sociology of media. This study, which finds itself at the intersection of interactionist sociology and actor-network theory, is dedicated to the layout and those who construct it and use it daily in the newspaper. We show that it is through their differentiated roles that two agents in particular make it possible for the layout to realize its full potential: editorial secretaries (SR and typographers. We try first to understand why these three actors (the layout, SR and typographers have remained invisible within the newspaper. It is therefore a question of rethinking their place and role – of renewing and widening the observation matrix. We can then observe how these three actors interact at the core of the news-production process. To do this, we develop three examples from fieldwork carried out in a regional daily newspaper. In fact, it is an attempt to understand the ways in which copy-editing journalists and typographers were more or less able (depending on the eras selected; and in a non-linear way to seize control of the layout and create what was necessary – the newspaper – as closely as possible to their vision of how it should be done. A diagramação do jornal ocupa um lugar particular no continuum da produção da informação. Ela está situada na interface da materialidade do jornal, entre a redação e o setor de pré-impressão. Os discursos e as prerrogativas sob a responsabilidade da diagramação garantem a ela um importante potencial estratégico e organizacional. Contudo, a diagramação do jornal continua sendo um ator desconhecido do ponto de vista da sociologia da mídia. Este estudo, que se situa na interseção entre a sociologia interacionista e a teoria do ator-rede, dedica-se ao estudo da diagramação e dos atores que trabalham na construção e na utilização dessa prática no cotidiano do jornal. Destacamos dois atores em particular: os copidesques (em francês: secrétaires de rédaction, SR e os gráficos. Eles possuem maneiras distintas de ser, o que permite à diagramação revelar todo o seu potencial. Num primeiro momento, buscamos entender em que sentido os três atores (diagramação, copidesques e gráficos permanecem invisíveis no interior do jornal. Trata-se, portanto, de repensar o seu lugar e o seu papel, de revelá-los ao prisma de uma grelha de observação renovada e ampliada. Em seguida, observamos a forma como esses três atores podem interagir, podem se agrupar em torno do processo de produção da informação. Para isso, desenvolvemos três exemplos oriundos de uma pesquisa de campo realizada no interior de um veículo da impressa regional na França. Trata-se de compreender o modo como os copidesques e os gráficos se utilizam – em momentos específicos e de uma forma não linear – do projeto gráfico para darem conta de suas obrigações – a produção do jornal –, mas buscando aproximar esse processo da forma como eles acreditam que isso deve ser feito.

  7. Studies on food preferences of maize weevil, Sitophilus zeamais Mots. to different crops in Chitwan, Nepal

    Directory of Open Access Journals (Sweden)

    Sheela Devi Sharma

    2016-12-01

    Full Text Available Food preference by the maize weevil, Sitophilus zeamais Motschulsky was studied on seven different crops and varieties including maize, wheat and rice. They were maize cultivars namely Arun-2, Manakamana-4, Deuti, buckwheat local cultivar, wheat cultivar namely Annapurna-1, polished rice-Radha 4 and unshelled rice cultivar Mansuli under storage condition at Institute of Agriculture and Animal Science, Rampur, Chitwan, Nepal from June 2013 to February 2014 . The hosts were tested using completely randomized design with three replications and were laid in free-choice and no-choice conditions. The maximum number of grain loss was recorded in wheat followed by polished rice respectively. Similarly, the highest weight loss was recorded in polished rice followed by Wheat in both conditions. F1 progeny emergence of weevil was highest in wheat followed by polished rice in free-choice and in no choice conditions, the highest progeny were emerged from polished rice followed by wheat. The lowest numbers of weevils emerged from rice in both conditions. Maximum germination losses were recorded in wheat (24.33% and lowest in Arun-2 (9.67. The rice showed a relatively higher preference to maize weevil under storage condition.

  8. Etiska Fonder : - Ett steg mot en mer hållbar värld?

    OpenAIRE

    Hamrin, Lisa; Orehag, Maria

    2011-01-01

    Today, there is no uniform definition of what an ethical fund is. Fund management companies choose themselves what they believe is ethical and not. The lack of the definition makes it difficult for consumers to understand why these funds are special compared to other funds. The purpose of this study is to examine three Swedish companies; KPA Pension, Swedbank Robur and Folksam, to obtain a clearer picture of the concept ethical funds and its definition. The study describes each company's view...

  9. Le sens des mots : le vocabulaire du genre en Espagne

    Directory of Open Access Journals (Sweden)

    Sofía Rodríguez

    2011-12-01

    Full Text Available Cet article dresse le bilan des études de genre menées en Espagne et revient sur les concepts-clé ayant orienté la recherche dans ce domaine. Il montre la relation entre l´évolution du féminisme théorique et l´apparition progressive d´un vocabulaire qui défini les femmes comme des sujets politiques. Si les relations de pouvoir sont l´épicentre des catégories structurant l´analyse historique, la violence, les demandes sociales et le matérialisme traversent la société civile et s’inscrivent dans l´agenda des États. L´avenir, néanmoins, s’accompagne de nouveaux défis et dialogues interculturels qui, sans aucun doute, transformeront le discours des femmes et le langage des genres au XXIe siècle.In these lines there is an account of gender studies in Spain and the key concepts on which this research has pivoted. The aim of this article is to show the relationship between the evolution of feminist theory and the gradual emergence of a vocabulary that explain women as political subjects. If power relationships are the epicenter of the categories of historical analysis, violence, social demands and maternalism are on the street and the agendas of state. But the future brings new challenges and intercultural dialogue, no doubt, will expand or transform the discourse of women and gender language in the XXI century.En estas líneas se hace balance de los estudios de género en España, así como los conceptos clave sobre los que la ha pivotado la investigación. El objetivo del artículo es mostrar la relación entre la evolución del feminismo teórico y la progresiva aparición de un vocabulario que explica a las mujeres como sujetos políticos. Si las relaciones de poder son el epicentro de las categorías de análisis histórico, la violencia, las demandas sociales y el maternalismo están en la calle y las agendas de Estado. Pero el futuro trae consigo nuevos retos y diálogos interculturales que, sin duda, habrán de ampliar o transformar el discurso de las mujeres y el lenguaje de género en el siglo XXI.

  10. Evaluation of irradiated essential oils to control of Sitophilus zeamais Mots. (Coleoptera: Curculionidae) and Blatella germanica (L.) (Dictyopera: Blattellidae); Avaliacao de produtos naturais irradiados para o controle de Sitophilus zeamais Mots. (Coleoptera: Curculionidae) e Blatella germanica (L.) (Dictyopera: Blattellidae)

    Energy Technology Data Exchange (ETDEWEB)

    Potenza, Marcos Roberto

    2004-07-01

    This work aimed to evaluate the effect of irradiated essential oils of Eucalyptus citriodora, Eucalyptus globulus, Pinus sp., Azadirachta indica, Cymbopogon nardus, Cupressus sempervirens, Cymbopogons citratus and Juniperus communis and aqueous, hexanic and ethanolic irradiated extracts of Solanum paniculatum, Dahlia pinnata, Lycopersicon esculentum, Nephrolepis pectinata, Ruta graveolens, Ficus elastica, Lavandula angustifolia, Rhododendron simsii, Agave angustifolia, Ocimum basilicum, Allamanda cathartica, Dieffenbachia brasiliensis, Pennisetum purpureum, Annona squamosa, Coffea arabica and Hibiscus rosa-sinensis, in order to identify new substances to integrated pest management (IPM) and to observe possible effects of gamma radiation about extracts and essential oils efficiency such as increase, reduction, activation and inactivation of the same to the pest control. It evaluated the effect of contact on Sitophilus zeamais and by ingestion in Blattella germanica. To irradiation was used an experimental irradiator of Cobalt-60, type Gammacell 220. The essential oils were submitted increasing doses of gamma radiation: 2.5; 5.0; 7.5 and 10.0 kGy. The bioassay with B. germanica demonstrated efficiency between 22.0 e 30.0% and between 30.0 and 42.0%, respectively, to irradiated essential oils of E. citriodora and E. globulus and they demonstrated too repellency to the nymphs. The gamma radiation used promoted changes in essential oils of E. citriodora e E. globulus that they began to show efficiency on B. germanica nymphs besides a significant reduction of repellency. Essential oils of Pinus sp., A. indica, C. sempervirens and J. communis did not display efficiency. The essential oils of C. nardus, and C. citratus had low efficiency. The gamma radiation increased the efficiency of ethanolic extract of D. Pinnata with dose of 7.5 kGy, showing 48.0% of efficiency on B. germanica nymphs. The gamma radiation showed adverse effect on the aqueous extract of R. Graveolens, decreasing its efficiency of 20.0% to 2.0% in doses of 2.5; 7.5 and 10.0 kGy and 4,0% In dose of 5.0 kGy. The bioassay with S. zeamais demonstrated that irradiated essential oils of E. citriodora, E. globulus e Pinus sp. with dose of 5.0 kGy presented 100.0; 92.0 and 100.0% of efficiency, respectively. The essential oil of A. indica in different doses of gamma radiation didn't display efficiency on S. zeamais adults. It was not found out gamma radiation effects on efficiency from essential oils of C. nardus, C. sempervirens, C. citratus and J. communis, besides the oil of C. nardus in doses of gamma radiation applied was highly efficient over than 90.0%. The gamma radiation increased the efficiency of ethanolic extract of L. esculentum getting 70.0% of efficiency with dose of 5.0 kGy on S. zeamais adults. The gamma radiation showed adverse effect on the aqueous extract of R. Graveolens, decreasing its efficiency of 20.0% to 12.0; 6.0 and 2.0% in doses of 5.0; 7.5 and 10.0 kGy, respectively. According to results we verified that the gamma radiation interfered on behavior of some essential oils to pest control and it can obtain increase, reduction, activation and inactivation from the same. (author)

  11. Evaluation of irradiated essential oils to control of Sitophilus zeamais Mots. (Coleoptera: Curculionidae) and Blatella germanica (L.) (Dictyopera: Blattellidae); Avaliacao de produtos naturais irradiados para o controle de Sitophilus zeamais Mots. (Coleoptera: Curculionidae) e Blatella germanica (L.) (Dictyopera: Blattellidae)

    Energy Technology Data Exchange (ETDEWEB)

    Potenza, Marcos Roberto

    2004-07-01

    This work aimed to evaluate the effect of irradiated essential oils of Eucalyptus citriodora, Eucalyptus globulus, Pinus sp., Azadirachta indica, Cymbopogon nardus, Cupressus sempervirens, Cymbopogons citratus and Juniperus communis and aqueous, hexanic and ethanolic irradiated extracts of Solanum paniculatum, Dahlia pinnata, Lycopersicon esculentum, Nephrolepis pectinata, Ruta graveolens, Ficus elastica, Lavandula angustifolia, Rhododendron simsii, Agave angustifolia, Ocimum basilicum, Allamanda cathartica, Dieffenbachia brasiliensis, Pennisetum purpureum, Annona squamosa, Coffea arabica and Hibiscus rosa-sinensis, in order to identify new substances to integrated pest management (IPM) and to observe possible effects of gamma radiation about extracts and essential oils efficiency such as increase, reduction, activation and inactivation of the same to the pest control. It evaluated the effect of contact on Sitophilus zeamais and by ingestion in Blattella germanica. To irradiation was used an experimental irradiator of Cobalt-60, type Gammacell 220. The essential oils were submitted increasing doses of gamma radiation: 2.5; 5.0; 7.5 and 10.0 kGy. The bioassay with B. germanica demonstrated efficiency between 22.0 e 30.0% and between 30.0 and 42.0%, respectively, to irradiated essential oils of E. citriodora and E. globulus and they demonstrated too repellency to the nymphs. The gamma radiation used promoted changes in essential oils of E. citriodora e E. globulus that they began to show efficiency on B. germanica nymphs besides a significant reduction of repellency. Essential oils of Pinus sp., A. indica, C. sempervirens and J. communis did not display efficiency. The essential oils of C. nardus, and C. citratus had low efficiency. The gamma radiation increased the efficiency of ethanolic extract of D. Pinnata with dose of 7.5 kGy, showing 48.0% of efficiency on B. germanica nymphs. The gamma radiation showed adverse effect on the aqueous extract of R. Graveolens, decreasing its efficiency of 20.0% to 2.0% in doses of 2.5; 7.5 and 10.0 kGy and 4,0% In dose of 5.0 kGy. The bioassay with S. zeamais demonstrated that irradiated essential oils of E. citriodora, E. globulus e Pinus sp. with dose of 5.0 kGy presented 100.0; 92.0 and 100.0% of efficiency, respectively. The essential oil of A. indica in different doses of gamma radiation didn't display efficiency on S. zeamais adults. It was not found out gamma radiation effects on efficiency from essential oils of C. nardus, C. sempervirens, C. citratus and J. communis, besides the oil of C. nardus in doses of gamma radiation applied was highly efficient over than 90.0%. The gamma radiation increased the efficiency of ethanolic extract of L. esculentum getting 70.0% of efficiency with dose of 5.0 kGy on S. zeamais adults. The gamma radiation showed adverse effect on the aqueous extract of R. Graveolens, decreasing its efficiency of 20.0% to 12.0; 6.0 and 2.0% in doses of 5.0; 7.5 and 10.0 kGy, respectively. According to results we verified that the gamma radiation interfered on behavior of some essential oils to pest control and it can obtain increase, reduction, activation and inactivation from the same. (author)

  12. Towards passive house standards in school buildings. Maela smart building - final report; Mot passivhusstandard i undervisningsbygg. Maela smartbygg - sluttrapport

    Energy Technology Data Exchange (ETDEWEB)

    Wachenfeldt, Bjoern Jenssen; Dokka, Tor Helge

    2008-07-01

    SINTEF has in cooperation with the projecting group for Maela School, worked towards smart and general concepts to achieve good comfort with low energy consumption, low environmental impact and low investments. The project is called 'Maela smart building'. Based on conceptual solutions chosen for Maela School, this might be one of the leading school buildings in concern of energy efficiency. To be sure of achieving the target of needed energy to be less than 80 kWh/m{sub 2}, this assumes that the solutions satisfies the demands elaborated with basis in the energy target for the building together with heating and ventilation technical outfit run optimally. If the real consumption shall decrease towards calculated energy needs, the users have to be conscious not to contribute in wasting energy. Further the management of heat and ventilation has to function optimally, the setpoint for heating and ventilation has to be precise. In addition the operators have to have insight in how a building like this functions and the right skills to run it correct. Emphasis on alternatives contributing positively to architecture and good indoor environment in addition to focus on energy efficiency were considered for technical designing of the conceptual heat and ventilation solutions. Generally the need for ventilation channels is reduced to a minimum and the mechanical ventilation is dimensioned considering air quality. Thermic comfort is secured by means of passive attempt such as natural ventilation, sun screening and exploitation of thermic substance in ceiling, walls and floor. Choice of windows and walls with translucent isolation implied some increased risk for overheated teaching wings in second floor in warm and sunny periods. Since these premises because of school vacation in summer, normally is not in use in the summer, the attempts such as sun screening, natural ventilation and night cooling (ventilation of surplus heat during nights),were considered sufficient to make sure an acceptable thermic comfort during school year. By fire technical reasons the solution of translucent isolation was afterwards re projected. This have consequences both in relation to energy usage and indoor environment, but no detailed analysis of these changes have been performed by SINTEF. (AG). 3 refs., 2 figs

  13. Les mots du jazz. Retour(s) sur Le Jazz, d'André Schaeffner et André Coeuroy

    OpenAIRE

    Roueff , Olivier

    2001-01-01

    International audience; Le Jazz by André Schaeffner and André Cœuroy (1926), the first learned analysis of jazz, signaled an important phase in the reinvention of this music in France, since, through the debates it sparked at the time, it helped change jazz’s identity from an « American » to a « Black American » music with African « roots ». Cœuroy and Schaeffner referred to sorts of music that jazz criticism would have throw out of its pantheon, but their analyses would form the major grids ...

  14. Politiinnsats mot voldelig radikalisering og islamistisk ekstremisme : en sammenlignende studie av utvalgte danske, nederlandske og norske politiavdelinger

    OpenAIRE

    LaForce, Ketil

    2011-01-01

    Master i politivitenskap. I denne elektroniske utgaven er forfatterens arbeidssted og "vedlegg 1" tatt ut. I dag utgjør islamistisk ekstremisme fra miljøer rotfestet i Europa en terrortrussel. Dette kalles ofte ”hjemmeavlet terrorisme”. Gjennom en voldelig radikalisering har det grodd frem ekstreme islamistiske miljøer i europeiske land, også nordiske. Denne studiens overordnede mål var å undersøke hvordan noen utvalgte politiavdelinger arbeidet for å forebygge og motvirke voldelig radikal...

  15. Využívanie folklórnych motívov v súčasnom tanci

    Directory of Open Access Journals (Sweden)

    Denisa Benčaťová

    2013-05-01

    Full Text Available This paper is based on a bachelor thesis which had the aim of showing the implementation of folk motifs in other types of dances apart from the folk dance styles, namely in the professional dance form of the latest demonstration of movement - in contemporary dance and physical theatre. It does not stress the issue of stylized dance folklore and its interpretation on the stage; it works with the folk motif as with a symbol depending on the particular plot of the performance. This means that the folk motif has a functional meaning, thus supplementing the nonverbal communication. This article deals with representing folklore from an interdisciplinary point of view: it uses knowledge from ethnology in identification and analysis of folk demonstrations in contemporary dance and physical theatre, and it also uses knowledge from choreology within the analysis and the structure of the particular motifs and levels of stylization. In order to achieve our aim, we have chosen the structural method and formal analysis; we have also created graphic models. We consider the key part of the paper to be the clarification of the graphic models presented, which connect the issues of occultism and initiatory rituals with issues of contemporary and folk dance. Thanks to the connections found between movement production and imitative occultism, both the principles of occultism and the ways it affects objects can be identified in the creation of movement. As a result, inferences can be drawn based on the performance analysis. This article is based on empirical knowledge: two professional dance groups and their performances serve as the example. They show the meaningful form from the content and visual points of view. When speaking about folklorism, we consider this topic to be a new one because the basics of the research concern folk dance presented in a different dance style and processed in other than its “own stylized” environment.

  16. 'Glokal' litteraturhistoria – på väg mot en omvärdering av finlandssvensk barnlitteratur

    Directory of Open Access Journals (Sweden)

    Österlund, Mia

    2011-03-01

    Full Text Available This article considers the conditions and possibilities of writing a methodologically innovative glocal history of post-war Swedish-language children’s literature in Finland. Since previous studies of this literature are, as of today, fragmented and scattered in various publications, a comprehensive and more nuanced picture of the time period is sorely needed. Yet, how is such a project to be carried out in light of recent revisionist debates on the possibility of writing national literary histories? The article proposes that the answer lies in applying transnational, intersectional and visual perspectives onto the material. A working hypothesis is that parallel representations of Finno-Swedishnesses, influenced by shifting notions of the child and childhood and by the liminality of Finno-Swedish culture, permeate the literature under study. Transnational and intersectional perspectives can, therefore, shed new light on representations of ideological and societal tendencies, such as power negotiations between generations, multilingualism, gender, and class distinctions. A fully integrated visual perspective acknowledging paratextual and material aspects of children’s literature would further deepen the discussion. Acknowledging transnational tendencies, an intersectional and visual national children’s literature history could thus interrogate established “truths” about Finno-Swedish children’s literature and thereby open up new ways of viewing this liminal literature.

  17. Evaluation of irradiated essential oils to control of Sitophilus zeamais Mots. (Coleoptera: Curculionidae) and Blatella germanica (L.) (Dictyopera: Blattellidae)

    International Nuclear Information System (INIS)

    Potenza, Marcos Roberto

    2004-01-01

    This work aimed to evaluate the effect of irradiated essential oils of Eucalyptus citriodora, Eucalyptus globulus, Pinus sp., Azadirachta indica, Cymbopogon nardus, Cupressus sempervirens, Cymbopogons citratus and Juniperus communis and aqueous, hexanic and ethanolic irradiated extracts of Solanum paniculatum, Dahlia pinnata, Lycopersicon esculentum, Nephrolepis pectinata, Ruta graveolens, Ficus elastica, Lavandula angustifolia, Rhododendron simsii, Agave angustifolia, Ocimum basilicum, Allamanda cathartica, Dieffenbachia brasiliensis, Pennisetum purpureum, Annona squamosa, Coffea arabica and Hibiscus rosa-sinensis, in order to identify new substances to integrated pest management (IPM) and to observe possible effects of gamma radiation about extracts and essential oils efficiency such as increase, reduction, activation and inactivation of the same to the pest control. It evaluated the effect of contact on Sitophilus zeamais and by ingestion in Blattella germanica. To irradiation was used an experimental irradiator of Cobalt-60, type Gammacell 220. The essential oils were submitted increasing doses of gamma radiation: 2.5; 5.0; 7.5 and 10.0 kGy. The bioassay with B. germanica demonstrated efficiency between 22.0 e 30.0% and between 30.0 and 42.0%, respectively, to irradiated essential oils of E. citriodora and E. globulus and they demonstrated too repellency to the nymphs. The gamma radiation used promoted changes in essential oils of E. citriodora e E. globulus that they began to show efficiency on B. germanica nymphs besides a significant reduction of repellency. Essential oils of Pinus sp., A. indica, C. sempervirens and J. communis did not display efficiency. The essential oils of C. nardus, and C. citratus had low efficiency. The gamma radiation increased the efficiency of ethanolic extract of D. Pinnata with dose of 7.5 kGy, showing 48.0% of efficiency on B. germanica nymphs. The gamma radiation showed adverse effect on the aqueous extract of R. Graveolens, decreasing its efficiency of 20.0% to 2.0% in doses of 2.5; 7.5 and 10.0 kGy and 4,0% In dose of 5.0 kGy. The bioassay with S. zeamais demonstrated that irradiated essential oils of E. citriodora, E. globulus e Pinus sp. with dose of 5.0 kGy presented 100.0; 92.0 and 100.0% of efficiency, respectively. The essential oil of A. indica in different doses of gamma radiation didn't display efficiency on S. zeamais adults. It was not found out gamma radiation effects on efficiency from essential oils of C. nardus, C. sempervirens, C. citratus and J. communis, besides the oil of C. nardus in doses of gamma radiation applied was highly efficient over than 90.0%. The gamma radiation increased the efficiency of ethanolic extract of L. esculentum getting 70.0% of efficiency with dose of 5.0 kGy on S. zeamais adults. The gamma radiation showed adverse effect on the aqueous extract of R. Graveolens, decreasing its efficiency of 20.0% to 12.0; 6.0 and 2.0% in doses of 5.0; 7.5 and 10.0 kGy, respectively. According to results we verified that the gamma radiation interfered on behavior of some essential oils to pest control and it can obtain increase, reduction, activation and inactivation from the same. (author)

  18. Influence of oxygen, nitrogen and carbonic gas during gamma irradiation of 'Sitophilus zeamais' Mots. and 'Zabrotes subfasciatus' (Boh.)

    International Nuclear Information System (INIS)

    Wiendl, F.M.; Tornisielo, V.L.; Walder, J.M.N.; Sgrillo, R.B.

    1976-01-01

    Zero to twenty-four hour old adults of the corn-weevil (S. zeamais) and of the bean weevil (Z. subfasciatus) with their food were irradiated with 5 krad of gamma rays from a Co-60 source (dose rate of 96.25 krad/h). The foodstuffs for the corn weevil were maize and rice as well as common beans for the bean weevil. Before irradiation, the insects of each treatment were exposed to 30 minutes gas fluxes of air, oxygen, nitrogen or carbonic gas, respectively. After irradiation, insects were kept in a temperature controlled chamber at 28 0 C. Losses in weight of the foodstuffs were recorded for 51 weeks. The greatest weight loss was found in the treatment with air flux. Weight losses decreased with the nitrogen, carbonic gas and oxygen treatments, respectively [pt

  19. Au carrefour de trois voies de formation de mots : les substantifs en b, ez-...-, #j-(o en russe moderne

    Directory of Open Access Journals (Sweden)

    Baïandina-Soujaeff, Natalia

    2013-09-01

    Full Text Available Les substantifs en sont très employés en russe moderne et illustrent parfaitement la complexité du système dérivationnel russe et la difficulté à laquelle on est parfois confronté quand il s'agit de déterminer à quel type de formation on a affaire. La morphologie de ces substantifs sera au centre de notre étude. Souvent négligée, la sémantique des noms en présente, elle aussi, un intérêt particulier. Ne serait-ce que par ce qu'elle est complexe et réunit en un tout des sens concrets et abstraits (le sens concret est conféré par et le sens abstrait par . La sémantique des noms en est donc le deuxième axe de la présente recherche. Enfin, l'aspect fonctionnel constituera le troisième pôle de notre étude avec l'analyse des relations synonymiques des noms en et des réflexions sur les critères de choix de la finale.

  20. Entrenamiento perceptivocognitivo con el Neurotracker 3D-MOT para potenciar el rendimiento en tres modalidades deportivas

    Directory of Open Access Journals (Sweden)

    Lluïsa Quevedo Junyent

    2015-03-01

    Full Text Available El propósito de esta investigación ha sido comprobar el efecto de la intensidad del contramovimiento sobre el rendimiento del salto vertical. Para el control de la intensidad se han utilizado tres protocolos de saltos verticales con participación de brazos: a saltos verticales partiendo desde la posición de erguidos (CMJ + S; b partiendo de un salto previo donde la altura de caída estaba regulada por el participante (DJ-AR, y c partiendo de un salto previo máximo (DJ-M. Han participado 28 deportistas practicantes de modalidades deportivas donde el salto vertical constituye una habilidad básica. Se ha utilizado una plataforma de fuerza, operando a 500 Hz, sincronizada temporalmente a una cámara de vídeo, que registraba a 210 Hz el plano sagital de los saltos realizados sobre la plataforma. La aceleración vertical del CM se determinó a partir de la fuerza neta vertical y la masa del saltador. A continuación, los sucesivos registros de la velocidad vertical y las posiciones de componente vertical adoptadas por el CM se determinaron mediante integración de las componentes verticales de las funciones de aceleración-tiempo y velocidad-tiempo, respectivamente. Las constantes de integración se determinaron mediante imágenes de vídeo (2D. Los resultados han puesto de manifiesto que, cuando se realizan saltos con alturas de caída superiores a 0,39 ± 0,05 m, el pico de potencia durante la fase propulsiva (PP(propulsiva(propulsión., y la altura de salto (Ycm vuelo, se reducen de forma significativa (p < 0,001, lo que nos permite afirmar que se reduce el rendimiento durante la fase propulsiva.

  1. Norwegian power and energy balance towards the year of 2010; Norges effekt- og energibalanse frem mot aar 2010

    Energy Technology Data Exchange (ETDEWEB)

    Loekke, K.

    1996-12-31

    The present conference paper deals with the Norwegian power and energy balance towards the year of 2010 based on the rate of domestic energy consumption, development of new power plants, and international supply agreements. The efficiency of power transmission compared to the level of delivered energy in the Norwegian power grid within the period from 1975 to 1992 has increased from 83% to 91% with an equivalency of 5.5 TWh. Aspects in connection with the long-range programme are discussed. 12 figs.

  2. Mot en ämnesintegrativ helhetssyn – ett digitalt utvecklingsprojekt i finländsk lärarutbildning

    Directory of Open Access Journals (Sweden)

    Mårten Björkgren

    2014-06-01

    Full Text Available The school teaching in Finland is traditionally divided into different subject lessons. Although several curricula for decades have stressed the importance of integrating subjects to each other, the didactical development of subject integrated teaching has been quite week. The authors of this article are all involved in the training of subject teachers for the Swedish schools in Finland. The article stresses the importance of integrating subject content knowledge into value education. With the theoretical discussion as a starting point, the authors describe their subject integrated project for student teachers in history, social science, religion, philosophy and literature. During the working process it was obvious that the student teachers used their own subject content knowledge, but as they worked in mixed subject groups, they also realized how to co-operate and ask questions to persons with other kinds of subject content knowledge and perspectives. It was challenging for the student teachers to combine new subject integrated perspectives with new digital methods, but considering the ambitions of the curricula, these kinds of integrated processes seems to be important in teacher training

  3. Energy for Road Transport - Prospects towards year 2020 and later; Energi foer Vaegtransporter - utsikter mot 2020 och daerefter

    Energy Technology Data Exchange (ETDEWEB)

    Aahman, Max

    2009-02-15

    The last few years, production of alternative fuels has grown significantly. The driving force can be primarily attributed to a growing interest in protecting the climate and the policy initiatives resulting from this, rising oil prices and industrial and agricultural interests. However, the debate has increasingly begun to question the usefulness and impact of a continued expansion of biofuels. The report provides an overview of our knowledge with respect to climate benefits, and economic potential for the 1st generation of ethanol and biodiesel, 2nd generation biofuels and electricity via e.g. plug-in hybrids. The report also provides various scenarios of how Sweden can meet the adopted EU directive on renewable energy in the transport sector to 2020. The substitution of fuels in the transport sector has only just begun. Driving forces, including those visible in the criteria of the EU Directive, however, will aim for more climate-effective fuels based on waste and forest raw material compared to today's efforts. Effective grain based fuels can still retain a relatively large niche even in the longer term, since the investment is justified by several reasons, including agricultural policy. Electric vehicles are expected to be launched in the not too distant future. But it will take a long time before electricity consumption via eg plug-in hybrids is visible in the statistics. Increased demands on energy efficiency can drive a trend towards more expensive vehicles and also to change forms of ownership and use of vehicles, including increased car pooling

  4. Développement phonético-phonologique en fulfulde et bambara d’enfants monolingues et bilingues : étude du babillage et des premiers mots

    NARCIS (Netherlands)

    Cissé, Ibrahima Abdoul Hayou

    2014-01-01

    This descriptive and analytical study is based on two corpora of audiovisual data of monolingual and multilingual children’s babbling and first words gathered in Mali during a period of nearly a year. It is concerned with fundamental discussions about the development and acquisition of language such

  5. Hvordan kan fosterbarns indre arbeidsmodeller positivt påvirkes i relasjon med nære omsorgspersoner? Knyttet opp mot SIP-modellen (Sosial informasjonsprosesserings-modell)

    OpenAIRE

    Sunde, Gunn Karin

    2014-01-01

    Master's thesis in Special education Sammendrag Det er stadig flere barn som har behov for å bli omplassert i fosterhjem (Aleris, 2012), grunnet bl.a. omsorgssvikt og utrygg tilknytning (Anke, 2007). Det vil ha innflytelse på fosterbarns indre arbeidsmodeller, som er integrerte mønster hos barnet basert på erfaringer fra samspillet med tilknytningspersonene (Bowlby, 1994). SIP-modellen gir kunnskap om barns mentale prosesser og sosiale tilpasning, og viser mulighet for modifisering av f...

  6. Addressing the impact of environmental uncertainty in plankton model calibration with a dedicated software system: the Marine Model Optimization Testbed (MarMOT 1.1 alpha)

    Science.gov (United States)

    Hemmings, J. C. P.; Challenor, P. G.

    2012-04-01

    A wide variety of different plankton system models have been coupled with ocean circulation models, with the aim of understanding and predicting aspects of environmental change. However, an ability to make reliable inferences about real-world processes from the model behaviour demands a quantitative understanding of model error that remains elusive. Assessment of coupled model output is inhibited by relatively limited observing system coverage of biogeochemical components. Any direct assessment of the plankton model is further inhibited by uncertainty in the physical state. Furthermore, comparative evaluation of plankton models on the basis of their design is inhibited by the sensitivity of their dynamics to many adjustable parameters. Parameter uncertainty has been widely addressed by calibrating models at data-rich ocean sites. However, relatively little attention has been given to quantifying uncertainty in the physical fields required by the plankton models at these sites, and tendencies in the biogeochemical properties due to the effects of horizontal processes are often neglected. Here we use model twin experiments, in which synthetic data are assimilated to estimate a system's known "true" parameters, to investigate the impact of error in a plankton model's environmental input data. The experiments are supported by a new software tool, the Marine Model Optimization Testbed, designed for rigorous analysis of plankton models in a multi-site 1-D framework. Simulated errors are derived from statistical characterizations of the mixed layer depth, the horizontal flux divergence tendencies of the biogeochemical tracers and the initial state. Plausible patterns of uncertainty in these data are shown to produce strong temporal and spatial variability in the expected simulation error variance over an annual cycle, indicating variation in the significance attributable to individual model-data differences. An inverse scheme using ensemble-based estimates of the simulation error variance to allow for this environment error performs well compared with weighting schemes used in previous calibration studies, giving improved estimates of the known parameters. The efficacy of the new scheme in real-world applications will depend on the quality of statistical characterizations of the input data. Practical approaches towards developing reliable characterizations are discussed.

  7. To use the full potential of electric metering - a step towards a more energy effective Sweden; Att utnyttja elmaetarnas potential - ett steg mot ett energieffektivare Sverige

    Energy Technology Data Exchange (ETDEWEB)

    Fonter, Gina; Wiberg, Maria (Royal Inst. of Technology, Stockholm (Sweden))

    2010-04-15

    In line with national and international targets, the electricity market will be characterized by increased use of renewable energy, an increased share of electric plug-in vehicles, engaged consumers, who are conscious of their electricity use and produce their own electricity, and by smarter electricity distribution systems. This will put higher demands for stricter requirements on the available transmission capacity and on the security of supply. Elaborate metering systems is one condition for meeting the challenges facing the electricity market. Electricity metering is also relevant for a range of applications such as remote reading, management of customer relations, demand management and value added services. Utilizing meter data to provide feedback enables use of the electricity metering systems in order to obtain electricity conservation. As of July 2009 the Swedish electricity distributors are required to read and report the electricity use on a monthly basis for all customers with a safety fuse of up to 63 amps. Remote electricity reading is the main function in the current system, which means that the distribution system operator (DSO) is provided with metering data without the need for manual reading and that the customers are charged on a monthly basis for their actual electricity use (rather than an estimate). One reason for the introduction of monthly billing, based on actual electricity use, was to visualize the electricity use to the households. For the electricity use to become visual and controllable, it is important that customers receive feedback on their electricity use. The introduction of monthly billing implied an improvement of the feedback, but it can be further improved in order to allow greater savings. Improved feedback can be given by synthesizing high-resolution data to information presented in new ways, for example by means of in-home-displays, and web-based interfaces combined with counselling. Research shows that the electricity consumption can be reduced by up to 15 percent by using feedback. As a safeguard against future legislative demands over 50 percent of the household have been provided with meters that can handle hourly metering. However, hourly metering is not used to a great extent due to a lack of incentives for the distributors to make use of the hourly metering values. Furthermore not all meters have communication infrastructure that can manage daily collection of values. By changing the current demand of daily collection of values it is possible to employ hourly metering for 74 percent of the households. In addition, propositions of introducing a new metering standard speaks against further investments in the existing metering systems. The metering systems' ability to reflect the short term electricity balance for the consumers is a prerequisite for normal price mechanisms to maintain the security of supply. For that reason, there is a need of metering values with higher resolution in order to indirectly, i.e. by more dynamic tariffs, influence the customer to use less electricity during high load periods. By using hourly metering to the extent made possible with the existing metering systems, this type of service could be offered to a part of the Swedish households. Currently, only the electricity distributors have access to the metering values in the metering systems. This situation limits the business potential that arises from the development of metering services. The business potential is also limited by the fact that the possible savings from electricity conservation are small. Innovation and investments in metering services world be promoted by making metering data accessible to more stakeholders. The development would also be positively affected by higher electricity prices, institutional means of control that promote energy services, and an increasing awareness among consumers. A number of functions that will be important to address the changes facing the electricity market are often referred to in connection to smart grids; the charging of plug-in vehicles, virtual power plants, distributed generation and management of the electricity net. The development of electricity meters, and associated systems is an important prerequisite in the quest towards a smarter grid. These functions are not fully applicable with the existing electricity metering system. Enabling of these functions would probably require major investments in the network, more advanced meters and more advanced communications infrastructure

  8. Une façon d’indiquer la « non-coïncidence entre les mots et les choses », on va dire...

    Directory of Open Access Journals (Sweden)

    Labeau Emmanuelle

    2012-07-01

    Full Text Available Nous souhaitons nous pencher ici sur un emploi particulier de la périphrase en aller + infinitif qui n’a fait l’objet – à notre connaissance – que d’un article (Lansari 2010. Cet emploi « modalisant » que Lansari limite à la formule 'on va dire' mériterait d’être approfondi pour plusieurs raisons. D’une part, l’emploi n’est décrit que sur base de « vingt exemples tirés d’internet, de blogs ou de forums » (Lansari 2010: 120 alors que, de l’aveu de Lansari elle-même, l’emploi relève de l’oral. Il serait donc utile d’enrichir – quantitativement et qualitativement - le corpus et d’y intégrer des occurrences d’oral authentique. D’autre part, Lansari restreint l’emploi modalisant à la séquence 'on va dire' ; on pourrait s’interroger sur la capacité de séquences comme 'je vais dire' à remplir les mêmes fonctions discursives. Dans cet article, nous commencerons par un – forcément bref – état de la question. Après avoir présenté le corpus, nous testerons les hypothèses précédemment défendues à la lueur du corpus rassemblé: (a Le corpus CFPP2000 issu du projet Discours sur la ville. Corpus de Français Parlé Parisien des années 2000 (disponible en ligne à http://cfpp2000.univ-paris3.fr/Corpus.html. CFPP2000 donne la parole à 41 informateurs en 28 interviews (2198 min et a généré 96 occurrences de on va dire modalisant. (b Le corpus CLAPI comprenant 45 heures d’interactions interrogeables en ligne à http://clapi.univ-lyon2.fr/analyse_requete_aide.php?menu=outils. On y a relevé 12 exemples de on va dire modalisant. (c Un corpus personnel d’interviews (163min réalisées pendant l’année académique 2009-10 auprès de cinq étudiants Erasmus français grâce au soutien d’une bourse de la Délégation Générale à la Langue Française et aux Langues de France (DGLFLF. Les entretiens avec une assistante de recherche, basés sur les thèmes suivants, étaient supposés générer l’emploi d’une variété de temps verbaux : - Récits de rêve (imparfait - Récits biographiques (personnage historique vs autobiographie (PC vs PS - Narration de film vs d’épisode historique (PC/ PRES vs PS - Présentation de projets d’avenir vs conjectures (Futur périphrastique ou simple Le corpus contient dix-sept occurrences de on va dire générés par deux des cinq informateurs : 15 par A. et 2 par J. Notre réflexion se basera donc sur 125 occurrences orales de 'on va dire'.

  9. Building method (concreting) for an offshore platform equipped with several cantilevered pillars. Fremgangsmaate for fremstilling (stoeping) av en fralandsplattform som har flere mot hverandre hellende stoetteben

    Energy Technology Data Exchange (ETDEWEB)

    Olsen, O.

    1985-07-29

    The invention deals with a building method for an offshore platform made of concrete comprising several cantilevered pillars. In accordance with the invention, the building work is to be started in a dry dock, and can be completed in the same place or in deep water. The pillars and the foundation are made as separate structures. The foundation can also be made as separate structures for each of the pillars. The vertical positioned pillars are made by means of moving forms, and finally put into cantilevered position and permanently connected to the foundation and the upper end arrangement. The structure then is to be completed in the normal way. 7 drawings.

  10. Towards an economic sustainable, high yielding and climate-smart agriculture with high landscape values; Paa vaeg mot ett ekonomiskt haallbart, hoegproducerande och klimatsmart jordbruk med hoega landskapsvaerden

    Energy Technology Data Exchange (ETDEWEB)

    Kumm, Karl-Ivar

    2013-07-15

    In 1995-97, the Swedish Environmental Protection Agency carried out a futures study with the aim of identifying ways to achieve environmentally friendly, sustainable Swedish agriculture by 2021. The results indicated that major environmental improvements were possible, while also improving profitability and increasing production of food and bioenergy. At a time half way between 1995 and 2021, the trends predicted in that study were compared against actual developments in agriculture. The analysis showed that most objectives regarding environmental quality were on the way to being achieved relatively well. However, profitability continued to be weak, while food production had decreased and bioenergy production was far below the predicted level. The latter means that agriculture was far from achieving the target of compensating for its emissions of greenhouse gases through bioenergy production substituting for fossil energy. This analysis showed that weak profitability and insufficient production capacity at current prices are the greatest sustainability problems in Swedish agriculture. If profitability cannot be improved, agriculture will decline and its positive effects on the landscape will decrease. If production does not increase, there will have to be continued or increased food imports, which are often less favourable from an environmental perspective than food produced in Sweden. If bioenergy production in agriculture does not drastically increase, it will be difficult to realise the vision of a Sweden without net emissions of greenhouse gases by 2050. The present report updates the futures study. In the evaluation, great emphasis is placed on identifying paths to economically sustainable, high producing and climate-smart agriculture with high landscape values. It is assumed that the current agricultural support system is replaced with environmental payment based on landscape and climate benefits. The views expressed in this report are those of its author and do not necessarily coincide with views held by the Swedish Environmental Protection Agency.

  11. Ripsteg mot spetskunskap i samisk matematik:lärares perspektiv på transformeringsaktiviteter i samisk förskola och sameskola

    OpenAIRE

    Jannok-Nutti, Ylva

    2010-01-01

    Syftet med föreliggande avhandling är att utifrån lärarperspektiv beskriva, analysera och försöka förstå transformering av utbildning i matematik så att ett samiskt perspektiv blir utgångspunkt för utbildningen. Avhandlingen genomfördes såsom ett aktionsforskningsprojekt med fokus på lärares perspektiv avseende transformering och genomförande av transformeringsaktiviteter i matematik. Teoretiska utgångspunkter togs utifrån Smiths teori om urfolksperspektiv, Banks teori för integrering av mult...

  12. Les mots du sida : néologie, obsolescence et fixation. Bilan terminologique de trois décennies d’épidémie et de recherche

    Directory of Open Access Journals (Sweden)

    Gouttefangeas Raphaëlle

    2014-07-01

    Je me propose ici d’étudier les phénomènes de création lexicale, d’obsolescence et de figement phraséologique dans une perspective à la fois descriptive et théorique, qui s’inscrit dans la lignée des principes posés par la théorie des portes de Maria Teresa Cabré, laquelle situe la terminologie au confluent de plusieurs disciplines (sciences cognitives, linguistique, sciences du langage, sciences de la communication, sociolinguistique, etc.. L’étude de recommandations linguistiques concernant la communication sur le sida, émanant d’un organisme international, l'ONUSIDA, à travers un document de synthèse, le Guide de Terminologie de l’ONUSIDA (version révisée de 2011, permettra de mettre en perspective les principes extralinguistiques présidant aux choix lexicaux et surtout phraséologiques dans la terminologie du sida, et de s’interroger sur la veille néologique que le terminologue doit mettre en place dans ce domaine. Ce travail sera conduit dans une perspective à la fois descriptive et théorique en tentant de voir comment le lexique du sida peut servir de prototype à une approche modulaire de la terminologie.

  13. Optické mřížky na motýlích křídlech

    Czech Academy of Sciences Publication Activity Database

    Krizek, G.O.; Hagen, G.M.; Křížek, P.; Havlová, M.; Křížek, Michal

    2012-01-01

    Roč. 60, č. 6 (2012), s. 300-301 ISSN 0044-4812 Institutional support: RVO:67985840 Keywords : light interference * polar coordinates * optical lattices Subject RIV: EG - Zoology http://ziva.avcr.cz/2012-6/opticke-mrizky-na-motylich-kridlech.html

  14. Opuštěné vojenské prostory jako významná refugia motýlí fauny

    Czech Academy of Sciences Publication Activity Database

    Vrba, Pavel; Čížek, Oldřich; Marhoul, P.; Zámečník, J.; Beneš, Jiří; Konvička, Martin

    2012-01-01

    Roč. 2012, č. 5 (2012), s. 251-254 ISSN 0044-4812 R&D Projects: GA ČR GAP505/10/2167 Grant - others:Ministerstvo životního prostředí(CZ) VaV/SP/2d3/153/08 Institutional support: RVO:60077344 Keywords : butterfly fauna

  15. Facebook och ansikte mot ansikte-kommunikation : En undersökning bland 100 ungdomar i Karlstads kommun om deras kommunikativa vanor

    OpenAIRE

    Hedenström, Tobias; Andersson, Tomas

    2011-01-01

    This essay deals with the subject of communication through Facebook. In this survey we studied 100 youths from Karlstad and their communication habits and behavior patterns on Facebook. The social network site Facebook has since its start in 2004 made a mark in modern communication. Today in 2010 the site has more than 500 million users. This paper wants to study what happens to other types of communication. Has the increased use of computer-mediated communication led us away from face to fac...

  16. Safety against releases in severe accidents. Annual report 1996. Project plan 1997; Saekerhet mot utslaepp vid reaktorhaverier. Aarsrapport 1996. Plans 1997

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-01-01

    The work scope of the RAK-2 project is divided into three sub-projects: RAK-2.1 Severe Accident Phenomenology; RAK-2.2 Computerised Accident Management; RAK-2.3 Reactors In Nordic Surroundings. The work in subproject 1 progresses roughly according to budget and time schedule. Some adjustments in the technical work scope were made during 1996. Main tasks of RAK-2.1 in 1996: Complete recriticality studies for Nordic BWRs; Investigate phenomena related to late phase melt progression; Issue and NKS Final Technical Report on KTH experiments. Main tasks of RAK-2.2 in 1996: CAMS would be further developed with signal validation, tracking simulation, state identification and PSA and risk monitoring applications; Carry out a feasibility study for development of a PWR version of CAMS in collaboration with EdF, France; Use CAMS in the Halden Man-Machine laboratory to perform human factor studies. Main tasks of RAK-2.3 in 1996: Collect and report data from the British reactor types AGR, MAGNOX and PWR; Make a report on accidents in nuclear ships; Put the collected data together in a common data base covering neighbour reactors treated in SIK-3 and RAK-2.3; Update the data in the former SIK-3 report if needed. The work in project 2 progresses according to plans. The data collection of British reactors with in sub-project 3 has been delayed significantly due to difficulty of obtaining information from some of the British utilities, but the problems are expected to be solved by the end of 1997. (EG).

  17. Reliability measures of a computer system with priority to PM over the H/W repair activities subject to MOT and MRT

    Directory of Open Access Journals (Sweden)

    Ashish Kumar

    2015-01-01

    Full Text Available This paper concentrates on the evaluation of reliability measures of a computer system of two-identical units having independent failure of h/w and s/w components. Initially one unit is operative and the other is kept as spare in cold standby. There is a single server visiting the system immediately whenever needed. The server conducts preventive maintenance of the unit after a maximum operation time. If server is unable to repair the h/w components in maximum repair time, then components in the unit are replaced immediately by new one. However, only replacement of the s/w components has been made at their failure. The priority is given to the preventive maintenance over repair activities of the h/w. The time to failure of the components follows negative exponential distribution whereas the distribution of preventive maintenance, repair and replacement time are taken as arbitrary. The expressions for some important reliability measures of system effectiveness have been derived using semi-Markov process and regenerative point technique. The graphical behavior of the results has also been shown for a particular case.

  18. Towards effective waste management. Knowledge centre Waste Refinery Activity Report 2007-2009; Mot effektivare avfallshantering. Kunskapscentrum Waste Refinery Verksamhetsrapport 2007-2009

    Energy Technology Data Exchange (ETDEWEB)

    2011-07-01

    This report aims to provide a comprehensive picture of the areas that have been discussed and developed during the knowledge centre Waste Refinery first three years. Details and depth analyzes of each area are contained in project reports, which can be downloaded free of charge through our website www.wasterefinery.se

  19. Climate cure 2020. Measures and instruments for achieving Norwegian climate targets to 2020; Klimakur 2020. Tiltak og virkemidler for aa naa norske klimamaal mot 2020

    Energy Technology Data Exchange (ETDEWEB)

    2010-07-01

    In this scenario, the analysis shows how international climate change agreements and the population's attitude to climate-friendly actions could affect Norway's ability to achieve the objectives of national emission reductions. Political feasibility, technology and carbon price may vary according to how forces will move in future. Some measures to reduce greenhouse gas emissions may be more robust against future uncertainties than others. Scenario analysis can therefore provide useful perspectives when instruments should be implemented to reduce greenhouse gas emissions in the years ahead. (AG)

  20. La musique du mot et du concept, ou certains problemes de traduction poetique (The Music of Word and Concept, or Certain Problems in Poetic Translation)

    Science.gov (United States)

    Maisonneuve, Roland

    1978-01-01

    The whole universe enters the poet's being to be eventually transformed by him/her into musical language. It is this music that the translator must reproduce. Excerpts from the poems of Patmore, Auden, Donne, Joyce and Sloate illustrate the discussion. Translation of mystical and religious poetry is given special attention. (Text is in French.)…

  1. Territoire et exclusion : des mots de l´Etat-providence et des maux de la société civile

    Directory of Open Access Journals (Sweden)

    Catherine Rhein

    1997-10-01

    Full Text Available Dans ce texte qui répond aux réflexions de Nicole Mathieu publiées dans ce même numéro, sont développés trois points. En premier lieu, il est proposé un bref retour aux origines et au sens ŕ donner ŕ la question de l´exclusion. Puis sont abordés les rapports entre territoire et exclusion en milieu urbain, notamment dans les travaux de l´école de sociologie de Chicago. Enfin plusieurs pistes de recherches sont proposées sur les processus et les facteurs d´intégration/exclusion sociales dans les grandes métropoles.

  2. Bestrijding schadelijke rupsensoorten in de glastuinbouw met sluipwespen : toetsing van Cotesia vanessae in het laboratorium en toetsing van Meteorus gyrator tegen turkse mot (Chrysodeixis chalcites) in komkommer

    NARCIS (Netherlands)

    Bloemhard, C.M.J.; Haaring, M.A.

    2005-01-01

    Zowel in groente- als sierteelten onder glas komen rupsen voor uit de families Noctuidae, Tortricidae en Pyralidae. Bestaande chemische middelen of biologische bestrijders voldoen vaak niet. Uit literatuuronderzoek zijn een aantal sluipwespsoorten gekomen die kandidaat zijn voor de bestrijding van

  3. Work-life balance utifrån ett arbetsgivarperspektiv : Om arbetsgivares arbete och inställning mot work-life balance

    OpenAIRE

    Eriksson, Johan

    2014-01-01

    I och med att tid spenderad på arbetsplatsen verkar fortsätta öka blir allt mindre och mindre tid kvar till familj och fritid, eller det som i denna uppsats benämns som övrigt liv. Den vanligaste orsaken till att en individ upplever obalans är att arbetssfären är för dominerande och lämnar kvar för lite tid till övriga sfärer. Därför har syftet i denna uppsats varit att öka förståelsen för hur och varför olika arbetsgivare arbetar med work-life balance samt att ta reda på vad de har för instä...

  4. Use of CAPE-OPEN standards in the interoperability between modelling tools (MoT) and process simulators (ProSim)

    DEFF Research Database (Denmark)

    Morales Rodriguez, Ricardo; Gani, Rafiqul; Déchelotte, Stéphane

    2008-01-01

    Computer-aided design, analysis and/or operation of chemical products and processes that manufacture them require a number of computational tools. As these tools may come from different sources and disciplines, an important issue is how they can be used simultaneously and efficiently for the design...... computational tools according to problem specific work-flows/data-flows. The reliability of the integration of different tools is illustrated through two case studies. In case study 1, the tools Simulis® Thermodynamics (PME) and ICAS-MoT (PMC) are combined for the calculation of thermodynamic properties through......SimPlus-ICAS-MoT-COFE interoperability is also carried out successfully to proof the interoperability of the different computational entities. Furthermore, the introduction of the multiscale modelling concept and its application through the CAPE-OPEN standards is highlighted....

  5. Climate cure 2020. Measures and instruments for achieving Norwegian climate targets to 2020; Klimakur 2020. Tiltak og virkemidler for aa naa norske klimamaal mot 2020

    Energy Technology Data Exchange (ETDEWEB)

    2010-07-01

    In this scenario, the analysis shows how international climate change agreements and the population's attitude to climate-friendly actions could affect Norway's ability to achieve the objectives of national emission reductions. Political feasibility, technology and carbon price may vary according to how forces will move in future. Some measures to reduce greenhouse gas emissions may be more robust against future uncertainties than others. Scenario analysis can therefore provide useful perspectives when instruments should be implemented to reduce greenhouse gas emissions in the years ahead. (AG)

  6. Motýli vybraných evropsky významných lokalit Libereckého kraje (Česká republika)

    Czech Academy of Sciences Publication Activity Database

    Kadlec, T.; Zapletal, Michal; Marhoul, P.

    2013-01-01

    Roč. 49, 1-2 (2013), s. 43-71 ISSN 1210-6100 R&D Projects: GA ČR GAP505/10/2167; GA MŽP SP/2D3/62/08 Grant - others:Interní grantová agentura FŽP ČZU(CZ) IGA FŽP 4290013123114 Institutional support: RVO:60077344 Keywords : macrolepidoptera * faunistics * conservation Subject RIV: EG - Zoology

  7. Radiosensitivity of Sitophilus Zeamais Mots (S. Oryzae L.) at Various Stages of Development: A Study of the Larval Stages by Means of Radiography and 'Actographic' Recording; Sensibilite des Divers Stades de Developpement de Sitophilus Zeamais Mots (S. Oryzae L.) aux Radiations Ionisantes Etude des Stades Endoges par Radiographie et Enregistrement Actographique

    Energy Technology Data Exchange (ETDEWEB)

    Pesson, P.; Girish, G. K. [Institut National Agronomique, Paris (France)

    1968-06-15

    The paper describes an original method of study, based on the employment of an 'actograph' which records the vitality of the larval stages and makes it possible to study the larva population inside grains (actograph for electro-acoustic detection developed by the INRA Acoustic Physiology Laboratory, Jouy-en-Josas). The contamination rate and the death rate of the larvae are observed by radiography. The effects of irradiation at doses of 2000, 4000, 8000 and 16000 rad are studied in the egg stage, on larvae aged 5-7 days, 13-15 days and 19-21 days and on adults, whose fertility is measured 0-5 days, 5-10 days and 10-15 days after irradiation. The effects of irradiation on the second generation bred from the various stages irradiated are noted. (author) [French] Les auteurs presentent une methode d'etude originale, fondee sur l'emploi d'un appareillage actographique, qui enregistre et traduit la vitalite des stades endoges et permet d'apprecier la population larvaire a l'interieur des grains (actogtaphe a detection electro-acoustique mis au point par le Laboratoire de physiologie acoustique de l'INRA, Jouy-en-Josas). Le controle du taux de contamination et de la mortalite larvaire se fait par radiographie. Les auteursont etudie les effets de l'irradiation (doses de 2000, 4000, 8000 et 16 000 rad)sur le stade oeuf, sur les larves agees respectivement de 5 a 7 jours, 13 a 15 jours, 19 a 21 jours et sur les adultes (fecondite 0 a 5 jours, 5 a 10 jours, 10 a 15 jours apres l'irradiation); ils ont egalement fait des observations sur les consequences de l'irradiation sur la seconde generation issue des divers stades irradies. (author)

  8. Mechanistic site-based emulation of a global ocean biogeochemical model (MEDUSA 1.0 for parametric analysis and calibration: an application of the Marine Model Optimization Testbed (MarMOT 1.1

    Directory of Open Access Journals (Sweden)

    J. C. P. Hemmings

    2015-03-01

    Full Text Available Biogeochemical ocean circulation models used to investigate the role of plankton ecosystems in global change rely on adjustable parameters to capture the dominant biogeochemical dynamics of a complex biological system. In principle, optimal parameter values can be estimated by fitting models to observational data, including satellite ocean colour products such as chlorophyll that achieve good spatial and temporal coverage of the surface ocean. However, comprehensive parametric analyses require large ensemble experiments that are computationally infeasible with global 3-D simulations. Site-based simulations provide an efficient alternative but can only be used to make reliable inferences about global model performance if robust quantitative descriptions of their relationships with the corresponding 3-D simulations can be established. The feasibility of establishing such a relationship is investigated for an intermediate complexity biogeochemistry model (MEDUSA coupled with a widely used global ocean model (NEMO. A site-based mechanistic emulator is constructed for surface chlorophyll output from this target model as a function of model parameters. The emulator comprises an array of 1-D simulators and a statistical quantification of the uncertainty in their predictions. The unknown parameter-dependent biogeochemical environment, in terms of initial tracer concentrations and lateral flux information required by the simulators, is a significant source of uncertainty. It is approximated by a mean environment derived from a small ensemble of 3-D simulations representing variability of the target model behaviour over the parameter space of interest. The performance of two alternative uncertainty quantification schemes is examined: a direct method based on comparisons between simulator output and a sample of known target model "truths" and an indirect method that is only partially reliant on knowledge of the target model output. In general, chlorophyll records at a representative array of oceanic sites are well reproduced. The use of lateral flux information reduces the 1-D simulator error considerably, consistent with a major influence of advection at some sites. Emulator robustness is assessed by comparing actual error distributions with those predicted. With the direct uncertainty quantification scheme, the emulator is reasonably robust over all sites. The indirect uncertainty quantification scheme is less reliable at some sites but scope for improving its performance is identified. The results demonstrate the strong potential of the emulation approach to improve the effectiveness of site-based methods. This represents important progress towards establishing a robust site-based capability that will allow comprehensive parametric analyses to be achieved for improving global models and quantifying uncertainty in their predictions.

  9. När David förlorade mot Goliat : En studie om hur ett varumärke påverkas vid förlusten av en tvist

    OpenAIRE

    Ekberg, Emma; Blomqvist, Hugo

    2016-01-01

    I november 2015 avgjordes en tvist mellan havredrycksproducenten Oatly och branschorganisationen Svensk Mjölk i Marknadsdomstolen. Svensk Mjölk stämde Oatly eftersom de ansåg att deras marknadsföring var vilseledande. Stämningen ledde till att Oatly dömdes till förbud för marknadsföring som antyder att havremjölk är ett bättre val än komjölk. Denna studies syfte är att undersöka hur tvisten påverkat Oatlys lojala kunders varumärkesuppfattning utifrån begreppet brand image. För att undersöka d...

  10. Les verbes à objets cognats en portugais européen : quelques réflexions sur la conversion et la génération de mots

    Directory of Open Access Journals (Sweden)

    Celda Morgado Choupina

    2013-01-01

    Full Text Available The text analyzes the verbs with cognate objects in European Portuguese and provides an analysis of this phenomenon in the framework of Distributed Morphology, and a few ideas of the Minimalist Program. In this paper we only develop the analysis of the constructions of the type of chorar um choro... [cry a cry…] and cantar uma cantiga [sing a song]. Since a lexicalist theory as the one developed by Hale e Keyser (1993; 2002 can’t solve all the issues raised by the various types of constructions in EP, we will try an analysis that combines the contributions of Haugen (2009, on cognate objects, Marantz (1993 and Alexiadou (2001, 2006, on verbal functional heads, and (Chomsky 1995, on the idea of movement by copy

  11. Att öka mottagligheten för branded content genom hyper-personalisering : En användarstudie mot målgruppen för digitala tidskrifter inom populärkultur.

    OpenAIRE

    Sombo, Alexandros

    2015-01-01

    I denna studie utreder jag om hur branded content mottas av målgruppen för digitala tidskrifter inom populärkultur genom en framträdande teknik in webb-personalisering, hyper-personalisering. Målgruppen för denna studie är unga opinionsbildare som konsumerar innehåll från digitala tidskrifter som exempelvis Nöjesguiden. Branded content, sponsrat innehåll, är innehåll som skapas för att ett varumärke skall förknippas med en kreatörs målgrupp. Alltså kan ett varumärke be Nöjesguiden skapa redak...

  12. Homoadoption i Bamse : hur skildras homosexualitet och homoadoption i serietidningen ”Bamse” och var placerar sig resultatet mot en kort jämförelse av homohistoria, samhälle och genus?

    OpenAIRE

    Beischer, Per-Henrik

    2011-01-01

    The purpose of this study is to investigate how homosexuality and homosexual adoptions are manifested in children's comic "Bamse" and study the result in the light of a brief background about the western society and gay history. The study has a historical gender perspective and focus homosexuality primarily in modern times. Drawing on critical theory and semiotic analysis, the study shows how ideas and ideology surrounding same-sex relations and parenting are negotiated in the ”Bamse” comic. ...

  13. Mäns våld mot kvinnor- Svenskt eller osvenskt våld? : Representationer av våld i nära relationer. En postkolonial feministisk diskursanalys.

    OpenAIRE

    Tuffaha, Lobna

    2015-01-01

    Men's violence against women is a serious social problem and an obstacle to the realisation of women's rights. In Sweden, approximately a fifth of the population, has at some time in their lives, been subjected to domestic violence. It is estimated that about 80 percent of the violence is not reported. The aim of this study is to analyse the discourse representations of domestic violence and violence in the name of honour, in two different Swedish reports. (Eva Lundgren, Captured Queen- Men’s...

  14. Water power and environmental protection. An analysis of the public opinion against water power development in Sweden 1950-1990; Vattenkraft och naturskydd; En analys av opinionen mot vattenkraftutbyggnaden i Sverige 1950-1990

    Energy Technology Data Exchange (ETDEWEB)

    Anshelm, J

    1993-12-31

    This study illuminates the first large environmental debate after World War 2: the struggle against the harnessing of the northern Swedish rivers. The fascinating question is raised of how it was possible for an unparliamentary environmental protection movement to make itself heard, and influence the Swedish energy policy, though their arguments were contrary to the outspoken interests of the industry, the trade unions, and the social democratic government. This was the more fascinating because the values the opinion stressed wore of ethic, esthetic, biological, and conservation economical nature

  15. Fiche pratique: La peche aux mots; Faire parler les BD; Rubrique evenement; Les droits de l'homme (Practical Ideas: Fishing for Words; Making Comic Strips Talk; Events Report; The Rights of Man).

    Science.gov (United States)

    Timbal-Doclaux, Louis; And Others

    1994-01-01

    Four activities for classroom French instruction are described: a board game for children's vocabulary development; a sentence and dialogue construction exercise using comic strips (existing or student-made); a discussion of the treatment of the notion of "event" in different journalistic contexts; and an exercise in debating skills and language.…

  16. Fiches pratiques: Avec un poeme; Tour de force; Amour et humour; Les mots de la peinture (Practical Ideas: With a Poem; Tour de Force; Love and Humor; The Words of Painting).

    Science.gov (United States)

    Noe, Alfred; And Others

    1989-01-01

    Four French language classroom activities are suggested, including an exercise sensitizing students to the structure of poetry, a group of games centering on the Eiffel Tower, a series of activities exploring attitudes toward the Eiffel Tower, and a vocabulary and cultural awareness development exercise using the terminology of painting. (MSE)

  17. Att lära sig se trådraken – om tvekan och fokusförskjutning på väg mot förändrat kunnande

    Directory of Open Access Journals (Sweden)

    Marléne Johansson

    2017-05-01

    Full Text Available Utgångspunkten i denna artikel är empiriskt förankrade exempel från textilslöjdspraktiker i den svenska skolan; grundskolans slöjdundervisning årskurs 8 och ett specialutformat program inom gymnasieskolan med textil inriktning i årskurserna 1 och 3. Artikelns videoutdrag handlar alla om principiellt samma handling – trådrak mönsterutläggning på tyg – men, dels finns det två olika inramningar (grundskolan och gymnasieskolan, och dels exemplifierar de olika skeden av kunnande. Syftet är att beskriva skillnader i kunnande och vad som framstår som svårt för elever med liten eller ingen erfarenhet av att lägga ut mönster på ett tyg inför tillklippning och hur kunnandet förändras med ökande erfarenhet, liksom vilka nya svårigheter som följer med att elever arbetar med mönster av ökande komplexitet. Det som vid en första blick kan framstå som samma handling utvecklas över tid från något som framstår som enkel handling till att utvecklas i komplexitet. I de tvekan-situationer som beskriv finns potential för ett förändrat deltagande, där förändringen idealt är ett mer kompetent deltagande där ingen tvekan förekommer. Med ökad förtrogenhet kan uppmärksamheten förflyttas till något annat. Det vi är förtrogna med blir till rutiner och därmed behövs det en avvikelse för att fånga uppmärksamheten. I avvikelsen ligger möjligheterna till fortsatt lärande. Artikelns empiriska exempel synliggör dessa skillnader i kunnande som annars oreflekterat kan uppfattas som lika. Eleverna bygger in kunskap i sina handlingar, fokus flyttar från att inte veta vad man tittar på till självklarheten i handlingen. Eleverna lär sig se och urskilja.

  18. Fiches Pratiques: Mots...a croiser; Profitons du cinema; Le discours rapporte; Cent ans (Practical Ideas: Words...to Cross; Let's Take Advantage of the Movies; Relating Others' Discourse; One Hundred Years).

    Science.gov (United States)

    Vever, Daniel; And Others

    1991-01-01

    Four class activities for French language instruction are described, including a crossword puzzle exercise emphasizing French culture, use of films for developing a variety of language skills, techniques for helping students discuss others' ideas, and an exercise promoting discussion through photographs of older adults engaged in various…

  19. Oil and Gas in a New Arctic. Developments of the Energy Issue and Regional Strategic Dynamic; Olja och gas i ett nytt och foeraendrat Arktis. Energifraagans utveckling mot bakgrund av regionens strategiska dynamik

    Energy Technology Data Exchange (ETDEWEB)

    Granholm, Niklas; Kiesow, Ingolf

    2010-03-15

    This study has as its point of departure that large reserves of energy and minerals are deposited in the Arctic. There is uncertainty on how large these reserves are and if extraction of them is technically and economically feasible. As the Arctic gradually becomes more accessible as the melting of the sea-ice in the Arctic Ocean progresses, the region becomes more open to human activities than ever before. The energy issue in the Arctic develops against the background of the region's increasing geostrategic importance. Russia shows no hesitation, Norway also put considerable resources into energy extraction in the Arctic. Environ-mental protection is a more prominent issue in Norway, Canada and the USA than in Russia. In addition to the energy issue, other factors in the Arctic are also changing. Shipping, climate change, military strategy, nuclear weapons, overlapping territorial claims, developments in international security and national policies and efforts, are all parts of a development that does not easily let itself be described and analysed. The different factors under change develop according to their own character and inner logic and how they interact will be hard to foresee. Uncertainties of future developments in the Arctic therefore remain. The Arctic will become more clearly linked into developments in the rest of the world than hitherto. The region will no longer be exclusively an issue for the states in the region. The interest in the Arctic is on the increase, not only from the Arctic states, but also from external state actors in Europe and Asia, as well as multilateral organisations such as the European Union and NATO

  20. Forestal measures against climate change. Review and status after the Fourth Conference of the Parties of the Climate Convention; Skogtiltak mot klimaendringer. Oversikt og status etter fjerde partskonferanse til Klimakonvensjonen

    Energy Technology Data Exchange (ETDEWEB)

    Naess, Lars Otto

    1999-08-01

    The Kyoto Protocol of December 1997 opens up the possibility that forestal measures can be used to meet parts of the commitments of the industrialized countries to achieve a net reduction of emission of climate gases. The present report summarizes the issues involved in forestal measures that will mitigate global climate changes. The emphasis is on forestal measures in the climate negotiations and technical carbon binding potential. There is also a brief review of economic, environmental and social aspects. The next decades will be crucial to the many of the world`s forests. The forests contain a large part of the biological diversity. Above all this is true of tropical forests. But untouched areas in tempered and boreal areas are also experiencing various types of threats, including the effects of a possible global heating. It is a main conclusion that, in spite of many complex challenges, climate measures in the forests may play a constructive role both in counteracting global climate changes and in improving the management of the world`s forest resources. 89 refs., 3 figs., 7 tabs.

  1. Una aproximación a la realidad de las plataformas virtuales de las universidades españolas: el primer reto para una educación personalizada en personas con discapacidad motórica o visual

    OpenAIRE

    Gutiérrez Gómez-calcerrada, Sonia; Solera Hernández, Eva; García González, Juan Manuel

    2015-01-01

    The starting point to provide a university education-based custom environments online education to people with functional diversity must focus on ensuring the optimal accessibility to your web content and learning resources. At present, most of the universities now have virtual platforms of education, with an important weight for the correct development of their studies and for the optimization of learning of its students. On the other hand, the virtual environments pose a major access point ...

  2. Public service för oss, vi eller dem? : En intervjustudie om mångfaldscoachers uppfattningar om mångfald och strävan mot detsamma inom public service-bolagen.

    OpenAIRE

    Huhta, Helena

    2012-01-01

    The purpose of this study is to dig deeper into the perceptions regarding diversity - and the ambition to achieve increased such - among those who have participated in the Swedish Public Service diversity coach education. Furthermore, the aim is also to problematize, and increase the awareness of, different outlooks on diversity and its practical usage. All in all, ten so called “Zebra coaches” have been interviewed for this study. The empirical material has been analysed through a theoretica...

  3. Denní motýli v národních maloploškách: první poznatky z celostátní inventarizace

    Czech Academy of Sciences Publication Activity Database

    Beneš, Jiří; Konvička, Martin

    2006-01-01

    Roč. 61, č. 5 (2006), s. 145-150 ISSN 1210-258X R&D Projects: GA AV ČR KJB6007306 Institutional research plan: CEZ:AV0Z50070508 Keywords : butterflies in Czech Nature Reserves Subject RIV: EH - Ecology, Behaviour

  4. A green thread: five strategic principles that lead us to a sustainable energy system towards 2050; En groenn traad: fem strategiske prinsipper som leder oss til et baerekraftig energisystem mot 2050

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2011-07-01

    The overall goal for the world is to limit global warming to two degrees in 2050, which requires an emission level of maximum two tonnes per capita in 2050, assuming we start cutting emissions in time. The climate challenge can only be solved through a comprehensive adjustment of the energy system and a well-functioning energy system is required to achieve the climate targets. This also applies for Norway, as two-thirds of our greenhouse gas emissions are linked to energy use in the petroleum, industry, transport and heating sectors. At the same time, secure access to energy is a precondition for financial development, both in the least developed parts of the world and the western world. In the last 100 years, the development in the Norwegian economy has been very closely connected to the energy sector, first through development of industry based on utilisation of the hydropower resources, and subsequently through recovery of oil and gas on the Norwegian shelf. At the same time, the development within ICT has facilitated an increasingly service-based economy where electricity is a crucial input factor. Through electrification of society, the power system has become an increasingly important critical infrastructure on a par with telecommunications, water supply, the transport system, health services, etc. - perhaps the most important we have considering all the processes in society that directly depend on stabile access to electricity. If we are to achieve the two-degree target in 2050, we must immediately start cutting emissions globally to prevent the accumulated emissions from becoming too large. It will be cost efficient, in a global perspective, to start now. To a large degree, this also applies for Norway. Purchasing quotas can be used to a certain degree in the short term, but in the long term we must also cut the physical emissions here at home. The reason behind this is that we must have implemented most of the emission-reducing measures on a global basis by 2050, also in industrialised countries. Then there will be no surplus of cheap quotas and we must expect much higher quota prices than today. It we wait too long, there will also be very great implementation challenges when major emissions cuts are made in a short period, and Norwegian businesses will become less competitive and have less business opportunities due to inadequate adaptation at home. In this perspective, purchase of quotas is a payment extension and not a permanent solution. Norwegian climate policy up towards 2020, such as the Storting's (Norwegian Parliament's) climate agreement from 2008, is only a first step that must be followed up with further cuts at a steady pace towards 2050.There are many political and strategic challenges associated with the climate and energy policy. Adapting the energy systems will require extensive measures over a long period of time. However, we are not good at making decisions that are necessary in the long term, but uncomfortable in the short term. It is difficult to see consequences of decisions across sectors. This leads to policies being characterised by an inability to see the big picture. It is difficult to imagine what will happen towards 2050 because the world is dynamic and innovative. Inadequate strategies not only entail inadequate climate target achievements, but also a decline in value creation. The adaptation in Norway and internationally creates new business opportunities for energy companies, industrial companies and service suppliers both in the short and long term. It is therefore crucial for both the climate and our economic development that we manage to create good strategies within energy and climate.A green thread is a tool for long-term strategic choices that unite climate, energy and value creation. A green thread is based on two constants: The two-degree target must be achieved in 2050. This entails a requirement for a maximum of two tonnes of emissions per capita in the world and Norway.We must have a well-functioning energy system. A well-functioning energy system is characterised by always providing enough energy and capacity, utilising resources efficiently, harming the environment as little as possible and ensuring a relatively balanced development between production and consumption of energy and associated infrastructure.Based on these constants, we have formulated five strategic principles for development of the energy system. Action rule for climate: Emissions must be cut to achieve the two-tonne target in 2050, and not exceed the total permitted emissions towards 2050.Co2-neutral energy carriers: End users must have Co2-neutral energy carriers and Co2 must be removed from the production stage.Robust energy system: We must have a very high delivery reliability and very low vulnerability as regards interruptions to the access of energy.Balanced development: Production, consumption and infrastructure for transport of energy must be developed concurrently. Efficient resource utilisation: We must utilise the resources in the energy system as efficiently as possible. This entails minimising costs and environmental impact.Together, these five principles form a comprehensive framework for the development of the energy system within a framework of climate and value creation considerations. The principles fulfil several functions:Principle 1 - the action rule for greenhouse gas emissions is based on a corresponding mechanism for the revenue from the oil activities, but with one important difference: The rule is not based on a constant expected real return (or a flat development path), but a defined path for greenhouse gas emissions which decreases from the current level to a maximum of two tonnes per capita in 2050. Two tonnes is the maximum level in 2050 that is consistent with a global warming of two degrees, given the expected world population in 2050. It is not unlikely that the level must be even lower in Norway and the industrialised countries if the developing countries are to experience growth during the same period. We do not take a specific stance on the exact level for Norway's part - but it must be reduced to a maximum of two tonnes per capita in 2050. Around the two-tonne path the annual emissions can vary as long as the final target is achieved. In addition, the action rule entails a requirement for the total emissions towards 2050. As greenhouse gases remain in the atmosphere for a long time (depending on the type of greenhouse gas), the level in 2050 is not the only factor in achieving the target of a global warming maximum of two degrees. The action rule therefore also implies that that higher emissions than the linear two-tonne path in a period must be met with corresponding lower emissions than the two-tonne path in subsequent periods, so the restrictions on the total emissions over time are complied with.The action rule for climate ensures a gradual phasing out of the greenhouse gas emissions in accordance with a global two-tonne path, but also provides flexibility to use quota purchases to avoid unfortunate consequences for the global climate and Norwegian competitiveness due to carbon leaks. It also provides predictability regarding the value of emission-reducing measures for companies, individuals and authorities and thus contributes to a more efficient implementation of emission reductions in Norway.In a 2050 perspective, it is not a question of whether to cut emissions nationally, but how much to cut and when. There will not be a large global surplus of cheap Co2 quotas in 2050. By then, most measures must have been implemented if we are to achieve the two-degree target. If we start today, we need to cut a minimum of 40 million tonnes in 40 years in Norway, i.e. at least one million tonnes per year on average.Principle 2 - adaptation to Co2-neutral energy carriers because we are not familiar with development of technology that can provide small-scale Co2 handling for end users. Electricity will be the dominant energy carrier in the future because electricity can be produced and transported to the users in large volumes and over great distances on a completely different magnitude than the other Co2-neutral energy carriers. The requirement for a well-functioning electricity system will therefore be key in the development of the energy system towards 2050.Principle 3 - robustness is the energy system's ability to deliver energy and output instantaneously or over a short period of time (for example a winter season). In this context, robustness is closely related to the term security of supply, but is more limited in time. Security of supply also covers the long-term access to energy, cf. the principle regarding balanced development below. The principle generally applies nationally and locally, but can also be used in a larger geographic region such as Northwestern Europe.Principle 4 - balanced development refers to the fundamental relationship between production and consumption of energy over a longer period, as a minimum between seasons but also over several years. The principle thus deals with the physical access to energy relative to the demand in the long term, and differs from robustness through the time perspective. The principle can be used both nationally and for a larger region that is physically connected through the energy system (such as Northwestern Europe). A key element to achieve balanced development is well-functioning markets.Principle 5 - effective resource utilisation is a prerequisite for achieving targets associated with climate, energy and value creation at the same time. Effective resource utilisation entails the overall costs of various measures in the energy system (and measures in the energy system in general), both specific measures that contribute to emission reductions and general measures. The lowest possible costs free up resources for value creation in other sectors in the economy, both in the form of capital and labour, and minimize interventions in the environment.The five strategic principles are tools for a structured dialogue regarding climate, energy and value creation in various arenas. The principles can be used as a basis to formulate specific tests for various measures and instruments within climate and energy in practice. Measures and instruments that do not fulfill the tests must either be rejected or adjusted.(Author)

  5. Fiches pratiques: En deux temps, trois mouvements; Bonjour, la France; Mots-Valise; A l'heure des titres (Practical Ideas: In Two Tenses, Three Movements; Hello France; Suitcase-Words; Understanding Titles).

    Science.gov (United States)

    Camilleri, Clara; And Others

    1992-01-01

    Four activities for the French language classroom are described, including exploration of the relationships between the perfect, imperfect, and pluperfect tenses; an introductory French geography activity; vocabulary development through creation of new words; and exercises to enhance comprehension of the titles and subtitles of newspaper articles.…

  6. An introduction to Management of Technology pedagogy (andragogy)

    NARCIS (Netherlands)

    Berg, Dan; Mani, H.S.; Marinakis, Yorgos; Tierney, Robert; Tierney, Robert; Walsh, Steven Thomas

    2015-01-01

    In this introduction we leverage efforts of three professionals involved in the practice and use of MoT education. These professionals each discuss MoT from different perspectives. One is primarily interested in MoT pedagogy from a practitioner point of view. Another is a progenitor of the field.

  7. A comparison of pulsed and continuous atom transfer between two magneto-optical traps

    International Nuclear Information System (INIS)

    Ram, S. P.; Tiwari, S. K.; Mishra, S. R.

    2010-01-01

    We present the experimental results for a comparison between pulsed and continuous transfer of cold 87 Rb atoms between a vapor chamber magneto-optical trap (VC-MOT) and an ultra-high vacuum magneto-optical trap (UHV-MOT) when using a resonant push beam. We find that employing repetitive cycles of a pulsed and unfocused push beam on an unsaturated VC-MOT cloud results in a significantly higher number of atoms transferred to the UHV-MOT than the number obtained with a continuous push beam focused on a continuous VC-MOT. In pulsed transfer, we find that both the VC-MOT loading duration and the push beam duration play important roles in the transfer process and govern the number of atoms transferred to the UHV-MOT. The parameters and processes affecting the transfer have been investigated and are discussed.

  8. Continuous loading of cold atoms into a Ioffe-Pritchard magnetic trap

    International Nuclear Information System (INIS)

    Schmidt, Piet O; Hensler, Sven; Werner, Joerg; Binhammer, Thomas; Goerlitz, Axel; Pfau, Tilman

    2003-01-01

    We present a robust continuous optical loading scheme for a Ioffe-Pritchard (IP) type magnetic trap (MT). Chromium atoms are cooled and trapped in a modified magneto-optical trap (MOT) consisting of a conventional 2D-MOT in the radial direction and an axial molasses. The MOT and IP trap share the same magnetic field configuration. Continuous loading of atoms into the IP trap is provided by radiative leakage from the MOT to a metastable level which is magnetically trapped and decoupled from the MOT light. We are able to accumulate 30 times more atoms in the MT than in the MOT. The absolute number of 2 x 10 8 atoms is limited by inelastic collisions. A model based on rate equations shows good agreement with the data. Our scheme can also be applied to other atoms with similar level structure like alkaline earth metals

  9. Explicit solution of the time domain magnetic field integral equation using a predictor-corrector scheme

    KAUST Repository

    Ulku, Huseyin Arda; Bagci, Hakan; Michielssen, Eric

    2012-01-01

    An explicit yet stable marching-on-in-time (MOT) scheme for solving the time domain magnetic field integral equation (TD-MFIE) is presented. The stability of the explicit scheme is achieved via (i) accurate evaluation of the MOT matrix elements using closed form expressions and (ii) a PE(CE) m type linear multistep method for time marching. Numerical results demonstrate the accuracy and stability of the proposed explicit MOT-TD-MFIE solver. © 2012 IEEE.

  10. Myths about vocabulary acquisition

    NARCIS (Netherlands)

    Mondria, J.A.

    2007-01-01

    Vrai ou faux? Voilà la question. «Les listes de vocabulaire sont inutiles, parce qu’il faut toujours apprendre des mots en contexte, de préférence en déduisant le sens des mots à partir du contexte. De cette façon-là, les chances de retenir les mots sont optimales. Heureusement, il n’est pas

  11. Explicit solution of the time domain magnetic field integral equation using a predictor-corrector scheme

    KAUST Repository

    Ulku, Huseyin Arda

    2012-09-01

    An explicit yet stable marching-on-in-time (MOT) scheme for solving the time domain magnetic field integral equation (TD-MFIE) is presented. The stability of the explicit scheme is achieved via (i) accurate evaluation of the MOT matrix elements using closed form expressions and (ii) a PE(CE) m type linear multistep method for time marching. Numerical results demonstrate the accuracy and stability of the proposed explicit MOT-TD-MFIE solver. © 2012 IEEE.

  12. Marching on-in-time solution of the time domain magnetic field integral equation using a predictor-corrector scheme

    KAUST Repository

    Ulku, Huseyin Arda; Bagci, Hakan; Michielssen, Eric

    2013-01-01

    An explicit marching on-in-time (MOT) scheme for solving the time-domain magnetic field integral equation (TD-MFIE) is presented. The proposed MOT-TD-MFIE solver uses Rao-Wilton-Glisson basis functions for spatial discretization and a PE(CE)m-type linear multistep method for time marching. Unlike previous explicit MOT-TD-MFIE solvers, the time step size can be chosen as large as that of the implicit MOT-TD-MFIE solvers without adversely affecting accuracy or stability. An algebraic stability analysis demonstrates the stability of the proposed explicit solver; its accuracy and efficiency are established via numerical examples. © 1963-2012 IEEE.

  13. Marching on-in-time solution of the time domain magnetic field integral equation using a predictor-corrector scheme

    KAUST Repository

    Ulku, Huseyin Arda

    2013-08-01

    An explicit marching on-in-time (MOT) scheme for solving the time-domain magnetic field integral equation (TD-MFIE) is presented. The proposed MOT-TD-MFIE solver uses Rao-Wilton-Glisson basis functions for spatial discretization and a PE(CE)m-type linear multistep method for time marching. Unlike previous explicit MOT-TD-MFIE solvers, the time step size can be chosen as large as that of the implicit MOT-TD-MFIE solvers without adversely affecting accuracy or stability. An algebraic stability analysis demonstrates the stability of the proposed explicit solver; its accuracy and efficiency are established via numerical examples. © 1963-2012 IEEE.

  14. Simple atom trap in a conical hollow mirror: Numerical analysis

    International Nuclear Information System (INIS)

    Kim, J. A.; Lee, K. I.; Nha, H.; Noh, H. R.; Yoo, S. H.; Jhe, W

    1996-01-01

    We analyze the trap dynamic in a conical hollow (axicon) mirror system. Atom's trajectory is ring shaped if we move the coil (magnetic field) axis off the mirror axis and if we overlap these two axes trap cloud is ball shaped and it is consistent with experiment. We also make a simple comparison between 6-beam MOT and axicon MOT in the ball shaped case, and it shows that at low velocity limit the axicon MOT and typical 6-beam MOT have nearly same trap properties. The axicon trap may be useful as precooled atom source for many other atomic physics experiments such as cold atomic beam, atom funnel, and atom waveguide.

  15. Effect of Traınıng and Competence on Motıvatıon wıth Cultural Organızatıon as Medıatıon (Research of SMEs Entrepreneurs Women In East Java, Indonesia

    Directory of Open Access Journals (Sweden)

    Sri Eka Astutiningsih

    2016-04-01

    Full Text Available This study aim is to analyze the effect of training and competence on motivation of women entrepreneurs with mediation of organizational culture which has been rarely studied. This research will fill this gap by conducting research on women entrepreneurs in Indonesia. The uniqueness of this study is the first study to examine micro and small women entrepreneurs in East Java, Indonesia. The samples are 100 respondents. Data was collected by questionnaire that measured by 5-point Likert scale. The data obtained is  analyzedby path analysis with SPSS version 21 software.The results showed that the training and competence directly have positive and significant effects on organizational culture. The results also indicate that training, competencies and organizational culture directly have positive and significant effects on motivation of female entrepreneurs.The calculation of the indirect effect indicate that organizational culture mediates the effect of training and competence on motivation of female entrepreneurs

  16. Příběh vzácného motýla, který se stal na Šumavě obyčejným aneb co k životu potřebuje perleťovec mokřadní

    Czech Academy of Sciences Publication Activity Database

    Slámová, Irena; Vrba, Pavel; Konvička, Martin

    2012-01-01

    Roč. 2012, - (2012), s. 16-17 ISSN 0862-5166 R&D Projects: GA ČR GAP505/10/2248; GA ČR GAP505/10/2167; GA MŠk LC06073 Grant - others:Grantová agentura Jihočeské univerzity(CZ) GA JU 135/2010/P; Grantová agentura Jihočeské univerzity(CZ) 144/2010/P Institutional support: RVO:60077344 Keywords : Proclossiana eunomia

  17. Quyen Duoc Gan Bo. Mot bai giang ve tam quan trong cua khai niem ‘huong’ trong Phap luat So sanh ve Xu huong Tinh duc [The right to relate. On the importance of "orientation" in comparative sexual orientation law

    NARCIS (Netherlands)

    Waaldijk, C.

    2013-01-01

    The right to establish and develop relationships with other human beings was first articulated - as an aspect of the right to respect for private life - by the European Commission of Human Rights in 1976. Since then such a right has been recognized in similar words by national and international

  18. Nové a významné nálezy denních motýlů a vřetenuškovitých (Lepidoptera) na Valašsku (okres Vsetín, Česká republika)

    Czech Academy of Sciences Publication Activity Database

    Spitzer, Lukáš; Beneš, Jiří

    2010-01-01

    Roč. 1, - (2010), s. 19-39 ISSN 1804-2732 R&D Projects: GA MŠk LC06073; GA ČR GAP505/10/2167; GA MŽP SP/2D3/62/08 Grant - others:Muzeum regionu Valašsko, ČSOP(CZ) 120931; Muzeum regionu Valašsko, ČSOP(CZ) 01010608 Institutional research plan: CEZ:AV0Z50070508 Keywords : Central Europe * faunistics * Hesperiidae

  19. Reindeer (Rangifer tarandus tarandus feeding on lichens and mushrooms: traditional ecological knowledge among reindeer-herding Sami in northern Sweden

    Directory of Open Access Journals (Sweden)

    Berit Inga

    2009-01-01

    Full Text Available The study was performed in four reindeer-herding districts (Sami villages in northern Sweden. Reindeer herding Sami, born in 1950 or earlier, were interviewed about reindeer foraging behaviour on lichens and mushrooms, especially relating to non-summer grazing habits, and about characteristics of a good winter feeding ground. The informants claimed that lichens are preferably grazed in the wintertime, but that they also may be eaten in the summertime when the weather is cold and humid. Mushrooms were chosen in the autumn months August and September, but according to some informants mushrooms may also be eaten during late autumn (from Oct. when frozen and under the snow. The reindeer herders had different names for lichens, which in general terms describe their appearance and habitat. For mushrooms they only used one Sami name. Ground lichens preferred by reindeer are Cladonia species, while the nitrogen-fixing lichen species such as Nephroma arcticum and Stereocaulon pascale were said not to be preferred by the reindeer. Snow conditions are very important, and the less snow (and the softer it is, the better. Habitats where reindeer herders know from experience that snow conditions tend to be problematic, e.g. in moist and open areas with small trees, are used early in the winter (Oct.–Jan., before too much snow has accumulated. A good winter grazing area should have lichens. It is preferably a dry pine (Pinus sylvestris forest heath with large, old and wide-crowned trees to shelter the ground from snow and thereby ease the cratering by reindeer. Abstract in Swedish / Sammanfattning: Renens (Rangifer tarandus tarandus bete av lavar och svampar: Traditionell ekologisk kunskap bland renskötande samer i norra Sverige Studien genomfördes i fyra renskötseldistrikt (samebyar i norra Sverige. Totalt 22 renskötande samer, födda 1950 eller tidigare, blev intervjuade om renens betande av lavar och svampar, renens vinterbete och om vad som karakt

  20. Practical Considerations for Use of Mobile Apps at the Tactical Edge

    Science.gov (United States)

    2014-06-01

    supports and drives the diversity of apps available on the market, including support of the development and deployment of the apps, as well the...Face recognition, gesture-based inputs, speech recognition  Software engineering methods to address MOTS 19 MOTS Example: Samsung Evolution Kit TV 20 Replace modular box to upgrade TV

  1. A Bottom-up Trend in Research of Management of Technology

    Directory of Open Access Journals (Sweden)

    Yoko Ishino

    2014-12-01

    Full Text Available Management of Technology (MOT is defined as an academic discipline of management that enables organizations to manage their technological fundamentals to create competitive advantage. MOT covers a wide range of contents including administrative strategy, R&D management, manufacturing management, technology transfer, production control, marketing, accounting, finance, business ethics, and others. For each topic, researchers have conducted their MOT research at various levels. However, a practical and pragmatic side of MOT surely affects its research trends. Finding changes of MOT research trends, or the chronological transitions of principal subjects, can help understand the key concepts of current MOT. This paper studied a bottom-up trend in research fields in MOT by applying a text-mining method to the conference proceedings of IAMOT (International Association for Management of Technology. First, focusing on only nouns found several keywords, which more frequently emerge over time in the IAMOT proceedings. Then, expanding the scope into other parts of speech viewed the keywords in a natural context. Finally, it was found that the use of an important keyword has qualitatively and quantitatively extended over time. In conclusion, a bottom-up trend in MOT research was detected and the effects of the social situation on the trend were discussed.Keywords: Management of Technology; Text Mining; Research Trend; Bottom-up Trend; Patent

  2. Managing Technological Dynamics. A Transdisciplinary Perspective

    DEFF Research Database (Denmark)

    Drejer, Anders; Ulhøi, John Parm

    1998-01-01

    The authors of this paper represent different traditions and approaches to Management of Technology (MoT) and to Technology Studies (TS) at firm level. This offers an opportunity to develop a transdisciplinary perspective. MoT and TS, it is argued, can be addressed from rationalistic planning...

  3. Dynamics and applications of excited cold atoms

    NARCIS (Netherlands)

    Claessens, B.J.

    2006-01-01

    In a Magneto-Optical Trap (MOT), realized for the first time in 1987, one can trap and cool neutral atoms to temperatures below a mK. The invention of this device caused a revolution in atomic physics. With an MOT collision and spectroscopy experiments could be performed with unprecedented accuracy.

  4. Magneto-optical trap for metastable helium at 389 nm

    NARCIS (Netherlands)

    Koelemeij, J.C.J.; Stas, R.J.W.; Hogervorst, W.; Vassen, W.

    2003-01-01

    We have constructed a magneto-optical trap (MOT) for metastable triplet helium atoms utilizing the 2 S-3(1)-->3 P-3(2) line at 389 nm as the trapping and cooling transition. The far-red-detuned MOT (detuning Delta=-41 MHz) typically contains few times 10(7) atoms at a relatively high (similar

  5. An efficient explicit marching on in time solver for magnetic field volume integral equation

    KAUST Repository

    Sayed, Sadeed Bin; Ulku, H. Arda; Bagci, Hakan

    2015-01-01

    An efficient explicit marching on in time (MOT) scheme for solving the magnetic field volume integral equation is proposed. The MOT system is cast in the form of an ordinary differential equation and is integrated in time using a PE(CE)m multistep

  6. Generation of a cold pulsed beam of Rb atoms by transfer from a 3D magneto-optic trap

    Energy Technology Data Exchange (ETDEWEB)

    Chanu, Sapam Ranjita; Rathod, Ketan D.; Natarajan, Vasant, E-mail: vasant@physics.iisc.ernet.in

    2016-08-26

    We demonstrate a technique for producing a cold pulsed beam of atoms by transferring a cloud of atoms trapped in a three dimensional magneto-optic trap (MOT). The MOT is loaded by heating a getter source of Rb atoms. We show that it is advantageous to transfer with two beams (with a small angle between them) compared to a single beam, because the atoms stop interacting with the beams in the two-beam technique, which results in a Gaussian velocity distribution. The atoms are further cooled in optical molasses by turning off the MOT magnetic field before the transfer beams are turned on. - Highlights: • Getter-source loaded magneto-optic trap (MOT). • Cold atomic beam generated by deflection from the MOT. • Use of two inclined beams for deflection.

  7. High data rate atom interferometric device

    Science.gov (United States)

    Biedermann, Grant; McGuinness, Hayden James Evans; Rakholia, Akash

    2015-07-21

    A light-pulse atomic interferometry (LPAI) apparatus is provided. The LPAI apparatus comprises a vessel, two sets of magnetic coils configured to magnetically confine an atomic vapor in two respective magneto-optical traps (MOTs) within the vessel when activated, and an optical system configured to irradiate the atomic vapor within the vessel with laser radiation that, when suitably tuned, can launch atoms previously confined in each of the MOTs toward the other MOT. In embodiments, the magnetic coils are configured to produce a magnetic field that is non-zero at the midpoint between the traps. In embodiments, the time-of-flight of the launched atoms from one MOT to the other is 12 ms or less. In embodiments, the MOTs are situated approximately 36 mm apart. In embodiments, the apparatus is configured to activate the magnetic coils according to a particular temporal magnetic field gradient profile.

  8. Improved atom number with a dual color magneto—optical trap

    International Nuclear Information System (INIS)

    Cao Qiang; Luo Xin-Yu; Gao Kui-Yi; Wang Xiao-Rui; Wang Ru-Quan; Chen Dong-Min

    2012-01-01

    We demonstrate a novel dual color magneto—optical trap (MOT), which uses two sets of overlapping laser beams to cool and trap 87 Rb atoms. The volume of cold cloud in the dual color MOT is strongly dependent on the frequency difference of the laser beams and can be significantly larger than that in the normal MOT with single frequency MOT beams. Our experiment shows that the dual color MOT has the same loading rate as the normal MOT, but much longer loading time, leading to threefold increase in the number of trapped atoms. This indicates that the larger number is caused by reduced light induced loss. The dual color MOT is very useful in experiments where both high vacuum level and large atom number are required, such as single chamber quantum memory and Bose—Einstein condensation (BEC) experiments. Compared to the popular dark spontaneous-force optical trap (dark SPOT) technique, our approach is technically simpler and more suitable to low power laser systems. (rapid communication)

  9. Atomic fountain and applications

    International Nuclear Information System (INIS)

    Rawat, H.S.

    2000-01-01

    An overview of the development of working of MOT along with the basic principle of laser atom cooling and trapping is given. A technique to separate the cooled and trapped atoms from the MOT using atomic fountain technique will also be covered. The widely used technique for atomic fountain is, first to cool and trap the neutral atoms in MOT and then launch them in the vertical direction, using moving molasses technique. Using 133 Cs atomic fountain clock, time improvement of 2 to 3 order of magnitude over a conventional 133 Cs atomic clock has been observed

  10. Explicitar las posturas, los enfoques y las palabras: elementos para pensar la escritura de un artículo, desde la voz de evaluadores expertos (Stating opinions, approaches and words: items to think about while writing an article from expert reviewers' perspective (Rendre explicites les perspectives, les approches et les mots: des éléments pour penser l'écriture d'un article. La voix des évaluateurs experts

    Directory of Open Access Journals (Sweden)

    Mauricio Pérez-Abril.

    2010-12-01

    Full Text Available Este texto presenta algunos aspectos relacionados con las observaciones y reflexiones que los pares evaluado- res expertos elaboran al leer los artículos que se some- ten al proceso de revisión, previo a la publicación, por parte de nuestra revista magis. Los aspectos se derivan de un pequeño estudio: un análisis documental que estamos desarrollando, a partir de los conceptos en- viados por ellos. En total, estamos analizando los 268 conceptos cualitativos correspondientes a los cuatro primeros números (2008-2010, desde los diferentes componentes que constituyen un artículo. Los ejes de análisis se construyen a partir de la información presen- te en los conceptos. El estudio tiene como fin generar unas primeras reflexiones acerca de los elementos que los evaluadores tematizan y de los problemas más fre- cuentes, destacados por ellos. Este texto explora sólo lo relacionado con el componente epistemológico y metodológico. Nos interesa aportar orientaciones, en especial para quienes comienzan a escribir artículos para revistas especializadas.

  11. Untitled

    African Journals Online (AJOL)

    Keytvords: Nosocomial infections, epidemiology, multi-drug resistance, medicinal plant preparations. ... Mots clés : Infections nosocomiales, épidémiologie, Résistance aux antibiotiques, plantes médicinales. ..... (1987)- Statistique non.

  12. Protein (Cyanobacteria): 652997457 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available WP_027249923.1 ... 1117:7063 ... 1150:51701 1301283:72835 ... 54304:160 1160:1002 ... chem...otaxis protein MotB Planktothrix agardhii MSDLSELELETELQEEQDSGVYLSIGDLMSGLLMFFALLFITVMVQLNKTQDIIKRIPDEMFTTMQ

  13. Open problems in CEM: Porting an explicit time-domain volume-integral- equation solver on GPUs with OpenACC

    KAUST Repository

    Ergü l, Ö zgü r; Feki, Saber; Al-Jarro, Ahmed; Clo, Alain M.; Bagci, Hakan

    2014-01-01

    -level approach, utilizing the OpenACC directive-based parallel programming model, is used to minimize two often-faced challenges in GPU programming: developer productivity and code portability. The MOT-TDVIE solver code, originally developed for CPUs

  14. Mixed Discretization of the Time Domain MFIE at Low Frequencies

    KAUST Repository

    Ulku, Huseyin Arda; Bogaert, Ignace; Cools, Kristof; Andriulli, Francesco Paolo; Bagci, Hakan

    2017-01-01

    stems from the classical MOT scheme’s failure to predict the correct scaling of the current’s Helmholtz components for large time steps. A recently proposed mixed discretization strategy is used to alleviate the inaccuracy problem by restoring

  15. Construction of an apparatus for the magnetic capture of fermionic lithium atoms

    International Nuclear Information System (INIS)

    Jochim, S.

    2000-01-01

    This thesis reports on the construction of an apparatus for the magneto-optical trapping of the fermionic 6 Li-Isotope. This represents a first step towards experiments on the quantum degeneracy of dilute fermionic gases. The magneto-optical trap (MOT) will serve as a cold atom source for loading an optical trap. The apparatus consists of a laser system that excites the two 6 Li-D 2 -lines at 671 nm, an arrangement of coils generating the magnetic fields necessary to operate the MOT and a Zeeman slower, and a UHV-apparatus. The MOT is loaded from a thermal atomic beam. The Zeeman slower decelerates atoms with a velocity smaller than 600 m/s to about 40 m/s, so that they can be captured in the MOT. We expect to trap at least 10 8 atoms at a temperature of about 400 μK. (orig.)

  16. Integrering av flyktninger. De frivillige organisasjoners rolle

    OpenAIRE

    Hussein, Ali

    2017-01-01

    Denne oppgaven tar for seg de frivillige organisasjonene i Tromsø og integrasjon. Oppgaven retter søkelyset mot de frivillige organisasjoners integreringstiltak og hvorvidt dette kan være et supplement til det offentlige tilbudet.

  17. la lagune Aghien

    African Journals Online (AJOL)

    MTRAOREABOU

    21 déc. 2008 ... Mots-clés : lagune Aghien, métaux lourds, sources anthropiques, ... Keywords : Aghien lagoon, heavy metals, anthropic origin, factors of enrichment. 1. ...... elements in Kosovo: a source identification and apportionment study.

  18. Caracterisation de la qualite des eaux de I' oued Kebir Quest (Nord ...

    African Journals Online (AJOL)

    Mots cles : Kebir Ouest - Skikda - Bassin versant - Qualite - Pollution - Metaux lourds. Abstract .... approche servira au suivi de l 'evolution annuelle des concentrations des ..... Watershed Management: principles and practice. New York, Wiley ...

  19. Eesti-Läti orienteerumisliiga kaardistajate seminar Kanepis / koostanud Markus Puusepp

    Index Scriptorium Estoniae

    2010-01-01

    Projekti teisest kaardistajate seminarist, mis toimus 30.-31. oktoobril Põlvamaal Kanepis. Vaata ka http://spordilinn.blogspot.com/2010/11/eesti-vs-lati-moned-motted.html ja http://orienteerumine.ee/estlat/seminarid/

  20. Letter to the editors

    African Journals Online (AJOL)

    ebutamanya

    11 mai 2016 ... Mots clés: Cancer, new therapies, cost, public health ... targeted therapies in oncology made it possible to modify the natural history of some ... management as well as a broader poor patient's access to innovative medicines.

  1. Collisional Cooling of Light Ions by Cotrapped Heavy Atoms.

    Science.gov (United States)

    Dutta, Sourav; Sawant, Rahul; Rangwala, S A

    2017-03-17

    We experimentally demonstrate cooling of trapped ions by collisions with cotrapped, higher-mass neutral atoms. It is shown that the lighter ^{39}K^{+} ions, created by ionizing ^{39}K atoms in a magneto-optical trap (MOT), when trapped in an ion trap and subsequently allowed to cool by collisions with ultracold, heavier ^{85}Rb atoms in a MOT, exhibit a longer trap lifetime than without the localized ^{85}Rb MOT atoms. A similar cooling of trapped ^{85}Rb^{+} ions by ultracold ^{133}Cs atoms in a MOT is also demonstrated in a different experimental configuration to validate this mechanism of ion cooling by localized and centered ultracold neutral atoms. Our results suggest that the cooling of ions by localized cold atoms holds for any mass ratio, thereby enabling studies on a wider class of atom-ion systems irrespective of their masses.

  2. An efficient explicit marching on in time solver for magnetic field volume integral equation

    KAUST Repository

    Sayed, Sadeed Bin

    2015-07-25

    An efficient explicit marching on in time (MOT) scheme for solving the magnetic field volume integral equation is proposed. The MOT system is cast in the form of an ordinary differential equation and is integrated in time using a PE(CE)m multistep scheme. At each time step, a system with a Gram matrix is solved for the predicted/corrected field expansion coefficients. Depending on the type of spatial testing scheme Gram matrix is sparse or consists of blocks with only diagonal entries regardless of the time step size. Consequently, the resulting MOT scheme is more efficient than its implicit counterparts, which call for inversion of fuller matrix system at lower frequencies. Numerical results, which demonstrate the efficiency, accuracy, and stability of the proposed MOT scheme, are presented.

  3. The Ebola Virus and Human Rights Concerns in Africa

    African Journals Online (AJOL)

    AJRH Managing Editor

    2015-09-03

    Sep 3, 2015 ... Keywords: Ebola, Public Health, human right. Résumé ... Mots clé : Ebola, de santé publique, droit humain. Introduction ... public health and human rights. This article .... Political Rights (ICCPR)21 and the International.

  4. Fulltext PDF

    Indian Academy of Sciences (India)

    The second important development was the serendipitous discovery that, under the right conditions, laser cooling works much better than what is ... For example, our Rb MOT uses commercial diode lasers that are commonly used in CD.

  5. 75 FR 54682 - Self-Regulatory Organizations; International Securities Exchange, LLC; Notice of Filing and...

    Science.gov (United States)

    2010-09-08

    .... (``MOT''), Newmont Mining Corporation (``NEM''), NetFlix Inc. (``NFLX''), NVIDIA Corporation (``NVDA... (``QQQQ''), Bank of America Corporation (``BAC''), Citigroup, Inc. (``C''), Standard and Poor's Depositary..., Inc. (``AAPL''), General Electric Company (``GE''), JPMorgan Chase & Co. (``JPM''), Intel Corporation...

  6. Täidan, täidan laeva / Andres Maimik

    Index Scriptorium Estoniae

    Maimik, Andres, 1970-

    2001-01-01

    Eesti-saksa ühine teatriprojekt "Piraadid" : Von Krahli Teater & Showcase Beat Le Mot. Lavastajad Dariusz Kostyra, Florian Feigl, Nikolai Duric, Veit Sprenger ja Thorsten Eibeler. Etendused 22.-27. maini

  7. Von Krahl võõrustab sakslasi

    Index Scriptorium Estoniae

    2001-01-01

    Showcase Beat Le Mot, viiest mehest koosnev füüsilise teatri vallas tegutsev sõltumatu teatritrupp Saksamaalt Hamburgist mängib 6. mail Tallinnas Kanuti Gildi hoones oma tipplavastust "Burn Cities Burn"

  8. Plaat

    Index Scriptorium Estoniae

    2006-01-01

    Heliplaadid kauplustest Lasering: Beck "The Information", Enigma "A Posteriori", Kosmikud "Pulmad ja matused", And One "Bodypop", Uno Loop "Viimane suudlus - duetid aastatest 1964-1979", Motörhead "Kiss Of Death"

  9. Reflections on the fight agnaist the image of shamanism / Art Leete

    Index Scriptorium Estoniae

    Leete, Art, 1969

    2013-01-01

    Arvustus: Sundström, Olle. Kampen mot "schamanismen" : Sovjetisk religionspolitik gentemot inhemska religioner i Sibirien och norra Ryssland. Studier av inter-religiösa relationer 40. Uppsala: Universitetstryckeriet 2007

  10. Maintenance of Traffic for Innovative Geometric Design Work Zones

    Science.gov (United States)

    2015-12-01

    Currently there are no guidelines within the Manual on Uniform Traffic Control Devices (MUTCD) on construction phasing and maintenance of traffic (MOT) for retrofit construction and maintenance projects involving innovative geometric designs. The res...

  11. Etude de la faisabilite d'un composite a matrice cimentaire renforce ...

    African Journals Online (AJOL)

    Mots cles: Composite cimentaire - Mortier de fibres - Fibres de jute - Compatibilite chimique. Abstract ... potential use of jute fibers as reinforcing elements for mortars. The jute fiber ...... kenaf fiber reinforced concrete, Construction and Building.

  12. Activité antibactérienne des flavonoides d'une plante médicinale ...

    African Journals Online (AJOL)

    Mots clés : Activité antibactérienne - Flavonoïdes - Marrubium vulgare L. - Souches multirésistantes. ... Keywords: Antibacterial Activity - Flavonoids - Marrubium vulgare L. - Multiresistant strains. ..... antimicrobial activities of the essential oil of.

  13. Managing Innovation and Business Development Using Enterprise Architecture

    DEFF Research Database (Denmark)

    Tambo, Torben; Bækgaard, Lars

    2011-01-01

    technologies. In management of IT, it has become increasingly popular to use Enterprise Architecture (EA) as a method and supported by a series of formal frameworks. EA maps artifacts and motives against the business strategy. In this paper, MOT and EA are reviewed for their mutual potentials and issues. Two...... of well planned technological changes. Management of technology (MOT) addresses identification, selection, (long term) planning, designing, implementation and operation of technology based business development. Information Technology (IT) is a key enabler for a vast range of contemporary corporate...... case studies illustrate how enterprises can make major changes derived from business strategy observing both MOT and EA. This suggests a combined view inspired from the IT business’ dedication to EA using EA’s formalisms and the management orientation of MOT to improve understanding technological...

  14. AFRREV IJAH, Vol.1 (4) November, 2012

    African Journals Online (AJOL)

    First Lady

    de Pride and Prejudice de Jane Austen. On nřa trouvé aucun signe ni dans le dictionnaire bilingue ni sur lřinternet qui correspond au sens du mot. Nous avons décidé de faire une analyse exégétique de tous les mots de la langue dřarrivée qui nous surgissent à la mémoire, tels que: complicated, assimilated, inhibited ...

  15. Le traitement macrostructural de l'emprunt au français dans les ...

    African Journals Online (AJOL)

    «ciment, brique, … surfer (Internet), s'abonner, affecter. (être), nommer (être), etc. Nous allons nous intéresser précisément aux mots locaux qui ont été créés pour remplacer les mots empruntés. Les emprunts sont souvent spontanément et naturellement remplacés à long terme par les termes locaux lorsque les choses et ...

  16. Survey of practices around pharmaceutical company funding for continuing professional development among medical oncologists and trainees in Australia.

    Science.gov (United States)

    Lee, Yeh Chen; Kroon, René; Koczwara, Bogda; Haines, Ian; Francis, Kay; Millward, Michael; Kefford, Richard; Olver, Ian; Mileshkin, Linda

    2017-08-01

    The completion of continuing professional development (CPD) is mandatory for medical oncologists and trainees (MO&T). Pharmaceutical companies may fund some CPD activities, but there is increasing debate about the potential for conflicts of interest (COI). To assess current practices around funding to attend CPD activities. An electronic survey was distributed to Australian MO&T. The survey asked questions about current practices, institutional policies and perceptions about attending CPD funded by pharmaceutical companies. The design looked at comparing responses between MO&T as well as their understanding of and training around institutional and ethical process. A total of 157 of 653 (24%) responses was received, the majority from MO (76%). Most CPD activities attended by MO&T were self-funded (53%), followed by funding from institutions (19%), pharmaceutical companies (16%) and salary award (16%). Most institutions allowed MO&T to receive CPD funding from professional organisations (104/157, 66%) or pharmaceutical companies (90/157, 57%). A minority of respondents (13/157, 8%) reported that the process to use pharmaceutical funds had been considered by an ethics committee. Although 103/157 (66%) had received pharmaceutical funding for CPD, most (109/157, 69%) reported never receiving training about potential COI. The lack of education was more noticeable among trainees (odds ratio (OR) 8.61, P = 0.02). MO&T acknowledged the potential bias towards a pharmaceutical product (P = 0.05) but believed there was adequate separation between themselves and pharmaceutical companies (P < 0.01). Majority of CPD attended by MO&T is self-funded. There is lack of clarity in institutional policies regarding external funding support for CPD activities. Formal education about potential COI is lacking. © 2017 Royal Australasian College of Physicians.

  17. The Multiple Object Test as a Performance Based Tool to Assess Cognitive Driven Activity of Daily Living Function in Parkinson's Disease.

    Science.gov (United States)

    Glonnegger, Hannah; Beyle, Aline; Cerff, Bernhard; Gräber, Susanne; Csoti, Ilona; Berg, Daniela; Liepelt-Scarfone, Inga

    2016-07-06

    There is need for multidimensional quantitative assessment of cognitive driven activities of daily living (ADL) functions in Parkinson's disease (PD). To determine whether there is an ADL profile related to cognitive impairment in PD assessed by the Multiple Object Test (MOT). We assumed MOT performance to be lower in PD patients versus controls and in PD patients with more severe cognitive impairment. 50 PD patients with no cognitive impairment (PD-NC), 54 patients with PD-mild cognitive impairment (PD-MCI), 29 with Parkinson's disease dementia (PDD), and 40 healthy controls (HC) were investigated. Besides comprehensive cognitive testing, the MOT, a performance based test consisting of five routine tasks (e.g., preparing a cup of coffee), was applied. Quantitative (total errors and time) and qualitative (error type) MOT parameters were analyzed. Total time and number of MOT errors was increased in PD patients compared to controls (p < 0.001). These parameters also differentiated PDD patients from other cognitive groups (p < 0.05). No control subject had ≥ 4 errors in the MOT, but 30% of PD patients, especially PDD, scored above this cut-off. Omission (p < 0.001) and mislocation (p < 0.03) errors were more prominent in PDD than other cognitive groups. Perplexity errors did not differ between PD-MCI and PDD but between PD-NC and PDD (p = 0.01). MOT parameters discriminating between cognitive groups correlated mainly with lower test performance in psychomotor speed and executive function. Performance based testing is promising to identify quantitative and qualitative ADL aspects differentiating between different cognitive groups which might be helpful for an early detection of PDD.

  18. On the geodesic incompleteness of spacetimes containing marginally (outer) trapped surfaces

    International Nuclear Information System (INIS)

    Costa e Silva, I P

    2012-01-01

    In a recent paper, Eichmair et al (2012 arXiv:1204.0278v1) have proved a Gannon–Lee-type singularity theorem based on the existence of marginally outer trapped surfaces (MOTS) on noncompact initial data sets for globally hyperbolic spacetimes. A natural question is whether the corresponding incomplete geodesics could still be complete in a possible non-globally hyperbolic extension of spacetime. In this paper, some variants of their result are given with weaker causality assumptions, thus suggesting that the answer is generically negative, at least if the putative extension has no closed timelike curves. We consider first marginally trapped surfaces (MTS) in chronological spacetimes, introducing the natural notion of a generic MTS, a notion also applicable to MOTS. In particular, a Hawking–Penrose-type singularity theorem is proven in chronological spacetimes with dimension n ⩾ 3 containing a generic MTS. Such surfaces naturally arise as cross-sections of quasi-local generalizations of black hole horizons, such as dynamical and trapping horizons, and we discuss some natural conditions which ensure the existence of MTS in initial data sets. Nevertheless, much of the more recent literature has focused on MOTS rather than MTS as quasi-local substitutes for the description of black holes, as they are arguably more natural and easier to handle in a number of situations. It is therefore pertinent to ask to what extent one can deduce the existence of singularities in the presence of MOTS alone. We address this issue and show that singularities indeed arise in the presence of generic MOTS, but under slightly stronger causal conditions than those in the case of MTS (specifically, for causally simple spacetimes). On the other hand, we show that with additional conditions on the MOTS itself, namely that it is either the boundary of a compact spatial region, or strictly stable in a suitable sense, a Penrose–Hawking-type singularity theorem can still be established for

  19. Harrap's shorter dictionary English-French, French-English

    CERN Document Server

    2004-01-01

    Maîtrisez parfaitement l'Anglais et l'Américain modernes. Les évolutions les plus récentes du vocabulaire. 350 000 mots et expressions 600 000 traductions. Nouveau : des centaines de mots nouveaux issus des grands thèmes de l'actualité (altermondialisme, bioterrorisme, coparentalité, bibande...). Une couverture complète du vocabulaire technique et idiomatique des deux langues. Un traitement détaillé des variantes régionales (irlandaises, australiennes, québécoises, belges, etc.). Les sigles, abréviations et noms propres. De nombreuses aides à la traduction : nouveau, 400 entrées longues introduites par des menus pour accéder sans ambiguïté à la bonne traduction ; nouveau, des notes culturelles pour comprendre mots et expressions liés à la civilisation anglo-saxonne ; des centaines de notes d'usage pour éviter les pièges de la traduction : faux amis, mots difficiles à traduire... Des milliers d'exemples pour illustrer les différents sens des mots. L'indication des niveaux de langue : ...

  20. Le Petit Robert dictionnaire alphabétique et analogique de la langue française

    CERN Document Server

    Rey, Alain

    2014-01-01

    60 000 mots, 300 000 sens 35 000, citations. Retrouvez le français vivant, les mots et expressions d'aujourd'hui : astroparticule, biothèque, caméo, clivant, coltan, dim sum, fadette, itinérance, locavore, microbiote, modeux, street art, transgénérationnel ...Vérifiez l'usage de chaque mot : l'orthographe, la prononciation, les nuances de sens, les homonymes. Découvrez l'histoire des mots et leur étymologie Passez d'une idée à l'autre, allez du connu vers l'inconnu, en suivant les liens entre les mots : synonymes, analogies, contraires... Rencontrez les auteurs classiques et contemporains, par leurs citations : Olivier Adam, Emmanuel Carrère, Jean Echenoz, Annie Ernaux, Alice Ferney, Le Clézio, Carole Martinez, Patrick Modiano, Marie NDiaye, Amélie Nothomb, Daniel Pennac, Pascal Quignard, Michel Tournier, Michel Tremblay, Delphine de Vigan ... Voyagez dans la francophonie et partez à la découverte de ses richesses.

  1. A Stable Marching on-in-time Scheme for Solving the Time Domain Electric Field Volume Integral Equation on High-contrast Scatterers

    KAUST Repository

    Sayed, Sadeed Bin

    2015-05-05

    A time domain electric field volume integral equation (TD-EFVIE) solver is proposed for characterizing transient electromagnetic wave interactions on high-contrast dielectric scatterers. The TD-EFVIE is discretized using the Schaubert- Wilton-Glisson (SWG) and approximate prolate spherical wave (APSW) functions in space and time, respectively. The resulting system of equations can not be solved by a straightforward application of the marching on-in-time (MOT) scheme since the two-sided APSW interpolation functions require the knowledge of unknown “future” field samples during time marching. Causality of the MOT scheme is restored using an extrapolation technique that predicts the future samples from known “past” ones. Unlike the extrapolation techniques developed for MOT schemes that are used in solving time domain surface integral equations, this scheme trains the extrapolation coefficients using samples of exponentials with exponents on the complex frequency plane. This increases the stability of the MOT-TD-EFVIE solver significantly, since the temporal behavior of decaying and oscillating electromagnetic modes induced inside the scatterers is very accurately taken into account by this new extrapolation scheme. Numerical results demonstrate that the proposed MOT solver maintains its stability even when applied to analyzing wave interactions on high-contrast scatterers.

  2. CASA in invertebrates.

    Science.gov (United States)

    van der Horst, Gerhard; Bennett, Monique; Bishop, John D D

    2018-04-09

    Sperm movement has been described in several phyla of invertebrates. Yet, sperm motility has only been quantified using computer-aided sperm analysis (CASA-Mot) in externally fertilising species (broadcast spawners) of two phyla, molluscs and echinoderms. In the present study we quantified in detail the nature of the sperm tracks, percentage motility groupings and detailed kinematics of rapid-, medium- and slow-swimming spermatozoa in the oyster Crassostrea gigas and four species never previously studied by CASA-Mot, namely the molluscs Choromytilus meridionalis, Donax serra and Haliotis midae and the echinoderm Parechinus angulosus. A feature common to all these species are the helical tracks, the diameter of which seems to be species specific. Using CASA-Mot, the behaviour of spermatozoa was also studied over time and in the presence of egg water and Ca2+ modulators such as caffeine and procaine hydrochloride. For the first time, we show that hyperactivation can be induced in all species in the presence of egg water (sea water that was mixed with mature eggs and then centrifuged) and/or caffeine, and these hyperactivated sperm tracks were characterised using CASA-Mot. We relate the different patterns of sperm motility and behaviour to reproductive strategies such as broadcast spawning and spermcasting, and briefly review studies using CASA-Mot on other invertebrates.

  3. A Stable Marching on-in-time Scheme for Solving the Time Domain Electric Field Volume Integral Equation on High-contrast Scatterers

    KAUST Repository

    Sayed, Sadeed Bin; Ulku, Huseyin; Bagci, Hakan

    2015-01-01

    A time domain electric field volume integral equation (TD-EFVIE) solver is proposed for characterizing transient electromagnetic wave interactions on high-contrast dielectric scatterers. The TD-EFVIE is discretized using the Schaubert- Wilton-Glisson (SWG) and approximate prolate spherical wave (APSW) functions in space and time, respectively. The resulting system of equations can not be solved by a straightforward application of the marching on-in-time (MOT) scheme since the two-sided APSW interpolation functions require the knowledge of unknown “future” field samples during time marching. Causality of the MOT scheme is restored using an extrapolation technique that predicts the future samples from known “past” ones. Unlike the extrapolation techniques developed for MOT schemes that are used in solving time domain surface integral equations, this scheme trains the extrapolation coefficients using samples of exponentials with exponents on the complex frequency plane. This increases the stability of the MOT-TD-EFVIE solver significantly, since the temporal behavior of decaying and oscillating electromagnetic modes induced inside the scatterers is very accurately taken into account by this new extrapolation scheme. Numerical results demonstrate that the proposed MOT solver maintains its stability even when applied to analyzing wave interactions on high-contrast scatterers.

  4. Intense source of cold cesium atoms based on a two-dimensional magneto–optical trap with independent axial cooling and pushing

    International Nuclear Information System (INIS)

    Huang Jia-Qiang; Wu Chen-Fei; Wang Li-Jun; Yan Xue-Shu; Zhang Jian-Wei

    2016-01-01

    We report our studies on an intense source of cold cesium atoms based on a two-dimensional (2D) magneto–optical trap (MOT) with independent axial cooling and pushing. The new-designed source, proposed as 2D-HP MOT, uses hollow laser beams for axial cooling and a thin pushing laser beam to extract a cold atomic beam. With the independent pushing beam, the atomic flux can be substantially optimized. The total atomic flux maximum obtained in the 2D-HP MOT is 4.02 × 10 10 atoms/s, increased by 60 percent compared to the traditional 2D + MOT in our experiment. Moreover, with the pushing power 10 μW and detuning 0 Γ , the 2D-HP MOT can generate a rather intense atomic beam with the concomitant light shift suppressed by a factor of 20. The axial velocity distribution of the cold cesium beams centers at 6.8 m/s with an FMHW of about 2.8 m/s. The dependences of the atomic flux on the pushing power and detuning are studied in detail. The experimental results are in good agreement with the theoretical model. (paper)

  5. Testez vos connaissances en langue française

    CERN Document Server

    Bouvet, Stéphanie

    2009-01-01

    C'est bien connu, la langue française est riche, très riche. Le " petit " Larousse ne compte pas moins de 150 000 définitions ! Le problème, c'est qu'elle est même tellement riche que vous y perdez parfois votre latin. Avec Testez vos connaissances en langue française, vous allez pouvoir réviser vos classiques tout en découvrant des trésors bien cachés du lexique français : étymologies surprenantes, sens insoupçonné de mots régionaux ou d'argotismes, équivalences entre mots de niveau de langage différents, etc. Ludique et instructif, Testez vos connaissances en langue française est un voyage à travers l'histoire des mots et des usages.

  6. Genre.

    Directory of Open Access Journals (Sweden)

    Jacques Lévy

    2004-10-01

    Full Text Available Depuis quelques années, le mot « genre » tend à remplacer le mot « sexe » dans les sciences sociales francophones. Pour une part, ce changement est probablement plus justifié en anglais, pour lequel le mot «  sex  » renvoie plus exclusivement qu’en français à la sexualité ( to have sex = faire l’amour. L’engouement francophone s’explique cependant, pour l’essentiel, par la même motivation que celui des anglophones : montrer que les différences observées dans ...

  7. Myositis ossificans traumatica in young children: report of three cases and review of the literature

    International Nuclear Information System (INIS)

    Gindele, A.; Benz-Bohm, G.; Schwamborn, D.; Tsironis, K.

    2000-01-01

    Myositis ossificans traumatica (MOT) is a rare musculoskeletal disorder in young children. Clinical and imaging presentation in the early stage of disease makes it difficult to differentiate between infection and musculoskeletal neoplasms, particularly in the absence of a history of trauma. Three cases of MOT in children under the age of 10 years, two with inferential trauma, are presented and the findings on different imaging modalities are discussed with reference to the existing literature. While findings based on a single imaging technique, including MRI, may be rather non-specific and even misleading, the combination of different modalities can assist in the consideration of MOT as a possible diagnosis. For example, the demonstration of soft-tissue haematoma on US would suggest the traumatic origin. A rational imaging approach is proposed. (orig.)

  8. Myositis ossificans traumatica in young children: report of three cases and review of the literature

    Energy Technology Data Exchange (ETDEWEB)

    Gindele, A.; Benz-Bohm, G. [Department of Diagnostic Radiology, Pediatric Radiology, University of Cologne, Medical School, Kerpener Strasse 68, 50 924 Cologne (Germany); Schwamborn, D. [Paediatric Oncology, University Children' s Hospital, Cologne (Germany); Tsironis, K. [Department of Surgery, Leverkusen Hospital, Cologne (Germany)

    2000-07-01

    Myositis ossificans traumatica (MOT) is a rare musculoskeletal disorder in young children. Clinical and imaging presentation in the early stage of disease makes it difficult to differentiate between infection and musculoskeletal neoplasms, particularly in the absence of a history of trauma. Three cases of MOT in children under the age of 10 years, two with inferential trauma, are presented and the findings on different imaging modalities are discussed with reference to the existing literature. While findings based on a single imaging technique, including MRI, may be rather non-specific and even misleading, the combination of different modalities can assist in the consideration of MOT as a possible diagnosis. For example, the demonstration of soft-tissue haematoma on US would suggest the traumatic origin. A rational imaging approach is proposed. (orig.)

  9. Internet et la géographie

    Directory of Open Access Journals (Sweden)

    Denise Pumain

    1998-07-01

    Full Text Available Voici venir la saison du surf. .Trop souvent hélas, la navigation sur Internet se réduit à un flottement indécis, voire s'achève par la noyade! De très nombreux sites répondent au même mot-clé (par exemple, un seul moteur de recherche vous propose plus de 4000 sites à l'appel du mot "geography". Beaucoup n'ont en fait aucun rapport avec le sujet qui vous intéresse (on ne saurait reprocher à certains groupes de rock d'avoir jugé bon d'inclure le mot géographie dans leur intitulé et le conten...

  10. Technology Management

    DEFF Research Database (Denmark)

    Pilkington, Alan

    2014-01-01

    This paper reports a bibliometric analysis (co-citation network analysis) of 10 journals in the management of technology (MOT) field. As well as introducing various bibliometric ideas, network analysis tools identify and explore the concepts covered by the field and their inter-relationships. Spe......This paper reports a bibliometric analysis (co-citation network analysis) of 10 journals in the management of technology (MOT) field. As well as introducing various bibliometric ideas, network analysis tools identify and explore the concepts covered by the field and their inter......-relationships. Specific results from different levels of analysis show the different dimensions of technology management: • Co-word terms identify themes • Journal co-citation network: linking to other disciplines • Co-citation network show concentrations of themes The analysis shows that MOT has a bridging role...

  11. High data-rate atom interferometers through high recapture efficiency

    Science.gov (United States)

    Biedermann, Grant; Rakholia, Akash Vrijal; McGuinness, Hayden

    2015-01-27

    An inertial sensing system includes a magneto-optical trap (MOT) that traps atoms within a specified trapping region. The system also includes a cooling laser that cools the trapped atoms so that the atoms remain within the specified region for a specified amount of time. The system further includes a light-pulse atom interferometer (LPAI) that performs an interferometric interrogation of the atoms to determine phase changes in the atoms. The system includes a controller that controls the timing of MOT and cooling laser operations, and controls the timing of interferometric operations to substantially recapture the atoms in the specified trapping region. The system includes a processor that determines the amount inertial movement of the inertial sensing system based on the determined phase changes in the atoms. Also, a method of inertial sensing using this inertial sensing system includes recapture of atoms within the MOT following interferometric interrogation by the LPAI.

  12. Tapered optical fibers as tools for probing magneto-optical trap characteristics

    International Nuclear Information System (INIS)

    Morrissey, Michael J.; Deasy, Kieran; Wu Yuqiang; Nic Chormaic, Sile; Chakrabarti, Shrabana

    2009-01-01

    We present a novel technique for measuring the characteristics of a magneto-optical trap (MOT) for cold atoms by monitoring the spontaneous emission from trapped atoms coupled into the guided mode of a tapered optical nanofiber. We show that the nanofiber is highly sensitive to very small numbers of atoms close to its surface. The size and shape of the MOT, determined by translating the cold atom cloud across the tapered fiber, is in excellent agreement with measurements obtained using the conventional method of fluorescence imaging using a charge coupled device camera. The coupling of atomic fluorescence into the tapered fiber also allows us to monitor the loading and lifetime of the trap. The results are compared to those achieved by focusing the MOT fluorescence onto a photodiode and it was seen that the tapered fiber gives slightly longer loading and lifetime measurements due to the sensitivity of the fiber, even when very few atoms are present.

  13. Theoretical Perspectives of Enterprise Architecture for Technological Transformation

    DEFF Research Database (Denmark)

    Tambo, Torben

    2017-01-01

    The purpose of this article is to investigate the completeness of the theoretical foundations of Enterprise Architecture (EA) by reviewing four selected disciplines from Management of Technology (MOT). Often theory on EA is based on prior EA contributions or more distant contributions such as ser......The purpose of this article is to investigate the completeness of the theoretical foundations of Enterprise Architecture (EA) by reviewing four selected disciplines from Management of Technology (MOT). Often theory on EA is based on prior EA contributions or more distant contributions...... such as service science, semiotics, psycho-social constructs, business process analytics, and systems science. It is here argued that other theories might be more supportive to EA. The current article is based on a review of the MOT literature and a subsequent literature review within each of the four specialized...

  14. Effects of taurine supplementation on hepatic markers of inflammation and lipid metabolism in mothers and offspring in the setting of maternal obesity.

    Science.gov (United States)

    Li, Minglan; Reynolds, Clare M; Sloboda, Deborah M; Gray, Clint; Vickers, Mark H

    2013-01-01

    Maternal obesity is associated with obesity and metabolic disorders in offspring. However, intervention strategies to reverse or ameliorate the effects of maternal obesity on offspring health are limited. Following maternal undernutrition, taurine supplementation can improve outcomes in offspring, possibly via effects on glucose homeostasis and insulin secretion. The effects of taurine in mediating inflammatory processes as a protective mechanism has not been investigated. Further, the efficacy of taurine supplementation in the setting of maternal obesity is not known. Using a model of maternal obesity, we examined the effects of maternal taurine supplementation on outcomes related to inflammation and lipid metabolism in mothers and neonates. Time-mated Wistar rats were randomised to either: 1) control : control diet during pregnancy and lactation (CON); 2) CON supplemented with 1.5% taurine in drinking water (CT); 3) maternal obesogenic diet (high fat, high fructose) during pregnancy and lactation (MO); or 4) MO supplemented with taurine (MOT). Maternal and neonatal weights, plasma cytokines and hepatic gene expression were analysed. A MO diet resulted in maternal hyperinsulinemia and hyperleptinemia and increased plasma glucose, glutamate and TNF-α concentrations. Taurine normalised maternal plasma TNF-α and glutamate concentrations in MOT animals. Both MO and MOT mothers displayed evidence of fatty liver accompanied by alterations in key markers of hepatic lipid metabolism. MO neonates displayed a pro-inflammatory hepatic profile which was partially rescued in MOT offspring. Conversely, a pro-inflammatory phenotype was observed in MOT mothers suggesting a possible maternal trade-off to protect the neonate. Despite protective effects of taurine in MOT offspring, neonatal mortality was increased in CT neonates, indicating possible adverse effects of taurine in the setting of normal pregnancy. These data suggest that maternal taurine supplementation may

  15. A Time Marching Scheme for Solving Volume Integral Equations on Nonlinear Scatterers

    KAUST Repository

    Bagci, Hakan

    2015-01-01

    Transient electromagnetic field interactions on inhomogeneous penetrable scatterers can be analyzed by solving time domain volume integral equations (TDVIEs). TDVIEs are oftentimes solved using marchingon-in-time (MOT) schemes. Unlike finite difference and finite element schemes, MOT-TDVIE solvers require discretization of only the scatterers, do not call for artificial absorbing boundary conditions, and are more robust to numerical phase dispersion. On the other hand, their computational cost is high, they suffer from late-time instabilities, and their implicit nature makes incorporation of nonlinear constitutive relations more difficult. Development of plane-wave time-domain (PWTD) and FFT-based schemes has significantly reduced the computational cost of the MOT-TDVIE solvers. Additionally, latetime instability problem has been alleviated for all practical purposes with the development of accurate integration schemes and specially designed temporal basis functions. Addressing the third challenge is the topic of this presentation. I will talk about an explicit MOT scheme developed for solving the TDVIE on scatterers with nonlinear material properties. The proposed scheme separately discretizes the TDVIE and the nonlinear constitutive relation between electric field intensity and flux density. The unknown field intensity and flux density are expanded using half and full Schaubert-Wilton-Glisson (SWG) basis functions in space and polynomial temporal interpolators in time. The resulting coupled system of the discretized TDVIE and constitutive relation is integrated in time using an explicit P E(CE) m scheme to yield the unknown expansion coefficients. Explicitness of time marching allows for straightforward incorporation of the nonlinearity as a function evaluation on the right hand side of the coupled system of equations. Consequently, the resulting MOT scheme does not call for a Newton-like nonlinear solver. Numerical examples, which demonstrate the applicability

  16. A Time Marching Scheme for Solving Volume Integral Equations on Nonlinear Scatterers

    KAUST Repository

    Bagci, Hakan

    2015-01-07

    Transient electromagnetic field interactions on inhomogeneous penetrable scatterers can be analyzed by solving time domain volume integral equations (TDVIEs). TDVIEs are oftentimes solved using marchingon-in-time (MOT) schemes. Unlike finite difference and finite element schemes, MOT-TDVIE solvers require discretization of only the scatterers, do not call for artificial absorbing boundary conditions, and are more robust to numerical phase dispersion. On the other hand, their computational cost is high, they suffer from late-time instabilities, and their implicit nature makes incorporation of nonlinear constitutive relations more difficult. Development of plane-wave time-domain (PWTD) and FFT-based schemes has significantly reduced the computational cost of the MOT-TDVIE solvers. Additionally, latetime instability problem has been alleviated for all practical purposes with the development of accurate integration schemes and specially designed temporal basis functions. Addressing the third challenge is the topic of this presentation. I will talk about an explicit MOT scheme developed for solving the TDVIE on scatterers with nonlinear material properties. The proposed scheme separately discretizes the TDVIE and the nonlinear constitutive relation between electric field intensity and flux density. The unknown field intensity and flux density are expanded using half and full Schaubert-Wilton-Glisson (SWG) basis functions in space and polynomial temporal interpolators in time. The resulting coupled system of the discretized TDVIE and constitutive relation is integrated in time using an explicit P E(CE) m scheme to yield the unknown expansion coefficients. Explicitness of time marching allows for straightforward incorporation of the nonlinearity as a function evaluation on the right hand side of the coupled system of equations. Consequently, the resulting MOT scheme does not call for a Newton-like nonlinear solver. Numerical examples, which demonstrate the applicability

  17. Explicit solution of the time domain volume integral equation using a stable predictor-corrector scheme

    KAUST Repository

    Al Jarro, Ahmed; Salem, Mohamed; Bagci, Hakan; Benson, Trevor; Sewell, Phillip D.; Vuković, Ana

    2012-01-01

    An explicit marching-on-in-time (MOT) scheme for solving the time domain volume integral equation is presented. The proposed method achieves its stability by employing, at each time step, a corrector scheme, which updates/corrects fields computed by the explicit predictor scheme. The proposedmethod is computationally more efficient when compared to the existing filtering techniques used for the stabilization of explicit MOT schemes. Numerical results presented in this paper demonstrate that the proposed method maintains its stability even when applied to the analysis of electromagnetic wave interactions with electrically large structures meshed using approximately half a million discretization elements.

  18. Explicit solution of the time domain volume integral equation using a stable predictor-corrector scheme

    KAUST Repository

    Al Jarro, Ahmed

    2012-11-01

    An explicit marching-on-in-time (MOT) scheme for solving the time domain volume integral equation is presented. The proposed method achieves its stability by employing, at each time step, a corrector scheme, which updates/corrects fields computed by the explicit predictor scheme. The proposedmethod is computationally more efficient when compared to the existing filtering techniques used for the stabilization of explicit MOT schemes. Numerical results presented in this paper demonstrate that the proposed method maintains its stability even when applied to the analysis of electromagnetic wave interactions with electrically large structures meshed using approximately half a million discretization elements.

  19. Towards the mass production of slow, trappable molecules

    Science.gov (United States)

    McCarron, Daniel J.

    2018-05-01

    The Fast Track Communication by Petzold et al (2018 New J. Phys. 20 042001) demonstrates the first Zeeman slowing scheme for species with type-II optical cycling transitions. This new approach is directly applicable to those 2Σ molecules that have recently been captured and cooled in molecular magneto-optical traps (MOTs) and has the potential to efficiently and continuously load these traps for the first time. This advance could produce molecular MOTs with populations comparable to their atomic counterparts and realize an ideal platform for a wide range of studies using large, dense samples of ultracold molecules.

  20. Rechercher avec Google : quelques conseils

    OpenAIRE

    Ginouvès, Véronique

    2004-01-01

    Quoi de neuf ? (août 2006) : Toute la recherche Google sur une seule page : Le Googdesk : http://googdesk.com/ Google Trends Google Trends est un outil d'analyse de mots ou expressions clés, censé vous permettre de voir ce que le monde cherche ("See what the world is searching for''). Il compare et analyse dans un graphique l’usage et le comportement des mots clés dans le moteur sur deux années en arrière, et il spécifie cette utilisation par ville, pays et langue. http://www.google.com/tr...

  1. An atomic beam source for fast loading of a magneto-optical trap under high vacuum

    DEFF Research Database (Denmark)

    McDowall, P.D.; Hilliard, Andrew; Grünzweig, T.

    2012-01-01

    We report on a directional atomic beam created using an alkali metal dispenser and a nozzle. By applying a high current (15 A) pulse to the dispenser at room temperature we can rapidly heat it to a temperature at which it starts dispensing, avoiding the need for preheating. The atomic beam produced...... is capable of loading 90 of a magneto-optical trap (MOT) in less than 7 s while maintaining a low vacuum pressure of 10 -11 Torr. The transverse velocity components of the atomic beam are measured to be within typical capture velocities of a rubidium MOT. Finally, we show that the atomic beam can be turned...

  2. Marc Amfreville, Écrits en souffrance. Figures du trauma dans la littérature nord-américaine, Paris, Michel Houdiard, 2009

    Directory of Open Access Journals (Sweden)

    Nathalie Cochoy

    2010-10-01

    Full Text Available Seule une écriture infiniment attentive aux ombres des mots saurait en éclairer les blessures sans toutefois en exposer et en expliquer les intimes secrets. C’est ainsi avec une admirable alliance de sensibilité et de respect que Marc Amfreville aborde les « écrits en souffrance » de la littérature américaine — la manière dont les mots disent et taisent la douleur, en diffèrent la manifestation, mais aussi en dessinent les contours, comme dans un « champ » de recherche commun. Dans sa structu...

  3. Generation of 99-mW continuous-wave 285-nm radiation for magneto-optical trapping of Mg atoms

    DEFF Research Database (Denmark)

    Madsen, Dorte Nørgaard; Yu, Ping; Balslev, Søren

    2002-01-01

    We have developed a tunable intense narrow-band 285 nm light source based on frequency doubling of 570 nm light in BBO. At input powers of 840 mW (including 130 mW used for locking purposes) we generate 99 mW UV radiation with an intensity profile suitable for laser-cooling experiments. The light...... is used for laser cooling of neutral magnesium atoms in a magneto-optical trap (MOT). We capture about 5 x 10(6) atoms directly from a thermal beam and find that the major loss mechanism of the magnesium MOT is a near-resonant two-photon ionization process....

  4. Generation of a cold pulsed beam of Rb atoms by transfer from a 3D magneto-optic trap

    OpenAIRE

    Chanu, Sapam Ranjita; Rathod, Ketan D.; Natarajan, Vasant

    2016-01-01

    We demonstrate a technique for producing a cold pulsed beam of atoms by transferring a cloud of atoms trapped in a three dimensional magneto-optic trap (MOT). The MOT is loaded by heating a getter source of Rb atoms. We show that it is advantageous to transfer with two beams (with a small angle between them) compared to a single beam, because the atoms stop interacting with the beams in the two-beam technique, which results in a Gaussian velocity distribution. The atoms are further cooled in ...

  5. Use of Admission Criteria to Predict Performance of Students in an Entry-Level Master's Program on Fieldwork Placements and in Academic Courses.

    Science.gov (United States)

    Kirchner, G L; Stone, R G; Holm, M B

    2001-01-01

    The relationships among clinical outcomes, academic success, and predictors used to screen applicants for entrance into a Master in Occupational Therapy Program (MOT) were examined. The dependent variables were grade point average in occupational therapy courses (OT-GPA), client therapy outcomes at the clinic, and ratings of MOT students by Level II Fieldwork supervisors. Predictor variables included undergraduate GPA, scores on the Graduate Record Examination (GRE), and an essay. Both undergraduate GPA and scores on the GRE were found to predict OT-GPA. The analytical section of the GRE was also positively correlated with fieldwork supervisors' ratings of students.

  6. Mixed Discretization of the Time Domain MFIE at Low Frequencies

    KAUST Repository

    Ulku, Huseyin Arda

    2017-01-10

    Solution of the magnetic field integral equation (MFIE), which is obtained by the classical marching on-in-time (MOT) scheme, becomes inaccurate when the time step is large, i.e., under low-frequency excitation. It is shown here that the inaccuracy stems from the classical MOT scheme’s failure to predict the correct scaling of the current’s Helmholtz components for large time steps. A recently proposed mixed discretization strategy is used to alleviate the inaccuracy problem by restoring the correct scaling of the current’s Helmholtz components under low-frequency excitation.

  7. Caractérisation Physico-Chimique de l'Amande d'Hybride de ...

    African Journals Online (AJOL)

    utilisée en biscuiterie, pâtisserie et savonnerie comme le PB 121 ordinaire. Mots clés: Cocotier, hybride, vitroculture, amande, caractéristique. Abstract. Chemical and physical characterization of kernel from coconut hybrid PB 121 (Cocos nucifera L.) regenerated by in vitro culture at different storage duration and mature ...

  8. Boutiques d'alimentation turques et chypriotes dans le quartier Hackney de Londres

    OpenAIRE

    Rigoni , Isabelle

    2002-01-01

    Sur la gauche, une épicerie turque vendant des produits du Moyen-Orient ; sur la droite, une patisserie chypriote (le mot patisserie est écrit à la fois en turc et en grec). Un véhicule utilitaire garé mentionne un restaurant de tapas espagnol.

  9. Slik bør du trene hvis du har høyt blodtrykk

    DEFF Research Database (Denmark)

    Bjørkelund, Oline Anita

    2016-01-01

    Svært mange nordmenn lever med lavt eller høyt blodtrykk. Sistnevnte er et utbredt helseproblem i Norge, og Nasjonalforeningen for folkehelsen opplyser at over 100 000 nordmenn bruker medisiner mot det. Høyt blodtrykk er jo ingen sykdom i seg selv, men det krever at man må tenke gjennom vaner og ...

  10. (Glycine max L. (Merril) à l'apport des biomasses vertes de Tithonia ...

    African Journals Online (AJOL)

    SARAH

    30 mars 2013 ... des biomasses de Tithonia diversifolia (10143 kg /hectare) comme fertilisant constituerait un atout majeur pour l'accroissement des rendements du soja dans un contexte de dégradation des sols et de prix élevé des engrais minéraux. Mots clés : biomasse de Tithonia diversifolia, fumure organique, soja, ...

  11. AS_468_A4 OK

    African Journals Online (AJOL)

    AKA BOKO

    Mots-clés : zones volcaniques de Madagascar, minéraux, fertilisant. Abstract. Characterization chemical physico of the volcanic products of Madagascar for its agricultural use. The volcanic zones are reputed to be fertile and have a big agricultural potentiality. Of this fact, a lot of people use the volcanic soils as fertilizing.

  12. TRANSIENT EXPRESSION OF β-GLUCURONIDASE IN ...

    African Journals Online (AJOL)

    ACSS

    2014-08-28

    Aug 28, 2014 ... production des cultivars de résistance adaptée aux charançons de la patate douce. Mots Clés: Agrobacterium tumefaciens, β-glucuronidase, Ipomoea batatas. INTRODUCTION. Plant transformation through Agrobacterium species is the most commonly used system since the transferred DNA has minimal ...

  13. Gender, Succession and Dynastic Politics: The Saga of Senate and ...

    African Journals Online (AJOL)

    Similarly it depicts the multiple of feuds within the Lesotho Kingdom. Indeed the story provides many other glimpses into the period of Senate's life. In the process Motšoene, who was meant to weld the nation together, became instead a cruel victim of the chimeric social experiment by Moshoeshoe I, founder of the nation ...

  14. Performance de six cultivars de tomates Lycopersicon esculentum ...

    African Journals Online (AJOL)

    Administrateur

    mêmes sont plus performantes que la variété. Petomech. Mots clés : Performance, tomate, jaunisse en cuillère, flétrissement bactérien, nématodes, Côte d'Ivoire. Abstract. Performance of six cultivars of tomato Lycopersicon esculentum Mills. against ...

  15. A comparison of spontaneous combustion susceptibility of coal from ...

    African Journals Online (AJOL)

    Although the CPT of Onyeama coal and Owukpa coal is identical to each other as they are the sub-bituminous, Owukpa coal has a lower initial oxidation temperature (IOT) and maximum oxidation temperature (MOT) than those of Onyeama coal. This means that although each coal has the same rank and CPT, spontaneous ...

  16. Designing a Lighting Installation Through Virtual Reality Technology - The Brighter Brunnshög Case Study

    DEFF Research Database (Denmark)

    Kim, Boa; Xylakis, Emmanouil; Predescu, Andrei-Ducu

    2018-01-01

    This paper investigates how VR technology can support the process of designing light installations. Specifically, how visual immersion through digital means can create spatial awareness of an area, without the need of physical presence, thus facilitating the fluency of the design process. The mot...

  17. Laboratory evaluation of four medicinal plants as protectants against ...

    African Journals Online (AJOL)

    The petroleum ether extract of four medicinal plants; Aristolochia ringens (Vahl), Allium sativum (L), Ficus exasperata (L) and Garcinia kola (H), were evaluated as grain protectant against the maize weevil, Sitophilus zeamais (Mots) in the laboratory at 0.5, 1.0 and 1.5% (w/v) concentrations. Parameters assessed were adult ...

  18. Hybrid MPI/OpenMP parallelization of the explicit Volterra integral equation solver for multi-core computer architectures

    KAUST Repository

    Al Jarro, Ahmed; Bagci, Hakan

    2011-01-01

    A hybrid MPI/OpenMP scheme for efficiently parallelizing the explicit marching-on-in-time (MOT)-based solution of the time-domain volume (Volterra) integral equation (TD-VIE) is presented. The proposed scheme equally distributes tested field values

  19. Contamination métallique de l'eau et du sédiment d'Oued Bouhamra ...

    African Journals Online (AJOL)

    d'identifier les origines industrielle, agricole et domestique de cette pollution. Mots-clés : éléments traces métalliques- rejets urbains en mer – eau superficielle – sédiment - Golfe d'Annaba. Abstract ...... thermique des déchets). Ed. TEC & DOC ...

  20. Case report

    African Journals Online (AJOL)

    abp

    un cas. Rev Chir Orthop Reparatrice. Appar Mot. 2000;86(1):98-103. PubMed | Google Scholar. 7. Nagamine N, Nohara Y, Ito E. Elastofibroma in Okinawa. A clinicopathologic study of 170 cases. Cancer. 1982;50(9):1794-.

  1. Algorithmic Issues in Modeling Motion

    DEFF Research Database (Denmark)

    Agarwal, P. K; Guibas, L. J; Edelsbrunner, H.

    2003-01-01

    This article is a survey of research areas in which motion plays a pivotal role. The aim of the article is to review current approaches to modeling motion together with related data structures and algorithms, and to summarize the challenges that lie ahead in producing a more unified theory of mot...

  2. Effets des extraits ou de la poudre de Spirulina platensis et Jatropha ...

    African Journals Online (AJOL)

    SARAH

    30 juin 2015 ... générale, les extraits ou la poudre de Spirulina platensis ont eu des ... Mots clés: Biostimulant, croissance, Spirulina platensis, Jatropha curcas, Solanum lycopersicum .... Le test de ..... in antioxidant metabolites, enzymes, and.

  3. Page 1 Rev. Sci. Technol., Synthese 26: 57 - 64 (2013) D. Ali ...

    African Journals Online (AJOL)

    Une augmentation de la teneur en proline est observee dans les plantes traitees ou non par !'hormone la kinetine. Mots cles: ... hormone in plants under stress induced a proportional increase in chlorophyll (a) and (b) with the concentration of used salt. ..... grains and vegetables, Agronomy Journal, Vol. 66,. 412-421.

  4. Eesti europiraadid Saksamaal / Juhan Ulfsak ; interv. Esme Kassak

    Index Scriptorium Estoniae

    Ulfsak, Juhan, 1973-

    2006-01-01

    Von Krahli Teatri ja Saksa teatri Showcase Beat Le Mot koostöös esietendus 17. mail Düsseldorfis "Europiraadid". Eesti poolel kaasategev Juhan Ulfsak räägib koostööst Saksa trupiga ja sellest, mis teemasid lavastus puudutab

  5. Sakslased tulevad! Ärevad ajad Tallinnas Von Krahli Teatris

    Index Scriptorium Estoniae

    2001-01-01

    Von Krahli Teater ja Showcase Beat Le Mot valmistuvad oma esimeseks koostööprojektiks - lavastuseks "Pirates", kus osalevad mõlema teatri näitlejad ja tehnikud. Ühisprojekti toetavad Goethe Instituut, Hamburgi Linnavalitsus ja Eesti Kultuurkapital

  6. Exécution de penalties et de tirs au but au football : maîtrise ...

    African Journals Online (AJOL)

    Mots clés : Penalty, émotion, habileté technique, tireur, gardien de but. English Abstract Football games sometimes end by penalty shoot-out sessions. During these faces to faces between penalty takers and goalkeepers each of the protagonists attempts to guess the intentions of the other to defeat him and win the duel.

  7. Optimization of transfer of laser-cooled atom cloud to a quadrupole ...

    Indian Academy of Sciences (India)

    2014-02-08

    Feb 8, 2014 ... Laser Physics Applications Section, Raja Ramanna Centre for Advanced Technology,. Indore 452 013 ... Laser cooling; optical molasses; double-MOT; magnetic trapping; phase-space density. PACS Nos 52.55. ... this method, the transfer of laser-cooled atom cloud to magnetic trap is an important step,.

  8. Word Frequencies in Written and Spoken English

    African Journals Online (AJOL)

    R.B. Ruthven

    data of the corpus and includes more formal audio material (lectures, TV and ... meticulous word-class tagging of nouns, adjectives, verbs etc., this book is not limited to word ... Fréquences d'utilisation des mots en français écrit contemporain.

  9. The Meaning of the Child Interview: A new procedure for assessing and understanding parent-child relationships of 'at-risk' families.

    Science.gov (United States)

    Grey, Ben; Farnfield, Steve

    2017-04-01

    Reder and Duncan's well-known studies of the 1990s on fatal child abuse drew attention to how parental scripts regarding their children could dangerously distort relationships in ways that were sometimes fatal to children. This article reports on a new system for assessing the 'meaning of the child to the parent', called the Meaning of the Child Interview (MotC). Parents are interviewed using the established Parent Development Interview, or equivalent, and the transcript of the interview is then analysed according to parental sensitivity and likely risk to the child. The MotC constructs were developed from those used in observed parent-child interaction (specifically, the CARE-Index) and the form of discourse analysis used in the Dynamic Maturational Model - Adult Attachment Interview, allowing a more systemic and inter-subjective understanding of parenting representations than often put forward. This article discusses the theoretical background to the MotC, gives a brief review of similar measures and then introduces the coding system and patterns of caregiving. The validity of the MotC is addressed elsewhere.

  10. Premier isolement de Stephanoascus ciferrii dans des infections ...

    African Journals Online (AJOL)

    Il faut garder à l'esprit que des pathogènes inhabituels peuvent causer ces infections vaginales. Mots clés : Stephanoascus ciferrii, Vitek 2, candidose vaginale. ABSTRACT. Introduction: Fungal infections know an extraordinary expansion with therapeutic progress and apparition of immunodepressive diseases such as HIV.

  11. AMELIORATON GENETIQUE DE Coffea canephora Pierre PAR ...

    African Journals Online (AJOL)

    AISA

    Mots clés : Café, descendance, robusta, C. canephora, congusta, Côte d'Ivoire. ABSTRACT. GENETIC BREEDING OF coffea canephoraPierre BY INTERSPECIFIC HYBRIDIZATION : STUDY OF FIRST GENERATION. HYBRIDES OF coffea cannephoraPierre X coffea congensis Froenhner. Coffee represents one of the most ...

  12. Explicit solution of Calderon preconditioned time domain integral equations

    KAUST Repository

    Ulku, Huseyin Arda; Bagci, Hakan; Michielssen, Eric

    2013-01-01

    operators and a PE(CE)m type linear multistep to march on in time. Unlike its implicit counterpart, the proposed explicit solver requires the solution of an MOT system with a Gram matrix that is sparse and well-conditioned independent of the time step size

  13. Estimates of Water Ingestion for Women in Pregnant, Lactating and Non-Pregnant and Non-Lactating Child Bearing Age Groups Based on USDA's 1994-96, 1998 Continuing Survey of Food Intake by Individuals (Journal Article)

    Science.gov (United States)

    Women in the child bearing age of 15 to 44 years and, in particular, pregnant and lactating women in this age cohort are considered a sensitive subpopulation when assessing risk from ingestion of contaminated water because ingested contaminants may pose a risk not only to the mot...

  14. Que reste-t-il à découvrir?

    CERN Multimedia

    Bonneau, Cécile; Grousson, Mathieu; Pajot, Philippe

    2007-01-01

    What is the nature of the black matter? And the one of the dark energy? and antimatter? Extraterrestrial life? All these questions, and some others, put today the physicians at the challenge. Because it's the last enigma of the Universe and the matter. But also because they threaten the mots fundamental certainties of the physics. Should we thus talk of crisis? (13 pages)

  15. Etude numérique de la convection naturelle dans une enceinte ...

    African Journals Online (AJOL)

    Mots-clés: convection naturelle, chaos, méthode de Lattice Boltzmann, methode des différences finies. Numerical Study of natural convection in an inclined enclosure. Lattice Boltzmann Method (LBM ) , Finite Difference Explicit ( DFE ) , Hybrid combines the two previous methods and Finite Elements (FE) are used to study ...

  16. Justice organisationnelle perçue des pratiques de gestion des ...

    African Journals Online (AJOL)

    Mots clés : Pratiques de GRH, Justice organisationnelle perçue, Engagement organisationnel. ABSTRACT. This study aims at measuring the mediator effect of the organizational justice perceived in the relation between the practices of human stock management and the organizational commitment of the employees.

  17. L'adoption des produits cosmétiques par les consommateurs ...

    African Journals Online (AJOL)

    Mots clés : adoption des produits cosmétiques, consommateurs, perception de la ... Keywords: adoption of cosmetics, consumers, perception of novelty, methods of ...... Bauer R (1960), Consumer Behavior as Risk Taking Dynamic Marketing for a changing ... via job mobility, Journal of economic Behaviour and Organization, ...

  18. Using complaints to enhance quality improvement: developing an analytical tool.

    Science.gov (United States)

    Hsieh, Sophie Yahui

    2012-01-01

    This study aims to construct an instrument for identifying certain attributes or capabilities that might enable healthcare staff to use complaints to improve service quality. PubMed and ProQuest were searched, which in turn expanded access to other literature. Three paramount dimensions emerged for healthcare quality management systems: managerial, operational, and technical (MOT). The paper reveals that the managerial dimension relates to quality improvement program infrastructure. It contains strategy, structure, leadership, people and culture. The operational dimension relates to implementation processes: organizational changes and barriers when using complaints to enhance quality. The technical dimension emphasizes the skills, techniques or information systems required to achieve successfully continuous quality improvement. The MOT model was developed by drawing from the relevant literature. However, individuals have different training, interests and experiences and, therefore, there will be variance between researchers when generating the MOT model. The MOT components can be the guidelines for examining whether patient complaints are used to improve service quality. However, the model needs testing and validating by conducting further research before becoming a theory. Empirical studies on patient complaints did not identify any analytical tool that could be used to explore how complaints can drive quality improvement. This study developed an instrument for identifying certain attributes or capabilities that might enable healthcare professionals to use complaints and improve service quality.

  19. Mesure de la vitesse d'infiltration des eaux dans le sol : Cas des sols ...

    African Journals Online (AJOL)

    SARAH

    30 avr. 2016 ... Pour ceux, il est nécessaire d'opter pour une agriculture moderne ... à une telle agriculture. Mots clés : mesure, vitesse, infiltration, sols, pollutions, eau, Niari, Congo .... une porosité tubulaire d'origine biologique. Toutes ces.

  20. Étude hydrochimique et microbiologique des eaux de source de l ...

    African Journals Online (AJOL)

    SARAH

    30 mars 2013 ... Mot clés : Assainissement, eaux de source, pollution, Hydrochimie, Environnement, Éléments Traces. Métalliques. ..... Demande Biologique en Oxygène sur 5 jours (DBO5), la ..... La région étant une zone forestière agricole,.

  1. 113 Étude de la qualité des eaux épurées par le lagunage naturel ...

    African Journals Online (AJOL)

    sam

    Mots-clés : lagunage naturel, performances, eaux usées, Algérie. Abstract ... domaine de l'irrigation agricole. Le ratio entre les ... traitement biologique : Cette filière est composée de six bassins, qui sont réparties suivant trois étages : • .

  2. Influence de l'activité des termites sur les propriétés du sol dans la ...

    African Journals Online (AJOL)

    SARAH

    30 sept. 2016 ... Mots Clés : Fertilité, sol dégradé, termites, infiltration de l'eau, matière organique, Lamto, Côte d'Ivoire. ABSTRACT ... des cultures et à la bonne production agricole se ..... et un début de dégradation chimique, biologique et.

  3. Case series

    African Journals Online (AJOL)

    abp

    4 déc. 2017 ... &Corresponding author: Meriem Elbachiri, Centre Mohamed VI pour le Traitement Des Cancers, Casablanca, Maroc. Mots clés: Homme, cancer du ... Abstract. Breast cancer in men is rare, accounting for approximately 1% of all breast cancers and less than 1% of all neoplasias in men. This study aimed to.

  4. High-flux cold rubidium atomic beam for strongly-coupled cavity QED

    Energy Technology Data Exchange (ETDEWEB)

    Roy, Basudev [Indian Institute of Science Education and Research, Kolkata (India); University of Maryland, MD (United States); Scholten, Michael [University of Maryland, MD (United States)

    2012-08-15

    This paper presents a setup capable of producing a high-flux continuous beam of cold rubidium atoms for cavity quantum electrodynamics experiments in the region of strong coupling. A 2D{sup +} magneto-optical trap (MOT), loaded with rubidium getters in a dry-film-coated vapor cell, fed a secondary moving-molasses MOT (MM-MOT) at a rate greater than 2 x 10{sup 10} atoms/s. The MM-MOT provided a continuous beam with a tunable velocity. This beam was then directed through the waist of a cavity with a length of 280 μm, resulting in a vacuum Rabi splitting of more than ±10 MHz. The presence of a sufficient number of atoms in the cavity mode also enabled splitting in the polarization perpendicular to the input. The cavity was in the strong coupling region, with an atom-photon dipole coupling coefficient g of 7 MHz, a cavity mode decay rate κ of 3 MHz, and a spontaneous emission decay rate γ of 6 MHz.

  5. Etude des proprietes antioxydantes d'un extrait d'ecorces d ...

    African Journals Online (AJOL)

    acide ascorbique. Ces résultats suggèrent une activité ... Ces résultats peuvent constituer un apport réel dans la recherche de molécules bioactives, pouvant prévenir ou traiter des pathologies liées au stress oxydatifs. Mots clés : Anacardium ...

  6. Lithiases vésicales géantes: A propos de 2 cas

    African Journals Online (AJOL)

    S. Ouedraogo

    Disponible sur Internet le 27 octobre 2016. MOTS CLÉS .... Il n'y pas eu de récidive au bout de 14 mois. ... Le patient a eu recours à la médecine traditionnelle, utilisant des .... Mamadou T. TRAORE: a participé à la recherche documentaire.

  7. Intérêt pronostique de l'infiltration du chorion dans les tumeurs ...

    African Journals Online (AJOL)

    W. Zakhama

    Disponible sur Internet le 27 octobre 2016. MOTS CLÉS tumeur vésicale; survie; .... ont eu une récidive précoce (inférieur à 6 mois). La récidive n'était ... recherche de nouvelles sous classification dans le but de trouver de nouveaux facteurs ...

  8. Metastases cerebrales d'un cancer de l'endometre: a propos d'une ...

    African Journals Online (AJOL)

    Mots clés: cancer, endomètre, métastases, cerveau, Lomé, Togo. English Title: Brain metastases of endometrial cancer: an observation at Lome and literature review. English Abstract. Introduction: document the clinical, paraclinical, therapeutic and prognostic of brain metastases of endometrial cancer in hospital in Togo.

  9. The motivational landscape of first-person shooter games

    OpenAIRE

    Finnerman, T. (Tomi); Kuoppala, A. (Antti)

    2014-01-01

    Abstract The purpose of this research was to gain better understanding of the motivations to play video games, particularly first-person shooter games. The aim was therefore to produce a motivational landscape that describes and categorizes the main motivations to play first-person shooter games (FPS). The study tries to expand the understanding of mot...

  10. African Journal of Neurological Sciences - 2009 Vol. 28 No 1

    African Journals Online (AJOL)

    Mots clés : Arbre, Accident, Chute, Mali, Rachis, Traumatisme ... Les chutes du haut d'un arbre sont des accidents graves et fréquents au MALI. ..... s'agir de traumatismes crâniens dans 39% des cas, de lésions musculo-squelettiques dans ...

  11. African Journal of Neurological Sciences 2010 - Vol. 29, No 1 25

    African Journals Online (AJOL)

    kim

    Mots-clés: Traumatisme crânio-encéphalique, Accident de la circulation, Epidémiologie. Keywords: ... and severe in 171 (22.7%) for all cases. TBI was lone in 135 ..... patient traumatisé crânien suite à un accident de la circulation. Figure 4 ...

  12. 2530-IJBCS-Article-Alain S A Ambe

    African Journals Online (AJOL)

    hp

    2015 International Formulae Group. All rights ... Mots clés: Mode de préparation, Candida albicans, cytotoxicité, Cellules HFF ; Enantia polycarpa. ... marché et utilisées en thérapeutique ont perdu ...... Manque d'Accès aux Médicaments.

  13. La politique intellectuelle de Mvemba N'zinga (Dom Afonso 1er ...

    African Journals Online (AJOL)

    Le Kongo venait de rater un grand rendez-vous avec l'histoire. Mots-Clés: enseignement; élite intellectuelle; Bakongo; Mvemba N'zinga; Mbanza Kongo; Lisbonne; Mani Kongo Summary Taking advantage of the opportunities that he offered to the Portuguese monarch - consignment of missionaries, study of the young " ...

  14. Étude ethnobotanique, phytochimique et écotoxicologique de ...

    African Journals Online (AJOL)

    ... Plante Médicinale a caractère de Légumes feuilles, gage de bonne santé et de Développement Durable. Mots clés: Ocimum gratissimum ; Légume feuille ; Plante médicinale ; Ethnobotanique ; Cotonou ; Bénin. English Abstract. Objective: The use of Ocimum gratissimum Lamiaceae (African Basil) is widespread in Benin.

  15. adaptation et selection de varietes performantes de riz pluvi

    African Journals Online (AJOL)

    PROJET SOJA

    Mots- clés : Résistivité, phosphates, filtrage, contours, Sidi Chennane, Maroc. .... Toutes les formations reposent par discordance sur les schistes et les .... L'image de départ I(x,y) n'étant pas une fonction continue mais discrète à cause de la.

  16. Cancer de la Vessie au Togo : Aspects Diagnostiques Et ...

    African Journals Online (AJOL)

    Mots clés : cancer de la vessie, diagnostic, traitement ;. ABSTRACT. Cancer of the Bladder in Togo. Clinical and Management Aspects at the Teaching Hospital of Sylvanus Olympio. Objective: to describe the clinical and management features in patients followed for bladder cancer at the teaching hospital of Sylvanus ...

  17. Évolution qualitative et quantitative des composantes de l'œuf ...

    African Journals Online (AJOL)

    SARAH

    28 févr. 2014 ... contrôle de coquille et de calibre dans les fermes. Mots clés : œuf, pondeuse, ... dynamique qualitative des composantes de l'œuf . Certains auteurs ont ... programme de conduite et de gestion d'élevage. Élevées en bande ...

  18. Données préliminaires sur la diversité du zooplancton du lac Nokoué

    African Journals Online (AJOL)

    SARAH

    31 juil. 2017 ... contribuera davantage à la compréhension de la dynamique de cette communauté biologique du lac. Mots clés ... dans une perspective de gestion durable de la .... ramenés au Laboratoire de Contrôle de Qualité des Eaux.

  19. 225-IJBCS-Article-Dr A Toguyeni

    African Journals Online (AJOL)

    RHUMSIKI

    Mots clés: Diversité ichtyologique, dynamique des populations, bassin de la Comoé, Burkina Faso. INTRODUCTION ... projet Gestion de la Pêche dans le Sud-Ouest. (GPSO) a .... contrôle des ressources piscicoles au regard de la législation ...

  20. Problematique de l'utilisation des tic dans l'enseignement superieur ...

    African Journals Online (AJOL)

    Mots clés : Technologies de l'Information et de la Communication (TIC), Internet, enseignants chercheurs, étudiants, université. Communication and Information Technologies (TIC) plays today an important part in the sectors of the life. Appearing as a means of supplementing the traditional educational techniques they make ...

  1. A Case of Appendicular Tuberculosis mimicking an Acute Appendicitis

    African Journals Online (AJOL)

    Les auteurs rapportent un cas rare de tuberculose de siège apendiculaire mimant un tableau d'appendicite aigue. La littérature sur cette question est revisée. Mots clés : tuberculose, appendice. The author report a rare case of appendiceal tuberculosis clinically presenting as acute appendicitis. The litterature is reviewed.

  2. On the static loop modes in the marching-on-in-time solution of the time-domain electric field integral equation

    KAUST Repository

    Shi, Yifei; Bagci, Hakan; Lu, Mingyu

    2014-01-01

    When marching-on-in-time (MOT) method is applied to solve the time-domain electric field integral equation, spurious internal resonant and static loop modes are always observed in the solution. The internal resonant modes have recently been studied by the authors; this letter investigates the static loop modes. Like internal resonant modes, static loop modes, in theory, should not be observed in the MOT solution since they do not satisfy the zero initial conditions; their appearance is attributed to numerical errors. It is discussed in this letter that the dependence of spurious static loop modes on numerical errors is substantially different from that of spurious internal resonant modes. More specifically, when Rao-Wilton-Glisson functions and Lagrange interpolation functions are used as spatial and temporal basis functions, respectively, errors due to space-time discretization have no discernible impact on spurious static loop modes. Numerical experiments indeed support this discussion and demonstrate that the numerical errors due to the approximate solution of the MOT matrix system have dominant impact on spurious static loop modes in the MOT solution. © 2014 IEEE.

  3. pluviosite en region soudano-sahelienne au nord du cameroun

    African Journals Online (AJOL)

    AISA

    Dans le but de montrer qu'en zone soudano-sahélienne du Nord du ... principaux facteurs responsables de la variation des rendements en culture pluviale, une étude basée sur ... Mots clés : Risque climatique, pluviométrie, variation, rendement agricole, Nord Cameroun. ... d'analyse plus global et fonctionnel, à savoir,.

  4. 2195-IJBCS-Article-Rachidi Saliou

    African Journals Online (AJOL)

    hp

    Mots clés : Distribution géographique, variabilités climatiques, herbacées fourragères, Moyen-Bénin. INTRODUCTION ... définie sur la zone d'étude, qui satisfait à un ensemble de ..... Global Ecology ... agropastoraux Soudano Sahéliens du.

  5. changement climatique, mécanisme actuel de prévention

    African Journals Online (AJOL)

    ACSS

    19 févr. 2015 ... Ainsi, dans un contexte des changements climatiques, cette étude vise ... Mots Clés: Adaptations, Banikoara, Bénin, changement climatique, ...... pastorale sahélienne: cas de l'arrondissement ... Global Environmental Politics.

  6. Francophonie en Asie du Sud-Est – Ce qu’on en dit localement, ce qu’on brandit institutionnellement

    Directory of Open Access Journals (Sweden)

    Michel Le Gall

    2016-12-01

    Full Text Available Le 20 mars 2016, la journée internationale de la francophonie était placée par ses instances de parrainage sous le signe du « pouvoir des mots ». Slogan ? Mot d’ordre ? Sésame ? Catalyseur ? Était-on invités à fêter le pouvoir que possèdent les mots en eux-mêmes, ou celui que chaque francophone exerce par leur usage, ou bien incitait-on à rallier un pouvoir constitué et donc des mots agrégés de longue date autour de certains enjeux économiques ou politiques ? En regard de ce que des élèves, des étudiants ou des enseignants expriment spontanément à propos de leur apprentissage ou usages de la langue française au Vietnam, on essaiera de comprendre à travers quelques exemples comment certains éléments institutionnels de langage ont vécu l’épreuve des traductions, des appropriations, des approximations ou des expropriations locales lors de ces deux dernières décennies.

  7. La contribution du sport dans le règlement du conflit Casamançais ...

    African Journals Online (AJOL)

    En tant que chercheur, nous avons étudié la question en se fondant sur la recherche documentaire fournie et l'analyse compréhensive et fonctionnaliste. Mots-clés: Sport, conflit, lutte, paix, culture. English Abstract Senegal, a country that lies in west African, is facing a serious armed conflict in the South of Casamance since ...

  8. Vehicle regulations.

    NARCIS (Netherlands)

    2006-01-01

    In the Netherlands, all vehicles using public roads must meet so-called permanent requirements. This is enforced by the police and, for some categories, also during the MOT. In the Netherlands, most types of motor vehicle1 can only be introduced to the market if they meet the entry requirements. For

  9. Campylobacter jejuni motility is required for infection of the flagellotropic bacteriophage F341

    DEFF Research Database (Denmark)

    Baldvinsson, Signe Berg; Sørensen, Martine Camilla Holst; Vegge, Christina Skovgaard

    2014-01-01

    . In contrast, phage F341 does not infect C. jejuni NCTC11168 mutants that either lack the flagellar filaments (ΔflaAB) or that have paralyzed, i.e., nonrotating, flagella (ΔmotA and ΔflgP). Complementing flgP confirmed that phage F341 requires rotating flagella for successful infection. Furthermore, adsorption...

  10. SAHARA MAKEUP NOV 07

    African Journals Online (AJOL)

    Winnie

    Mots clés: Education par les pairs et le soutien, prévention du VIH, éducation sur le VIH à l'école, ..... HIV and drug awareness days including drama, song, dance and ...... Sexual and Relationships Therapy, 15(3), 283-296. .... Family Planning.

  11. Fulltext PDF

    Indian Academy of Sciences (India)

    Upgradation of MOT and its Relevance to WET Campaigns (Alisher S. Hojaev), 311. Argos: An Optimized Time-Series Photometer (Anjum S. Mukadam & R. E. Nather),. 321. Small-scale Magnetic Field Diagnostics Outside Sunspots: Comparison of Different. Methods (D. N. Rachkovsky, T. T. Tsap & V. G. Lozitsky), 435.

  12. Transient analysis of electromagnetic wave interactions on high-contrast scatterers using volume electric field integral equation

    KAUST Repository

    Sayed, Sadeed Bin; Ulku, Huseyin Arda; Bagci, Hakan

    2014-01-01

    A marching on-in-time (MOT)-based time domain volume electric field integral equation (TD-VEFIE) solver is proposed for accurate and stable analysis of electromagnetic wave interactions on high-contrast scatterers. The stability is achieved using

  13. optimisation of a somatic embryogenesis and transformation ...

    African Journals Online (AJOL)

    ACSS

    3Department of Agricultural Science and Technology, Kenyatta University, P. O. Box 43844-00100,. Nairobi, Kenya ... Mots Clés: Cytokinine, Manihot esculenta, protocole de génération ..... Z., Xiang, C., Fonger, T.M., Pegg, S.E.K, Li,.

  14. LES CANCERS DE L'ORBITE

    African Journals Online (AJOL)

    19 déc. 2007 ... té au type histologique permet d'améliorer la survie et la qualité de vie chez les patients atteints de ces tumeurs. Mots-clés ... management of these tumors. Materials ... La durée moyenne d'évolution de la symptomatologie.

  15. 199 Étude de la qualité des eaux d'une retenue située sous climat ...

    African Journals Online (AJOL)

    Afrique Sciences

    Mots-clés : barrage Hassan II, Maroc, climat, eau, qualité, eutrophisation. Abstract ... However, the feasibility and management of these structures are ..... Figure 5 : Evolution spatio-temporelle de la température au barrage Hassan II. De S à P6 ...

  16. 1957-IJBCS-Article-Koura Kourouma

    African Journals Online (AJOL)

    hp

    des sous-populations de Parkia biglobosa (néré) du Nord-Bénin, en vue d'une gestion durable de l'espèce. ... Mots clés : Sous-population, Parkia biglobosa, phénotype, structure, Nord-Bénin. ...... nutrition et alimentation dans les pays en.

  17. Untitled

    Indian Academy of Sciences (India)

    No mutarotation The solution turned deep pyridine and chloroform red on keeping, hence turned Scarlet red imme-. Cd and Ag lines could diately, the readings were mot be read. taken with much diffi- culty. The change in benzene is so rapid that readings could not be taken. TABLE V p-Amino anilinomethylenecamphors.

  18. Comparative efficacy of sweet orange, Citrus sinensis (l) rind ...

    African Journals Online (AJOL)

    Sweet orange, Citrus sinensis((L.) rind powder and oil were evaluated for the control of maize weevil, Sitophilus zeamais(Mot.) under ambient laboratory conditions (28 ± 2o C and 75 ± 20% R.H.). Experiments consisted of exposing adult S. zeamais to both the powder and oil for 42 days. Mortality counts were taken from the ...

  19. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... Keywords. Telescopes; method: observational; stars: oscillation. Abstract. The Maidanak One-meter Telescope (MOT) is a Ritchey-Chretien telescope by Carl Zeiss, located atop Maidanak in Uzbekistan, where site parameters indicate excellent atmospheric seeing conditions. An effort to computerize the ...

  20. La gestion des rapatriés de Libye dans la commune de ...

    African Journals Online (AJOL)

    25 juin 2015 ... Mots clés : Tchintabaraden, risque sécuritaire, migration de retour .... Comité international de la croix rouge (CICR), le Programme alimentaire ..... poursuivent malgré la fermeture des maisons d'accueil des migrants à .... Bredeloup, S., Pliez Olivier, 2005, « Migrations entre les deux rives du Sahara »,.

  1. 537-IJBCS-Article-Pr Leonard Simon Tinkeu Ngamo

    African Journals Online (AJOL)

    DR GATSING

    de Tephritidae qui ont émergé des mangues mûres ramassées sous les arbres appartiennent à deux espèces. B. invadens (98,5%) et ... Mots clés: Mouches des fruits, Mangifera indica, Bactrocera invadens, Dacus punctatifrons, Cameroun,. Adamaoua, dynamique ... diversifié leur production de cultures non traditionnelles ...

  2. Reference: 689 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available the high affinity of MOT1 allows plants to obtain scarce Mo from soil. An Arabidopsis thaliana high-affinity... molybdate transporter required for efficient uptake of molybdate from soil. 47 18807-12 18003916 2007 Nov P

  3. Biodisponibilité et mobilité du phosphore des sédiments de la ...

    African Journals Online (AJOL)

    Mots clés: Biodisponibilité, mobilité, relargage, fractionnement, extraction séquentielle. English Title: Bioavailability and mobility of phosphorus in the sediments of the Porto-Novo Lagoon. English Abstract. Phosphorus sources in the Porto-Novo lagoon (50 km2 of area, located in southeast Benin) are of two types: diffuse ...

  4. Public awareness of human papillomavirus as a causative factor for oropharyngeal cancer.

    Science.gov (United States)

    Williams, Michael U; Carr, Michele M; Goldenberg, David

    2015-06-01

    To assess the public's awareness of human papillomavirus (HPV) as a causative factor for oropharyngeal cancer. Twenty-three-item survey. Local shopping malls and Maxwell Air Force Base in 2012. Respondents were randomly chosen to participate in 23-item survey at various local shopping malls and at Maxwell Air Force Base in 2012. The χ(2) test was used in statistical analysis. The majority of respondents (n = 319) were civilians; 158 were military officer trainees (MOTs). All MOTs had a bachelor's degree or higher, while 37% of civilian respondents had a bachelor's degree or higher. Most MOTs (82%) were aware of oropharyngeal cancer, and 53% of civilians had not heard of oropharyngeal cancer (P aware of the association between HPV and cervical cancer. Conversely, 75% of civilian population and 49% of MOTs were not aware of the association between HPV and oropharyngeal cancer (P aware that HPV is a causative agent of cervical cancer. However, the majority were not aware of the association between oropharyngeal cancer and HPV. Furthermore, many respondents were not aware that HPV equally affects males and females and that the vaccine is available for both sexes. This underscores the need to educate the public on the availability of HPV vaccine and the association between HPV and oropharyngeal cancer. © American Academy of Otolaryngology—Head and Neck Surgery Foundation 2015.

  5. Responsabilite societale des entreprises et groupes de societes ...

    African Journals Online (AJOL)

    Mots clés: Responsabilité Sociétale des Groupes de Sociétés ; développement durable ; protection. English Title: Social responsibility of companies and groups of companies. English Abstract. The social responsibility (CSR) corporate social is the contribution of business to sustainable development issues. The approach is ...

  6. Interactions variations climatiques – insectes ravageurs et ...

    African Journals Online (AJOL)

    ... calamistis et de E. saccharina. De plus l'analyse de la perception des agriculteurs indique l'apparition de «nouveaux» ravageurs tels que les termites, le criquet puant Zonocerus variegatus et une recrudescence des ravageurs de stock. Mots clés: Changements climatiques, Sesamia calamistis, maïs, générations, termites.

  7. Original Paper Inventaire et essais phytochimiques sur quelques ...

    African Journals Online (AJOL)

    astrid

    2017 International Formulae Group. All rights reserved. Mots clés : Plantes médicinales, goutte, phytochimie, Tchad. Inventory and phytochemical screening of some plants used in Chad for the treatment of gout. ABSTRACT. The practice of herbal medicine is a worldwide custom that preoccupied mankind in the evolution of.

  8. Maladie de kimura: À propos d'un cas | Dib | Journal Tunisien d'ORL ...

    African Journals Online (AJOL)

    Introduction : Mots-clés : Maladie de Kimura, parotide, chirurgie.La maladie de Kimura ou lymphogranulome éosinophile est une pathologie inflammatoire chronique très rare, d'étiologie inconnue. Nous rapportons un cas de maladie de Kimura à localisation parotidienne et à travers une revue de la littérature, rappelons les ...

  9. Linear quadratic regulator design for an unpowered, winged re-entry vehicle

    NARCIS (Netherlands)

    Mooij, E.

    1998-01-01

    This report describes the design of an attitude controller for an unpowered, winged re-entry vehicle. The decoupling of the symmetric and asymmetric motion makes it possible to design two separate controllers, one for the pitch mot ion and one for the lateral motion. The design of the controller, a

  10. Formulation de farine de fonio enrichie en ressources alimentaires ...

    African Journals Online (AJOL)

    Mots clés: fonio (Digitaria exilis), alimentation complémentaire, ressources alimentaires locales au Bénin, enfants de 6 – 23 mois, formulation de farine de céréale. English Title: Developing a fonio flour enriched with local food resources for complementary feeding of young children in Benin. English Abstract. The objective ...

  11. Cannabis et thrombose du sinus caverneux | Agba | Journal de la ...

    African Journals Online (AJOL)

    Mots clés: Thrombose-sinus caverneux-cannabis. English Abstract. Introduction: Cerebral venous thrombosis (CVT) is a rare cause of Cerebro Vascular Accidents (CVA). Their clinical manifestations are often atypical, which can simulate transient ischemic attacks, migraines with aura, thunder headaches and hemorrhages ...

  12. Plantes médicinales utilisées dans le traitement traditionnel du ...

    African Journals Online (AJOL)

    Les résultats de cette étude pourront ainsi contribuer à la connaissance exhaustive des plantes à visée antipaludique et à une valorisation de la médecine traditionnelle Malienne. © 2016 International Formulae Group. All rights reserved. Mots clés: Paludisme, plantes médicinales, ethnobotanique, Bamako. English Title: ...

  13. Laser frequency stabilization and large detuning by Doppler-free ...

    Indian Academy of Sciences (India)

    c Indian Academy of Sciences. Vol. 65, No. 3. — journal of. September 2005 physics .... magneto-optical trap; BS: beam splitter plate; S: stopper; PBS: polarizing .... The MOT is of standard design and basically consists of a glass cell with eight.

  14. Managing technological and environmental dynamics

    DEFF Research Database (Denmark)

    Madsen, Henning; Ulhøi, John Parm

    2001-01-01

    The field of MoT cannot continue indefinitely to ignore the importance of the natural environment as a fundamental basis for technological development. This paper will therefore focus on the various linkages between management of technology and sustainable development, discussing both the current...

  15. Holoprosencéphalie alobaire avec diabète insipide et hypothyroïdie ...

    African Journals Online (AJOL)

    ... déceler un diabète insipide central et une hypothyroïdie centrale probablement d'origine hypothalamique. Mots clés: Holoprosencéphalie alobaire, nourrisson, diabète insipide, hypothyroïdie centrale. English Title: Alobar holoprosencephaly associated with diabetes insipidus and hypothyroidism in a 10-month old infant.

  16. Activités anti-radicalaires de l'huile essentielle et des extraits bruts ...

    African Journals Online (AJOL)

    une haute capacité de blocage du peroxyde d'hydrogène en comparaison avec les contrôles positifs de l'acide gallique et l'acide caféique. Mots-clés : Thymus numidicus, extraits bruts, activité antioxydante. Anti-radical activities of essential oil ...

  17. Mesure de la vitesse d'infiltration des eaux dans le sol : Cas des sols ...

    African Journals Online (AJOL)

    C'est donc une infiltration superficielle qui ne peut pas modifier la composition des eaux de l'aquifère. Ces sols sont alors favorables à une telle agriculture. Mots clés: mesure, vitesse, infiltration, sols, pollutions, eau, Niari, Congo. English Title: Measuring the speed of the water infiltration into the soil: case of the soil of the ...

  18. Chemical Suppression of the Reactivated Androgen Signaling Pathway in Androgen-Independent Prostate Cancer

    Science.gov (United States)

    2011-07-01

    when it is ingested during pregnancy [20,21]. Aside from its role in development, Hh signaling also supports stem cells in adult tissues [22-24]. However...For the mo.~t commonly uti - lized human prostate cancer cell lines (LNCaP and derivatives, DUI45, PC3 or CWR22rvl) grown in culture, Shh, Glil/2 and

  19. Existe-t-il une corrélation entre la taille tumorale au scanner et les ...

    African Journals Online (AJOL)

    Mots-Clés: cancer; rein; tomodensitométrie; anatomie pathologique; imagerie. English Title: Is there a correlation between tumor size on CT scan and pathological characteristics of kidney cancer? English Abstract. Introduction: Renal cell carcinoma (RCC) may vary in prognosis according to staging, histological subtype, ...

  20. 1087-IJBCS-Article-Chouti Waris

    African Journals Online (AJOL)

    DR GATSING

    2011 International Formulae Group. All rights reserved. Mots-clés : pollution, phosphore, azote, eaux de ruissellement, eutrophisation. INTRODUCTION. Les déchets agricoles et ménagers continuent d'être rejetés sans traitement dans les rivières et lacs de plusieurs pays africains, empêchant ainsi ces cours d'eau de jouer.

  1. Von Krahli teater kolib mõneks ajaks Saksamaale / Rain Tolk

    Index Scriptorium Estoniae

    Tolk, Rain, 1977-

    2006-01-01

    Von Krahli Teatri selle hooaja eelviimane esietendus "Europiraadid" on 17. mail Düsseldorfis, koostöös Saksamaa teatrirühmaga Showcase Beat Le Mot. Eesti poole pealt teevad kaasa Juhan Ulfsak, Taavi Eelmaa, Maarja Jakobson ja üllatusmängijana filmimees Rain Tolk, kes räägib oma suhtumisest teatrisse ja suhetest Von Krahli Teatriga

  2. 2431-IJBCS-Article -Dougna Akpene A

    African Journals Online (AJOL)

    hp

    Physico-chimie et qualité des eaux des forages d'hydraulique villageoise dans la région ... Mots clés : Région centrale, Togo, faciès hydrochimiques, pollution, eaux souterraines, socle. Physical ...... total) ont un pH< 6 et présentent des indices.

  3. 1 Commande multivariable du moteur asynchrone triphasé à cage ...

    African Journals Online (AJOL)

    AKA BOKO

    Correspondance, courriel : rabenarivo.michel@yahoo.fr. Résumé. La commande du moteur asynchrone triphasé à ... synthèse du système à l'aide du logiciel MATLAB. Mots-clés : commande, système multivariable, variation de ... of the system by MATLAB software. Keywords : control, MIMO system, frequency variation, ...

  4. Templet for V° 6 N°2

    African Journals Online (AJOL)

    PNLC

    décrit. Les pronostics maternels et foetal sont discutés à la lumière de la revue de la littérature. MOTS CLES: Rupture utérine - Grossesse - Traumatisme abdominal - Accident de la voie publique. UTERINE RUPTURE FOLLOWING A ROAD TRAFFIC ACCIDENT: A case report. ABSTRACT: A case of a ruptured gravid uterus ...

  5. Carcinome épidermoïde primitif du colon: à propos d'un cas ...

    African Journals Online (AJOL)

    cliniques et thérapeutiques ainsi que les hypothèses étiopathogéniques de cette entité peu commune. Mots clés: Colon, carcinome épidermoïde, pronostic. English Title: Primary squamous cell carcinoma of the colon: about a case. English Abstract.

  6. Effect of Intraoperative Mitomycin C on the Re-currence rate of ...

    African Journals Online (AJOL)

    ... effectif dans les cas recurrents. L'utilisation intra-operative du mitomycin C est fortement recommend après excision du pterygium du type primaire chez les Nigerian pour reduire le taux de recurrence. Mot clés: Pterygium, recurrence, mitomycin. West African Jnl of Pharmacology and Drug Research Vol.18 2002: 17-20 ...

  7. Images in medicine

    African Journals Online (AJOL)

    abp

    26 avr. 2016 ... Thumb trapeziometacarpal arthrosis treated with a prosthesis. Adil El Alaoui1,&, Ilyas Rabhi1. 1Service de Chirurgie Orthopédique du Centre Hospitalier de Chambéry, France. &Corresponding author: El Alaoui Adil, Service de Chirurgie Orthopédique du Centre Hospitalier de Chambéry, France. Mots clés: ...

  8. Efficacité des champignons mycorhiziens contre les nématodes ...

    African Journals Online (AJOL)

    SARAH

    30 mai 2015 ... Mots clés : Glomus sp., Lycopersicon esculentum, lutte biologique, Meloidogyne spp. Effectiveness of the arbuscular mycorrhizal fungi on the parasitic nematodes of tomato in Togo. ABSTRACT. Objectives : To find alternatives to the synthetic pesticides used against nematodes the present work aimed at.

  9. 1943-IJBCS-Article-Ly Mamadou

    African Journals Online (AJOL)

    hp

    3 Silviculture Division, Forest Research Institute, New Forest, Dehradun, Uttarakhand 248006, India. 4 ISRA/CRZ BP 53 Kolda, ... des parties racinaires évalués à la fin de l'expérience varient en fonction du niveau du stress salin. Les deux ... Mots clés : Stress salin, croissance, biomasse, Jatropha curcas L., provenances.

  10. Le point sur les indices du bien-être national | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    21 janv. 2011 ... Les indices économiques sont des outils statistiques qui résument des ... En quelques mots, le PIB correspond à la valeur totale des biens et ... copieux menu d'instruments de mesure allant du réjouissant Happy Planet Index, ...

  11. Additivity of Feature-based and Symmetry-based Grouping Effects in Multiple Object Tracking

    Directory of Open Access Journals (Sweden)

    Chundi eWang

    2016-05-01

    Full Text Available Multiple object tracking (MOT is an attentional process wherein people track several moving targets among several distractors. Symmetry, an important indicator of regularity, is a general spatial pattern observed in natural and artificial scenes. According to the laws of perceptual organization proposed by Gestalt psychologists, regularity is a principle of perceptual grouping, such as similarity and closure. A great deal of research reported that feature-based similarity grouping (e.g., grouping based on color, size, or shape among targets in MOT tasks can improve tracking performance. However, no additive feature-based grouping effects have been reported where the tracking objects had two or more features. Additive effect refers to a greater grouping effect produced by grouping based on multiple cues instead of one cue. Can spatial symmetry produce a similar grouping effect similar to that of feature similarity in MOT tasks? Are the grouping effects based on symmetry and feature similarity additive? This study includes four experiments to address these questions. The results of Experiments 1 and 2 demonstrated the automatic symmetry-based grouping effects. More importantly, an additive grouping effect of symmetry and feature similarity was observed in Experiments 3 and 4. Our findings indicate that symmetry can produce an enhanced grouping effect in MOT and facilitate the grouping effect based on color or shape similarity. The where and what pathways might have played an important role in the additive grouping effect.

  12. An ENU-induced point mutation in the mouse Btaf1 gene causes post-gastrulation embryonic lethality and protein instability

    NARCIS (Netherlands)

    Wansleeben, C.; van Gurp, L.; de Graaf, P.; Mousson, F.; Timmers, H.T.; Meijlink, F.

    2011-01-01

    The mouse Btaf1 gene, an ortholog of yeast MOT1, encodes a highly conserved general transcription factor. The function of this SNF2-like ATPase has been studied mainly in yeast and human cells, which has revealed that it binds directly to TBP, forming the B-TFIID complex. This complex binds to core

  13. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 167 ... Vol 1, No 1 (2010), Agricultural Marketing Cooperatives in Developing Society in Relation to Poverty Alleviation and Sustainable Development: The Case of Lesotho, Abstract. MMM Daemane, KA Mot'soene, VZ Nyawo-Shava. Vol 8, No 1 (2017), An alternative approach to financing development in Africa ...

  14. Cognitive-motor dual-task ability of athletes with and without intellectual impairment.

    Science.gov (United States)

    Van Biesen, Debbie; Jacobs, Lore; McCulloch, Katina; Janssens, Luc; Vanlandewijck, Yves C

    2018-03-01

    Cognition is important in many sports, for example, making split-second-decisions under pressure, or memorising complex movement sequences. The dual-task (DT) paradigm is an ecologically valid approach for the assessment of cognitive function in conjunction with motor demands. This study aimed to determine the impact of impaired intelligence on DT performance. The motor task required balancing on one leg on a beam, and the cognitive task was a multiple-object-tracking (MOT) task assessing dynamic visual-search capacity. The sample included 206 well-trained athletes with and without intellectual impairment (II), matched for sport, age and training volume (140 males, 66 females, M age = 23.2 ± 4.1 years, M training experience = 12.3 ± 5.7 years). In the single-task condition, II-athletes showed reduced balance control (F = 55.9, P balance and the MOT task between both groups. The DT costs were significantly larger for the II-athletes (-8.28% versus -1.34% for MOT and -33.13% versus -12.89% for balance). The assessment of MOT in a DT paradigm provided insight in how impaired intelligence constrains the ability of II-athletes to successfully perform at the highest levels in the complex and dynamical sport-environment.

  15. et du neem (Azadirachta indica A. Juss.)

    African Journals Online (AJOL)

    SARAH

    30 nov. 2015 ... Mots clés : tomate ; ravageurs, extraits végétaux, activité insecticide. ABSTRACT. Objective: ... obtained with the decis unlike Lippia that has been mitigated. Indeed, neem extract can be recommended as an alternative against ...

  16. 169 Résumé Abstract Measure of uranium in some samples of ...

    African Journals Online (AJOL)

    youness

    puits et par activation neutronique. Mots-clés : Uranium, Radioactivité naturelle, Coraux, Coquilles de mollusques, lichens, travertins, Carbonates. Abstract. Measure of uranium in some samples of natural deposits in Morocco: environmental implications. In this work, we report the measurement results of uranium content in.

  17. Foreign Language Workshop on French Culture.

    Science.gov (United States)

    Reynolds, Sue, Ed.; And Others

    A compilation of French cultural units for use in secondary school language classes is presented in this text. Units include: (1) "Les mots et leur implication culturelle," (2) "Le telephone--une capsule culturelle," (3) "Le repas," (4) "La femme francaise 1972," (5) "Les Parents," (6)…

  18. Untitled

    African Journals Online (AJOL)

    with spotted high readings in a few individualshence the overall response was mot significantly different (P>0.05). However. IgG4 responses to 013 were very low or negligible in both groups. Pronounced IgG3 responses to the recombinant antigens OV25 and OV47 were observed for the protected individuals against lower ...

  19. Déchets solides encombrants les plages d'Annaba Rabah Chaouch ...

    African Journals Online (AJOL)

    Les rejets des déchets solides sur nos plages constituent une véritable plaie qui dégrade la beauté des paysages. ... Mots clés : environnement; déchets solides; gestion; littoral; santé. Abstract ..... déchets soldes et liquides apportés par les ...

  20. Experimental Investigation of the Influence of the Laser Beam Waist on Cold Atom Guiding Efficiency.

    Science.gov (United States)

    Song, Ningfang; Hu, Di; Xu, Xiaobin; Li, Wei; Lu, Xiangxiang; Song, Yitong

    2018-02-28

    The primary purpose of this study is to investigate the influence of the vertical guiding laser beam waist on cold atom guiding efficiency. In this study, a double magneto-optical trap (MOT) apparatus is used. With an unbalanced force in the horizontal direction, a cold atomic beam is generated by the first MOT. The cold atoms enter the second chamber and are then re-trapped and cooled by the second MOT. By releasing a second atom cloud, the process of transferring the cold atoms from MOT to the dipole trap, which is formed by a red-detuned converged 1064-nm laser, is experimentally demonstrated. And after releasing for 20 ms, the atom cloud is guided to a distance of approximately 3 mm. As indicated by the results, the guiding efficiency depends strongly on the laser beam waist; the efficiency reaches a maximum when the waist radius ( w ₀) of the laser is in the range of 15 to 25 μm, while the initial atom cloud has a radius of 133 μm. Additionally, the properties of the atoms inside the dipole potential trap, such as the distribution profile and lifetime, are deduced from the fluorescence images.

  1. 75 FR 32826 - Self-Regulatory Organizations; NASDAQ OMX PHLX, Inc.; Notice of Filing and Immediate...

    Science.gov (United States)

    2010-06-09

    ...''), American Express Company (``AXP''), Ciena Corp. (``CIEN''), Star Scientific, Inc. (``CIGX''), Dendreon Corp. (``DNDN''), eBay Inc. (``EBAY''), Corning Inc. (``GLW''), Halliburton Company (``HAL''), iShares Dow Jones US Real Estate (``IYR''), Motorola, Inc., (``MOT''), NVIDIA Corporation (``NVDA''), ON Semiconductor...

  2. 75 FR 30887 - Self-Regulatory Organizations; The NASDAQ Stock Market LLC; Notice of Filing and Immediate...

    Science.gov (United States)

    2010-06-02

    ...''), American Express Company (``AXP''), Ciena Corp. (``CIEN''), Star Scientific, Inc. (``CIGX''), Dendreon Corp. (``DNDN''), eBay Inc. (``EBAY''), Corning Inc. (``GLW''), Halliburton Company (``HAL''), iShares Dow Jones US Real Estate (``IYR''), Motorola, Inc., (``MOT''), NVIDIA Corporation (``NVDA''), ON Semiconductor...

  3. Motivation Monitoring and Assessment Extension for Input-Process-Outcome Game Model

    Science.gov (United States)

    Ghergulescu, Ioana; Muntean, Cristina Hava

    2014-01-01

    This article proposes a Motivation Assessment-oriented Input-Process-Outcome Game Model (MotIPO), which extends the Input-Process-Outcome game model with game-centred and player-centred motivation assessments performed right from the beginning of the game-play. A feasibility case-study involving 67 participants playing an educational game and…

  4. 102-IJBCS-Article-Dr Coulibaly

    African Journals Online (AJOL)

    RHUMSIKI

    Mot-clés: Poisson, longueur-poids, pêcherie continentale, rivière Sourou, Burkina Faso. INTRODUCTION. Chez les poissons, la croissance se manifeste par des variations de poids et de longueur et il existe par ailleurs une relation étroite entre ces deux variables (Le Cren,. 1951 ; Baijot et al., 1994 ; Pauly et Moreau,.

  5. Résultats du traitement chirurgical des traumatismes du rachis à l ...

    African Journals Online (AJOL)

    incomplète était prédictive de bon pronostic P< 0,001. Les traumatismes du rachis cervical sont des urgences neurologiques qui mettent en jeu le pronostic vital et fonctionnel des patients. Mots clés : Traumatisme, rachis, traitement. The purpose of this series was to describe the results of surgical treatment of spinal injury.

  6. Plaadid / Immo Mihkelson

    Index Scriptorium Estoniae

    Mihkelson, Immo, 1959-

    2002-01-01

    Uutest plaatidest Vanessa Carlton "Be Not Nobody", Nine Inch Nails "And All That Could have...", peeter Selis Thomson "Vaba kui tuul", Killer "Sickeningly Pretty", mylene Farmer "Les Mots", Marianne Faithfull "A Stranger On Earth", faultline "Your Love Means Everything" "Mozart in Egyt"

  7. Caractéristiques morphologiques et optiques du silicium ...

    African Journals Online (AJOL)

    Mots clés: silicium nanoporeux; modèle de Bruggeman; indice de réfraction; degrés d'oxydation. The silicon anodisation in hydrofluoric acid solutions HF is an acquired method in the preparation of porous silicon, with potential applications in many fields such as electronics, optics as well as chemical technology and that of ...

  8. Les obstacles a l'action des ong Au Togo | Gbemouk | Journal de la ...

    African Journals Online (AJOL)

    Mots clés : Action, autonomie, dynamique, Obstacle, ONG, participation. Hurdles to the NGOs' activities in Togo. NGOs play a key role - by the government's side - in the fight against poverty. In many areas, they are working towards the improved living conditions of local populations. But their effort encounters many ...

  9. Representation sociale de l'hygiene chez les populations riveraines ...

    African Journals Online (AJOL)

    Mots clés: Représentation sociale, hygiène, populations riveraines, décharge, environnement, pollution. English Title: Social representation of hygiene in the populations living in the vicinity of Akouedo-Cocody dump (Abidjan-Ivory Coast). English Abstract. Landfills are generally the common option for the final deposit of ...

  10. 197 ORIGINAL ARTICLE

    African Journals Online (AJOL)

    boaz

    Methods: A randomized open label study with participants allocated into three ... La division des Sciences Clinique et Laboratoire de Virologie Humaine, l'Institut nigérian de Recherche Médicale, ... Mots clés : La co - infection VIH/HBV, complément de Sélénium, HAART. .... monitor version 1.5 (Roche Diagnostic Systems,.

  11. Analyse comparative entre la distribution des fréquences de ...

    African Journals Online (AJOL)

    2016 International Formulae Group. All rights reserved. Mots clés: Hydrogéochimie, conductivité électrique, diagramme de Piper, socle cristallin et cristallophyllien, Côte d'Ivoire. English Title: Comparative analysis of electrical conductivity frequencies distribution and geochemical facies of hard rock aquifers waters (Ivory ...

  12. Bases génétiques et biochimiques de la capacité germinative des ...

    African Journals Online (AJOL)

    recherche et discute de la relation entre capacité germinative des graines et sécurité alimentaire. Mots clé: Semence, capacité germinative, facteurs biochimiques, gènes, systèmes semenciers, sécurité alimentaire. Abstract. Genetic and biochemical bases of seed germination capacity: implications for seed systems and.

  13. Infections du site Operatoire en Chirurgie Orthopedique ...

    African Journals Online (AJOL)

    Mots clés: Infection site opératoire chirurgie orthopédique. English Title: Infections of the operative site in orthopedic surgery: clinical presentations, etiologies and management. English Abstract. Introduction: In orthopedic surgery, wound site infections constitute a difficult situation to the surgeon; and for the patient. The aim ...

  14. a comparative study

    African Journals Online (AJOL)

    Physical fitness of some Cameroon division one soccer players: ... conditions, the known poor nutritional status fréquent in developing countries and to an insufficient level and intensity of ... championnat d'élite camerounais. Mots clés ...

  15. Pratiques Matrimoniales Et Transmission Mere-Enfant Du Vih Au Togo

    African Journals Online (AJOL)

    Mots clés : Pratiques matrimoniales, transmission mère-enfant, VIH, Togo. Purpose: To study the influence of customs and marriage practices on the mode of sexual transmission and mother-to-child transmission of HIV/AIDS in Togo, to make suggestions to the location of populations and public authorities to avoid customs ...

  16. SAHARA MAKEUP NOV 07

    African Journals Online (AJOL)

    Winnie

    Mots clés: CDV,VIH, genre. Kennedy Otwombe is currently a PhD student in statistics at the University of the Witwatersrand with an interest in the application of statistics in health research. His current interest is in monitoring and evaluation of HIV related studies and the analysis of incomplete data in longitudinal studies.

  17. Research

    African Journals Online (AJOL)

    abp

    29 avr. 2016 ... Mots clés: Accident vasculaire cérébrale, doppler transcrânien, drépanocytose, enfant. Received: 17/05/2015 - Accepted: 07/03/2016 - Published: ... original work is properly cited. Pan African Medical Journal – ISSN: 1937- 8688 ..... Aracaju, Northeast-Brazil. Arq Neuropsiquiatr. 2008 Jun; 66(2):. 360-4.

  18. La libéralisation comme source du dérèglement des transports ...

    African Journals Online (AJOL)

    Mots clés: Libéralisation - Transport public - Chronologie - Urbain - Organisation. English Title: Liberalization as a source of deregulation of public transport in Annaba city. English Abstract. Similarly at almost of the Algerian cities, after the dissolution of the Municipal Board RMCA, the city of Annaba doesn't escape from the ...

  19. African Journal of Neurological Sciences 2013 - Vol. 32, No 1 http ...

    African Journals Online (AJOL)

    Service de Neurochirurgie, Hôpital Avicenne, Rabat. 2. Service de neuroradiologie, Rabat, Royaume du Maroc. Mots clés : Epidermoïde - Intra médullaire - IRM - Kyste - Moelle spinale. Keywords: Cyst - Epidermoid - Intramedullary -Medullary spinal -MRI. RESUME. Introduction. Les kystes épidermoïdes sont des tumeurs ...

  20. Caracteristiques des malnutris aigus severes decedes en milieu ...

    African Journals Online (AJOL)

    Mots clés: audit, enfant, malnutrition, mortalité, Côte d'Ivoire. English Title: Characteristics of people suffering from acute and severe malnutrition, deceased in a hospital environment in Abidjan (Republic of Cote d'Ivoire). English Abstract. Introduction: The infant and juvenile mortality linked to acute malnutrition remains high ...

  1. 1678-IJBCS-Article-Jacques Fatombi

    African Journals Online (AJOL)

    hp

    Elimination du fer et du manganèse d'une eau de surface par les graines de. Moringa oleifera. Jacques K. ... Mot clés: Moringa oleifera - fer - manganèse adjuvant de coagulation - jar-test. .... coagulation-floculation types jar-test. Des volumes ...

  2. 1090-IJBCS-Article-Fatiha Zidane

    African Journals Online (AJOL)

    DR GATSING

    1Laboratoire Science de l'Eau et d'Environnement, Département de Chimie, Faculté des Sciences Ain Chock,. Université ... élevée en divers types de polluants. ... Mots clés: traitement, hydroxyde, coagulation, demande chimique en oxygène.

  3. Composition chimique de l'huile essentielle de Satureja calamintha ...

    African Journals Online (AJOL)

    Ce travail vise l'étude de la composition chimique de l'huile essentielle de Satureja calamintha (L.) Scheele du Maroc. Les constituants chimiques principaux de cette huile essentielle sont borneol (34.52%), αcampholenic aldehyde (14.26%), cedren-13-ol (6.45%), et manoyloxide (3.78%). Mots-clés : huile essentielle, ...

  4. caracterisation des systemes de production a base d'anacardier

    African Journals Online (AJOL)

    AISA

    Mots clés : Systèmes de culture, anacardier, gestion des plantations, rentabilité économique, Bénin. .... qui élimine au fur et à mesure les variables .... regard à la performance des arbres. ..... le contrôle des mauvaises herbes et la meilleure.

  5. Deling av personbilder på Snapchat - med vekt på retten til eget bilde etter åndsverkloven § 45c.

    OpenAIRE

    Heiberg, Henrik

    2017-01-01

    Avbildedes vern mot offentliggjøring av personbildet og fotografens rettigheter til personbildet belyses i oppgaven. En sentral problemstilling er hva som følger av offentlig-begrepet etter åndsverkloven § 45c. Når er et bilde delt offentlig på Snapchat?

  6. New insights into the origin of the bimodal volcanism in the middle Okinawa Trough: not a basalt-rhyolite differentiation process

    Science.gov (United States)

    Zhang, Yuxiang; Zeng, Zhigang; Chen, Shuai; Wang, Xiaoyuan; Yin, Xuebo

    2018-06-01

    In the middle Okinawa Trough (MOT), rhyolites have been typically considered as products of crystallization differentiation of basaltic magma as a feature of bimodal volcanism. However, the evidence is insufficient. This paper compared chemical trends of volcanic rocks from the MOT with fractional crystallization simulation models and experimental results and utilized trace element modeling combined with Rayleigh fractionation calculations to re-examine fractional crystallization processes in generating rhyolites. Both qualitative and quantitative studies indicate that andesites, rather than rhyolites, originate by fractional crystallization from basalts in the MOT. Furthermore, we established two batch-melting models for the MOT rhyolites and proposed that type 1 rhyolites are produced by remelting of andesites with amphiboles in the residue, while type 2 rhyolites are derived from remelting of andesites without residual amphiboles. It is difficult to produce melts with a SiO2 content ranging from 62% to 68% either by magmatic differentiation from basalts or by remelting of andesites, and this difficulty might help account for the compositional gap (Daly gap) for bimodal volcanism in the Okinawa Trough.

  7. 75 caracteristiques et evolution des operations de fusions

    African Journals Online (AJOL)

    Elles apparaissent enfin comme un moyen à la disposition des entreprises de grande taille afin de se développer en acquérant des PME. Mots clés : Fusions & Acquisitions, Tunisie, Industrie, Commerce. Classification JEL : L26, G34. *. Chercheur associé au CEPN, Université Paris 13, PRES Sorbonne Paris-Cité,. France.

  8. Statut nutritionnel et parasitoses (intestinales et urinaires) chez les ...

    African Journals Online (AJOL)

    ... d'y associer un traitement efficace contre les parasites intestinaux et urinaires. Mots-cles: Enfant, Ecole, Statut nutritionnel, IMC pour age, parasitoses, Burkina Faso. Nutritional status and parasites (intestinal and urinary) infections among school-age children in Burkina Faso: case study of Yamtenga, Koubri and Daguilma ...

  9. Étude ethnobotanique et phytochimique de Momordica charantia ...

    African Journals Online (AJOL)

    Mots clés: Momordica charantia ; Ethnobotanique ; Ecotoxicologique ; Cotonou Benin. English Title: Ethnobotanical and phytochemical study of Momordica charantia Linn (Cucurbitaceae) in Cotonou Benin. English Abstract. Objective: This study, on Momordica charantia Linn (Cucurbitaceae), commonly known as margose ...

  10. Some words on Word

    NARCIS (Netherlands)

    Janssen, Maarten; Visser, A.

    In many disciplines, the notion of a word is of central importance. For instance, morphology studies le mot comme tel, pris isol´ement (Mel’ˇcuk, 1993 [74]). In the philosophy of language the word was often considered to be the primary bearer of meaning. Lexicography has as its fundamental role

  11. The effect of extender, method of thawing, and duration of storage on in vitro fertility measures of frozen-thawed boar sperm.

    Science.gov (United States)

    Knox, R V; Ringwelski, J M; McNamara, K A; Aardsma, M; Bojko, M

    2015-08-01

    Frozen-thawed boar sperm (FTS) has reduced in vitro and in vivo life span compared to liquid semen. Experiments tested whether extenders, thawing procedures, and storage temperatures could extend the fertile life span of FTS. Experiment 1 tested the effect of six extenders on postthaw motility (MOT) and viability (VIA). Straws from boars (n = 6) were thawed, diluted into each extender, and evaluated at 20, 60, and 120 minutes. There was a trend (P = 0.08) for an extender-by-time interaction for MOT and effect of extender and time for MOT (P extender (P = 0.10) and time (P boar ejaculates (n = 15) were thawed at 50 °C for 10, 20, or 30 seconds or at 70 °C for 5, 10, or 20 seconds and evaluated at 5, 30, and 60 minutes. There was an effect of thawing treatment on MOT, VIA, and ACR (viable sperm with intact acrosomes, P extenders, thawing, and storage. Copyright © 2015 Elsevier Inc. All rights reserved.

  12. Coping with Technological Dynamics

    DEFF Research Database (Denmark)

    Ulhøi, John Parm; Drejer, A.

    It is argued that, up to now, MOT and TS have primarily been addressed from different rationalistic and planning based perspectives. Based on an extensive literature review this paper identifies four such approaches within Management of Technology which have dominated the discipline from the very...

  13. Evaluation of TOGAF as a Management of Technology Framework

    DEFF Research Database (Denmark)

    Tambo, Torben; Bargholz, Jonas Magleby; Yde, Lars

    2016-01-01

    of several companies. Architectural views of studied companies do provide interesting observations on employee and corporate self-perception and potential and relevance for new technologies and change. The studied case provides such a platform for experiments in MOT practice and tentative introduction...

  14. Modelisation du stock de biomasse et dynamique de sequestration ...

    African Journals Online (AJOL)

    Mots clés: Jatropha curcas, séquestration, carbone, Bénin, Afrique de l'Ouest. English Title: Biomass stock modeling and dynamics of mineral and carbon sequestration of Jatropha curcas L. under different soil types in Benin. English Abstract. In West Africa, carbon sequestration function of Jatropha curcas shrubs and their ...

  15. Evaluating brief motivational and self-regulatory hand hygiene interventions: a cross-over longitudinal design.

    Science.gov (United States)

    Lhakhang, Pempa; Lippke, Sonia; Knoll, Nina; Schwarzer, Ralf

    2015-02-04

    Frequent handwashing can prevent infections, but non-compliance to hand hygiene is pervasive. Few theory- and evidence-based interventions to improve regular handwashing are available. Therefore, two intervention modules, a motivational and a self-regulatory one, were designed and evaluated. In a longitudinal study, 205 young adults, aged 18 to 26 years, were randomized into two intervention groups. The Mot-SelfR group received first a motivational intervention (Mot; risk perception and outcome expectancies) followed by a self-regulatory intervention (SelfR; perceived self-efficacy and planning) 17 days later. The SelfR-Mot group received the same two intervention modules in the opposite order. Follow-up data were assessed 17 and 34 days after the baseline. Both intervention sequences led to an increase in handwashing frequency, intention, self-efficacy, and planning. Also, overall gains were found for the self-regulatory module (increased planning and self-efficacy levels) and the motivational module (intention). Within groups, the self-regulatory module appeared to be more effective than the motivational module, independent of sequence. Self-regulatory interventions can help individuals to exhibit more handwashing. Sequencing may be important as a motivation module (Mot) first helps to set the goal and a self-regulatory module (SelfR) then helps to translate this goal into actual behavior, but further research is needed to evaluate mechanisms.

  16. A wavelet-based PWTD algorithm-accelerated time domain surface integral equation solver

    KAUST Repository

    Liu, Yang; Yucel, Abdulkadir C.; Gilbert, Anna C.; Bagci, Hakan; Michielssen, Eric

    2015-01-01

    © 2015 IEEE. The multilevel plane-wave time-domain (PWTD) algorithm allows for fast and accurate analysis of transient scattering from, and radiation by, electrically large and complex structures. When used in tandem with marching-on-in-time (MOT

  17. Impact de l'activité anthropique sur la dégradation de l ...

    African Journals Online (AJOL)

    Mots clés : El Kala - IPO - Diagramme de Piper - Impact anthropique – Piézométrie. Abstract ..... quelques recommandations afin de participer à la protection du parc ... hydrochimique de quelques hydro systèmes de la Numidie. (Régions d'El ...

  18. 1959-IJBCS-Article-Diarrassoubo Nafan

    African Journals Online (AJOL)

    hp

    ... un système d'exploitation agricole à base de coton dans le département de Sinématiali – Côte d'Ivoire ... Mots clés : Systèmes de culture, coton, vivriers, marge brute, Côte d'Ivoire. ..... La prise en compte de toutes ces recommandations.

  19. sommaire N°13

    African Journals Online (AJOL)

    cation thérapeutique doit être bien étudiée. Mots-clés : hyperparathyroïdie primaire, adénome, glande parathyroïde, parathormone, scintigraphie, parathyroïdectomie. SUMMARY. Objective : Primary hyperparathyroidism (PhPT) is defined as excessive and inappropriate production of parathormone (PTh). Asymptomatic and ...

  20. High densities and optical collisions in a two-colour magneto-optical trap for metastable helium

    NARCIS (Netherlands)

    Koelemeij, J.C.J.; Tychkov, A.; Jeltes, T.; Hogervorst, W.; Vassen, W.

    2004-01-01

    We have studied a cloud of cold metastable helium (He*) atoms interacting with near-resonant light at 1083 nm and 389 nm. The 1083 nm light allows for efficient loading of a large magneto-optical trap (MOT) and the 389 nm light is subsequently used to increase the density and reduce the temperature

  1. etude physico-chimique et parasitologique des eaux usees

    African Journals Online (AJOL)

    AISA

    pollution ont été relativement faibles, comparativement à la moyenne des concentrations habituellement rencontrées pour les ... Mots clés : Pollution, eaux usées, physico-chimie, Helminthes, lac Fouarat, Maroc. ...... Paris, 1383 p. SDNAL.

  2. A Highly Stable Marching-on-in-Time Volume Integral Equation Solver for Analyzing Transient Wave Interactions on High-Contrast Scatterers

    KAUST Repository

    Bagci, Hakan

    2014-01-06

    Time domain integral equation (TDIE) solvers represent an attractive alternative to finite difference (FDTD) and finite element (FEM) schemes for analyzing transient electromagnetic interactions on composite scatterers. Current induced on a scatterer, in response to a transient incident field, generates a scattered field. First, the scattered field is expressed as a spatio-temporal convolution of the current and the Green function of the background medium. Then, a TDIE is obtained by enforcing boundary conditions and/or fundamental field relations. TDIEs are often solved for the unknown current using marching on-in-time (MOT) schemes. MOT-TDIE solvers expand the current using local spatio-temporal basis functions. Inserting this expansion into the TDIE and testing the resulting equation in space and time yields a lower triangular system of equations (termed MOT system), which can be solved by marching in time for the coefficients of the current expansion. Stability of the MOT scheme often depends on how accurately the spatio-temporal convolution of the current and the Green function is discretized. In this work, band-limited prolate-based interpolation functions are used as temporal bases in expanding the current and discretizing the spatio-temporal convolution. Unfortunately, these functions are two sided, i.e., they require ”future” current samples for interpolation, resulting in a non-causal MOT system. To alleviate the effect of non-causality and restore the ability to march in time, an extrapolation scheme can be used to estimate the future values of the currents from their past values. Here, an accurate, stable and band-limited extrapolation scheme is developed for this purpose. This extrapolation scheme uses complex exponents, rather than commonly used harmonics, so that propagating and decaying mode fields inside the dielectric scatterers are accurately modeled. The resulting MOT scheme is applied to solving the time domain volume integral equation (VIE

  3. Analysis of electromagnetic wave interactions on nonlinear scatterers using time domain volume integral equations

    KAUST Repository

    Ulku, Huseyin Arda

    2014-07-06

    Effects of material nonlinearities on electromagnetic field interactions become dominant as field amplitudes increase. A typical example is observed in plasmonics, where highly localized fields “activate” Kerr nonlinearities. Naturally, time domain solvers are the method of choice when it comes simulating these nonlinear effects. Oftentimes, finite difference time domain (FDTD) method is used for this purpose. This is simply due to the fact that explicitness of the FDTD renders the implementation easier and the material nonlinearity can be easily accounted for using an auxiliary differential equation (J.H. Green and A. Taflove, Opt. Express, 14(18), 8305-8310, 2006). On the other hand, explicit marching on-in-time (MOT)-based time domain integral equation (TDIE) solvers have never been used for the same purpose even though they offer several advantages over FDTD (E. Michielssen, et al., ECCOMAS CFD, The Netherlands, Sep. 5-8, 2006). This is because explicit MOT solvers have never been stabilized until not so long ago. Recently an explicit but stable MOT scheme has been proposed for solving the time domain surface magnetic field integral equation (H.A. Ulku, et al., IEEE Trans. Antennas Propag., 61(8), 4120-4131, 2013) and later it has been extended for the time domain volume electric field integral equation (TDVEFIE) (S. B. Sayed, et al., Pr. Electromagn. Res. S., 378, Stockholm, 2013). This explicit MOT scheme uses predictor-corrector updates together with successive over relaxation during time marching to stabilize the solution even when time step is as large as in the implicit counterpart. In this work, an explicit MOT-TDVEFIE solver is proposed for analyzing electromagnetic wave interactions on scatterers exhibiting Kerr nonlinearity. Nonlinearity is accounted for using the constitutive relation between the electric field intensity and flux density. Then, this relation and the TDVEFIE are discretized together by expanding the intensity and flux - sing half

  4. A produção escrita de histórias por crianças e sua relação com as habilidades de leitura e escrita de palavras/pseudopalavras

    Directory of Open Access Journals (Sweden)

    Jerusa Fumagalli de Salles

    2014-08-01

    Full Text Available L'étude décrit la production écrite d'histories par enfants avec trois années de scolarité dans écoles publiques et les compare entre sous-groupes de compétences em lecture et écriture de mots/pseudomots. Les productions textuelles ont été regroupés em cinq catégories: 54,6% de l'échantillon atteint catégories intermédiaires (III et IV, caractérisé par l'absence d'une situation problématique ou juste une esquisse de ça. Il existe une association significative entre les compétences dans le niveau de mot et la production de texte narratif écrit. Les enfants qui sont qualifiés dans la lecture et l'écriture de mots/pseudomots sont qualifiés dans la production de texte écrit aussi. L'inverse est également vrai. Le domaine des correspondances de graphèmes et phonèmes reguliérs em lecture et écriture semble être important pour la production écrite de texte narratif. Toutefois, le compétence en lecture de mots irréguliers semble être plus important que en le écriture de mots irréguliers par la production écrit de l'histoire.

  5. Visual attention measures predict pedestrian detection in central field loss: a pilot study.

    Science.gov (United States)

    Alberti, Concetta F; Horowitz, Todd; Bronstad, P Matthew; Bowers, Alex R

    2014-01-01

    The ability of visually impaired people to deploy attention effectively to maximize use of their residual vision in dynamic situations is fundamental to safe mobility. We conducted a pilot study to evaluate whether tests of dynamic attention (multiple object tracking; MOT) and static attention (Useful Field of View; UFOV) were predictive of the ability of people with central field loss (CFL) to detect pedestrian hazards in simulated driving. 11 people with bilateral CFL (visual acuity 20/30-20/200) and 11 age-similar normally-sighted drivers participated. Dynamic and static attention were evaluated with brief, computer-based MOT and UFOV tasks, respectively. Dependent variables were the log speed threshold for 60% correct identification of targets (MOT) and the increase in the presentation duration for 75% correct identification of a central target when a concurrent peripheral task was added (UFOV divided and selective attention subtests). Participants drove in a simulator and pressed the horn whenever they detected pedestrians that walked or ran toward the road. The dependent variable was the proportion of timely reactions (could have stopped in time to avoid a collision). UFOV and MOT performance of CFL participants was poorer than that of controls, and the proportion of timely reactions was also lower (worse) (84% and 97%, respectively; p = 0.001). For CFL participants, higher proportions of timely reactions correlated significantly with higher (better) MOT speed thresholds (r = 0.73, p = 0.01), with better performance on the UFOV divided and selective attention subtests (r = -0.66 and -0.62, respectively, pattention may provide useful measures of functional visual ability of individuals with CFL relevant to more complex mobility tasks.

  6. The effect of minocycline on the masticatory movements following the inferior alveolar nerve transection in freely moving rats

    Directory of Open Access Journals (Sweden)

    Mostafeezur Rahman

    2012-04-01

    Full Text Available Abstract Background To determine the effects of inferior alveolar nerve transection (IAN-X on masticatory movements in freely moving rats and to test if microglial cells in the trigeminal principal sensory nucleus (prV or motor nucleus (motV may be involved in modulation of mastication, the effects of microglial cell inhibitor minocycline (MC on masticatory jaw movements, microglia (Iba1 immunohistochemistry and the masticatory jaw movements and related masticatory muscle EMG activities were studied in IAN-X rats. Results The number of Iba1-immunoreactive (IR cells both in prV and motV was significantly larger in IAN-X rats compared with sham rats on day 3 after IAN-X. The intraperitoneal (i.p. administration of MC caused a significant reduction of the number of Iba1-IR cells both in prV and motV that was evident on day 14 after IAN-X. Furthermore, a significant reduction of the number of Iba1-IR cells could be observed in motV but not in prV after microinjection (m.i. of MC into the motV of IAN-X rats. The rats also exhibited a significant decrease in the head-withdrawal threshold on the side ipsilateral to the IAN-X compared to the threshold before IAN-X and it lasted to day 14. In addition, IAN-X markedly affected the ability to rat to carry out mastication. The number of complete masticatory sequences was significantly decreased. Furthermore, the total masticatory sequence time and food preparatory (PP period duration was significantly elongated in compared to sham rats. Although IAN-X significantly affected the total number of chewing cycles within the RC period of a masticatory sequence, it had no effect on the duration of the chewing cycles. On the other hand, systemic administration of MC (both i.p. and m.i. in IAN-X rats significantly improved decreased head-withdrawal threshold and the impaired masticatory jaw movements. Conclusions The present findings reveal that the strong modulation of masticatory jaw movements occurs following

  7. Progress toward studies of bubble-geometry Bose-Einstein condensates in microgravity with a ground-based prototype of NASA CAL

    Science.gov (United States)

    Lundblad, Nathan; Jarvis, Thomas; Paseltiner, Daniel; Lannert, Courtney

    2016-05-01

    We have proposed using NASA's Cold Atom Laboratory (CAL, launching to the International Space Station in 2017) to generate bubble-geometry Bose-Einstein condensates through radiofrequency dressing of an atom-chip magnetic trap. This geometry has not been truly realized terrestrially due to the perturbing influence of gravity, making it an ideal candidate for microgravity investigation aboard CAL. We report progress in the construction of a functional prototype of the orbital BEC apparatus: a compact atom-chip machine loaded by a 2D+MOT source, conventional 3D MOT, quadrupole trap, and transfer coil. We also present preliminary modeling of the dressed trap uniformity, which will crucially inform the geometric closure of the BEC shell surface as atom number, bubble radius, and bubble aspect ratio are varied. Finally, we discuss plans for experimental sequences to be run aboard CAL guided by intuition from ground-based prototype operation. JPL 1502172.

  8. On the internal resonant modes in marching-on-in-time solution of the time domain electric field integral equation

    KAUST Repository

    Shi, Yifei

    2013-08-01

    Internal resonant modes are always observed in the marching-on-in-time (MOT) solution of the time domain electric field integral equation (EFIE), although \\'relaxed initial conditions,\\' which are enforced at the beginning of time marching, should in theory prevent these spurious modes from appearing. It has been conjectured that, numerical errors built up during time marching establish the necessary initial conditions and induce the internal resonant modes. However, this conjecture has never been proved by systematic numerical experiments. Our numerical results in this communication demonstrate that, the internal resonant modes\\' amplitudes are indeed dictated by the numerical errors. Additionally, it is shown that in a few cases, the internal resonant modes can be made \\'invisible\\' by significantly suppressing the numerical errors. These tests prove the conjecture that the internal resonant modes are induced by numerical errors when the time domain EFIE is solved by the MOT method. © 2013 IEEE.

  9. Parallel, explicit, and PWTD-enhanced time domain volume integral equation solver

    KAUST Repository

    Liu, Yang

    2013-07-01

    Time domain volume integral equations (TDVIEs) are useful for analyzing transient scattering from inhomogeneous dielectric objects in applications as varied as photonics, optoelectronics, and bioelectromagnetics. TDVIEs typically are solved by implicit marching-on-in-time (MOT) schemes [N. T. Gres et al., Radio Sci., 36, 379-386, 2001], requiring the solution of a system of equations at each and every time step. To reduce the computational cost associated with such schemes, [A. Al-Jarro et al., IEEE Trans. Antennas Propagat., 60, 5203-5215, 2012] introduced an explicit MOT-TDVIE method that uses a predictor-corrector technique to stably update field values throughout the scatterer. By leveraging memory-efficient nodal spatial discretization and scalable parallelization schemes [A. Al-Jarro et al., in 28th Int. Rev. Progress Appl. Computat. Electromagn., 2012], this solver has been successfully applied to the analysis of scattering phenomena involving 0.5 million spatial unknowns. © 2013 IEEE.

  10. Explicit solution of Calderon preconditioned time domain integral equations

    KAUST Repository

    Ulku, Huseyin Arda

    2013-07-01

    An explicit marching on-in-time (MOT) scheme for solving Calderon-preconditioned time domain integral equations is proposed. The scheme uses Rao-Wilton-Glisson and Buffa-Christiansen functions to discretize the domain and range of the integral operators and a PE(CE)m type linear multistep to march on in time. Unlike its implicit counterpart, the proposed explicit solver requires the solution of an MOT system with a Gram matrix that is sparse and well-conditioned independent of the time step size. Numerical results demonstrate that the explicit solver maintains its accuracy and stability even when the time step size is chosen as large as that typically used by an implicit solver. © 2013 IEEE.

  11. EFFECT OF IMPERMEANT CRYOPROTECTANTS ON THE IN VITRO VIABILITY OF FROZEN SPERMATOZOA OF SWISS-ALBINA AND BALB/C MICE (Mus musculus EFEITO DE CRIOPROTETORES IMPERMEÁVEIS SOBRE A VIABILIDADE IN VITRO DE ESPERMATOZOIDES CONGELADOS DE CAMUNDONGOS (Mus musculus DAS LINHAGENS SWISS-ALBINA e BALB/c

    Directory of Open Access Journals (Sweden)

    Antonio Sergio Varela Junior

    2009-12-01

    Full Text Available

    The objective of this study was to evaluate the effect of three disaccharides (sucrose, threalose and lactose used as nonpenetrating cryoprotectants in extender for mice semen. The parameters evaluated were sperm motility (MOT and cleavage rate (CLV after in vitro fertilization in the SWISS-ALBINA and BALB/c lines. The treatments were S1=sucrose; S2=threalose; S3=lactose, for SWISS-ALBINA; and B1=lactose; B2=threalose for BALB/c.  MOT was evaluated after: thawing (THA, centrifugation and re-suspension in P-1 medium (CEN and after 10 minutes of incubation (10M. The MOT for the SWISS-ALBINA line was higher for S2 (P<0.001 in the 3 evaluated steps (47% at DES; 66.5% at CEN and 67.2% at 10M than for S1 (32.5% at DES; 51.5% at CEN and 47.7% at 10M and S3 (30% at DES, 46.5% at CEN and 32.7% at 10M. For the BALB/c line, MOT was superior for B2 than for B1 (P<0.001. Thus, the tested disaccharides, especially threalose, can be recommended for freezing of mice sperm.

    KEY WORDS: Cryopreservation, disaccharides, mice, semen. 

    O trabalho objetivou avaliar os efeitos dos dissacarídeos sacarose, trealose e lactose, como crioprotetores impermeáveis à membrana plasmática em diluentes para criopreservação de sêmen de camundongos. Para avaliação do sêmen utilizaram-se os seguintes parâmetros: motilidade progressiva (MOT das células espermáticas, e a taxa de clivagem embrionária (TXCL obtida por meio de fertilização in vitro, nas linhagens SWISS-ALBINA e BALB/c. Os tratamentos avaliados foram: S1=sacarose; S2=trealose; S3=lactose, para SWISS-ALBINA e B1=lactose; B2=trealose para BALB/c. Avaliou-se a MOT durante as seguintes etapas: descongelação (DES, centrifugação e ressuspensão no meio P-1 (CEN e após dez minutos de incubação (10M. A MOT no S2 para a linhagem SWISS-ALBINA nas três etapas (47% no DES; 66,5% na CEN e 67,2% no 10M foi superior (P<0,001 a S1 (32,5% no DES; 51,5% no

  12. Atom Trap Trace Analysis for radiokrypton and radioargon dating

    Science.gov (United States)

    Williams, William; Jiang, Wei; Sun, Yun; Bailey, Kevin; Davis, Andrew; Hu, Shuiming; Lu, Zheng-Tian; Mueller, Peter; O'Connor, Thomas; Purtschert, Roland; Sturchio, Neil

    2011-05-01

    Atom Trap Trace Analysis (ATTA), a MOT-based atom counting method, is used to analyze three noble gas radioisotopes (81Kr, 85Kr, 39Ar) covering a wide range of geological ages and applications in the earth sciences. Their isotopic abundances are extremely low, in the range of 10-16 - 10-11. Yet, ATTA can trap and unmistakably detect these rare isotopes one atom at a time. The system is currently limited by the excitation efficiency of the RF discharge that produces the metastable atoms (Kr* & Ar*) needed for laser trapping. To further improve the MOT loading rate, we plan to replace the RF discharge with a photon excitation scheme that employs a VUV light source at 124 nm. The VUV source can be a lamp or a free electron laser. This work is supported by DOE, Office of Nuclear Physics and by NSF, Division of Earth Sciences.

  13. On the internal resonant modes in marching-on-in-time solution of the time domain electric field integral equation

    KAUST Repository

    Shi, Yifei; Bagci, Hakan; Lu, Mingyu

    2013-01-01

    Internal resonant modes are always observed in the marching-on-in-time (MOT) solution of the time domain electric field integral equation (EFIE), although 'relaxed initial conditions,' which are enforced at the beginning of time marching, should in theory prevent these spurious modes from appearing. It has been conjectured that, numerical errors built up during time marching establish the necessary initial conditions and induce the internal resonant modes. However, this conjecture has never been proved by systematic numerical experiments. Our numerical results in this communication demonstrate that, the internal resonant modes' amplitudes are indeed dictated by the numerical errors. Additionally, it is shown that in a few cases, the internal resonant modes can be made 'invisible' by significantly suppressing the numerical errors. These tests prove the conjecture that the internal resonant modes are induced by numerical errors when the time domain EFIE is solved by the MOT method. © 2013 IEEE.

  14. Systembolagets monopol kontra EU:s fria rörlighet för varor

    OpenAIRE

    Edqvist, Daniel; Gisslén, Kristofer

    2006-01-01

    Denna uppsats strävar efter att besvara frågorna: Har systembolaget rätt att som ensam aktör bedriva detaljhandel av alkohol i Sverige? Strider nuvarande reglering av svensk import och export av vin och sprit mot EG-rätten? EG-domstolen har i flera fall rörande offentliga monopol fastslagit att dessa i sig inte utgör något brott mot EG-rätten, under förutsättning att de anpassas till övrig EG-rätt på konkurrensrättens område. Det är därför med anledning av detta fullt möjligt för Systembolage...

  15. OPTIMOT, a software package for computer-assisted modelling and optimized control of internal combustion engines on the test stand; OPTIMOT - Ein Softwarepaket zur rechnergestuetzten Modellbildung und optimierten Steuerung von Verbrennungsmotoren am Motorenpruefstand

    Energy Technology Data Exchange (ETDEWEB)

    Hafner, M.; Isermann, R. [Technische Univ. Darmstadt (Germany). Inst. fuer Automatisierungstechnik

    2002-07-01

    The OptiMot toolbox is a simple interface to the complex optimization algorithms of the model-based engine optimization process developed under MATLAB. Defaults enable also inexpert users to achieve good results. The optimization algorithms are based on static and dynamic neuronal emission models. The training data required for the neuronal nets were recorded on an engine test stand with in a very short time (about 1 h) using new dynamic measuring strategies. [German] Zusammenfassend konnte in diesem Beitrag die OptiMot-Toolbox als einfache Schnittstelle zu den komplexen Optimierungsalgorithmen der unter MATLAB entwickelten modellbasierten Motoroptimierung vorgestellt werden. Default-Einstellungen ermoeglichen hierbei auch ungeuebten Benutzern, schnell Ergebnisse zu erarbeiten. Die verwendeten Optimierungsalgorithmen selbst basieren auf statischen und dynamischen neuronalen Emissionsmodellen. Die benoetigten Trainingsdaten fuer die neuronalen Netze wurden mit Hilfe von neuen dynamischen Messstrategien in kurzer Zeit (ca. 1 h) am Motorenpruefstand erfasst. (orig.)

  16. High-resolution structure of TBP with TAF1 reveals anchoring patterns in transcriptional regulation.

    Science.gov (United States)

    Anandapadamanaban, Madhanagopal; Andresen, Cecilia; Helander, Sara; Ohyama, Yoshifumi; Siponen, Marina I; Lundström, Patrik; Kokubo, Tetsuro; Ikura, Mitsuhiko; Moche, Martin; Sunnerhagen, Maria

    2013-08-01

    The general transcription factor TFIID provides a regulatory platform for transcription initiation. Here we present the crystal structure (1.97 Å) and NMR analysis of yeast TAF1 N-terminal domains TAND1 and TAND2 bound to yeast TBP, together with mutational data. We find that yeast TAF1-TAND1, which in itself acts as a transcriptional activator, binds TBP's concave DNA-binding surface by presenting similar anchor residues to TBP as does Mot1 but from a distinct structural scaffold. Furthermore, we show how TAF1-TAND2 uses an aromatic and acidic anchoring pattern to bind a conserved TBP surface groove traversing the basic helix region, and we find highly similar TBP-binding motifs also presented by the structurally distinct TFIIA, Mot1 and Brf1 proteins. Our identification of these anchoring patterns, which can be easily disrupted or enhanced, provides insight into the competitive multiprotein TBP interplay critical to transcriptional regulation.

  17. Interaction of gamma radiation and temperature on the determination of the sterilizing dose of some stored products pests

    International Nuclear Information System (INIS)

    Barbosa, A.P.

    1976-08-01

    The influence of temperature on sterilizing dosages of gamma radiation was studied for Sitophilus zeamais Mots. in corn, Sitophilus oryzae (L.) in rice, Araecerus fasciculatus (DeGeer) in coffee, and Zabrotes subfasciatus (Boh.) in beans. It was found that temperature has a significant influence on the amount of radiation required to sterilize these species. The highest radiation dosages were required at those temperature most nearly optimum for insect development. The minimum radiation doses required for complete sterility of each species at the indicated temperatures were as follows: Sitophilus zeamais Mots. in corn, 8 krad at 24 0 C; Sitophilus oryzae (L.) in rice, 9 krad at 24 0 C; Araecerus fasciculatus (DeGeer) in coffee, 6 krad at 30 0 C; Zabrotes subfasciatus (Boh.) in beans, 9 krad at 24 - 27 0 C. At either higher or lower temperature smaller radiation dosages were required. (author) [pt

  18. IT4IT™ as a Management of Technology framework: Perspectives, implications and contributions

    DEFF Research Database (Denmark)

    Tambo, Torben; Filtenborg, Jacob

    2017-01-01

    Information technology (IT) is at the core of digitisation of existing business models and dominates in the innovation efforts of many industries. IT has until now in many ways been regarded as exempted from the structuration and automation represented by IT. The IT4IT framework released...... as a practical implementation of a Management of Technology framework and to review its perspectives and implications to the MoT society as well as the contributions it has to IT professionals, innovators and MoT practitioners. Methodologically this paper is based on an extensive case study of a large IT service...... from relative mature innovations to operational environments and life-cycle management. (2) IT4IT is driving IT further in the direction of commoditization and consumerization reducing uncertainty in IT implementation and operations and giving business stakeholders better opportunities for innovation...

  19. Transient analysis of electromagnetic wave interactions on high-contrast scatterers using volume electric field integral equation

    KAUST Repository

    Sayed, Sadeed Bin

    2014-07-01

    A marching on-in-time (MOT)-based time domain volume electric field integral equation (TD-VEFIE) solver is proposed for accurate and stable analysis of electromagnetic wave interactions on high-contrast scatterers. The stability is achieved using band-limited but two-sided (non-causal) temporal interpolation functions and an extrapolation scheme to cast the time marching into a causal form. The extrapolation scheme is designed to be highly accurate for oscillating and exponentially decaying fields, hence it accurately captures the physical behavior of the resonant modes that are excited inside the dielectric scatterer. Numerical results demonstrate that the resulting MOT scheme maintains its stability as the number of resonant modes increases with the contrast of the scatterer.

  20. Brève histoire d’une erreur lexicale. Polysémie et liens lexicaux dans l’enseignement du vocabulaire

    Directory of Open Access Journals (Sweden)

    Sikora Dorota

    2014-07-01

    Au-delà d’un diagnostic portant sur un ensemble d’erreurs, cette réflexion mène vers la question plus générale de l’objet de l’enseignement et de l’apprentissage du vocabulaire. Faut-il apprendre des mots, des familles des mots, des lexies ou des réseaux lexicaux ? Une fois de plus, nous chercherons des réponses du côté de lexique, en admettant que la démarche pédagogique et le processus d’apprentissage doivent porter sur ce dont le lexique d’une langue est fait : les lexies (ou unités lexicales et les relations qui les connectent dans le système lexical.

  1. Quand la maison devient papier, et le papier refuge

    Directory of Open Access Journals (Sweden)

    Clara Domingues

    2010-05-01

    Full Text Available Le voyageur de nulle part, un exilé dénommé Alfred, élit domicile au dernier sous-sol de l’aéroport Charles de Gaulle où il entasse des valises pleines de liasses de papiers et de journaux. Car Alfred écrit tout autant qu’il fait écrire les journalistes intrigués par son personnage, et l’intrication de son écriture et de celle des journalistes lui bâtit progressivement un refuge : refuge mental de mots et refuge physique de papiers entassés, comme autant de protections face à une société qui disloque la vie des humains au point que leur unique refuge ne soit plus que de papier, et leurs livres des mots sur des feuillets volatiles.

  2. Laser Cooling without Repumping: A Magneto-Optical Trap for Erbium Atoms

    International Nuclear Information System (INIS)

    McClelland, J.J.; Hanssen, J.L.

    2006-01-01

    We report on a novel mechanism that allows for strong laser cooling of atoms that do not have a closed cycling transition. This mechanism is observed in a magneto-optical trap (MOT) for erbium, an atom with a very complex energy level structure with multiple pathways for optical-pumping losses. We observe surprisingly high trap populations of over 10 6 atoms and densities of over 10 11 atoms cm -3 , despite the many potential loss channels. A model based on recycling of metastable and ground state atoms held in the quadrupole magnetic field of the trap explains the high trap population, and agrees well with time-dependent measurements of MOT fluorescence. The demonstration of trapping of a rare-earth atom such as erbium opens a wide range of new possibilities for practical applications and fundamental studies with cold atoms

  3. Molecules cooled below the Doppler limit

    Science.gov (United States)

    Truppe, S.; Williams, H. J.; Hambach, M.; Caldwell, L.; Fitch, N. J.; Hinds, E. A.; Sauer, B. E.; Tarbutt, M. R.

    2017-12-01

    Magneto-optical trapping and sub-Doppler cooling have been essential to most experiments with quantum degenerate gases, optical lattices, atomic fountains and many other applications. A broad set of new applications await ultracold molecules, and the extension of laser cooling to molecules has begun. A magneto-optical trap (MOT) has been demonstrated for a single molecular species, SrF, but the sub-Doppler temperatures required for many applications have not yet been reached. Here we demonstrate a MOT of a second species, CaF, and we show how to cool these molecules to 50 μK, well below the Doppler limit, using a three-dimensional optical molasses. These ultracold molecules could be loaded into optical tweezers to trap arbitrary arrays for quantum simulation, launched into a molecular fountain for testing fundamental physics, and used to study collisions and chemistry between atoms and molecules at ultracold temperatures.

  4. Tracing Impact in a Usability Improvement Process

    DEFF Research Database (Denmark)

    Uldall-Espersen, Tobias; Frøkjær, Erik; Hornbæk, Kasper Anders Søren

    2008-01-01

    Analyzing usability improvement processes as they take place in real-life organizations is necessary to understand the practice of usability work. This paper describes a case study where the usability of an information system is improved and a relationship between the improvements...... and the evaluation efforts is established. Results show that evaluation techniques complemented each other by suggesting different kinds of usability improvement. Among the techniques applied, a combination of questionnaires and Metaphors of Human Thinking (MOT) showed the largest mean impact and MOT produced...... the largest number of impacts. Logging of real-life use of the system over 6 months indicated six aspects of improved usability, where significant differences among evaluation techniques were found. Concerning five of the six aspects Think Aloud evaluations and the above-mentioned combination of questionnaire...

  5. Les albums de jeunesse en langues étrangères, un moyen détourné pour développer les compétences inférentielles et interprétatives des élèves ?

    OpenAIRE

    Isoz, Annick; Gremaud, Coralie; Deschoux, Carole-Anne

    2016-01-01

    Les albums en langues étrangères peuvent-ils être une entrée pour développer les compétences inférentielles et interprétatives? De nombreux élèves présentent des difficultés en compréhension écrite. Or lorsqu’on se penche sur la question, nous constatons que cette dernière est très peu enseignée et que les élèves ont souvent une représentation erronée de ce qu’est l’acte de lire. Ils la réduisent à une compréhension mot à mot et ne prennent pas en compte les dimensions inférentielles et inter...

  6. Effet de la substitution partielle de la farine de blé par la purée de ...

    African Journals Online (AJOL)

    La production de la pulpe séchée peut se faire à moindre coût. Mots clés : Substitution partielle, Farine de blé, Pulpe séchée, Purée de banane plantain Musa AAB, Gâteaux de plantain. Effect of partial substitution of wheat flour with mashed ripe plantain (Musa AAB) on pastry products quality. Objective: Plantain, third food ...

  7. Social Networks in Crisis Response: Trust is Vital

    Science.gov (United States)

    2016-06-01

    Meeting of the APANPIRG ATM Sub-Group (ATM/SG/2).” Hong Kong, China, August 4-8, 2014. [72] Australian Maritime Safety Authority. “Search for Malaysia ...response community as a whole. iv  2014 search for Malaysia Airlines Flight 370 (MH370)  2012 South Sudan WASH crisis  2004 Indian...Meteorological and Oceanographic MH370 Malaysia Airlines Flight 370 MOT Malaysia Ministry of Transportation xiv MSF Doctors Without Borders

  8. LE CARCINOME ONCOCYTAIRE DE LA PAROTIDE : A PROPOS D ...

    African Journals Online (AJOL)

    Après chirurgie, les récidives sont fréquentes. Le rôle de la radio- thérapie et de chimiothérapie est toujours controversé.Le pronostic est mauvais. Mots clés : Carcinome oncocytaire, parotide, chirurgie, radiothérapie. SUMMARY. Introduction : Oncocyticcarcinomais a rare salivary gland tumor. its management is not codified ...

  9. Étude des lésions anatomo-pathologiques des Tilapia et Clarias ...

    African Journals Online (AJOL)

    SARAH

    29 déc. 2014 ... marchés de Lubumbashi témoignent de la mauvaise qualité du produit consommé à cause du danger présenté pour l'homme (toxi- ... Mots- clés: Poisson, Tilapia, Clarias, lésions anatomo-pathologiques, marché, Lubumbashi. ABSTRACT ... sequestration of fishing products that pose a danger to the public.

  10. The Theme of “A New Lost Generation” in the Production of Prešov National Theatre

    OpenAIRE

    Knopová Elena

    2017-01-01

    The authoress elucidates the concepts of generations and generational affiliation, while focusing on various names and characteristics referring to a group of young people born during the 1980s and early 1990s. She introduces Generation Y, also called Millennials, and gives a short characteristic of a generation referred to as the Lost Generation, the Set-aside Generation, the Scarred Generation. She captures the external manifestations of the generation together with inner mechanisms and mot...

  11. Downsizing Survivors and their Post-Era Behavior

    OpenAIRE

    Karjalainen, Petra; Tyynelä, Jonna

    2016-01-01

    The interest towards managing structural change successfully through downsizing activities has increased as a result of globalization and the recent economic, technological and demographic changes occurring across Europe. As a result of downsizing activities companies often break a Psychological Contract that an employee has established with the organization when starting the employment contract. This results in employees experiencing negative feelings, lack of motivation, inability to re-mot...

  12. A circularly polarized optical dipole trap and other developments in laser trapping of atoms

    Science.gov (United States)

    Corwin, Kristan Lee

    Several innovations in laser trapping and cooling of alkali atoms are described. These topics share a common motivation to develop techniques for efficiently manipulating cold atoms. Such advances facilitate sensitive precision measurements such as parity non- conservation and 8-decay asymmetry in large trapped samples, even when only small quantities of the desired species are available. First, a cold, bright beam of Rb atoms is extracted from a magneto-optical trap (MOT) using a very simple technique. This beam has a flux of 5 × 109 atoms/s and a velocity of 14 m/s, and up to 70% of the atoms in the MOT were transferred to the atomic beam. Next, a highly efficient MOT for radioactive atoms is described, in which more than 50% of 221Fr atoms contained in a vapor cell are loaded into a MOT. Measurements were also made of the 221Fr 7 2P1/2 and 7 2P3/2 energies and hyperfine constants. To perform these experiments, two schemes for stabilizing the frequency of the light from a diode laser were developed and are described in detail. Finally, a new type of trap is described and a powerful cooling technique is demonstrated. The circularly polarized optical dipole trap provides large samples of highly spin-polarized atoms, suitable for many applications. Physical processes that govern the transfer of large numbers of atoms into the trap are described, and spin-polarization is measured to be 98(1)%. In addition, the trap breaks the degeneracy of the atomic spin states much like a magnetic trap does. This allows for RF and microwave cooling via both forced evaporation and a Sisyphus mechanism. Preliminary application of these techniques to the atoms in the circularly polarized dipole trap has successfully decreased the temperature by a factor of 4 while simultaneously increasing phase space density.

  13. adaptation et selection de varietes performantes de riz pluvi

    African Journals Online (AJOL)

    PROJET SOJA

    Mots-clés : « Web usage mining », extraction de connaissances, fichier Log, méthode. « A Priori », algorithme, théorie de décision. Abstract. Log file treatment and exploration of the web site, for extracting and mining the knowledges : Web usage mining. The aim of this work is to design and produce one tool and implement, ...

  14. Etat des lieux sur l'entrepreneuriat feminin dans la wilaya de Djelfa ...

    African Journals Online (AJOL)

    Abstract. En Algérie, l'entrepreneuriat féminin est faible malgré la politique volontariste de l'Etat pour booster l'activité féminine qui se trouve être la plus faible dans le Maghreb. Seulement 5 % des ... et la gestion de leur projet. Mots clefs: Entreprenariat féminin, Djelfa, Investissement, Micro crédit, Développement social ...

  15. Ce que nous faisons | Page 52 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Consultez notre bibliothèque de projets. Nous avons financé plus de 1 000 projets au cours de la dernière décennie. Vous pouvez les consulter tous ici. Mots-clés. Sujet(s). - Tout -, Développement, Économie, Environnement, Évaluation, Alimentation et agriculture, Gouvernance, Santé, Information et communication, Divers ...

  16. Les bactéries sporulées dans les conserves de légumes (petits pois ...

    African Journals Online (AJOL)

    Unicornis

    brevis (4.53%). Mots clés : Conserves végétales - Petits pois- Bactéries sporulées - Identification biochimique. Abstract. For a consumer more and more aware about the risks for his health, regarding the food he buys, the aim of this study is to verify the hygienic quality of ten batches, each one contains five green peas cans, ...

  17. "Genette devient écrivain"

    NARCIS (Netherlands)

    Schuerewegen, F.M.J.

    2012-01-01

    On ne naît pas écrivain, on le devient, souvent pour une série de raisons qui n’ont pas grand-chose à voir avec un projet personnel et qui relèvent plutôt de ce qu’on appelle, avec le mot de Stanley Fish, la « communauté interprétative ». Il en va sans doute de même de la fameuse distinction que

  18. The streptomycin-treated mouse intestine selects Escherichia coli envZ missense mutants that interact with dense and diverse intestinal microbiota.

    Science.gov (United States)

    Leatham-Jensen, Mary P; Frimodt-Møller, Jakob; Adediran, Jimmy; Mokszycki, Matthew E; Banner, Megan E; Caughron, Joyce E; Krogfelt, Karen A; Conway, Tyrrell; Cohen, Paul S

    2012-05-01

    Previously, we reported that the streptomycin-treated mouse intestine selected nonmotile Escherichia coli MG1655 flhDC deletion mutants of E. coli MG1655 with improved colonizing ability that grow 15% faster in vitro in mouse cecal mucus and 15 to 30% faster on sugars present in mucus (M. P. Leatham et al., Infect. Immun. 73:8039-8049, 2005). Here, we report that the 10 to 20% remaining motile E. coli MG1655 are envZ missense mutants that are also better colonizers of the mouse intestine than E. coli MG1655. One of the flhDC mutants, E. coli MG1655 ΔflhD, and one of the envZ missense mutants, E. coli MG1655 mot-1, were studied further. E. coli MG1655 mot-1 is more resistant to bile salts and colicin V than E. coli MG1655 ΔflhD and grows ca. 15% slower in vitro in mouse cecal mucus and on several sugars present in mucus compared to E. coli MG1655 ΔflhD but grows 30% faster on galactose. Moreover, E. coli MG1655 mot-1 and E. coli MG1655 ΔflhD appear to colonize equally well in one intestinal niche, but E. coli MG1655 mot-1 appears to use galactose to colonize a second, smaller intestinal niche either not colonized or colonized poorly by E. coli MG1655 ΔflhD. Evidence is also presented that E. coli MG1655 is a minority member of mixed bacterial biofilms in the mucus layer of the streptomycin-treated mouse intestine. We offer a hypothesis, which we call the "Restaurant" hypothesis, that explains how nutrient acquisition in different biofilms comprised of different anaerobes can account for our results.

  19. Le chomage endemique: un effet dysfonctionnel du modele ivoirien ...

    African Journals Online (AJOL)

    ... de l'action des différents gouvernements qui se sont succédés et contrarient leur projet d'assurer le plein-emploi. Mots-clés: Crise de l'emploi ; Chômage ; Côte d'Ivoire ; miracle ivoirien ; Economie-politique de la Côte d'Ivoire. English Title: Endemic unemployment: a dysfunctional effect of the Ivoirian Development Model.

  20. Knowledge and attitudes of parents toward children with epilepsy ...

    African Journals Online (AJOL)

    Certains parents pensaient que l'épilepsie était lié avec l'attaque de mauvais esprit/démoniaque et contagieuse. Quelques-uns d'entre eux a rejeté l'épilepsie mot et ne pensent pas qu'un enfant épileptique pourrait atteindre beaucoup dans la vie. Les connaissances sur les caractéristiques cliniques et les procédures ...

  1. Multiple Object Permanence Tracking: Maintenance, Retrieval and Transformation of Dynamic Object Representations

    OpenAIRE

    Saiki, Jun

    2008-01-01

    Multiple object permanence tracking (MOPT) task revealed that our ability of maintaining and transforming multiple representations of complex feature-bound objects is limited to handle only 1-2 objects. Often reported capacity of 3-5 objects likely reflects memory for partial representations of objects and simple cases such as just color and their locations. Also, performance in multiple object tracking (MOT) task is likely mediated by spatiotemporal indices, not by feature-bound object repre...

  2. utilisation du semoir philippin, une alternative au repiquage du riz ...

    African Journals Online (AJOL)

    1Institut d'Economie Rurale (IER) - Equipe Système et Gestion des Ressources Naturelles (ESPGRN), Centre Régional de Recherche ... Mots clés : Riziculture irriguée, semoir philippin, économie semences, économie temps de travail, rendement riz .... échantillons, mais qui fait appel à la mémoire et la subjectivité de ...

  3. Effet variétal et du traitement fongicide sur la sévérité de la maladie ...

    African Journals Online (AJOL)

    utilisation intégrée des variétés moins sensibles (PNG, PNN et TY 3396-12), des variétés fortement productives (MEX 142 et MAC 33) et du fongicide manèbe améliore la production du haricot commun. Mots clés : Variétés, taches angulaires, ...

  4. LA MÉTAPLASIE MALPIGhIENNE DANS LE CARCINOME ...

    African Journals Online (AJOL)

    Conclusion : bien que rare, la métaplasie malpighienne peut se voir dans la thyroïde. Elle doit être distinguée d'un car- cinome épidermoïde de la thyroïde par la recherche systématique, devant tout foyer de métaplasie malpighienne, des signes de malignité. Mots clés : métaplasie malpighienne, carcinome papillaire, ...

  5. 655-IJBCS-Article- Dr Madjidou Oumarou

    African Journals Online (AJOL)

    DR GATSING

    4 Laboratoire d'Ecologie Appliquée, Faculté des sciences Agronomiques,. Université d'Abomey-Calavi 01 BP ... All rights reserved. Mots clés : potentiel pastoral, Invasion biologique, écologie, conduite de l'élevage, Bénin. INTRODUCTION ..... problème d'alimentation est aggravé avec l'arrivée des bovins transhumants ...

  6. Capacité de la biopsie de la prostate à prédire le score réel du ...

    African Journals Online (AJOL)

    Y. Dehayni

    Disponible sur Internet le 8 août 2016. MOTS CLÉS .... Les résultats de notre étude ont démontré que bien qu'il y ait eu une bonne concordance, un .... tion des stratégies thérapeutiques, dans l'espoir que des recherches futures améliorent les ...

  7. angiomyxome agressif de la joue

    African Journals Online (AJOL)

    Les aspects cliniques, histologiques et thérapeutiques de la tumeur ont été discutés. Mots-clés : L'angiomyxome agressif, tumeur mésenchymateuse, exérèse, récidive. SUMMARY. An aggressive angiomyxoma is a mesenchymal tumour arising from connective tissues with a predilection for the fema- le pelvic soft parts.

  8. La surveillance des abords vasculaires chez les hémodialysés ...

    African Journals Online (AJOL)

    La fistule artério veineuse a présenté très peu de complications chez les patients. Mots clés : Abord vasculaire, Hémodialyse, insuffisance rénale chronique. English abstract. Monitoring of vascular access in chronic hemodialysis patients at the National Hospital of Niamey Lamordé The purpose of this cross-sectional study ...

  9. A new approach to the classification of African oral texts | Kam ...

    African Journals Online (AJOL)

    Toutes ces raisons ont conduit à un nouvel examen des différents genres oraux dans le cadre africain et à proposer une division de ces textes en cinq grandes catégories. Mots clés: littérature orale, genres oraux, textes oraux, discours, énoncés, jeux de plaisanterie, chercheurs en littérature orale. Tydskrif vir Letterkunde ...

  10. Apport de l'echographie dans les contusions abdominales de l ...

    African Journals Online (AJOL)

    Conclusion : l'échographie joue un rôle déterminant dans le bilan lésionnel dans les contusions abdominales, cependant son utilisation reste limitée dans le domaine pédiatrique au CHU SO de Lomé, d'où la nécessité d'une plus large diffusion de cet outil diagnostic. Mots clés : contusion abdominale, enfant, échographie, ...

  11. bacteriologie de l'otite moyenne suppuree chronique de l'enfant au ...

    African Journals Online (AJOL)

    Conclusion : Ainsi le rôle pathogène de staphylococcus aureus est prépondérant dans les otites moyennes suppurées chroniques de l'enfant dans notre unité. Mots-clés : bactériologie - otite moyenne suppurée chronique - enfant. Introduction: L'otite moyenne suppurée chronique est une affection fréquente chez l'enfant.

  12. Effect of School-based Human Papillomavirus (HPV) Vaccination on ...

    African Journals Online (AJOL)

    ... de comportement des pairs positifs. Des obstacles majeurs à l'acceptation du vaccin ont été: les rumeurs et les idées fausses au sujet des effets secondaires possibles, information inadéquate perçue sur le vaccin, et la peur des effets secondaires. Mots clés: adolescentes; connaissances; acceptabilité; vaccin; Ouganda ...

  13. Benefits and challenges of using social media in marketing strategy:investigating small- and medium-sized companies in the Oulu region

    OpenAIRE

    Orajärvi, P. (Paavo)

    2016-01-01

    Abstract This thesis explains what social media marketing is as a phenomenon and what kind of roles it can fill in a company’s overall marketing strategies. The thesis also provides very practical information on how small/medium-sized companies can use social media channels in their daily marketing activities. This has been achieved through a literature review on the topic supported by an empirical multi-case study. The mot...

  14. Analyse des images satellitales radar RSO-ERS et optique ETM+ de ...

    African Journals Online (AJOL)

    ... l'analyse des images satellitales est un outil¸ au même titre que par exemple, la géophysique de prospection minière. Les spatio-cartes géologiques obtenues peuvent permettre de mieux planifier les travaux miniers sur le terrain. Mots-clés : images satellitales, Radar RSO-ERS, ETM+ - LANDSAT 7, prospection minière, ...

  15. Caractérisation de la variabilité climatique : cas du bassin versant ...

    African Journals Online (AJOL)

    DK

    Cette étude présente l'intérêt de certaines méthodes statistiques, pour interpréter la variabilité spatiotemporelle ... Mots-clés : Sécheresse - Variabilité climatique - Fraction pluviométrique - Bassin versant Medjerda - Est de .... global actuel, aussi bien l'espérance ...... de l'Afrique de l'Ouest non sahélienne entre 1950-1989.

  16. Integration et exclusion des communautes : La curieuse ...

    African Journals Online (AJOL)

    Les données que nous y présentons procèdent d'une démarche méthodologique qui a consisté à combiner la recherche documentaire et l'observation des pratiques sportives de diverses communautés aussi bien à l'échelle locale que globale. Mots clés : Sport, société, socialisation, intégration, exclusion. English Abstract.

  17. Hypogammaglobulinémie acquise associée au thymome: le ...

    African Journals Online (AJOL)

    La tomodensitométrie thoracique a permis de mettre en évidence des dilatations des bronches associées à un thymome confirmé sur pièce opératoire. La découverte d'une hypogammaglobulinémie a permis de porter le diagnostic de syndrome de Good. Mots clés: Thymome, hypogammaglobulinémie, syndrome de Good.

  18. Le "Re" en Idaasha | Ayena | Journal de la Recherche Scientifique ...

    African Journals Online (AJOL)

    L'usage de ce morphème accorde à l'interrogation le statut d'interrogation totale. Ainsi, dans en idaasha, le foyer de l'interrogation peut porter non seulement sur tout l'énoncé, mais aussi sur l'un des constituants. Mots clés: idaasha, dialecte, interrogation, portée, prosodie. English Title: "Re" in Idaasha. English Abstract.

  19. Download this PDF file

    African Journals Online (AJOL)

    FOBUR

    smgle mo~• important means o-f preventing hosp~t~J acquired infection.'".~ kobo l~ba&ed hand. Nbs (liquiru; geJs or foams) are the· preferred melluxl for hEUld hygiene in mo~t situations du-e to tln: superior effie~>· or the~ El.,gents in rapidly. reduGing tmcte.rlal counts on hands and their cue of usc.'Hnnd hygiene is done ...

  20. Dégradation photocatalytique du 5-fluorouracile par un système UV ...

    African Journals Online (AJOL)

    Mots clés : 5-fluorouracile, UV-A/TiO2, eau ultra pure, eau bicarbonatée, eau usée. Photocatalytic degradation of 5-fluorouracil by a UV-A / TiO2 system: effect of catalyst concentration and pollutant, pH and dilution matrices. ABSTRACT. Residues of anticancer drugs are among the emerging micropollutants often identified ...

  1. régression linéaire multiple

    African Journals Online (AJOL)

    Mots clés: Alcools et phénols – Représentation numérique de la structure chimique – Facteur acentrique – Régression linéaire multiple – Modèle RSP hybride. English Title: Structure / acentric factor relationship of alcohols and phenols: genetic algorithm – multiple linear regression approach. English Abstract. The acentric ...

  2. Von Krahl klaarib piraadina asju euroliidus / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2006-01-01

    Von Krahli Teatri selle hooaja eelviimane esietendus "Europiraadid" on 17. mail Düsseldorfis, koostöös Saksamaa teatrirühmaga Showcase Beat Le Mot. (Varem on tehtud sama teatrirühmaga koostöös "Piraadid", mida mängiti nii Eestis kui Saksamaal). Eesti poole pealt teevad kaasa Juhan Ulfsak, Taavi Eelmaa, Maarja Jakobson ja Rain Tolk. Sakslaste poole pealt on tegijad Nikola Duric, Thorsten Eibler, Dariusz Kostyra ja Veit Spengler

  3. germination et accumulation des metabolites chez les plantules

    African Journals Online (AJOL)

    AISA

    semaines, trois séries de 7 plantes ont été prélevées dans chaque milieu de culture en vue d'évaluer les teneurs en lipides, protéines et proline. ... Mots clés : Stress salin, légumineuses, NaCl, accumulation des métabolites, Cameroun. ABSTRACT .... quotidiennement, l'émergence de la radicule étant l'indicateur de la ...

  4. The Application of KINECT Motion Sensing Technology in Game-Oriented Study

    OpenAIRE

    Hui Yu Yang; Hao Zhang; Wei Xu; Ping Jian Zhang; Liang Ming Xu

    2014-01-01

    The learning environment based on the KINECT Motion Sensing technology is able to fully mobilize the learners' multi-sensory organs, closely combine study with sports and enhance human-computer interactions, which can be conducive to the learners' health, greatly increase the relishes of learning and promote effective learning in the game, and finally compensate for the shortage of human-computer interactions in the traditional mouse and keyboard mode. The article elaborates on the KINECT Mot...

  5. Les marqueurs d'une stratégie de gestion de la charge de la preuve: franchement et en fait qualifiant une thèse

    NARCIS (Netherlands)

    Tseronis, A.

    2010-01-01

    Jusqu’à présent, la plupart des études qui font le point sur l’inscription linguistique de l’argumentation s’intéressent plutôt au « potentiel indiciaire » des mots et des locutions étudiés et négligent leur effet stratégique potentiel dans le discours argumentatif. Dans cet article, je propose une

  6. Department of the Navy Supporting Data for Fiscal Year 1984 Budget Estimates Descriptive Summaries Submitted to Congress January 1983. Research, Development, Test and Evaluation, Navy. Book 2. Tactical Programs

    Science.gov (United States)

    1983-01-01

    Production Releass for the Army, OPv and At, Force is in ty 1991. Production of 602 uitcrcft for the Marine Corps and May) will be completed :n tY 1998 ...Fy 1965 3. Operational Test and Evaluation (USKO) Secoad Quartet FY 1998 4. First USEC delivery Third Quarter FY 1991 5. USA/USAF/USN Delivery First...vehicular mounted loler power unite. (U) Project C0075. Tactical Mot Tranprt Vehicles: This program is to provide the optimum mix of tactical motor

  7. Business Plan for Launching a Luxury Adventure Tour Operator Based in Canada

    OpenAIRE

    Hung, Greg; Khlystov, Nikolai

    2011-01-01

    MOT Elite Travel Experiences (METE) is a tour operator and online travel agent start-up company based in Vancouver, British Columbia. METE is faced with the challenge of establishing itself as a business in the travel industry. However, recent advances in technology such as an increase in the number of broadband Internet users, search engine optimization, and the advent of smartphones have created an opportunity to capitalize on the growing popularity of online travel booking services. This t...

  8. The active straight leg raising test and mobility of the pelvic joints

    OpenAIRE

    Mens, J. M. A.; Vleeming, Andry; Snijders, Chris J.; Stam, Henk J.; Ginai, Abida Z.

    1999-01-01

    Objective signs to assess impairment in patients who are disabled by peripartum pelvic girdle pain hardly exist. The purpose of this study was to develop a clinical test to quantify and qualify disability in these patients. The study examined the relationship between impaired active straight leg raising (ASLR) and mobility of pelvic joints in patients with peripartum pelvic girdle pain, focusing on (1) the reduction of impairment of ASLR when the patient was wearing a pelvic belt, and (2) mot...

  9. Visual working memory contaminates perception

    OpenAIRE

    Kang, Min-Suk; Hong, Sang Wook; Blake, Randolph; Woodman, Geoffrey F.

    2011-01-01

    Indirect evidence suggests that the contents of visual working memory may be maintained within sensory areas early in the visual hierarchy. We tested this possibility using a well-studied motion repulsion phenomenon in which perception of one direction of motion is distorted when another direction of motion is viewed simultaneously. We found that observers misperceived the actual direction of motion of a single motion stimulus if, while viewing that stimulus, they were holding a different mot...

  10. Datation de l'infection a Toxoplasma gondii chez 128 femmes ...

    African Journals Online (AJOL)

    L'utilisation de ce test dans les laboratoires de biologie médicale au Togo pourrait contribuer à améliorer la prise charge adéquate des femmes enceintes au Togo. Mots clés: Toxoplasmose, sérologie, test d'avidité, femmes enceintes, Togo. English Title: Datation of Toxoplasma gondii infection among pregnant women in a ...

  11. Coordonnateur, Gestion des documents | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Classifier, indexer, faire des références croisées et identifier les documents relatifs aux projets et aux activités administratives du CRDI en attribuant, conformément au plan de classification des documents du Centre, le numéro de dossier et le titre appropriés de chaque dossier et les mots-clés servant à la recherche;.

  12. Approche SIG pour une analyse spatiale des infrastructures ...

    African Journals Online (AJOL)

    SARAH

    31 janv. 2014 ... SIG jouent un rôle primordial dans l'implantation, le suivi et la gestion des infrastructures hydrauliques. L'utilisation de ces outils peut atténuer les difficultés d'approvisionnement en eau. Mots clés : SIG, distribution spatiale, infrastructure hydraulique, Zè, Bénin. ... accès à un dispositif d'assainissement de.

  13. The effect of a motivational intervention on weight loss is moderated by level of baseline controlled motivation

    OpenAIRE

    Webber, Kelly H; Gabriele, Jeanne M; Tate, Deborah F; Dignan, Mark B

    2010-01-01

    Abstract Background Clinic-based behavioral weight loss programs are effective in producing significant weight loss. A one-size-fits-all approach is often taken with these programs. It may be beneficial to tailor programs based on participants' baseline characteristics. Type and level of motivation may be an important factor to consider. Previous research has found that, in general, higher levels of controlled motivation are detrimental to behavior change while higher levels of autonomous mot...

  14. Original Paper Evaluation de la fonction rénale chez les patients ...

    African Journals Online (AJOL)

    Evaluation de la fonction rénale chez les patients atteints de maladie cardio vasculaire (MCV) : comparaison entre ... Mots clés : Cystatine C, créatinine, insuffisance rénale, débit de filtration glomérulaire, maladies cardiovasculaires. Evaluation of the ... L'insuffisance rénale chronique (IRC) et les maladies cardiovasculaires ...

  15. La tuberculose iléo-caecale : à propos de deux cas au CHU ...

    African Journals Online (AJOL)

    Le traitement antituberculeux instauré était conforme au protocole du programme national burkinabè de lutte contre la tuberculose. L'évolution a été favorable dans les deux cas. Mots clés: tuberculose - jonction iléocaécale - traitement antituberculeux - chirurgie. English Abstract. The ileo-caecal tuberculosis is rare and ...

  16. Tuberculose orale secondaire: a propos d'un cas a Lome | Bissa ...

    African Journals Online (AJOL)

    L'intérêt de cette présentation est d'attirer l'attention sur la tuberculose que l'on peut retrouver de façon exceptionnelle dans certaines localisations, comme la cavité buccale. Mots-clés: tuberculose orale ; nécrose caséeuse ; tuberculose pulmonaire. English Title: Secondary orale tuberculosis: about one case at Lome.

  17. Militantisme Politique et Entrepreneuriat :: relations de dépendance ...

    African Journals Online (AJOL)

    d'entreprise doivent rimer et concourir au développement de l'économie d'une nation. Mots clés: militantisme politique- entrepreneurs politiques- entrepreneuriat -politique- économie ..... à des facilités économiques.9 Cette stratégie n'est pas nouvelle au Cameroun lorsque l'on sait .... Le recrutement se fait sous la base.

  18. Study of Managerial Challenges Confronting a New Agency: The Case of the Malaysian Maritime Enforcement Agency

    Science.gov (United States)

    2015-06-01

    Environment Public Works Rural Development Science, Technology, & Innovation Tourism Transport (MOT) Women, Family, & Community Affairs Youth... Sports 8 2. The Role of Ministries The ministries discussed in the paper are of those that are relevant to the administration and management of...and tourism , and ultimately jeopardize defense and security. 2. History A Nucleus Team for the MMEA’s establishment was initiated in 2002 with the

  19. Effet de la substitution partielle de la farine de blé par la purée de ...

    African Journals Online (AJOL)

    SARAH

    31 oct. 2014 ... de plantain bien mûr pourrait être recommandée aux industries locales dans la fabrication des produits de pâtisserie de haute qualité. La production de la pulpe séchée peut se faire à moindre coût. Mots clés : Substitution partielle, Farine de blé, Pulpe séchée, Purée de banane plantain Musa AAB,.

  20. Africa Development - Vol 35, No 3 (2010)

    African Journals Online (AJOL)

    (Re)produire, marquer et (s')approprier des « lieux (publics) de ville » par les mots ou comment les murs (dé)font les langues à Dschang · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JB Tsofack, 93-117. http://dx.doi.org/10.4314/ad.v35i3.70209 ...

  1. Author Details

    African Journals Online (AJOL)

    Tsofack, JB. Vol 35, No 3 (2010) - Articles (Re)produire, marquer et (s')approprier des « lieux (publics) de ville » par les mots ou comment les murs (dé)font les langues à Dschang Abstract PDF. ISSN: 0850-3907. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More ...

  2. 39 VetoMed : un système expert à base d'icônes pour la médecine ...

    African Journals Online (AJOL)

    PR BOKO

    Mots-clés: système expert, générateur de systèmes expert, base de connaissances, médecine traditionnelle vétérinaire, plantes médicinales, interface iconique, tradipraticien. Abstract. VetoMed : An icon-based expert system for Traditional Veterinary Medicine. In this paper we propose an expert system in which, icons are ...

  3. Exploring the learnings derived from catalytic experiences in a leadership context

    OpenAIRE

    Daphna S. Horowitz; René van Eeden

    2015-01-01

    Orientation: Personal leadership comprises self-awareness, authenticity, inspiration and passion. The concept of personal leadership was explored together with its relationship with leadership-related learnings derived from a catalytic experience. Research purpose: The objective of the study was to explore the leadership-related learnings derived from a catalytic experience and any connection between these learnings, personal leadership and leadership in an organisational context. Mot...

  4. Effective Methods and Emerging Trends in Engineering Education ...

    African Journals Online (AJOL)

    Mots clés: ingénierie; éducation; approches; qualité; certification. Engineering education plays a very important role in the social and economic development of a nation as well as its standing in the world. During the 19th and 20th centuries, engineering “disintegrated” into specific disciplines. The 21st century will instead be ...

  5. Analyse du bruit dans un préamplificateur de harge en technologie ...

    African Journals Online (AJOL)

    Aussi la valeur de l'ENC total est essentiellement dominée par l'expression du bruit thermique du transistor d'entrée et cette derniere peut etre optimisée au détriment de la consommation en jouant sur ID. La valeur du courant de drain et le dimensionnement du transistor d'entrée sont décisifs pour le bruit. Mots-clés : bruit ...

  6. Tsitutu , ou mecanisme local de mediation et de reconciliation « par ...

    African Journals Online (AJOL)

    Par ailleurs, ce rituel qui tente de proposer des solutions endogènes aux crises, fait office d'une médiation qui retrace une diplomatie africaine de résolution des conflits. Mots clés: Tsitutu, mécanisme, médiation, réconciliation, rituel, sociopolitiques. English Title: Tsitutu, or a local mechanism of mediation and reconciliation ...

  7. Kvinners rett til liv og helse : en studie av abortloven i Nicaragua

    OpenAIRE

    Salvesen, Camilla Holst

    2009-01-01

    Sammenhengen mellom internasjonale menneskerettigheter og nasjonal lovgivning er utgangspunktet for denne oppgaven som handler om endringen i Nicaraguas abortlov. Tidligere var det, som i de aller fleste land i verden, tillat å ta såkalt terapeutisk abort- i tilfeller der kvinnens liv og helse står i fare. Mot slutten av 2006 ble denne loven endret. Flere advokater, leger og menneskerettighetsforkjempere hevder lovendringen er i strid med menneskerettighetene, slik som for eksempel rett til l...

  8. Jeux et enjeux autour de l'insertion professionnelle des jeunes ...

    African Journals Online (AJOL)

    S'inscrivant dans une certaine logique d'action, ces stratégies sont développées autant sur les plans physique, que métaphysique. Mots clés : Jeux, enjeux, insertion professionnelle. Graduates of higher education in general, and those of professional schools of the Université Abomey-Calavi (UAC) in particular, are facing ...

  9. Recherche et Titrage des Hémolysines Anti-A et Anti-B Chez Les ...

    African Journals Online (AJOL)

    Les hémolysines apparaissent suite à une immunisation ABO et peuvent causer, à titre élevé, une hémolyse chez le receveur de sang ou chez le nouveau-né. ... Mots Clés: Hémolysines anti-A et anti-A, Incompatibilité foeto-maternelle ABO, Maladie hémolytique du nouveau-né, Période du post-partum immédiate ...

  10. Impact de la variabilité climatique sur le régime des cours d'eau du ...

    African Journals Online (AJOL)

    ... pluies de la “saison sèche” d'été (juillet et août) sont plus élevées depuis quelques décennies, ce qui entretient vraisemblablement une humidité du sol plus élevée favorable au ruissellement au début de la crue d'automne. Mots clefs : changement climatique ; climat équatorial ; séries chronologiques ; Sud Cameroun.

  11. No More Polarization, Please!

    OpenAIRE

    Reinholt, Mia

    2006-01-01

    The organizational science literature on motivation has for long been polarized into two main positions; the organizational economic position focusing on extrinsic motivation and the organizational behavior position emphasizing intrinsic motivation. With the rise of the knowledge economy and the increasing levels of complexities it entails, such polarization is not fruitful in the attempt to explain motivation of organizational members. This paper claims that a more nuanced perspective on mot...

  12. Evaluation de la qualité et de l'acceptabilité de couscous à base de ...

    African Journals Online (AJOL)

    Mots clés : qualité, acceptabilité, enrichissement, soja, moringa, couscous. Evaluation of the quality and .... ont été lavés à l'eau potable puis rincés à l'eau déminéralisée. ... Détermination de l'indice de gonflement. L'indice de gonflement a été ...

  13. 1 Analyse de l'impact des ondes électromagnétiques sur l'homme ...

    African Journals Online (AJOL)

    AKA BOKO

    Correspondance, courriel : belmiencarlos2002@yahoo.fr. Résumé. Cet article présente ... MATLAB montrent que, l'utilisation d'un téléphone portable peut entraîner une augmentation de la température du cerveau. Mots-clés ... Simulation results using MATLAB show that the usage of a mobile phone could lead to an ...

  14. La libéralisation comme source du dérèglement des transports ...

    African Journals Online (AJOL)

    proposant un phasage chronologique relatif à son évolution, tout en mettant la lumière sur ses effets les plus manifestes à l'échelle nationale et surtout sur le plan urbain par rapport au périmètre de transport de la ville d'Annaba, ceci à travers ses différents volets organisationnels et fonctionnels. Mots clés: Libéralisation ...

  15. Apport de la scintigraphie renale dans l'exploration d'un syndrome ...

    African Journals Online (AJOL)

    Les aspects étiopathogéniques et la place de l'imagerie médicale notamment de la scintigraphie aussi bien dans la prise en charge diagnostique que thérapeutique sont discutées à la lumière de la littérature. Mots clés : Syndrome de jonction pyélo-uréterale, ectopie rénale, Scintigraphie rénale, pays en développement.

  16. Effekten av antioksidanter på aerob kapasitet, lungefunksjon og luftveisinflammasjon hos utrente personer

    OpenAIRE

    Freuchen, Fredrik

    2013-01-01

    Masteroppgave - Norges idrettshøgskole, 2013 Antioksidanter kan beskytte celler mot alvorlig skade ved å hindre oksidering av cellulære bestanddeler. Likevel er det antydet at store doser antioksidanter kan hemme gunstige treningseffekter. Formålet med studien var å undersøke hvilken effekt antioksidanttilskudd kombinert med 12 ukers utholdenhetstrening har på aerob kapasitet, lungefunksjon og luftveisinflammasjon.

  17. Les catastrophes naturelles présentent une menace pour les ...

    African Journals Online (AJOL)

    toufik

    L'événement sismique a été simulé en utilisant le catalogue algérien des failles actives. Les résultats obtenus montrent que les constructions les plus endommagées sont celles qui reposent sur des sols meubles. Mots-clés : SIG, risque sismique, probabilité de dommages, courbes de fragilité, Hazus. Abstract. Use of a GIS ...

  18. Simulation de la répartition de température dans un bloc en acier ...

    African Journals Online (AJOL)

    Simulation of the temperature distribution within a steel block ... Mots clés: Simulation – Fortran – Différences finies – Equation de la chaleur – Température. ..... TM = (15). La méthode de sur-relaxation successive obtenue à partir de la méthode de Gausse-Seidel est utilisée pour accélérer la convergence du système.

  19. Changing Consumption Behavior of Net Generation and the Adoption of Streaming Music Services : Extending the Technology Acceptance Model to Account for Streaming Music Services

    OpenAIRE

    Delikan, Mehmet Deniz

    2010-01-01

    The rise of the streaming music services and the decreasing importance of physical distribution is an inevitable change that the industry has been facing, which is resulting from the so-called internet revolution over the past few years. Through years, the music business has already shifted to online platform with the birth of file sharing. Today, a generation who had grown up digital came to age. Members of this generation have different consumption habits than before, and have different mot...

  20. Nécrose drépanocytaire de la tête fémorale chez l'enfant et l ...

    African Journals Online (AJOL)

    ... sociaux de la méthode ambulatoire méritent d'en faire un protocole codifié qui pourrait faire l'objet d'une étude multicentrique régionale. Mots clés : Drépanocytose, hanche, enfant, traitement ambulatoire. Objective: The taking care of avascular necrosis of femoral head on sickle cell disease young patients is very difficult.