Diu, Bernard
2005-01-01
Comment comprendre la physique ? Comment savoir pourquoi il y a des particules et des antiparticules, ou dans quel état se trouve le chat de Schrödinger ? Comment découvrir ce qui se conserve dans la nature ? Comment s'initier aux théories à la pointe de notre connaissance de l'Univers ? Ce livre veut aider à parler la physique, à apprendre son vocabulaire. Chaque mot est défini dans son sens immédiat comme dans ses significations plus complexes. Et les renvois d'un mot à l'autre permettent de saisir la physique en bloc. Après Les atomes existent-ils vraiment ? et Traité de physique à l'usage des profanes, Bernard Diu fait partager, sous une nouvelle forme, sa passion pour la physique. A le lire, il ne fait aucun doute qu'Einstein avait raison : " Subtil est le Créateur. "
CASA-Mot in mammals: an update.
Yániz, J L; Silvestre, M A; Santolaria, P; Soler, C
2018-03-08
Sperm motility is one of the most widely used parameters of sperm quality. Computer-aided sperm motility analysis (CASA-Mot) systems were developed to reduce the subjectivity of sperm motility assessment, and have had broad scientific and practical acceptance. In this review, the sources of variation and current applications of this technology and its relationships with other sperm quality tests are described in detail. Despite remarkable advances in the technique, there is still great need for standardisation in many species, and the numerous factors that affect the results make it difficult to provide universally accepted criteria for classifying semen samples based on sperm motility characteristics. The main fields for CASA-Mot include the study of male fertility and pathologies, evaluation of the effects of physical and chemical agents, improvement of epidemiological survey studies, more precise calculation of seminal doses for farm animals, realisation of basic studies about sperm function, improvement of sperm technologies such as cryopreservation and quality control analysis. Numerous relationships have been established between CASA-Mot and other sperm quality tests, although most of these parameters are complementary. Future CASA-Mot systems will probably be able to integrate several sperm quality parameters with motility.
Mitochondria related peptide MOTS-c suppresses ovariectomy-induced bone loss via AMPK activation
Energy Technology Data Exchange (ETDEWEB)
Ming, Wei, E-mail: weiming@xiyi.edu.cn [State Key Laboratory of Cancer Biology, Department of Pharmacogenomics, Fourth Military Medical University, Xi’an 710032 (China); Department of Pharmacology, Xi’an Medical University, Xi’an 710021 (China); Lu, Gan, E-mail: leonming99@163.com [Department of Gynecology of Shaanxi Provincial People’s Hospital, Xi’an, 710068 (China); Xin, Sha, E-mail: 248967979@qq.com [Institute of Orthopedic Surgery, Xijing Hospital, Fourth Military Medical University, Xi’an 710032 (China); Huanyu, Lu, E-mail: 2366927258@qq.com [Department of Occupational and Environmental Health and the Ministry of Education Key Lab of Hazard Assessment and Control in Special Operational Environment, School of Public Health, Fourth Military Medical University, Xi’an 710032 (China); Yinghao, Jiang, E-mail: jiangyh@fmmu.edu.cn [State Key Laboratory of Cancer Biology, Department of Pharmacogenomics, Fourth Military Medical University, Xi’an 710032 (China); Xiaoying, Lei, E-mail: leixiaoy@fmmu.edu.cn [State Key Laboratory of Cancer Biology, Department of Pharmacogenomics, Fourth Military Medical University, Xi’an 710032 (China); Chengming, Xu, E-mail: chengmingxu@yeah.net [State Key Laboratory of Cancer Biology, Department of Pharmacogenomics, Fourth Military Medical University, Xi’an 710032 (China); Banjun, Ruan, E-mail: running@163.com [State Key Laboratory of Cancer Biology, Department of Pharmacogenomics, Fourth Military Medical University, Xi’an 710032 (China); Li, Wang, E-mail: wanglifw@fmmu.edu.cn [State Key Laboratory of Cancer Biology, Department of Pharmacogenomics, Fourth Military Medical University, Xi’an 710032 (China); and others
2016-08-05
Therapeutic targeting bone loss has been the focus of the study in osteoporosis. The present study is intended to evaluate whether MOTS-c, a novel mitochondria related 16 aa peptide, can protect mice from ovariectomy-induced osteoporosis. After ovary removal, the mice were injected with MOTS-c at a dose of 5 mg/kg once a day for 12 weeks. Our results showed that MOTS-c treatment significantly alleviated bone loss, as determined by micro-CT examination. Mechanistically, we found that the receptor activator of nuclear factor-κB ligand (RANKL) induced osteoclast differentiation was remarkably inhibited by MOTS-c. Moreover, MOTS-c increased phosphorylated AMPK levels, and compound C, an AMPK inhibitor, could partially abrogate the effects of the MOTS-c on osteoclastogenesis. Thus, our findings provide evidence that MOTS-c may exert as an inhibitor of osteoporosis via AMPK dependent inhibition of osteoclastogenesis. -- Highlights: •MOTS-c decreases OVX-induced bone loss in vivo. •MOTS-c inhibits RANKL-induced osteoclast formation. •MOTS-c inhibits RANKL-induced osteoclast-specific gene expression. •MOTS-c represses osteoclast differentiation via the activation of AMPK.
Mitochondria related peptide MOTS-c suppresses ovariectomy-induced bone loss via AMPK activation
International Nuclear Information System (INIS)
Ming, Wei; Lu, Gan; Xin, Sha; Huanyu, Lu; Yinghao, Jiang; Xiaoying, Lei; Chengming, Xu; Banjun, Ruan; Li, Wang
2016-01-01
Therapeutic targeting bone loss has been the focus of the study in osteoporosis. The present study is intended to evaluate whether MOTS-c, a novel mitochondria related 16 aa peptide, can protect mice from ovariectomy-induced osteoporosis. After ovary removal, the mice were injected with MOTS-c at a dose of 5 mg/kg once a day for 12 weeks. Our results showed that MOTS-c treatment significantly alleviated bone loss, as determined by micro-CT examination. Mechanistically, we found that the receptor activator of nuclear factor-κB ligand (RANKL) induced osteoclast differentiation was remarkably inhibited by MOTS-c. Moreover, MOTS-c increased phosphorylated AMPK levels, and compound C, an AMPK inhibitor, could partially abrogate the effects of the MOTS-c on osteoclastogenesis. Thus, our findings provide evidence that MOTS-c may exert as an inhibitor of osteoporosis via AMPK dependent inhibition of osteoclastogenesis. -- Highlights: •MOTS-c decreases OVX-induced bone loss in vivo. •MOTS-c inhibits RANKL-induced osteoclast formation. •MOTS-c inhibits RANKL-induced osteoclast-specific gene expression. •MOTS-c represses osteoclast differentiation via the activation of AMPK.
An N-terminal Region of Mot-2 Binds to p53 In Vitro
Directory of Open Access Journals (Sweden)
Sunil C. Kaul
2001-01-01
Full Text Available The mouse mot-2 protein was earlier shown to bind to the tumor suppressor protein, p53. The mot-2 binding site of p53 was mapped to C-terminal amino acid residues 312–352, which includes the cytoplasmic sequestration domain. In the present study, we have found that both mot-1 and mot-2 bind to p53 in vitro. By using His-tagged deletion mutant proteins, the p53-binding domain of mot-2 was mapped to its Nterminal amino acid residues 253–282, which are identical in mot-1 and mot-2 proteins. Some peptides containing the p53-binding region of mot-2 were able to compete with the full-length protein for p53 binding. The data provided rationale for in vitro binding of mot-1 and mot-2 proteins to p53 and supported the conclusion that inability of mot-1 protein to bind p53 in vivo depends on secondary structure or its binding to other cellular factors. Most interestingly, the p53-binding region of mot-2 was common to its MKT-077, a cationic dye that exhibits antitumor activity, binding region. Therefore it is most likely that MKT-077-induced nuclear translocation and restoration of wild-type p53 function in transformed cells takes place by a competitional mechanism.
Periodic vehicle inspection (MOT). [previously: Periodic Vehicle Inspection of cars (MOT).
2010-01-01
In the 1980s the periodic vehicle inspection (MOT) of various categories of vehicles was introduced in the Netherlands. This fact sheet will discuss the legal framework of this measure and the research carried out into its effects on road safety, also in an international context. For instance, the
Accurate absolute measurement of trapped Cs atoms in a MOT
International Nuclear Information System (INIS)
Talavera O, M.; Lopez R, M.; Carlos L, E. de; Jimenez S, S.
2007-01-01
A Cs-133 Magneto-Optical Trap (MOT) has been developed at the Time and Frequency Division of the Centro Nacional de Metrologia, CENAM, in Mexico. This MOT is part of a primary frequency standard based on ultra-cold Cs atoms, called CsF-1 clock, under development at CENAM. In this Cs MOT, we use the standard configuration (σ + - σ - ) 4-horizontal 2-vertical laser beams 1.9 cm in diameter, with 5 mW each. We use a 852 nm, 5 mW, DBR laser as a master laser which is stabilized by saturation spectroscopy. Emission linewidth of the master laser is l MHz. In order to amplify the light of the master laser, a 50 mW, 852 nm AlGaAs laser is used as slave laser. This slave laser is stabilized by light injection technique. A 12 MHz red shift of the light is performed by two double passes through two Acusto-Optic Modulators (AOMs). The optical part of the CENAMs MOT is very robust against mechanical vibration, acoustic noise and temperature changes in our laboratory, because none of our diode lasers use an extended cavity to reduce the linewidth. In this paper, we report results of our MOT characterization as a function of several operation parameters such as the intensity of laser beams, the laser beam diameter, the red shift of light, and the gradient of the magnetic field. We also report accurate absolute measurement of the number of Cs atoms trapped in our Cs MOT. We found up to 6 x 10 7 Cs atoms trapped in our MOT measured with an uncertainty no greater than 6.4%. (Author)
Hsieh, Meng-Lun; James, Tamara D; Knipling, Leslie; Waddell, M Brett; White, Stephen; Hinton, Deborah M
2013-09-20
Gene expression can be regulated through factors that direct RNA polymerase to the correct promoter sequence at the correct time. Bacteriophage T4 controls its development in this way using phage proteins that interact with host RNA polymerase. Using a process called σ appropriation, the T4 co-activator AsiA structurally remodels the σ(70) subunit of host RNA polymerase, while a T4 activator, MotA, engages the C terminus of σ(70) and binds to a DNA promoter element, the MotA box. Structures for the N-terminal (NTD) and C-terminal (CTD) domains of MotA are available, but no structure exists for MotA with or without DNA. We report the first molecular map of the MotA/DNA interaction within the σ-appropriated complex, which we obtained by using the cleaving reagent, iron bromoacetamidobenzyl-EDTA (FeBABE). We conjugated surface-exposed, single cysteines in MotA with FeBABE and performed cleavage reactions in the context of stable transcription complexes. The DNA cleavage sites were analyzed using ICM Molsoft software and three-dimensional physical models of MotA(NTD), MotA(CTD), and the DNA to investigate shape complementarity between the protein and the DNA and to position MotA on the DNA. We found that the unusual "double wing" motif present within MotA(CTD) resides in the major groove of the MotA box. In addition, we have used surface plasmon resonance to show that MotA alone is in a very dynamic equilibrium with the MotA element. Our results demonstrate the utility of fine resolution FeBABE mapping to determine the architecture of protein-DNA complexes that have been recalcitrant to traditional structure analyses.
Periodic vehicle inspection (MOT). [previously: Periodic Vehicle Inspection of cars (MOT).
2010-01-01
In the 1980s the periodic vehicle inspection (MOT) of various categories of vehicles was introduced in the Netherlands. This fact sheet will discuss the legal framework of this measure and the research carried out into its effects on road safety, also in an international context. For instance, the technical conditions of cars at inspection as well as that of cars involved in crashes were studied. Tyre pressure will also be discussed in this fact sheet.
An Explicit MOT-TD-VIE Solver for Time Varying Media
Sayed, Sadeed Bin
2016-03-15
An explicit marching on-in-time (MOT) scheme for solving the time domain electric field integral equation enforced on volumes with time varying dielectric permittivity is proposed. Unknowns of the integral equation and the constitutive relation, i.e., flux density and field intensity, are discretized using full and half Schaubert-Wilton-Glisson functions in space. Temporal interpolation is carried out using band limited approximate prolate spherical wave functions. The discretized coupled system of integral equation and constitutive relation is integrated in time using a PE(CE)m type linear multistep scheme. Unlike the existing MOT methods, the resulting explicit MOT scheme allows for straightforward incorporation of the time variation in the dielectric permittivity.
Haque, Md Manjurul; Hirata, Hisae; Tsuyumu, Shinji
2015-01-01
We previously showed that SlyA of Dickeya dadantii 3937 plays an important role in virulence toward plants, and that the ΔslyA mutant is hypermotile, whereas flagellum synthesis and flagellin production are indistinguishable from the wild type. Here we show that motility factors, including the distance of continuous directed movement, time for that movement and speed, were significantly higher in the ΔslyA mutant than in the wild type. Remarkably, transcription levels of motA and motB, that are involved in flagellar rotation, were elevated in the ΔslyA mutant, suggesting that the mutant's hypermotility was due to an increase in flagellar rotation. In low (10 μM) magnesium medium that activates the PhoP-PhoQ system, growth and virulence of the ΔslyA mutant were much lower than for the wild type; expression of motA, motB, mgtA, pelA, pelB, pelC, pelD, pelE, pelI, indA, tolC, sodC, acsA and hrpN were also reduced in the mutant. Interestingly, motA, motB, pelD, pelE, pelI, sodC and indA were also reduced in phoP and phoQ mutants. Because the SlyA protein directly binds to the promoter region of PhoP, SlyA regulates virulence by controlling multiple pathogenicity-related genes directly and/or at least by controlling PhoP in D. dadantii 3937 when magnesium is low. Copyright © 2015 Institut Pasteur. Published by Elsevier Masson SAS. All rights reserved.
Quasi-exact evaluation of time domain MFIE MOT matrix elements
Shi, Yifei; Bagci, Hakan; Shanker, Balasubramaniam; Lu, Mingyu; Michielssen, Eric
2013-01-01
A previously proposed quasi-exact scheme for evaluating matrix elements resulting from the marching-on-in-time (MOT) discretization of the time domain electric field integral equation (EFIE) is extended to matrix entries resulting from the discretization of its magnetic field integral equation (MFIE) counterpart. Numerical results demonstrate the accuracy of the scheme as well as the late-time stability of the resulting MOT-MFIE solver. © 2013 IEEE.
Quasi-exact evaluation of time domain MFIE MOT matrix elements
Shi, Yifei
2013-07-01
A previously proposed quasi-exact scheme for evaluating matrix elements resulting from the marching-on-in-time (MOT) discretization of the time domain electric field integral equation (EFIE) is extended to matrix entries resulting from the discretization of its magnetic field integral equation (MFIE) counterpart. Numerical results demonstrate the accuracy of the scheme as well as the late-time stability of the resulting MOT-MFIE solver. © 2013 IEEE.
SA-Mot: a web server for the identification of motifs of interest extracted from protein loops.
Regad, Leslie; Saladin, Adrien; Maupetit, Julien; Geneix, Colette; Camproux, Anne-Claude
2011-07-01
The detection of functional motifs is an important step for the determination of protein functions. We present here a new web server SA-Mot (Structural Alphabet Motif) for the extraction and location of structural motifs of interest from protein loops. Contrary to other methods, SA-Mot does not focus only on functional motifs, but it extracts recurrent and conserved structural motifs involved in structural redundancy of loops. SA-Mot uses the structural word notion to extract all structural motifs from uni-dimensional sequences corresponding to loop structures. Then, SA-Mot provides a description of these structural motifs using statistics computed in the loop data set and in SCOP superfamily, sequence and structural parameters. SA-Mot results correspond to an interactive table listing all structural motifs extracted from a target structure and their associated descriptors. Using this information, the users can easily locate loop regions that are important for the protein folding and function. The SA-Mot web server is available at http://sa-mot.mti.univ-paris-diderot.fr.
MOT solution of the PMCHWT equation for analyzing transient scattering from conductive dielectrics
Uysal, Ismail Enes
2015-01-01
Transient electromagnetic interactions on conductive dielectric scatterers are analyzed by solving the Poggio-Miller-Chan-Harrington-Wu-Tsai (PMCHWT) surface integral equation with a marching on-in-time (MOT) scheme. The proposed scheme, unlike the previously developed ones, permits the analysis on scatterers with multiple volumes of different conductivity. This is achieved by maintaining an extra temporal convolution that only depends on permittivity and conductivity of these volumes. Its discretization and computation come at almost no additional cost and do not change the computational complexity of the resulting MOT solver. Accuracy and applicability of the MOT-PMCHWT solver are demonstrated by numerical examples.
Transient analysis of plasmonic nanostructures using an MOT-PMCHWT solver
Uysal, Ismail Enes
2015-10-26
A marching on in time (MOT) scheme for solving the Poggio-Miller-Chan-Harrington-Wu-Tsai (PMCHWT) surface integral equation on plasmonic nanostructures is described. The proposed scheme calls for temporal convolutions of the permittivity and Green function of the plasmonic medium with the temporal basis function. Time domain samples of the permittivity and the Green function required by these convolutions are computed using a fast relaxed vector fitting (FRVF) algorithm. Numerical results demonstrate the accuracy and applicability of the proposed MOT-PMCHWT solver.
Du, Caiqi; Zhang, Cai; Wu, Wei; Liang, Yan; Wang, Anru; Wu, Shimin; Zhao, Yue; Hou, Ling; Ning, Qin; Luo, Xiaoping
2018-04-25
A novel bioactive peptide, mitochondrial-derived peptide (MOTS-c), has recently attracted attention as a potential prevention or therapeutic option for obesity and type 2 diabetes mellitus (T2DM). MOTS-c profiles have not yet been reported in human obesity and T2DM. We aimed to determine circulating MOTS-c levels in obesity and explore the association between MOTS-c levels and various metabolic parameters. In this case-control study, 40 obese children and adolescents (27 males) and 57 controls (40 males) were recruited in the Hubei Province of China in 2017. Circulating MOTS-c levels were measured, clinical data (e.g., glucose, insulin and lipid profile) were recorded, and anthropometric measurements were performed. Finally, we investigated correlations between MOTS-c levels and related variables. MOTS-c levels were significantly decreased in the obese group compared with the control group (472.61 ± 22.83 ng/mL vs. 561.64 ± 19.19 ng/mL, p c levels were significantly decreased in obese male children and adolescents compared to their counterparts (465.26 ± 24.53 ng/mL vs. 584.07 ± 21.18 ng/mL, p 0.05). Further, MOTS-c levels were negatively correlated with body mass index (BMI), BMI standard deviation score, waist circumference, waist-to-hip ratio, fasting insulin level, HOMA-IR, and HbA1c in the male cohort. Circulating MOTS-c levels were decreased in obese male children and adolescents and correlated with markers of insulin resistance and obesity. This article is protected by copyright. All rights reserved.
Boosman, Hileen; van Heugten, Caroline M; Winkens, Ieke; Smeets, Sanne M J; Visser-Meily, Johanna M A
2016-01-01
The Motivation for Traumatic Brain Injury Rehabilitation Questionnaire (MOT-Q) evaluates motivation for rehabilitation in four subscales: Interest in rehabilitation, Lack of anger, Lack of denial, and Reliance on professional help. The objective of this study was to further validate the MOT-Q in 122 inpatients and 92 outpatients with acquired brain injury (ABI). The main measures were motivation for rehabilitation (MOT-Q), self-awareness (Patient Competency Rating Scale), and treatment motivation (Visual Analogue Scale). The MOT-Q showed adequate feasibility in terms of few items with missing responses and few undecided responses. We found no floor or ceiling effects, and significant item-total MOT-Q correlations for 29 of 31 items. Internal consistency was good for the MOT-Q total and acceptable to good for the subscales. The MOT-Q scores were significantly intercorrelated except for the subscales Lack of denial and Reliance on professional help in the inpatient group. The MOT-Q total and subscales were significantly associated with treatment motivation. The Lack of denial subscale showed no significant association with treatment motivation and no to moderate significant associations with self-awareness. In conclusion, the overall MOT-Q is a valid instrument to assess motivation for rehabilitation in patients with ABI. Further research is needed to examine the validity of the subscales.
On the DC loop modes in the MOT solution of the time domain EFIE
Shi, Yifei; Bagci, Hakan; Lu, Mingyu
2014-01-01
When marching-on-in-time (MOT) method is applied to solve the time domain electric field integral equation (TD-EFIE), DC loop modes are always observed in the solution. In theory these modes should not be observed since they do not satisfy the relaxed initial conditions. Their appearance is attributed to numerical errors. It is shown here that when Rao-Wilton-Glisson basis and Lagrange interpolation functions are used to discretize the TD-EFIE, errors due to this space-time discretization have zero impact on the DC loop modes. Numerical experiments demonstrate that the numerical errors due to approximate solution of the MOT matrix system have more dominant impact on DC loop modes in the MOT solution.
On the DC loop modes in the MOT solution of the time domain EFIE
Shi, Yifei
2014-07-01
When marching-on-in-time (MOT) method is applied to solve the time domain electric field integral equation (TD-EFIE), DC loop modes are always observed in the solution. In theory these modes should not be observed since they do not satisfy the relaxed initial conditions. Their appearance is attributed to numerical errors. It is shown here that when Rao-Wilton-Glisson basis and Lagrange interpolation functions are used to discretize the TD-EFIE, errors due to this space-time discretization have zero impact on the DC loop modes. Numerical experiments demonstrate that the numerical errors due to approximate solution of the MOT matrix system have more dominant impact on DC loop modes in the MOT solution.
Sperm motility in fish: technical applications and perspectives through CASA-Mot systems.
Gallego, V; Asturiano, J F
2018-03-09
Although a relatively high number of sperm quality biomarkers have been reported over the years in several fish species, sperm motility is nowadays considered the best biomarker for fish spermatozoa. The first scientific reports focusing on fish sperm motility date from a century ago, but the objective assessment allowed by computer-aided sperm analysis (CASA-Mot) systems was not applied to fish species until the mid-1980s. Since then, a high number of sperm kinetic parameters from more than 170 fish species have been reported in more than 700 scientific articles, covering a wide range of topics, such as sperm physiology, sperm storage, broodstock management, the phenomenon of sperm competition, ecotoxicology and understanding the life cycle of the species. The sperm kinetic parameters provided by CASA-Mot systems can serve as powerful and useful tools for aquaculture and ecological purposes, and this review provides an overview of the major research areas in which fish sperm motility assessment by a CASA-Mot system has been used successfully.
An MOT-TDIE solver for analyzing transient fields on graphene-based devices
Shi, Yifei
2016-11-02
A marching on-in-time (MOT) scheme for analyzing transient electromagnetic wave interactions on devices consisting of graphene sheets and dielectric substrates is proposed. The MOT scheme discretizes time domain resistive boundary condition (TD-RBC) and Poggio-Miller-Chang-Harrington-Wu-Tsai (TD-PMCHWT) integral equation, which are enforced on the surfaces of the graphene and dielectric substrate, respectively. The expressions of the time domain resistivity and conductivity of the graphene sheet are obtained analytically from the intra-band contribution formulated in frequency domain. Numerical results, which demonstrate the applicability of the proposed scheme, are presented.
Transient analysis of plasmonic nanostructures using an MOT-PMCHWT solver
Uysal, Ismail Enes; Ulku, Huseyin Arda; Bagci, Hakan
2015-01-01
A marching on in time (MOT) scheme for solving the Poggio-Miller-Chan-Harrington-Wu-Tsai (PMCHWT) surface integral equation on plasmonic nanostructures is described. The proposed scheme calls for temporal convolutions of the permittivity and Green
An Explicit MOT-TD-VIE Solver for Time Varying Media
Sayed, Sadeed Bin; Ulku, Huseyin Arda; Bagci, Hakan
2016-01-01
An explicit marching on-in-time (MOT) scheme for solving the time domain electric field integral equation enforced on volumes with time varying dielectric permittivity is proposed. Unknowns of the integral equation and the constitutive relation, i
Wessel-Aas, Jon; Fladmoe, Audun; Nadim, Marjan
2016-01-01
De siste årene har hatefulle ytringer på internett fått økt oppmerksomhet i den offentlige debatten. Denne rapporten inneholder en juridisk utredning som har som formål å redegjøre for det strafferettslige vernet mot hatefulle ytringer, basert på gjeldende rett. Gjennomgangen synliggjør dessuten hvilke grupper som er gitt slikt vern. Et forbud mot hatefulle ytringer er et inngrep i ytringsfriheten. Spørsmålet om hvor grensen mellom ytringsfriheten og hva man skal slippe å tåle av hatefulle yt...
A unitary ESPRIT scheme of joint angle estimation for MOTS MIMO radar.
Wen, Chao; Shi, Guangming
2014-08-07
The transmit array of multi-overlapped-transmit-subarray configured bistatic multiple-input multiple-output (MOTS MIMO) radar is partitioned into a number of overlapped subarrays, which is different from the traditional bistatic MIMO radar. In this paper, a new unitary ESPRIT scheme for joint estimation of the direction of departure (DOD) and the direction of arrival (DOA) for MOTS MIMO radar is proposed. In our method, each overlapped-transmit-subarray (OTS) with the identical effective aperture is regarded as a transmit element and the characteristics that the phase delays between the two OTSs is utilized. First, the measurements corresponding to all the OTSs are partitioned into two groups which have a rotational invariance relationship with each other. Then, the properties of centro-Hermitian matrices and real-valued rotational invariance factors are exploited to double the measurement samples and reduce computational complexity. Finally, the close-formed solution of automatically paired DOAs and DODs of targets is derived in a new manner. The proposed scheme provides increased estimation accuracy with the combination of inherent advantages of MOTS MIMO radar with unitary ESPRIT. Simulation results are presented to demonstrate the effectiveness and advantage of the proposed scheme.
Directory of Open Access Journals (Sweden)
Cyril F Reboul
Full Text Available BACKGROUND: The C-terminal domain of MotB (MotB-C shows high sequence similarity to outer membrane protein A and related peptidoglycan (PG-binding proteins. It is believed to anchor the power-generating MotA/MotB stator unit of the bacterial flagellar motor to the peptidoglycan layer of the cell wall. We previously reported the first crystal structure of this domain and made a puzzling observation that all conserved residues that are thought to be essential for PG recognition are buried and inaccessible in the crystal structure. In this study, we tested a hypothesis that peptidoglycan binding is preceded by, or accompanied by, some structural reorganization that exposes the key conserved residues. METHODOLOGY/PRINCIPAL FINDINGS: We determined the structure of a new crystalline form (Form B of Helicobacter pylori MotB-C. Comparisons with the existing Form A revealed conformational variations in the petal-like loops around the carbohydrate binding site near one end of the β-sheet. These variations are thought to reflect natural flexibility at this site required for insertion into the peptidoglycan mesh. In order to understand the nature of this flexibility we have performed molecular dynamics simulations of the MotB-C dimer. The results are consistent with the crystallographic data and provide evidence that the three loops move in a concerted fashion, exposing conserved MotB residues that have previously been implicated in binding of the peptide moiety of peptidoglycan. CONCLUSION/SIGNIFICANCE: Our structural analysis provides a new insight into the mechanism by which MotB inserts into the peptidoglycan mesh, thus anchoring the power-generating complex to the cell wall.
On spurious resonant modes in the MOT solution of time domain EFIE
Shi, Yifei
2013-07-01
Theoretically, internal resonant modes should not be induced in the marching-on-in-time (MOT) solution of the time domain electric field integral equation since zero initial conditions are enforced at the beginning of time marching and the internal resonant modes do not satisfy these initial conditions. However, these spurious modes are always observed in the MOT solution. It has been conjectured in the past that numerical errors might establish the necessary initial conditions and allow the incident field to induce the internal resonant modes. Systematic numerical experiments carried out in this work prove this conjecture by demonstrating that the internal resonant modes\\' amplitudes are indeed dictated by the numerical errors and the spectrum of the incident field. © 2013 IEEE.
Maruo, Yukinori; Nishigawa, Goro; Yoshihara, Kumiko; Minagi, Shogo; Matsumoto, Takuya; Irie, Masao
2017-03-01
Dental ceramic surfaces are modified with silane coupling agents, such as γ-methacryloxypropyl trimethoxy silane (γ-MPTS), to improve bond strength. For bonding between lithium disilicate glass ceramic and resin cement, the objective was to investigate if 8-methacryloxyoctyl trimethoxy silane (8-MOTS) could yield a similar performance as the widely used γ-MPTS. One hundred and ten lithium disilicate glass ceramic specimens were randomly divided into 11 groups (n=10) according to pretreatment regime. All specimens were pretreated with a different solution composed of one or a combination of these agents: 10 or 20wt% silane coupling agent of γ-MPTS or 8-MOTS, followed by a hydrolysis solution of acetic acid or 10-methacryloyloxydecyl dihydrogen phosphate (10-MDP). Each pretreated surface was luted to a stainless steel rod of 3.6mm diameter and 2.0mm height with resin cement. Shear bond strength between ceramic and cement was measured after 24-h storage in 37°C distilled water. 8-MOTS produced the same bonding performance as γ-MPTS. Both silane coupling agents significantly increased the bond strength of resin cement, depending on their concentration. When activated by 10-MDP hydrolysis solution, 20wt% concentration produced the highest values (γ-MPTS: 24.9±5.1MPa; 8-MOTS: 24.6±7.4MPa). Hydrolysis with acetic acid produced lower bond strengths than with 10-MDP. Silane coupling pretreatment with 8-MOTS increased the initial bond strength between lithium disilicate glass ceramic and resin cement, rendering the same bonding effect as the conventional γ-MPTS. Copyright © 2016 The Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.
Upgradation of MOT and its Relevance to WET Campaigns Alisher S ...
Indian Academy of Sciences (India)
instrumentation of the telescope and how the system can be used in future campaigns. .... After the upgrade, the MOT should have computer control of pointing, tracking and focus, with ... For this purpose we plan to use portable GPS station.
On spurious resonant modes in the MOT solution of time domain EFIE
Shi, Yifei; Bagci, Hakan; Lu, Mingyu
2013-01-01
Theoretically, internal resonant modes should not be induced in the marching-on-in-time (MOT) solution of the time domain electric field integral equation since zero initial conditions are enforced at the beginning of time marching and the internal
An explicit MOT scheme for solving the TD-EFVIE on nonlinear and dispersive scatterers
Sayed, Sadeed Bin; Ulku, H. Arda; Bagci, Hakan
2017-01-01
An explicit marching-on-in-time (MOT) scheme for solving the time domain electric field volume integral equation (TD-EFVIE) on nonlinear and dispersive scatterers is described. The unknown electric field intensity, electric flux density, and polarization densities representing Kerr nonlinearity along with Lorentz dispersion relation, all of which are induced inside the scatterer upon excitation, are expanded using half and full Schaubert-Wilton-Glisson functions in space. The TD-EFVIE and the constitutive relations between polarization, field, and flux terms are cast in the form of a first-order ordinary differential equation. The resulting matrix system is integrated in time using a predictor-corrector scheme to obtain the time dependent unknown expansion coefficients. The resulting MOT scheme is explicit and accounts for nonlinearity by simple function evaluations.
An explicit MOT scheme for solving the TD-EFVIE on nonlinear and dispersive scatterers
Sayed, Sadeed Bin
2017-10-25
An explicit marching-on-in-time (MOT) scheme for solving the time domain electric field volume integral equation (TD-EFVIE) on nonlinear and dispersive scatterers is described. The unknown electric field intensity, electric flux density, and polarization densities representing Kerr nonlinearity along with Lorentz dispersion relation, all of which are induced inside the scatterer upon excitation, are expanded using half and full Schaubert-Wilton-Glisson functions in space. The TD-EFVIE and the constitutive relations between polarization, field, and flux terms are cast in the form of a first-order ordinary differential equation. The resulting matrix system is integrated in time using a predictor-corrector scheme to obtain the time dependent unknown expansion coefficients. The resulting MOT scheme is explicit and accounts for nonlinearity by simple function evaluations.
Ulku, Huseyin Arda
2015-02-01
An explicit marching on-in-time (MOT) based time domain electric field volume integral equation (TDVIE) solver for characterizing electromagnetic wave interactions on scatterers with nonlinear material properties is proposed. Discretization of the unknown electric field intensity and flux density is carried out by half and full Schaubert-Wilton-Glisson basis functions, respectively. Coupled system of spatially discretized TDVIE and the nonlinear constitutive relation between the field intensity and the flux density is integrated in time to compute the samples of the unknowns. An explicit PE(CE)m scheme is used for this purpose. Explicitness allows for \\'easy\\' incorporation of the nonlinearity as a function only to be evaluated on the right hand side of the coupled system of equations. A numerical example that demonstrates the applicability of the proposed MOT scheme to analyzing electromagnetic interactions on Kerr-nonlinear scatterers is presented. © 2015 IEEE.
BioMot exoskeleton - Towards a smart wearable robot for symbiotic human-robot interaction.
Bacek, Tomislav; Moltedo, Marta; Langlois, Kevin; Prieto, Guillermo Asin; Sanchez-Villamanan, Maria Carmen; Gonzalez-Vargas, Jose; Vanderborght, Bram; Lefeber, Dirk; Moreno, Juan C
2017-07-01
This paper presents design of a novel modular lower-limb gait exoskeleton built within the FP7 BioMot project. Exoskeleton employs a variable stiffness actuator in all 6 joints, a directional-flexibility structure and a novel physical humanrobot interfacing, which allows it to deliver the required output while minimally constraining user's gait by providing passive degrees of freedom. Due to modularity, the exoskeleton can be used as a full lower-limb orthosis, a single-joint orthosis in any of the three joints, and a two-joint orthosis in a combination of any of the two joints. By employing a simple torque control strategy, the exoskeleton can be used to deliver user-specific assistance, both in gait rehabilitation and in assisting people suffering musculoskeletal impairments. The result of the presented BioMot efforts is a low-footprint exoskeleton with powerful compliant actuators, simple, yet effective torque controller and easily adjustable flexible structure.
Rigidity of outermost MOTS: the initial data version
Galloway, Gregory J.
2018-03-01
In the paper Commun Anal Geom 16(1):217-229, 2008, a rigidity result was obtained for outermost marginally outer trapped surfaces (MOTSs) that do not admit metrics of positive scalar curvature. This allowed one to treat the "borderline case" in the author's work with R. Schoen concerning the topology of higher dimensional black holes (Commun Math Phys 266(2):571-576, 2006). The proof of this rigidity result involved bending the initial data manifold in the vicinity of the MOTS within the ambient spacetime. In this note we show how to circumvent this step, and thereby obtain a pure initial data version of this rigidity result and its consequence concerning the topology of black holes.
Simulation of a 3D MOT-Optical Molasses Hybrid for Potassium-41 Atoms
Peterson, W. A.; Wrubel, Jonathan
2017-04-01
We report a design and numerical model for a 3D magneto-optical trap (MOT)-optical molasses hybrid for potassium-41 atoms. In this arrangement, the usual quadrupole magnetic field is replaced by an octupole field. The octupole field has a central region of very low magnetic field where our simulations show that the atoms experience an optical molasses, resulting in sub-doppler cooling not possible in a quadrupole MOT. The simulations also show that the presence of the magneto-optical trapping force at the edge of the cooling beams provides a restoring force which cycles atoms through the molasses region. We plan to use this hybrid trap to directly load a far off-resonance optical dipole trap. Because the atoms are recycled for multiple passes through the molasses, we expect a higher phase-space density of atoms loaded into the dipole trap. Similar hybrid cooling schemes should be relevant for lithium-6 and lithium-7, which also have poorly resolved D2 hyperfine structure. Research Corporation for Science Advancement, Cottrell College Science Award.
Les mots d'identité et d'égalité dans les langues romanes
Sneyders de Vogel, Kornelis
1947-01-01
La présente étude est en premier lieu une étude de mots que nous nous proposons de suivre dans leur formation, leurs modifications morphologiques et dans leur développement sémantique. Les problèmes de syntaxe ne nous occuperont guère. Pourtant on traitera des phrases indépendantes qui, exprimant
Tēli un motīvi Vladimira Novikova bērnu stāstu krājumā "Mīlestība un krēms brulē".
Fedjkina, Jeļena
2017-01-01
Bakalaura darbs ir veltīts tēlu un motīvu atklāšanai Vladimira Novikova bērnu stāstu krājumā “Mīlestība un krēms brulē”. Darba mērķis ir noteikt galvenos tēlus un motīvus no izvēlētā stāstu krājuma. Bakalaura darba autors secina, ka galvenie stāstu krājuma motīvi ir bērnības, ģimenes, skolas, skaistuma, pirmās mīlestības un draudzības motīvi, bet tēli – skolotāja un bērna tēls. Bakalaura darbs sastāv no trim daļām. Pirmajā nodaļā ir izklāstīts bērnu literatūras galvenās funkcijas un iezīmes. ...
Directory of Open Access Journals (Sweden)
Wouter Cools
2010-12-01
Full Text Available The purpose was to determine the level of agreement between the Motoriktest für Vier- bis Sechsjährige Kinder [MOT 4-6] and the Movement Assessment Battery for Children [M-ABC]. 48 preschool children participated in the study (Mean age = 5 years, 6 months, SD = 3 months. There was high classification agreement (90% between both tests. A Kappa correlation coefficient (0.67 provided moderately strong support for convergent validity. Less agreement was shown in identification of motor difficulties (58%. This was reflected by lower correlation coefficients on the fine movement cluster and test item level. The MOT 4-6 showed values within the range of similar movement skill performance assessment protocols. Because of its specific focus it may be of meaningful value to assess movement skill competence in typically developing preschool children (ages 4 to 6.
Directory of Open Access Journals (Sweden)
Villoing Florence
2012-07-01
Full Text Available Cette communication porte sur les contraintes phonologiques qui pèsent sur la formation des mots construits dans le cadre théorique de la morphologie lexématique (Anderson 1992, Aronoff 1994, Fradin 2003. En étudiant les données du français, les travaux de Lignon (à paraître, Plénat (2009 & Roché (2003 ont montré que des contraintes de taille étaient à l’œuvre dans plusieurs constructions morphologiques. L’objectif de cet article est d’étudier cette hypothèse sur les mots composés Verbe-Nom du français (Villoing 2009. L’analyse quantitative des données du corpus montre clairement que les verbes des mots composés VN du français sont soumis à des contraintes de taille et doivent répondre au format d’un monosyllabe. La contrainte pèse moins lourdement sur les noms qui parviennent à s’imposer plus facilement que les verbes avec une taille supérieure. Cependant, la majorité des mots composés VN tend à ne pas dépasser trois syllabes (leur format optimal étant de deux ou trois syllabes, révélant ainsi l'influence des contraintes de taille sur le mot composé lui-même. La mise au jour de ces contraintes permet d'expliquer l’absence de certains verbes dans le corpus de composés VN, répondant pourtant bien aux propriétés sémantiques attendues : les verbes construits par affixation (absence de suffixés en -iser, -ifier; très rares cas de préfixés, les verbes du 2ème groupe, les verbes de taille supérieure à trois syllabes. En outre, cet article met au jour un cas de concurrence entre contrainte morphologique et contrainte phonologique au sein d'une construction morphologique, et montre comment la première l'emporte sur la dernière, bien que la contrainte phonologique contraigne fortement le choix du verbe et du nom de base. Il donne également à voir comment la contrainte phonologique parvient néanmoins à influencer le choix de bases sémantiquement peu conformes aux attentes de la règle.
Uudised : Tüür Frankfurdi "Auftaktil". Motörhead ja Manson Soomes
2007-01-01
Frankfurdi Vana Ooperi uut hooaega traditsiooniliselt sissejuhatava festivali "Auftakt" tänavusteks külalisteks on Erkki-Sven Tüür ja inglise tšellist Steven Isserlis, 28. aug.-1. okt. kestval festivalil mängitakse Tüüri 6. ja 7. (4. sümfooniat dirigeerib Paavo Järvi), 12. sept. kavas "Fata Morgana" ja "Oxymoron" ning Helena Tulve "Lumineux..." Olari Eltsi juhatusel. Inglise ansambli Motörhead kontserdist 11. dets. ja USA rokkari Marilyn Mansoni kontserdist 20. dets. Helsingis
Mortality and reproduction of Sitophilus zeamais Mots. on irradiated macaroni and maize
International Nuclear Information System (INIS)
Wiendl, F.M.
1975-11-01
Maize weevils, Sitophilus zeamais Mots. were reared on irradiated macaroni and maize. Diets were treated with dosages of O (control), 20, 100, 500 and 1500 Krad of gamma radiation from a Cobalt 60 gamma source, with a supplementary doses of 5000 Krad on maize. The parent generation was checked for mortality and fecundity. The analysis of results indicated decrease of longevity on diets used. Also it could be observed that on maize, the doses of 100 Krad caused an increase of progeny, with no effects on other dosages
Beskytter røyking mot Parkinsons sykdom
Directory of Open Access Journals (Sweden)
Trond Peder Flaten
2009-10-01
Full Text Available SAMMENDRAGDen negative sammenhengen mellom røyking og Parkinsons sykdom i epidemiologiske studier er robust.Det er prosentvis færre røykere og eks-røykere blant Parkinson-pasienter enn blant kontrollpersoner.Videre har røykere en lavere insidens og en lavere dødelighet enn andre av Parkinsons sykdom. Det er etåpent spørsmål om dette skyldes en beskyttende virkning av nikotin eller andre stoffer i tobakksrøyk somhydrazin eller karbonmonoksid, eller om det skyldes andre, underliggende faktorer. De mest aktuelle slikefaktorer er (1 selektiv dødelighet, altså at mange røykere ikke overlever lenge nok til å utvikleParkinsons sykdom, og (2 at personer som utvikler Parkinsons sykdom ofte har karaktertrekk som gjørdet mindre sannsynlig at de begynner å røyke. Det vitenskapelige grunnlaget er i alle fall for tynt for åanbefale røyking som et forebyggende virkemiddel mot Parkinsons sykdom. Og selv om det skulle viseseg at røyking virkelig beskytter mot sykdommen, veier de negative helsevirkningene av røyking myetyngre i folkehelsesammenheng. Allikevel bør denne assosiasjonen forfølges videre, ikke minst forpotensialet for en bedret forståelse av de underliggende patofysiologiske mekanismene bak sykdommen.Flaten TP. Does smoking protect against Parkinson’s disease? Nor J Epidemiol 1995; 5 (2: 145-150. ENGLISH SUMMARYIt is epidemiologically well established that Parkinson's disease is about twice as common among nonsmokers as among smokers. Whether this is due to a protective effect of nicotine or other compounds in cigarette smoke like hydrazine or carbon monoxide, or whether it is due to some other, confounding factor(s, remains to be established. The most relevant confounding factors are (1 selective mortality, that is, many smokers do not survive long enough to develop Parkinson's disease, and (2 that persons who eventually develop Parkinson's disease tend to have a preclinical personality type that makes them less likely
Mjelde, M.; Berge, D.; Edvardsen, H.
2012-01-01
Den foreliggende rapporten utgjør kunnskapsgrunnlaget for Handlingsplan mot vasspest (Elodea canadensis) og smal vasspest (Elodea nuttallii). Rapporten gir en oppdatert oversikt over de to artenes biologi og økologi, utbredelse og spredningsveier, samt kjente effekter på vannøkosystemet. Kunnskapsbehov diskuteres, bl.a. knyttet til artenes økologiske krav og effekter på biologisk mangfold. Rapporten omtaler tiltak for å hindre videre spredning og tiltak for å redusere eller bekjempe bestande...
Directory of Open Access Journals (Sweden)
Trang Pham Thi Thuy
2017-01-01
Full Text Available The main objective of this paper is to investigate the household willingness to pay (WTP for improved solid waste management in Thu Dau Mot city, Binh Duong by using Dichotomons choice Contingent Valuation Method. A questionnaire was designed to draw a sample of 330 respondents for the study. The results show that mean household willingness to pay for solid waste management system in Thu Dau Mot is about 24 thousand VND/ month/ household, higher than the current fee (20 thousand VND month/ household.The paper used a logistic regression to establish the factor affecting to the household willingness to pay for solid waste management system. The logit results show that those with a higher income and more educated is willing to pay more for improvement in management of their solid waste. Also, more environmental aware the person the more they are willing to pay. Moreover, females are less likely to give a positive response to WTP compare to male.
GOOFRE version 2: voir et traiter 600 milliards de mots
Directory of Open Access Journals (Sweden)
Etienne Brunet
2014-12-01
Full Text Available http://dx.doi.org/10.5007/1807-9288.2014v10n2p75 Les données de Google Books ont doublé en deux ans, en franchissant le cap des 500 milliards de mots. Un nouveau traitement a repris les images scannées pour en proposer une lecture plus fidèle. Et pour la première fois les textes enregistrés ont bénéficié de la désambiguïsation et de la lemmatisation. Enfin le site Culturomics a fourni les outils nécessaires pour en assurer la diffusion. Il convenait donc de procéder à une nouvelle expertise et de créer une nouvelle base, pourvue de tout l’appareillage statistique qu’exige, en réseau ou en local, l’exploitation des grands corpus.
En liten høyskole som tenker stort: tiltak mot fusk og plagiat ved Høgskolen i Hedmark
Directory of Open Access Journals (Sweden)
Ellen Nierenberg
2010-07-01
Full Text Available Høgskolen i Hedmark har satt i gang en del tiltak mot fusk og plagiat, og vi vil gjerne dele våre ressurser og erfaringer med andre undervisningsinstitusjoner. Dette er relevant til to av konferansens temaer: fagreferentens rolle og undervisning i biblioteket. HH's tiltak mot fusk og plagiat inkluderer: • Undervisning i informasjonskompetanse - Høgskolebiblioteket • Kurs i kildebruk og plagiat, "Kilder og kildebruk" • Søkekurs • Synliggjøring av bibliotekressurser/-kurs • Brosjyre til ansatte • Bibliotekets websider om informasjonskompetanse • Nettressurser • Bibliotekets websider • Eksempelsamlingen i APA-standard • "Skriving av faglige tekster - En guide for studenter" • Webside om plagiat og opphavsrett • Fronter • Videoforelesning - "Kilder og kildebruk" • PowerPoint - "Kilder og kildebruk" • Tekstgjenkjenningsprogrammet Ephorus • Vurdering • Elektronisk prøve • Obligatorisk skriveoppgave • Rutinebeskrivelse for tiltak mot fusk og plagiat på Høgskolen • Oppfølging av ikke-møtte studenter på "Kilder og kildebruk" • Vurdering i etterkant av kurset • Bruk av Ephorus • Konsekvenser for fusk Høgskolens tiltak skal forebygge fusk og plagiat ved å gi alle nye studenter tilstrekkelig informasjon om kravene for riktig kildebruk og om konsekvensene for fusk. Høgskolebiblioteket har en sentral rolle i dette arbeidet. Vår Informasjonskompetansegruppe har utarbeidet mange nyttige ressurser, blant annet to-timers kurset "Kilder og kildebruk". Målet med kurset er å lære nye studenter å kritisk vurdere forskjellige typer kilder og bruke dem på korrekt måte i skriftlig arbeid. Kurset blir holdt av bibliotekarer på høgskolens fire campus, og etterfølges av et søkekurs tilpasset det enkelte studium. Antall plagiatsaker på HH har økt de siste årene, men dette kan skyldes bruk av Ephorus. Etter hvert som våre tiltak blir tatt i bruk ved alle studier, håper vi at antall saker blir
Del Gallego, R; Sadeghi, S; Blasco, E; Soler, C; Yániz, J L; Silvestre, M A
2017-02-01
Several factors unrelated to the semen samples could be influencing in the sperm motility analysis. The aim of the present research was to study the effect of four chambers with different characteristics, namely; slide-coverslip, Spermtrack, ISAS D4C10, and ISAS D4C20 on the sperm motility. The filling procedure (drop or capillarity) and analysis time (0, 120 and 240s), depth of chamber (10 or 20μm) and field on motility variables were analysed by use of the CASA-mot system in goat sperm. Use of the drop-filling chambers resulted in greater values than capillarity-filling chambers for all sperm motility and kinetic variables, except for LIN (64.5% compared with 56.3% of motility for drop- and capillarity-filling chambers respectively, PCASA-mot system with a drop-loaded chamber within 2min after filling the chamber. Copyright © 2016 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Tanner, T
2006-07-01
Being supported by an international collaboration the project ProMot has developed and disseminated in the European Union a decision support tool for electric motor users helping them to choose energy efficient motor systems. During the first phase all necessary components to build the decision support tool have been selected, developed or improved and adapted. At the beginning it was assumed that the contribution of the author's company, Semafor would be the integration of the company's OPAL software components developed for pumps and variable speed drives (VSD) into the EuroDEEM package. In view of the deficiencies of EuroDEEM it was soon agreed to abandon this approach. Instead, the package IMSSA (International Motor Selection and Saving Analysis), developed at the Washington State University on the basis of MotorMaster was selected. IMSSA - which has been renamed to EuroDEEM International - and the pump and VSD module can now be used as standalone applications. The second phase integrated all collected and developed material into a comprehensive and user-friendly web site that was then demonstrated to key actors in the participating countries. Several requirements had to be considered. The platform had to allow the publication of the web pages in several languages and to enable the team members to place and modify their content without disturbing ongoing operation. It was therefore decided to evaluate a suitable Web Content Management System (CMS) which lead to Plone, a powerful and adaptable open-source system already in use at many web sites. The pages have then been created and published with this system. With some support from Semafor, German and French translations were created. Also a hardcopy brochure that gives an overview of the web site has been produced and distributed in the participating countries. (author)
Energy Technology Data Exchange (ETDEWEB)
Tanner, T.
2006-07-01
Being supported by an international collaboration the project ProMot has developed and disseminated in the European Union a decision support tool for electric motor users helping them to choose energy efficient motor systems. During the first phase all necessary components to build the decision support tool have been selected, developed or improved and adapted. At the beginning it was assumed that the contribution of the author's company, Semafor would be the integration of the company's OPAL software components developed for pumps and variable speed drives (VSD) into the EuroDEEM package. In view of the deficiencies of EuroDEEM it was soon agreed to abandon this approach. Instead, the package IMSSA (International Motor Selection and Saving Analysis), developed at the Washington State University on the basis of MotorMaster was selected. IMSSA - which has been renamed to EuroDEEM International - and the pump and VSD module can now be used as standalone applications. The second phase integrated all collected and developed material into a comprehensive and user-friendly web site that was then demonstrated to key actors in the participating countries. Several requirements had to be considered. The platform had to allow the publication of the web pages in several languages and to enable the team members to place and modify their content without disturbing ongoing operation. It was therefore decided to evaluate a suitable Web Content Management System (CMS) which lead to Plone, a powerful and adaptable open-source system already in use at many web sites. The pages have then been created and published with this system. With some support from Semafor, German and French translations were created. Also a hardcopy brochure that gives an overview of the web site has been produced and distributed in the participating countries. (author)
Castellví, Jordi; Camps, Adriano; Corbera, Jordi; Alamús, Ramon
2018-01-01
The 3Cat-3/MOTS (3: Cube, Cat: Catalunya, 3: 3rd CubeSat mission/Missió Observació Terra Satèl·lit) mission is a joint initiative between the Institut Cartogràfic i Geològic de Catalunya (ICGC) and the Universitat Politècnica de Catalunya-BarcelonaTech (UPC) to foster innovative Earth Observation (EO) techniques based on data fusion of Global Navigation Satellite Systems Reflectometry (GNSS-R) and optical payloads. It is based on a 6U CubeSat platform, roughly a 10 cm × 20 cm × 30 cm parallel...
Directory of Open Access Journals (Sweden)
Raphaël Micheli
2013-04-01
Full Text Available L’objectif de cet article est de contribuer à la description d’un type particulier d’affrontement qui met régulièrement aux prises les acteurs politiques dans l’espace médiatique contemporain : la querelle de mots. Dans ce genre de cas, un mot particulier est érigé en objet du désaccord, sous l’effet d’un travail de cadrage médiatique opéré par les journalistes : les acteurs politiques sont amenés à prendre position quant à son usage et à justifier leur prise de position au moyen d’arguments. On esquisse un modèle d’analyse de ces querelles de mots et l’on teste ce modèle sur un corpus de discours constitué à partir d’une polémique ayant opposé plusieurs acteurs politiques français autour du mot « rigueur » entre mai et juillet 2010. Sur le plan méthodologique, la démarche se situe à la croisée de la linguistique, des théories de l’argumentation et des sciences de la communication et des médias : elle articule l’étude des formes du métalangage ordinaire à celle du fonctionnement argumentatif des discours et des enjeux contemporains de la médiatisation du politique.This paper aims to contribute to the description of a particular type of confrontation, often taking place between political actors in contemporary media, namely verbal disputes. In such confrontations, a particular word becomes the very object of disagreement. Under the effect of a framing process led by journalists, political actors are invited to take a stand as to whether the word should or should not be used and to justify their position by means of arguments. I propose a model of analysis for verbal disputes, and I test it using a data set composed of a controversy involving several French political actors over the use of the word “rigueur” between May and July, 2010. Methodologically, this paper is influenced by linguistics, argumentation theory and media studies. The paper is focused on describing forms of
Lund, Karl Erik; Rise, Jostein
2008-01-01
- I nasjonal strategiplan for det tobakksforebyggende arbeidet 2006-2010 ønsket Helse- og omsorgsdepartementet å få utredet forslaget om forbud mot synlig oppstilling av tobakksvarer. Departementet har allerede hatt forslaget på høring, og represen tanter fra tobakksindustrien og handelsnæringen hevdet i sine svar at tiltaket bl.a. var i strid med EØS- reglene og at det ikke kunne dokumenteres effekt. Før departementet eventuelt skal arbeide videre med et lo vfor...
Macià, Jaume
2007-01-01
El treball vol aprofundir en les conceptualitzacions gramaticals dels alumnes de secundària, particularment en els sabers que mobilitzen quan han de determinar la classe lèxica de certes paraules (els mots analitzats pertanyen a categories “simples” com les de nom, verb, adjectiu i adverbi). Per a tal fi s'han enquestat 141 alumnes i se n'han entrevistat 18 (es tracta d'estudiants de tots els nivells de secundària d'un mateix institut). L'estudi posa en evidència la diversitat de procediments...
Directory of Open Access Journals (Sweden)
Eva Thue Vold
2014-09-01
Full Text Available Fremmedspråkfaget har lenge hatt et todelt formål: Det skal ha en nytteverdi, først og fremst i form av kommunikative ferdigheter, og det skal ha en allmenndannende funksjon, bl.a. gjennom tilegnelse av kunnskap om kultur og samfunn i målspråksområdet. Fra og med læreplanen for fremmedspråk i Kunnskapsløftet (2006 er det også tydelig uttrykt at dannelsesdimensjonen omfatter utvikling av interkulturell kompetanse. Denne artikkelen drøfter hvordan fagets todelte formål vil kunne forstås og realiseres i fremmedspråksundervisningen fram mot 2030. Drøftingen tar utgangspunkt i en analyse av dagens situasjon, der trenden med å stykke opp lærestoffet i håndterbare enheter og å vektlegge sterkest det som kan måles mest presist, kan gjøre at ikke-målbar kompetanse som interkulturell dannelse får en relativt svak posisjon. Det argumenteres for at pågående endringer i samfunnsutviklingen og i europeisk utdanningspolitikk vil kunne åpne for en jevnere balanse mellom nytte- og dannelsesperspektivet i faget i fremtiden. Blant disse endringene er 1 en dreining mot et mer holistisk kunnskapssyn, 2 en stadig økende heterogenitet i elevmassen, 3 større bredde i fremmedspråkstilbudet og 4 et økt fokus på flerspråklighet. Artikkelen ser nærmere på disse fire endringsprosessene og diskuterer på hvilken måte de kan og bør påvirke fortolkningen av fremmedspråkfagets todelte formål i årene som kommer.
CASA-Mot technology: how results are affected by the frame rate and counting chamber.
Bompart, Daznia; García-Molina, Almudena; Valverde, Anthony; Caldeira, Carina; Yániz, Jesús; Núñez de Murga, Manuel; Soler, Carles
2018-04-04
For over 30 years, CASA-Mot technology has been used for kinematic analysis of sperm motility in different mammalian species, but insufficient attention has been paid to the technical limitations of commercial computer-aided sperm analysis (CASA) systems. Counting chamber type and frame rate are two of the most important aspects to be taken into account. Counting chambers can be disposable or reusable, with different depths. In human semen analysis, reusable chambers with a depth of 10µm are the most frequently used, whereas for most farm animal species it is more common to use disposable chambers with a depth of 20µm . The frame rate was previously limited by the hardware, although changes in the number of images collected could lead to significant variations in some kinematic parameters, mainly in curvilinear velocity (VCL). A frame rate of 60 frames s-1 is widely considered to be the minimum necessary for satisfactory results. However, the frame rate is species specific and must be defined in each experimental condition. In conclusion, we show that the optimal combination of frame rate and counting chamber type and depth should be defined for each species and experimental condition in order to obtain reliable results.
Directory of Open Access Journals (Sweden)
Berit Inga
2009-01-01
Full Text Available The study was performed in four reindeer-herding districts (Sami villages in northern Sweden. Reindeer herding Sami, born in 1950 or earlier, were interviewed about reindeer foraging behaviour on lichens and mushrooms, especially relating to non-summer grazing habits, and about characteristics of a good winter feeding ground. The informants claimed that lichens are preferably grazed in the wintertime, but that they also may be eaten in the summertime when the weather is cold and humid. Mushrooms were chosen in the autumn months August and September, but according to some informants mushrooms may also be eaten during late autumn (from Oct. when frozen and under the snow. The reindeer herders had different names for lichens, which in general terms describe their appearance and habitat. For mushrooms they only used one Sami name. Ground lichens preferred by reindeer are Cladonia species, while the nitrogen-fixing lichen species such as Nephroma arcticum and Stereocaulon pascale were said not to be preferred by the reindeer. Snow conditions are very important, and the less snow (and the softer it is, the better. Habitats where reindeer herders know from experience that snow conditions tend to be problematic, e.g. in moist and open areas with small trees, are used early in the winter (Oct.–Jan., before too much snow has accumulated. A good winter grazing area should have lichens. It is preferably a dry pine (Pinus sylvestris forest heath with large, old and wide-crowned trees to shelter the ground from snow and thereby ease the cratering by reindeer. Abstract in Swedish / Sammanfattning: Renens (Rangifer tarandus tarandus bete av lavar och svampar: Traditionell ekologisk kunskap bland renskötande samer i norra Sverige Studien genomfördes i fyra renskötseldistrikt (samebyar i norra Sverige. Totalt 22 renskötande samer, födda 1950 eller tidigare, blev intervjuade om renens betande av lavar och svampar, renens vinterbete och om vad som karakt
Directory of Open Access Journals (Sweden)
Eli-Marie Danbolt Drange
2014-09-01
Full Text Available I denne artikkelen drøfter jeg hvordan teknologi kan skape nye undervisnings- og læringsmåter i fremmedspråksundervisningen fram mot 2030. Jeg starter med å skissere et mulig framtidsscenario i form av et blogginnlegg skrevet av en 15 åring i året 2030. Videre i artikkelen tar jeg utgangspunkt i dette framtidsscenarioet og sammenligner det med dagens situasjon, i tillegg til at jeg drøfter hva som må til for at scenarioet kan oppfylles. Læreren spiller en nøkkelrolle i utviklingen av nye undervisnings- og læringsmåter, og det er først når læreren integrerer teknologien i sin undervisning at nye praksiser oppstår. Jeg viser noen konkrete eksempler på bruk av teknologi på nye måter, samt refleksjon rundt utviklingen framover.
Directory of Open Access Journals (Sweden)
Maranúbia Pereira Barbosa Doiron
2014-03-01
Full Text Available : Cette étude concerne les variantes lexicales pour le mot espadrilles dans l’Etat du Paraná et dans la région Nord-Est du Brésil, sous un regard ethnolinguistique. Le corpus est composé par les donnés obtenues à partir de la question numéro 276 du Questionnaire Semantique-Lexical de l’Atlas Linguistique du Paraná (ALPR, dont l’auteur est le professeur Vanderci de Andrade Aguilera (1994, de l’Université de l’Etat de Londrina, autant que les variantes lexicales pour le mot espadrilles trouvées dans deux ouvrages littéraires d’auteurs originaires du Nord-Est du Brésil – Fogo Morto, de José Lins do Rego (2009 et Vidas Secas, de Graciliano Ramos (1969. Dans ces livres, les espadrilles jouent un rôle fondamental, tout en reflétant son importance dans le vestiaire de cette région, du moins jusqu’à moitié du XXème siècle. On rechercha des éventuelles ressemblances ou différences existentes entre les variantes lexicales de la chaussure mentionnée par les informateurs “paranaenses” et le modèle cité dans les ouvrages des écrivains Rego et Ramos. Dans les deuxs sources – la linguistique et la littéraire – on privilégia l’analyse semantique des unités lexicales et le contexte dans lequel elles ont été enregistrées. L’étude démontra que l’unité lexicale espadrilles et ses variantes phonétiques similaires dans les deux corpora, aussi que les variantes lexicales populaires présentes dans l’Atlas Linguistique du Paraná (ALPR. En dépit des simitudes l’esthétique et la fonction des espadrilles ne sont pas les mêmes dans les localitées concernées.
Directory of Open Access Journals (Sweden)
Vanderci de Andrade AGUILERA
2013-12-01
Full Text Available Cette étude concerne les variantes lexicales pour le mot espadrilles dans l’Etat du Paraná et dans la région Nord-Est du Brésil, sous un regard ethnolinguistique. Le corpus est composé par les donnés obtenues à partir de la question numéro 276 du Questionnaire Semantique-Lexical de l’Atlas Linguistique du Paraná (ALPR, dont l’auteur est le professeur Vanderci de Andrade Aguilera (1994, de l’Université de l’Etat de Londrina, autant que les variantes lexicales pour le mot espadrilles trouvées dans deux ouvrages littéraires d’auteurs originaires du Nord-Est du Brésil – Fogo Morto, de José Lins do Rego (2009 et Vidas Secas, de Graciliano Ramos (1969. Dans ces livres, les espadrilles jouent un rôle fondamental, tout en reflétant son importance dans le vestiaire de cette région, du moins jusqu’à moitié du XXème siècle. On rechercha des éventuelles ressemblances ou différences existentes entre les variantes lexicales de la chaussure mentionnée par les informateurs “paranaenses” et le modèle cité dans les ouvrages des écrivains Rego et Ramos. Dans les deuxs sources – la linguistique et la littéraire – on privilégia l’analyse semantique des unités lexicales et le contexte dans lequel elles ont été enregistrées. L’étude démontra que l’unité lexicale espadrilles et ses variantes phonétiques similaires dans les deux corpora, aussi que les variantes lexicales populaires présentes dans l’Atlas Linguistique du Paraná (ALPR. En dépit des simitudes l’esthétique et la fonction des espadrilles ne sont pas les mêmes dans les localitées concernées.
EFEITO RESIDUAL DE INSETICIDAS NATURAIS NO CONTROLE DE SITOPHILUS ZEAMAIS MOTS. EM MILHO ARMAZENADO
Directory of Open Access Journals (Sweden)
Rodrigo Leandro Braga de Castro Coitinho
2006-01-01
Full Text Available The residual effect of natural insecticides was evaluated on adults of Sitophilus zeamais Mots. (Coleoptera: Curculionidae on stored corn grains. Clove (Syzygium aromaticum L., white pepper (Piper nigrum L., neem (Azadirachta indica A. Juss and silica dioxide powders were tested as well as neem, eucalyptus (Eucaliptus globulus Labill and Eucaliptus citriodora Hook., eugenol, andiroba (Carapa guianensis Aubl., rosemary (Lippia gracillis HBK., cedar (Cedrela fissilis Vell. and pequi (Caryocar brasiliense Camb. oils. Powders were tested at concentration of 1kg/t in 50g-corn-plot and the oils at dosage of 50¿L in 20g-corn-plot. The plots infestation was accomplished using 20 and 8 adults (males and females of S. zeamais being 0 to 15 days old, respectively, in the experiments with powders and oils. Silica dioxide caused 46.7, 38.3 and 37.5% of mortality, respectively, in the initial (soon after the treatment with the powders or oils and at 60 and 120 days of storage periods, but the mortality induced by the other powders was inexpressive. In the three studied storage periods, silica dioxide was the more efficient in reducing adults emergency. At the initial storage period, all the oils caused mortality above 79%, however, after 60 and 120 days, mortality was lower than 2.5%. The adult emergency increased as stored period increased, although at 120 days the best performance was obtained using neem, followed by andiroba, cedar, rosemary and E. globulus oils.
Bergamasco, Massimo; Frisoli, Antonio; Fontana, Marco; Loconsole, Claudio; Leonardis, Daniele; Troncossi, Marco; Foumashi, Mohammad Mozaffari; Parenti-Castelli, Vincenzo
2011-01-01
This paper presents the preliminary results of the project BRAVO (Brain computer interfaces for Robotic enhanced Action in Visuo-motOr tasks). The objective of this project is to define a new approach to the development of assistive and rehabilitative robots for motor impaired users to perform complex visuomotor tasks that require a sequence of reaches, grasps and manipulations of objects. BRAVO aims at developing new robotic interfaces and HW/SW architectures for rehabilitation and regain/restoration of motor function in patients with upper limb sensorimotor impairment through extensive rehabilitation therapy and active assistance in the execution of Activities of Daily Living. The final system developed within this project will include a robotic arm exoskeleton and a hand orthosis that will be integrated together for providing force assistance. The main novelty that BRAVO introduces is the control of the robotic assistive device through the active prediction of intention/action. The system will actually integrate the information about the movement carried out by the user with a prediction of the performed action through an interpretation of current gaze of the user (measured through eye-tracking), brain activation (measured through BCI) and force sensor measurements. © 2011 IEEE
Directory of Open Access Journals (Sweden)
Danguolė Melnikienė
2009-01-01
décrire. Pourtant les mots ne se laissent pas facilement saisir sur l’axe de temps et l’auteur du dictionnaire se trouve souvent devant un dilemme difficile à résoudre. Quelle quantité de mots vieux et livresques doit être présente dans sa nomenclature? Est-ce qu’un mot nouveau qu’il avait recensé sera vraiment intégré au lexique de la langue décrite ? Le but de ce travail est donc d’essayer de répondre à ces questions, d’analyser la présence du lexique de ces deux types dans neuf grands dictionnaires bilingues, parus en Lituanie entre 2000 et 2006, et, enfin, définir leur rôle dans leurs macrostructures. On propose également certaines recommandations générales qui pourraient aider les futurs rédacteurs des dictionnaires à mieux équilibrer le lexique de différents types.
Directory of Open Access Journals (Sweden)
Rodrigo Leandro Braga de Castro Coitinho
2006-01-01
Full Text Available Oils of andiroba (Carapa guianensis Aubl., copaiba (Copaifera sp., Eucaliptus globulus Labill. and Eucaliptus citriodora Hook., neem (Azadirachta indica A. Juss, eugenol, souari nut (Caryocar brasiliense Camb., rosemary (Lippia gracillis HBK., and cedar (Cedrela fissilis Vell. were evaluated in adults of Sitophilus zeamais Mots. (Coleoptera: Curculionidae. In the non-choice test, 20 g of corn grains per plot were treated with 50¿L of each oil and homogenized for two minutes. The plot was infested with eight 0 to 15 days-old S. zeamais adults. The E. globulus, eugenol, rosemary, and neem oils caused 100% mortality in S. zeamais adults. Except for copaiba, all oils caused mortality above 87% and the reduction in emergence of 100%. In the free-choice tests, arenas consisting of two plastic containers symmetrically interconnected to a central box by two plastic tubes were used. Twenty grams of non-treated corn (control were placed in one of the boxes and the same amount of grain treated with 50¿L of each oil comprised the other treatment. Sixteen non-sexed S. zeamais adults (0-15 days old were released in the central box. The rosemary, E. citriodora, eugenol and copaiba oils were the most repellent for S. zeamais adults, with repellence percentage varying from 97.3 to 87.7. Rosemary, andiroba, neem, and cedar reduced S. zeamais emergence in 100%, while the reduction caused by the other oils ranged from 72.7 to 97.9%.
Eklund, Anton; Johansson, Tommy
2017-01-01
Denna kvalitativa studie syftar till att studera förekomsten av hot och våld mot lärare på högstadieskolor, hur man på de undersökta skolorna arbetar med att minimera förekomsten av hot och våld samt hur lärare definierar sin syn på vad som kan vara hot och våld från föräldrar och elever. Studien är baserad på ett riktat bekvämlighetsurval där skyddsombud på högstadieskolor i den undersökta kommunen valdes ut. I samband med analysen av studiens resultat har Lintons rollteori använts för att s...
A comparison of pulsed and continuous atom transfer between two magneto-optical traps
International Nuclear Information System (INIS)
Ram, S. P.; Tiwari, S. K.; Mishra, S. R.
2010-01-01
We present the experimental results for a comparison between pulsed and continuous transfer of cold 87 Rb atoms between a vapor chamber magneto-optical trap (VC-MOT) and an ultra-high vacuum magneto-optical trap (UHV-MOT) when using a resonant push beam. We find that employing repetitive cycles of a pulsed and unfocused push beam on an unsaturated VC-MOT cloud results in a significantly higher number of atoms transferred to the UHV-MOT than the number obtained with a continuous push beam focused on a continuous VC-MOT. In pulsed transfer, we find that both the VC-MOT loading duration and the push beam duration play important roles in the transfer process and govern the number of atoms transferred to the UHV-MOT. The parameters and processes affecting the transfer have been investigated and are discussed.
International Nuclear Information System (INIS)
Oliveira, Carolina Natali de
2005-01-01
The resistance of 13 /////com grain genotypes was evaluated against the attack of Sitophilus zeamais (Mots.) by means of a no-choice test; 6 of them were selected (AGN 2012, AGN 30AOO, AGN 31A31, AGN 25A23, AGN 32A43, and AGN 35A42) and then submitted to a free-choice test where attractiveness and non preference for oviposition were assessed. The grain from the selected genotypes were later treated with Cobalt-60 gamma radiation at the doses of 0.0; 0.5; 1.0; and 1.5 kGy and submitted to the same tests. Based on the results, it was verified that genotypes AGN 2012 (30.6 eggs), AGN 31A31 (33.6 eggs), and AGN 30AOO (34.8 eggs) showed a non-preference for oviposition type of resistance, while non-preference for feeding and/or antibiosis were observed in the first two genotypes only. Genotypes AGN 25A23, AGN 32A43, and AGN 35A42 were the most susceptible to com weevil. The increasing gamma radiation ( 60 Co) doses reduced the mean mass of adults in genotype AGN 2012; however, the same parameter increased in genotype AGN 35A42; when treated at the dose of 1.5 kGy, genotypes AGN 2012 and AGN 31A31 showed a reduction in their mean masses of adults, while genotypes AGN 30AOO and AGN 35A42 showed higher mean mass of adults values. The increasing gamma radiation doses ( 60 Co) provided a reduction in mean grain dry mass consumed by the weevil; however, it was concluded that irradiation did not break com grain resistance and can be used for S. zeamais disinfestation prior to storage. (author)
Improved atom number with a dual color magneto—optical trap
International Nuclear Information System (INIS)
Cao Qiang; Luo Xin-Yu; Gao Kui-Yi; Wang Xiao-Rui; Wang Ru-Quan; Chen Dong-Min
2012-01-01
We demonstrate a novel dual color magneto—optical trap (MOT), which uses two sets of overlapping laser beams to cool and trap 87 Rb atoms. The volume of cold cloud in the dual color MOT is strongly dependent on the frequency difference of the laser beams and can be significantly larger than that in the normal MOT with single frequency MOT beams. Our experiment shows that the dual color MOT has the same loading rate as the normal MOT, but much longer loading time, leading to threefold increase in the number of trapped atoms. This indicates that the larger number is caused by reduced light induced loss. The dual color MOT is very useful in experiments where both high vacuum level and large atom number are required, such as single chamber quantum memory and Bose—Einstein condensation (BEC) experiments. Compared to the popular dark spontaneous-force optical trap (dark SPOT) technique, our approach is technically simpler and more suitable to low power laser systems. (rapid communication)
Continuous loading of cold atoms into a Ioffe-Pritchard magnetic trap
International Nuclear Information System (INIS)
Schmidt, Piet O; Hensler, Sven; Werner, Joerg; Binhammer, Thomas; Goerlitz, Axel; Pfau, Tilman
2003-01-01
We present a robust continuous optical loading scheme for a Ioffe-Pritchard (IP) type magnetic trap (MT). Chromium atoms are cooled and trapped in a modified magneto-optical trap (MOT) consisting of a conventional 2D-MOT in the radial direction and an axial molasses. The MOT and IP trap share the same magnetic field configuration. Continuous loading of atoms into the IP trap is provided by radiative leakage from the MOT to a metastable level which is magnetically trapped and decoupled from the MOT light. We are able to accumulate 30 times more atoms in the MT than in the MOT. The absolute number of 2 x 10 8 atoms is limited by inelastic collisions. A model based on rate equations shows good agreement with the data. Our scheme can also be applied to other atoms with similar level structure like alkaline earth metals
A Bottom-up Trend in Research of Management of Technology
Directory of Open Access Journals (Sweden)
Yoko Ishino
2014-12-01
Full Text Available Management of Technology (MOT is defined as an academic discipline of management that enables organizations to manage their technological fundamentals to create competitive advantage. MOT covers a wide range of contents including administrative strategy, R&D management, manufacturing management, technology transfer, production control, marketing, accounting, finance, business ethics, and others. For each topic, researchers have conducted their MOT research at various levels. However, a practical and pragmatic side of MOT surely affects its research trends. Finding changes of MOT research trends, or the chronological transitions of principal subjects, can help understand the key concepts of current MOT. This paper studied a bottom-up trend in research fields in MOT by applying a text-mining method to the conference proceedings of IAMOT (International Association for Management of Technology. First, focusing on only nouns found several keywords, which more frequently emerge over time in the IAMOT proceedings. Then, expanding the scope into other parts of speech viewed the keywords in a natural context. Finally, it was found that the use of an important keyword has qualitatively and quantitatively extended over time. In conclusion, a bottom-up trend in MOT research was detected and the effects of the social situation on the trend were discussed.Keywords: Management of Technology; Text Mining; Research Trend; Bottom-up Trend; Patent
Directory of Open Access Journals (Sweden)
Faria João Luiz
2005-01-01
Full Text Available O gorgulho do milho Sitophilus zeamais Mots. tem sido relatado com freqüência atacando frutíferas temperadas em condições de campo, com destaque para o pessegueiro em Pelotas, RS, macieira em Fraiburgo, SC e videira na Serra Gaúcha, RS. Este trabalho avaliou, em laboratório, o efeito dos inseticidas deltametrina (Decis 25 CE, 40mL 100L-1, dimetoato (Dimetoato 400 CE, 150mL 100L-1, triclorfon (Dipterex 500 SNAqC, 300mL 100L-1, fosmet (Imidan 500 PM, 200g 100L-1, fention (Lebaycid 500 CE, 100mL 100L-1, clorpirifós (Lorsban 480 BR, 150mL 100L-1, malation (Malation 1000, 200mL 100L-1, carbaril (Sevin 480 SC, 360mL 100L-1, fenitrotion (Sumithion 500 CE, 150mL 100L-1 e metidation (Supracid 400 CE, 100mL 100L-1 atualmente empregados no controle de pragas em frutíferas temperadas e os novos inseticidas tiametoxam (Actara 250 WG, 15 e 30g 100L-1, benzoato de emamectina (Proclaim 5 SG, 10 e 20g 100L-1, imidacloprid (Provado 200 SC, 30 e 60mL 100L-1, spinosad (Tracer 480 CE, 10 e 20mL 100L-1 e etofenprox (Trebon 100 SC, 100 e 150mL 100L-1. No primeiro experimento, frutos de maçã foram mergulhados na calda inseticida por 10 segundos e oferecidos a adultos de S. zeamais sp (contato residual e, no segundo, os produtos foram aplicados diretamente sobre os insetos (contato direto em torre de pulverização. Os inseticidas triclorfon (150g 100L-1, fention (50g 100L-1, clorpirifós (72g 100L-1, malation (200g 100L-1, metidation (40g 100L-1 e tiametoxam (3,75 e 7,5g 100L-1 foram eficientes no controle do gorgulho do milho, via contato residual, enquanto fention (50g 100L-1, clorpirifós (72g 100L-1, malation (200g 100L-1, fenitrotion (75g 100L-1 e metidation (40g 100L-1 foram eficientes via contato direto.
An introduction to Management of Technology pedagogy (andragogy)
Berg, Dan; Mani, H.S.; Marinakis, Yorgos; Tierney, Robert; Tierney, Robert; Walsh, Steven Thomas
2015-01-01
In this introduction we leverage efforts of three professionals involved in the practice and use of MoT education. These professionals each discuss MoT from different perspectives. One is primarily interested in MoT pedagogy from a practitioner point of view. Another is a progenitor of the field.
Generation of a cold pulsed beam of Rb atoms by transfer from a 3D magneto-optic trap
Energy Technology Data Exchange (ETDEWEB)
Chanu, Sapam Ranjita; Rathod, Ketan D.; Natarajan, Vasant, E-mail: vasant@physics.iisc.ernet.in
2016-08-26
We demonstrate a technique for producing a cold pulsed beam of atoms by transferring a cloud of atoms trapped in a three dimensional magneto-optic trap (MOT). The MOT is loaded by heating a getter source of Rb atoms. We show that it is advantageous to transfer with two beams (with a small angle between them) compared to a single beam, because the atoms stop interacting with the beams in the two-beam technique, which results in a Gaussian velocity distribution. The atoms are further cooled in optical molasses by turning off the MOT magnetic field before the transfer beams are turned on. - Highlights: • Getter-source loaded magneto-optic trap (MOT). • Cold atomic beam generated by deflection from the MOT. • Use of two inclined beams for deflection.
Myths about vocabulary acquisition
Mondria, J.A.
2007-01-01
Vrai ou faux? Voilà la question. «Les listes de vocabulaire sont inutiles, parce qu’il faut toujours apprendre des mots en contexte, de préférence en déduisant le sens des mots à partir du contexte. De cette façon-là, les chances de retenir les mots sont optimales. Heureusement, il n’est pas
Directory of Open Access Journals (Sweden)
Jorge O Alarcón
2012-12-01
Full Text Available Objetivos. Estimar la incidencia de VIH en la población adulta del Perú, 2010, y analizar su distribución según comportamientos de riesgo. Materiales y métodos. Se aplicó el modelo de ONUSIDA según modos de transmisión (MoT. Los datos fueron obtenidos de la revisión detallada de 59 documentos (1984 - 2008. También se analizó bases de datos nacionales para obtener datos específicos. La selección final de los datos fue validada por el grupo técnico y un grupo de expertos. Después de la consulta con expertos, se corrigieron los valores y se realizó un análisis de incertidumbre. El modelo fue ajustado a la prevalencia nacional del 2009 (0,45%. Resultados. La incidencia estimada para el 2010 fue de 0,03%, (4346 nuevas infecciones. El 84% de nuevas infecciones se concentra en grupos de mayor riesgo: hombres que tienen sexo con hombres (55% y personas que tienen sexo casual heterosexual (6,2%. El 16% restante corresponde a la población heterosexual de bajo riesgo. La transmisión heterosexual es el 43% de nuevos casos, y dentro de estos el 18% corresponde a parejas femeninas de sujetos de alto riesgo. Solo 2,2% de casos está relacionado al trabajo sexual femenino y 1,0% a usuarios de drogas inyectables. Conclusiones. El modelo proporciona una estimación de la incidencia y su distribución entre los grupos de riesgo según el modo de transmisión, consistente con los reportes de casos de VIH. El modelo permite crear escenarios para ayudar a la toma de decisiones y formulación de políticas, así como para vigilancia y planificación de la prevención y control.Objectives. To estimate HIV incidence in the adult population of Peru, 2010, and analyze its distribution based on risk behavior. Materials and methods. The UNAIDS model was applied based on the modes of transmission (MoT. The information was obtained from the review detailed in 59 documents (1984 - 2008. National databases were also analyzed to obtain specific data. Final
Directory of Open Access Journals (Sweden)
Adelheid Koch-Didier
2014-04-01
Full Text Available Co-fondateur du dadaïsme à Berlin, Raoul Hausmann (1886-1971 est encore trop peu perçu comme écrivain de langue française. Ses archives conservées au musée d’Art contemporain de Rochechouart permettent cependant de découvrir cet artiste protéiforme qui fut peintre, photographe, poète, romancier, théoricien et danseur. Notre article se propose de retracer le lien entre le multilinguisme de Hausmann et sa créativité d’écrivain qui s’obstine à s’affranchir de toutes les normes linguistiques et artistiques.
High data rate atom interferometric device
Biedermann, Grant; McGuinness, Hayden James Evans; Rakholia, Akash
2015-07-21
A light-pulse atomic interferometry (LPAI) apparatus is provided. The LPAI apparatus comprises a vessel, two sets of magnetic coils configured to magnetically confine an atomic vapor in two respective magneto-optical traps (MOTs) within the vessel when activated, and an optical system configured to irradiate the atomic vapor within the vessel with laser radiation that, when suitably tuned, can launch atoms previously confined in each of the MOTs toward the other MOT. In embodiments, the magnetic coils are configured to produce a magnetic field that is non-zero at the midpoint between the traps. In embodiments, the time-of-flight of the launched atoms from one MOT to the other is 12 ms or less. In embodiments, the MOTs are situated approximately 36 mm apart. In embodiments, the apparatus is configured to activate the magnetic coils according to a particular temporal magnetic field gradient profile.
Ulku, Huseyin Arda; Bagci, Hakan; Michielssen, Eric
2013-01-01
An explicit marching on-in-time (MOT) scheme for solving the time-domain magnetic field integral equation (TD-MFIE) is presented. The proposed MOT-TD-MFIE solver uses Rao-Wilton-Glisson basis functions for spatial discretization and a PE(CE)m-type linear multistep method for time marching. Unlike previous explicit MOT-TD-MFIE solvers, the time step size can be chosen as large as that of the implicit MOT-TD-MFIE solvers without adversely affecting accuracy or stability. An algebraic stability analysis demonstrates the stability of the proposed explicit solver; its accuracy and efficiency are established via numerical examples. © 1963-2012 IEEE.
Ulku, Huseyin Arda
2013-08-01
An explicit marching on-in-time (MOT) scheme for solving the time-domain magnetic field integral equation (TD-MFIE) is presented. The proposed MOT-TD-MFIE solver uses Rao-Wilton-Glisson basis functions for spatial discretization and a PE(CE)m-type linear multistep method for time marching. Unlike previous explicit MOT-TD-MFIE solvers, the time step size can be chosen as large as that of the implicit MOT-TD-MFIE solvers without adversely affecting accuracy or stability. An algebraic stability analysis demonstrates the stability of the proposed explicit solver; its accuracy and efficiency are established via numerical examples. © 1963-2012 IEEE.
Le Petit Robert dictionnaire alphabétique et analogique de la langue française
Rey, Alain
2014-01-01
60 000 mots, 300 000 sens 35 000, citations. Retrouvez le français vivant, les mots et expressions d'aujourd'hui : astroparticule, biothèque, caméo, clivant, coltan, dim sum, fadette, itinérance, locavore, microbiote, modeux, street art, transgénérationnel ...Vérifiez l'usage de chaque mot : l'orthographe, la prononciation, les nuances de sens, les homonymes. Découvrez l'histoire des mots et leur étymologie Passez d'une idée à l'autre, allez du connu vers l'inconnu, en suivant les liens entre les mots : synonymes, analogies, contraires... Rencontrez les auteurs classiques et contemporains, par leurs citations : Olivier Adam, Emmanuel Carrère, Jean Echenoz, Annie Ernaux, Alice Ferney, Le Clézio, Carole Martinez, Patrick Modiano, Marie NDiaye, Amélie Nothomb, Daniel Pennac, Pascal Quignard, Michel Tournier, Michel Tremblay, Delphine de Vigan ... Voyagez dans la francophonie et partez à la découverte de ses richesses.
Simple atom trap in a conical hollow mirror: Numerical analysis
International Nuclear Information System (INIS)
Kim, J. A.; Lee, K. I.; Nha, H.; Noh, H. R.; Yoo, S. H.; Jhe, W
1996-01-01
We analyze the trap dynamic in a conical hollow (axicon) mirror system. Atom's trajectory is ring shaped if we move the coil (magnetic field) axis off the mirror axis and if we overlap these two axes trap cloud is ball shaped and it is consistent with experiment. We also make a simple comparison between 6-beam MOT and axicon MOT in the ball shaped case, and it shows that at low velocity limit the axicon MOT and typical 6-beam MOT have nearly same trap properties. The axicon trap may be useful as precooled atom source for many other atomic physics experiments such as cold atomic beam, atom funnel, and atom waveguide.
Ulku, Huseyin Arda; Bagci, Hakan; Michielssen, Eric
2012-01-01
An explicit yet stable marching-on-in-time (MOT) scheme for solving the time domain magnetic field integral equation (TD-MFIE) is presented. The stability of the explicit scheme is achieved via (i) accurate evaluation of the MOT matrix elements using closed form expressions and (ii) a PE(CE) m type linear multistep method for time marching. Numerical results demonstrate the accuracy and stability of the proposed explicit MOT-TD-MFIE solver. © 2012 IEEE.
Ulku, Huseyin Arda
2012-09-01
An explicit yet stable marching-on-in-time (MOT) scheme for solving the time domain magnetic field integral equation (TD-MFIE) is presented. The stability of the explicit scheme is achieved via (i) accurate evaluation of the MOT matrix elements using closed form expressions and (ii) a PE(CE) m type linear multistep method for time marching. Numerical results demonstrate the accuracy and stability of the proposed explicit MOT-TD-MFIE solver. © 2012 IEEE.
Estimación de la incidencia de VIH en población adulta de Paraguay con el modelo matemático MoT
Directory of Open Access Journals (Sweden)
Margarita Samudio
2015-03-01
Full Text Available OBJETIVO: Estimar la incidencia del VIH en la población adulta del Paraguay para 2014, y analizar su distribución con la incertidumbre asociada según comportamiento de riesgo. MÉTODOS: Se aplicó el modelo de ONUSIDA según modos de transmisión (MoT. Los datos se obtuvieron de la revisión detallada de documentos elaborados entre 1996 y 2013. Se realizó el análisis de incertidumbre de los valores estimados. RESULTADOS: La incidencia estimada para 2014 fue 0,091% (3 081 nuevas infecciones. Tanto el porcentaje de nuevas infecciones (74,75%, intervalo de confianza de 95%: 64,19-81,47 como la tasa de incidencia por 10 000 personas (9 518 fueron mayores en el grupo de hombres que tienen sexo con hombres (HSH y el segundo grupo más afectado fue el de personas que tienen sexo heterosexual estable (9,9%. La transmisión heterosexual se produjo en 23% de nuevos casos y 8% de ellos corresponde a parejas (hombres y mujeres de personas con comportamiento de alto riesgo de transmisión del VIH. El 1% está relacionado con el trabajo sexual de mujeres y el uso de drogas inyectables. CONCLUSIONES: Los resultados de la estimación de la incidencia de VIH y su distribución entre los grupos en riesgo son congruentes con los de los informes a escala nacional y con la población de HSH, la que acumula más casos de la epidemia. Las acciones de prevención deben dirigirse a este grupo para producir un impacto importante en el curso de la epidemia en el país. Además, se recomienda ampliar y fortalecer las actividades preventivas en las parejas estables de grupos en riesgo y en la población general.
Harrap's shorter dictionary English-French, French-English
2004-01-01
Maîtrisez parfaitement l'Anglais et l'Américain modernes. Les évolutions les plus récentes du vocabulaire. 350 000 mots et expressions 600 000 traductions. Nouveau : des centaines de mots nouveaux issus des grands thèmes de l'actualité (altermondialisme, bioterrorisme, coparentalité, bibande...). Une couverture complète du vocabulaire technique et idiomatique des deux langues. Un traitement détaillé des variantes régionales (irlandaises, australiennes, québécoises, belges, etc.). Les sigles, abréviations et noms propres. De nombreuses aides à la traduction : nouveau, 400 entrées longues introduites par des menus pour accéder sans ambiguïté à la bonne traduction ; nouveau, des notes culturelles pour comprendre mots et expressions liés à la civilisation anglo-saxonne ; des centaines de notes d'usage pour éviter les pièges de la traduction : faux amis, mots difficiles à traduire... Des milliers d'exemples pour illustrer les différents sens des mots. L'indication des niveaux de langue : ...
Glonnegger, Hannah; Beyle, Aline; Cerff, Bernhard; Gräber, Susanne; Csoti, Ilona; Berg, Daniela; Liepelt-Scarfone, Inga
2016-07-06
There is need for multidimensional quantitative assessment of cognitive driven activities of daily living (ADL) functions in Parkinson's disease (PD). To determine whether there is an ADL profile related to cognitive impairment in PD assessed by the Multiple Object Test (MOT). We assumed MOT performance to be lower in PD patients versus controls and in PD patients with more severe cognitive impairment. 50 PD patients with no cognitive impairment (PD-NC), 54 patients with PD-mild cognitive impairment (PD-MCI), 29 with Parkinson's disease dementia (PDD), and 40 healthy controls (HC) were investigated. Besides comprehensive cognitive testing, the MOT, a performance based test consisting of five routine tasks (e.g., preparing a cup of coffee), was applied. Quantitative (total errors and time) and qualitative (error type) MOT parameters were analyzed. Total time and number of MOT errors was increased in PD patients compared to controls (p < 0.001). These parameters also differentiated PDD patients from other cognitive groups (p < 0.05). No control subject had ≥ 4 errors in the MOT, but 30% of PD patients, especially PDD, scored above this cut-off. Omission (p < 0.001) and mislocation (p < 0.03) errors were more prominent in PDD than other cognitive groups. Perplexity errors did not differ between PD-MCI and PDD but between PD-NC and PDD (p = 0.01). MOT parameters discriminating between cognitive groups correlated mainly with lower test performance in psychomotor speed and executive function. Performance based testing is promising to identify quantitative and qualitative ADL aspects differentiating between different cognitive groups which might be helpful for an early detection of PDD.
An efficient explicit marching on in time solver for magnetic field volume integral equation
Sayed, Sadeed Bin
2015-07-25
An efficient explicit marching on in time (MOT) scheme for solving the magnetic field volume integral equation is proposed. The MOT system is cast in the form of an ordinary differential equation and is integrated in time using a PE(CE)m multistep scheme. At each time step, a system with a Gram matrix is solved for the predicted/corrected field expansion coefficients. Depending on the type of spatial testing scheme Gram matrix is sparse or consists of blocks with only diagonal entries regardless of the time step size. Consequently, the resulting MOT scheme is more efficient than its implicit counterparts, which call for inversion of fuller matrix system at lower frequencies. Numerical results, which demonstrate the efficiency, accuracy, and stability of the proposed MOT scheme, are presented.
Managing Innovation and Business Development Using Enterprise Architecture
DEFF Research Database (Denmark)
Tambo, Torben; Bækgaard, Lars
2011-01-01
technologies. In management of IT, it has become increasingly popular to use Enterprise Architecture (EA) as a method and supported by a series of formal frameworks. EA maps artifacts and motives against the business strategy. In this paper, MOT and EA are reviewed for their mutual potentials and issues. Two...... of well planned technological changes. Management of technology (MOT) addresses identification, selection, (long term) planning, designing, implementation and operation of technology based business development. Information Technology (IT) is a key enabler for a vast range of contemporary corporate...... case studies illustrate how enterprises can make major changes derived from business strategy observing both MOT and EA. This suggests a combined view inspired from the IT business’ dedication to EA using EA’s formalisms and the management orientation of MOT to improve understanding technological...
de Jong, Lex D; Peters, Andy; Hooper, Julie; Chalmers, Nina; Henderson, Claire; Laventure, Robert Me; Skelton, Dawn A
2016-06-20
Increasing physical activity (PA) brings many health benefits, but engaging people in higher levels of PA after their 60s is not straightforward. The Functional Fitness MOT (FFMOT) is a new approach which aims to raise awareness about the importance of components of fitness (strength, balance, flexibility), highlight benefits of PA, engages older people in health behavior change discussions, and directs them to local activity resources. This battery of tests combined with a brief motivational interview has not been tested in terms of feasibility or effectiveness. To assess whether the FFMOT, provided in a health care setting, is appealing to older patients of a community physiotherapy service and to understand the views and perceptions of the older people undergoing the FFMOT regarding the intervention, as well as the views of the physiotherapy staff delivering the intervention. Secondary aims are to assess the feasibility of carrying out a phase 2 pilot randomized controlled trial of the FFMOT, in the context of a community physiotherapy service, by establishing whether enough patients can be recruited and retained in the study, and enough outcome data can be generated. A mixed-methods feasibility study will be conducted in two physiotherapy outpatient clinics in the United Kingdom. A total of 30 physically inactive, medically stable older adults over the age of 60 will be provided with an individual FFMOT, comprising a set of six standardized, validated, age-appropriate tests aimed at raising awareness of the different components of fitness. The results of these tests will be used to provide the participants with feedback on performance in comparison to sex and age-referenced norms. This will be followed by tailored advice on how to become more active and improve fitness, including advice on local opportunities to be more active. Subsequently, participants will be invited to attend a focus group to discuss barriers and motivators to being more active, health
Lee, Yeh Chen; Kroon, René; Koczwara, Bogda; Haines, Ian; Francis, Kay; Millward, Michael; Kefford, Richard; Olver, Ian; Mileshkin, Linda
2017-08-01
The completion of continuing professional development (CPD) is mandatory for medical oncologists and trainees (MO&T). Pharmaceutical companies may fund some CPD activities, but there is increasing debate about the potential for conflicts of interest (COI). To assess current practices around funding to attend CPD activities. An electronic survey was distributed to Australian MO&T. The survey asked questions about current practices, institutional policies and perceptions about attending CPD funded by pharmaceutical companies. The design looked at comparing responses between MO&T as well as their understanding of and training around institutional and ethical process. A total of 157 of 653 (24%) responses was received, the majority from MO (76%). Most CPD activities attended by MO&T were self-funded (53%), followed by funding from institutions (19%), pharmaceutical companies (16%) and salary award (16%). Most institutions allowed MO&T to receive CPD funding from professional organisations (104/157, 66%) or pharmaceutical companies (90/157, 57%). A minority of respondents (13/157, 8%) reported that the process to use pharmaceutical funds had been considered by an ethics committee. Although 103/157 (66%) had received pharmaceutical funding for CPD, most (109/157, 69%) reported never receiving training about potential COI. The lack of education was more noticeable among trainees (odds ratio (OR) 8.61, P = 0.02). MO&T acknowledged the potential bias towards a pharmaceutical product (P = 0.05) but believed there was adequate separation between themselves and pharmaceutical companies (P < 0.01). Majority of CPD attended by MO&T is self-funded. There is lack of clarity in institutional policies regarding external funding support for CPD activities. Formal education about potential COI is lacking. © 2017 Royal Australasian College of Physicians.
International Nuclear Information System (INIS)
Huang Jia-Qiang; Wu Chen-Fei; Wang Li-Jun; Yan Xue-Shu; Zhang Jian-Wei
2016-01-01
We report our studies on an intense source of cold cesium atoms based on a two-dimensional (2D) magneto–optical trap (MOT) with independent axial cooling and pushing. The new-designed source, proposed as 2D-HP MOT, uses hollow laser beams for axial cooling and a thin pushing laser beam to extract a cold atomic beam. With the independent pushing beam, the atomic flux can be substantially optimized. The total atomic flux maximum obtained in the 2D-HP MOT is 4.02 × 10 10 atoms/s, increased by 60 percent compared to the traditional 2D + MOT in our experiment. Moreover, with the pushing power 10 μW and detuning 0 Γ , the 2D-HP MOT can generate a rather intense atomic beam with the concomitant light shift suppressed by a factor of 20. The axial velocity distribution of the cold cesium beams centers at 6.8 m/s with an FMHW of about 2.8 m/s. The dependences of the atomic flux on the pushing power and detuning are studied in detail. The experimental results are in good agreement with the theoretical model. (paper)
Collisional Cooling of Light Ions by Cotrapped Heavy Atoms.
Dutta, Sourav; Sawant, Rahul; Rangwala, S A
2017-03-17
We experimentally demonstrate cooling of trapped ions by collisions with cotrapped, higher-mass neutral atoms. It is shown that the lighter ^{39}K^{+} ions, created by ionizing ^{39}K atoms in a magneto-optical trap (MOT), when trapped in an ion trap and subsequently allowed to cool by collisions with ultracold, heavier ^{85}Rb atoms in a MOT, exhibit a longer trap lifetime than without the localized ^{85}Rb MOT atoms. A similar cooling of trapped ^{85}Rb^{+} ions by ultracold ^{133}Cs atoms in a MOT is also demonstrated in a different experimental configuration to validate this mechanism of ion cooling by localized and centered ultracold neutral atoms. Our results suggest that the cooling of ions by localized cold atoms holds for any mass ratio, thereby enabling studies on a wider class of atom-ion systems irrespective of their masses.
Directory of Open Access Journals (Sweden)
Magne Rogne
2008-06-01
Full Text Available Artikkelen tek for seg tekstomgrepet i norskfaget gjennom læreplananalysar. Først kjem ein faghistorisk gjennomgang med vekt på spørsmålet om norskfaget kan seiast å vere dynamisk i den forstand at det tek opp i seg tekstkulturelle endringar i samfunnet, særleg knytt til medie- og kommunikasjonsutviklinga. Denne gjennomgangen endar opp i ei drøfting av om dagens norskfag kan seiast å ha eit føremålstenleg tekstomgrep i høve til den funksjonen faget skal ha i dagens skule, med eit særleg fokus på spenninga mellom danning og nytte. Artikkelen konkluderer med at norskfaget har endra seg i tråd med samfunnsutviklinga når det gjeld kva type tekstar det er viktig å arbeide med, men òg at dei svake krava til det å meistre tekstproduksjon i dagens plan ikkje er i samsvar med overordna målsetjingar for faget.
Roueff, Olivier
2007-01-01
L’ouvrage d’André Schaeffner constitue la première analyse savante du jazz (1926). Il a marqué une étape importante dans le processus de réinvention du jazz en France en contribuant notamment, par sa réception et les polémiques qu’il a suscitées, à transformer l’identification du jazz d’une musique « américaine » à une musique « noire-américaine » (c’est-à-dire aux « racines » africaines). Les analyses proposées dans cet ouvrage, alors qu’elles désignaient des musiques que la critique de jazz...
An efficient explicit marching on in time solver for magnetic field volume integral equation
Sayed, Sadeed Bin; Ulku, H. Arda; Bagci, Hakan
2015-01-01
An efficient explicit marching on in time (MOT) scheme for solving the magnetic field volume integral equation is proposed. The MOT system is cast in the form of an ordinary differential equation and is integrated in time using a PE(CE)m multistep
Construction of an apparatus for the magnetic capture of fermionic lithium atoms
International Nuclear Information System (INIS)
Jochim, S.
2000-01-01
This thesis reports on the construction of an apparatus for the magneto-optical trapping of the fermionic 6 Li-Isotope. This represents a first step towards experiments on the quantum degeneracy of dilute fermionic gases. The magneto-optical trap (MOT) will serve as a cold atom source for loading an optical trap. The apparatus consists of a laser system that excites the two 6 Li-D 2 -lines at 671 nm, an arrangement of coils generating the magnetic fields necessary to operate the MOT and a Zeeman slower, and a UHV-apparatus. The MOT is loaded from a thermal atomic beam. The Zeeman slower decelerates atoms with a velocity smaller than 600 m/s to about 40 m/s, so that they can be captured in the MOT. We expect to trap at least 10 8 atoms at a temperature of about 400 μK. (orig.)
Atomic fountain and applications
International Nuclear Information System (INIS)
Rawat, H.S.
2000-01-01
An overview of the development of working of MOT along with the basic principle of laser atom cooling and trapping is given. A technique to separate the cooled and trapped atoms from the MOT using atomic fountain technique will also be covered. The widely used technique for atomic fountain is, first to cool and trap the neutral atoms in MOT and then launch them in the vertical direction, using moving molasses technique. Using 133 Cs atomic fountain clock, time improvement of 2 to 3 order of magnitude over a conventional 133 Cs atomic clock has been observed
Directory of Open Access Journals (Sweden)
Jacques Lévy
2004-10-01
Full Text Available Depuis quelques années, le mot « genre » tend à remplacer le mot « sexe » dans les sciences sociales francophones. Pour une part, ce changement est probablement plus justifié en anglais, pour lequel le mot « sex » renvoie plus exclusivement qu’en français à la sexualité ( to have sex = faire l’amour. L’engouement francophone s’explique cependant, pour l’essentiel, par la même motivation que celui des anglophones : montrer que les différences observées dans ...
van der Horst, Gerhard; Bennett, Monique; Bishop, John D D
2018-04-09
Sperm movement has been described in several phyla of invertebrates. Yet, sperm motility has only been quantified using computer-aided sperm analysis (CASA-Mot) in externally fertilising species (broadcast spawners) of two phyla, molluscs and echinoderms. In the present study we quantified in detail the nature of the sperm tracks, percentage motility groupings and detailed kinematics of rapid-, medium- and slow-swimming spermatozoa in the oyster Crassostrea gigas and four species never previously studied by CASA-Mot, namely the molluscs Choromytilus meridionalis, Donax serra and Haliotis midae and the echinoderm Parechinus angulosus. A feature common to all these species are the helical tracks, the diameter of which seems to be species specific. Using CASA-Mot, the behaviour of spermatozoa was also studied over time and in the presence of egg water and Ca2+ modulators such as caffeine and procaine hydrochloride. For the first time, we show that hyperactivation can be induced in all species in the presence of egg water (sea water that was mixed with mature eggs and then centrifuged) and/or caffeine, and these hyperactivated sperm tracks were characterised using CASA-Mot. We relate the different patterns of sperm motility and behaviour to reproductive strategies such as broadcast spawning and spermcasting, and briefly review studies using CASA-Mot on other invertebrates.
Sayed, Sadeed Bin
2015-05-05
A time domain electric field volume integral equation (TD-EFVIE) solver is proposed for characterizing transient electromagnetic wave interactions on high-contrast dielectric scatterers. The TD-EFVIE is discretized using the Schaubert- Wilton-Glisson (SWG) and approximate prolate spherical wave (APSW) functions in space and time, respectively. The resulting system of equations can not be solved by a straightforward application of the marching on-in-time (MOT) scheme since the two-sided APSW interpolation functions require the knowledge of unknown “future” field samples during time marching. Causality of the MOT scheme is restored using an extrapolation technique that predicts the future samples from known “past” ones. Unlike the extrapolation techniques developed for MOT schemes that are used in solving time domain surface integral equations, this scheme trains the extrapolation coefficients using samples of exponentials with exponents on the complex frequency plane. This increases the stability of the MOT-TD-EFVIE solver significantly, since the temporal behavior of decaying and oscillating electromagnetic modes induced inside the scatterers is very accurately taken into account by this new extrapolation scheme. Numerical results demonstrate that the proposed MOT solver maintains its stability even when applied to analyzing wave interactions on high-contrast scatterers.
Sayed, Sadeed Bin; Ulku, Huseyin; Bagci, Hakan
2015-01-01
A time domain electric field volume integral equation (TD-EFVIE) solver is proposed for characterizing transient electromagnetic wave interactions on high-contrast dielectric scatterers. The TD-EFVIE is discretized using the Schaubert- Wilton-Glisson (SWG) and approximate prolate spherical wave (APSW) functions in space and time, respectively. The resulting system of equations can not be solved by a straightforward application of the marching on-in-time (MOT) scheme since the two-sided APSW interpolation functions require the knowledge of unknown “future” field samples during time marching. Causality of the MOT scheme is restored using an extrapolation technique that predicts the future samples from known “past” ones. Unlike the extrapolation techniques developed for MOT schemes that are used in solving time domain surface integral equations, this scheme trains the extrapolation coefficients using samples of exponentials with exponents on the complex frequency plane. This increases the stability of the MOT-TD-EFVIE solver significantly, since the temporal behavior of decaying and oscillating electromagnetic modes induced inside the scatterers is very accurately taken into account by this new extrapolation scheme. Numerical results demonstrate that the proposed MOT solver maintains its stability even when applied to analyzing wave interactions on high-contrast scatterers.
Managing Technological Dynamics. A Transdisciplinary Perspective
DEFF Research Database (Denmark)
Drejer, Anders; Ulhøi, John Parm
1998-01-01
The authors of this paper represent different traditions and approaches to Management of Technology (MoT) and to Technology Studies (TS) at firm level. This offers an opportunity to develop a transdisciplinary perspective. MoT and TS, it is argued, can be addressed from rationalistic planning...
Knox, R V; Ringwelski, J M; McNamara, K A; Aardsma, M; Bojko, M
2015-08-01
Frozen-thawed boar sperm (FTS) has reduced in vitro and in vivo life span compared to liquid semen. Experiments tested whether extenders, thawing procedures, and storage temperatures could extend the fertile life span of FTS. Experiment 1 tested the effect of six extenders on postthaw motility (MOT) and viability (VIA). Straws from boars (n = 6) were thawed, diluted into each extender, and evaluated at 20, 60, and 120 minutes. There was a trend (P = 0.08) for an extender-by-time interaction for MOT and effect of extender and time for MOT (P extender (P = 0.10) and time (P boar ejaculates (n = 15) were thawed at 50 °C for 10, 20, or 30 seconds or at 70 °C for 5, 10, or 20 seconds and evaluated at 5, 30, and 60 minutes. There was an effect of thawing treatment on MOT, VIA, and ACR (viable sperm with intact acrosomes, P extenders, thawing, and storage. Copyright © 2015 Elsevier Inc. All rights reserved.
Bagci, Hakan
2014-01-06
Time domain integral equation (TDIE) solvers represent an attractive alternative to finite difference (FDTD) and finite element (FEM) schemes for analyzing transient electromagnetic interactions on composite scatterers. Current induced on a scatterer, in response to a transient incident field, generates a scattered field. First, the scattered field is expressed as a spatio-temporal convolution of the current and the Green function of the background medium. Then, a TDIE is obtained by enforcing boundary conditions and/or fundamental field relations. TDIEs are often solved for the unknown current using marching on-in-time (MOT) schemes. MOT-TDIE solvers expand the current using local spatio-temporal basis functions. Inserting this expansion into the TDIE and testing the resulting equation in space and time yields a lower triangular system of equations (termed MOT system), which can be solved by marching in time for the coefficients of the current expansion. Stability of the MOT scheme often depends on how accurately the spatio-temporal convolution of the current and the Green function is discretized. In this work, band-limited prolate-based interpolation functions are used as temporal bases in expanding the current and discretizing the spatio-temporal convolution. Unfortunately, these functions are two sided, i.e., they require ”future” current samples for interpolation, resulting in a non-causal MOT system. To alleviate the effect of non-causality and restore the ability to march in time, an extrapolation scheme can be used to estimate the future values of the currents from their past values. Here, an accurate, stable and band-limited extrapolation scheme is developed for this purpose. This extrapolation scheme uses complex exponents, rather than commonly used harmonics, so that propagating and decaying mode fields inside the dielectric scatterers are accurately modeled. The resulting MOT scheme is applied to solving the time domain volume integral equation (VIE
On the geodesic incompleteness of spacetimes containing marginally (outer) trapped surfaces
International Nuclear Information System (INIS)
Costa e Silva, I P
2012-01-01
In a recent paper, Eichmair et al (2012 arXiv:1204.0278v1) have proved a Gannon–Lee-type singularity theorem based on the existence of marginally outer trapped surfaces (MOTS) on noncompact initial data sets for globally hyperbolic spacetimes. A natural question is whether the corresponding incomplete geodesics could still be complete in a possible non-globally hyperbolic extension of spacetime. In this paper, some variants of their result are given with weaker causality assumptions, thus suggesting that the answer is generically negative, at least if the putative extension has no closed timelike curves. We consider first marginally trapped surfaces (MTS) in chronological spacetimes, introducing the natural notion of a generic MTS, a notion also applicable to MOTS. In particular, a Hawking–Penrose-type singularity theorem is proven in chronological spacetimes with dimension n ⩾ 3 containing a generic MTS. Such surfaces naturally arise as cross-sections of quasi-local generalizations of black hole horizons, such as dynamical and trapping horizons, and we discuss some natural conditions which ensure the existence of MTS in initial data sets. Nevertheless, much of the more recent literature has focused on MOTS rather than MTS as quasi-local substitutes for the description of black holes, as they are arguably more natural and easier to handle in a number of situations. It is therefore pertinent to ask to what extent one can deduce the existence of singularities in the presence of MOTS alone. We address this issue and show that singularities indeed arise in the presence of generic MOTS, but under slightly stronger causal conditions than those in the case of MTS (specifically, for causally simple spacetimes). On the other hand, we show that with additional conditions on the MOTS itself, namely that it is either the boundary of a compact spatial region, or strictly stable in a suitable sense, a Penrose–Hawking-type singularity theorem can still be established for
Dynamics and applications of excited cold atoms
Claessens, B.J.
2006-01-01
In a Magneto-Optical Trap (MOT), realized for the first time in 1987, one can trap and cool neutral atoms to temperatures below a mK. The invention of this device caused a revolution in atomic physics. With an MOT collision and spectroscopy experiments could be performed with unprecedented accuracy.
Directory of Open Access Journals (Sweden)
Jerusa Fumagalli de Salles
2014-08-01
Full Text Available L'étude décrit la production écrite d'histories par enfants avec trois années de scolarité dans écoles publiques et les compare entre sous-groupes de compétences em lecture et écriture de mots/pseudomots. Les productions textuelles ont été regroupés em cinq catégories: 54,6% de l'échantillon atteint catégories intermédiaires (III et IV, caractérisé par l'absence d'une situation problématique ou juste une esquisse de ça. Il existe une association significative entre les compétences dans le niveau de mot et la production de texte narratif écrit. Les enfants qui sont qualifiés dans la lecture et l'écriture de mots/pseudomots sont qualifiés dans la production de texte écrit aussi. L'inverse est également vrai. Le domaine des correspondances de graphèmes et phonèmes reguliérs em lecture et écriture semble être important pour la production écrite de texte narratif. Toutefois, le compétence en lecture de mots irréguliers semble être plus important que en le écriture de mots irréguliers par la production écrit de l'histoire.
Practical Considerations for Use of Mobile Apps at the Tactical Edge
2014-06-01
supports and drives the diversity of apps available on the market, including support of the development and deployment of the apps, as well the...Face recognition, gesture-based inputs, speech recognition Software engineering methods to address MOTS 19 MOTS Example: Samsung Evolution Kit TV 20 Replace modular box to upgrade TV
A Time Marching Scheme for Solving Volume Integral Equations on Nonlinear Scatterers
Bagci, Hakan
2015-01-07
Transient electromagnetic field interactions on inhomogeneous penetrable scatterers can be analyzed by solving time domain volume integral equations (TDVIEs). TDVIEs are oftentimes solved using marchingon-in-time (MOT) schemes. Unlike finite difference and finite element schemes, MOT-TDVIE solvers require discretization of only the scatterers, do not call for artificial absorbing boundary conditions, and are more robust to numerical phase dispersion. On the other hand, their computational cost is high, they suffer from late-time instabilities, and their implicit nature makes incorporation of nonlinear constitutive relations more difficult. Development of plane-wave time-domain (PWTD) and FFT-based schemes has significantly reduced the computational cost of the MOT-TDVIE solvers. Additionally, latetime instability problem has been alleviated for all practical purposes with the development of accurate integration schemes and specially designed temporal basis functions. Addressing the third challenge is the topic of this presentation. I will talk about an explicit MOT scheme developed for solving the TDVIE on scatterers with nonlinear material properties. The proposed scheme separately discretizes the TDVIE and the nonlinear constitutive relation between electric field intensity and flux density. The unknown field intensity and flux density are expanded using half and full Schaubert-Wilton-Glisson (SWG) basis functions in space and polynomial temporal interpolators in time. The resulting coupled system of the discretized TDVIE and constitutive relation is integrated in time using an explicit P E(CE) m scheme to yield the unknown expansion coefficients. Explicitness of time marching allows for straightforward incorporation of the nonlinearity as a function evaluation on the right hand side of the coupled system of equations. Consequently, the resulting MOT scheme does not call for a Newton-like nonlinear solver. Numerical examples, which demonstrate the applicability
Li, Minglan; Reynolds, Clare M; Sloboda, Deborah M; Gray, Clint; Vickers, Mark H
2013-01-01
Maternal obesity is associated with obesity and metabolic disorders in offspring. However, intervention strategies to reverse or ameliorate the effects of maternal obesity on offspring health are limited. Following maternal undernutrition, taurine supplementation can improve outcomes in offspring, possibly via effects on glucose homeostasis and insulin secretion. The effects of taurine in mediating inflammatory processes as a protective mechanism has not been investigated. Further, the efficacy of taurine supplementation in the setting of maternal obesity is not known. Using a model of maternal obesity, we examined the effects of maternal taurine supplementation on outcomes related to inflammation and lipid metabolism in mothers and neonates. Time-mated Wistar rats were randomised to either: 1) control : control diet during pregnancy and lactation (CON); 2) CON supplemented with 1.5% taurine in drinking water (CT); 3) maternal obesogenic diet (high fat, high fructose) during pregnancy and lactation (MO); or 4) MO supplemented with taurine (MOT). Maternal and neonatal weights, plasma cytokines and hepatic gene expression were analysed. A MO diet resulted in maternal hyperinsulinemia and hyperleptinemia and increased plasma glucose, glutamate and TNF-α concentrations. Taurine normalised maternal plasma TNF-α and glutamate concentrations in MOT animals. Both MO and MOT mothers displayed evidence of fatty liver accompanied by alterations in key markers of hepatic lipid metabolism. MO neonates displayed a pro-inflammatory hepatic profile which was partially rescued in MOT offspring. Conversely, a pro-inflammatory phenotype was observed in MOT mothers suggesting a possible maternal trade-off to protect the neonate. Despite protective effects of taurine in MOT offspring, neonatal mortality was increased in CT neonates, indicating possible adverse effects of taurine in the setting of normal pregnancy. These data suggest that maternal taurine supplementation may
A Time Marching Scheme for Solving Volume Integral Equations on Nonlinear Scatterers
Bagci, Hakan
2015-01-01
Transient electromagnetic field interactions on inhomogeneous penetrable scatterers can be analyzed by solving time domain volume integral equations (TDVIEs). TDVIEs are oftentimes solved using marchingon-in-time (MOT) schemes. Unlike finite difference and finite element schemes, MOT-TDVIE solvers require discretization of only the scatterers, do not call for artificial absorbing boundary conditions, and are more robust to numerical phase dispersion. On the other hand, their computational cost is high, they suffer from late-time instabilities, and their implicit nature makes incorporation of nonlinear constitutive relations more difficult. Development of plane-wave time-domain (PWTD) and FFT-based schemes has significantly reduced the computational cost of the MOT-TDVIE solvers. Additionally, latetime instability problem has been alleviated for all practical purposes with the development of accurate integration schemes and specially designed temporal basis functions. Addressing the third challenge is the topic of this presentation. I will talk about an explicit MOT scheme developed for solving the TDVIE on scatterers with nonlinear material properties. The proposed scheme separately discretizes the TDVIE and the nonlinear constitutive relation between electric field intensity and flux density. The unknown field intensity and flux density are expanded using half and full Schaubert-Wilton-Glisson (SWG) basis functions in space and polynomial temporal interpolators in time. The resulting coupled system of the discretized TDVIE and constitutive relation is integrated in time using an explicit P E(CE) m scheme to yield the unknown expansion coefficients. Explicitness of time marching allows for straightforward incorporation of the nonlinearity as a function evaluation on the right hand side of the coupled system of equations. Consequently, the resulting MOT scheme does not call for a Newton-like nonlinear solver. Numerical examples, which demonstrate the applicability
Magneto-optical trap for metastable helium at 389 nm
Koelemeij, J.C.J.; Stas, R.J.W.; Hogervorst, W.; Vassen, W.
2003-01-01
We have constructed a magneto-optical trap (MOT) for metastable triplet helium atoms utilizing the 2 S-3(1)-->3 P-3(2) line at 389 nm as the trapping and cooling transition. The far-red-detuned MOT (detuning Delta=-41 MHz) typically contains few times 10(7) atoms at a relatively high (similar
Shi, Yifei; Bagci, Hakan; Lu, Mingyu
2014-01-01
When marching-on-in-time (MOT) method is applied to solve the time-domain electric field integral equation, spurious internal resonant and static loop modes are always observed in the solution. The internal resonant modes have recently been studied by the authors; this letter investigates the static loop modes. Like internal resonant modes, static loop modes, in theory, should not be observed in the MOT solution since they do not satisfy the zero initial conditions; their appearance is attributed to numerical errors. It is discussed in this letter that the dependence of spurious static loop modes on numerical errors is substantially different from that of spurious internal resonant modes. More specifically, when Rao-Wilton-Glisson functions and Lagrange interpolation functions are used as spatial and temporal basis functions, respectively, errors due to space-time discretization have no discernible impact on spurious static loop modes. Numerical experiments indeed support this discussion and demonstrate that the numerical errors due to the approximate solution of the MOT matrix system have dominant impact on spurious static loop modes in the MOT solution. © 2014 IEEE.
Francophonie en Asie du Sud-Est – Ce qu’on en dit localement, ce qu’on brandit institutionnellement
Directory of Open Access Journals (Sweden)
Michel Le Gall
2016-12-01
Full Text Available Le 20 mars 2016, la journée internationale de la francophonie était placée par ses instances de parrainage sous le signe du « pouvoir des mots ». Slogan ? Mot d’ordre ? Sésame ? Catalyseur ? Était-on invités à fêter le pouvoir que possèdent les mots en eux-mêmes, ou celui que chaque francophone exerce par leur usage, ou bien incitait-on à rallier un pouvoir constitué et donc des mots agrégés de longue date autour de certains enjeux économiques ou politiques ? En regard de ce que des élèves, des étudiants ou des enseignants expriment spontanément à propos de leur apprentissage ou usages de la langue française au Vietnam, on essaiera de comprendre à travers quelques exemples comment certains éléments institutionnels de langage ont vécu l’épreuve des traductions, des appropriations, des approximations ou des expropriations locales lors de ces deux dernières décennies.
Grey, Ben; Farnfield, Steve
2017-04-01
Reder and Duncan's well-known studies of the 1990s on fatal child abuse drew attention to how parental scripts regarding their children could dangerously distort relationships in ways that were sometimes fatal to children. This article reports on a new system for assessing the 'meaning of the child to the parent', called the Meaning of the Child Interview (MotC). Parents are interviewed using the established Parent Development Interview, or equivalent, and the transcript of the interview is then analysed according to parental sensitivity and likely risk to the child. The MotC constructs were developed from those used in observed parent-child interaction (specifically, the CARE-Index) and the form of discourse analysis used in the Dynamic Maturational Model - Adult Attachment Interview, allowing a more systemic and inter-subjective understanding of parenting representations than often put forward. This article discusses the theoretical background to the MotC, gives a brief review of similar measures and then introduces the coding system and patterns of caregiving. The validity of the MotC is addressed elsewhere.
High-flux cold rubidium atomic beam for strongly-coupled cavity QED
Energy Technology Data Exchange (ETDEWEB)
Roy, Basudev [Indian Institute of Science Education and Research, Kolkata (India); University of Maryland, MD (United States); Scholten, Michael [University of Maryland, MD (United States)
2012-08-15
This paper presents a setup capable of producing a high-flux continuous beam of cold rubidium atoms for cavity quantum electrodynamics experiments in the region of strong coupling. A 2D{sup +} magneto-optical trap (MOT), loaded with rubidium getters in a dry-film-coated vapor cell, fed a secondary moving-molasses MOT (MM-MOT) at a rate greater than 2 x 10{sup 10} atoms/s. The MM-MOT provided a continuous beam with a tunable velocity. This beam was then directed through the waist of a cavity with a length of 280 μm, resulting in a vacuum Rabi splitting of more than ±10 MHz. The presence of a sufficient number of atoms in the cavity mode also enabled splitting in the polarization perpendicular to the input. The cavity was in the strong coupling region, with an atom-photon dipole coupling coefficient g of 7 MHz, a cavity mode decay rate κ of 3 MHz, and a spontaneous emission decay rate γ of 6 MHz.
Zhang, Yuxiang; Zeng, Zhigang; Chen, Shuai; Wang, Xiaoyuan; Yin, Xuebo
2018-06-01
In the middle Okinawa Trough (MOT), rhyolites have been typically considered as products of crystallization differentiation of basaltic magma as a feature of bimodal volcanism. However, the evidence is insufficient. This paper compared chemical trends of volcanic rocks from the MOT with fractional crystallization simulation models and experimental results and utilized trace element modeling combined with Rayleigh fractionation calculations to re-examine fractional crystallization processes in generating rhyolites. Both qualitative and quantitative studies indicate that andesites, rather than rhyolites, originate by fractional crystallization from basalts in the MOT. Furthermore, we established two batch-melting models for the MOT rhyolites and proposed that type 1 rhyolites are produced by remelting of andesites with amphiboles in the residue, while type 2 rhyolites are derived from remelting of andesites without residual amphiboles. It is difficult to produce melts with a SiO2 content ranging from 62% to 68% either by magmatic differentiation from basalts or by remelting of andesites, and this difficulty might help account for the compositional gap (Daly gap) for bimodal volcanism in the Okinawa Trough.
Directory of Open Access Journals (Sweden)
Denise Pumain
1998-07-01
Full Text Available Voici venir la saison du surf. .Trop souvent hélas, la navigation sur Internet se réduit à un flottement indécis, voire s'achève par la noyade! De très nombreux sites répondent au même mot-clé (par exemple, un seul moteur de recherche vous propose plus de 4000 sites à l'appel du mot "geography". Beaucoup n'ont en fait aucun rapport avec le sujet qui vous intéresse (on ne saurait reprocher à certains groupes de rock d'avoir jugé bon d'inclure le mot géographie dans leur intitulé et le conten...
Directory of Open Access Journals (Sweden)
Jacques Virchaux
2006-05-01
Full Text Available Le point de vue de l’informatique. Le trafic est constitué des éléments d'informations qui circulent entre deux équipements — typiquement un ordinateur et un serveur — par l'intermédiaire du réseau. Ces informations sont structurées selon des protocoles pour permettre un dialogue harmonieux et ne pas se perdre. Elles sont organisées en différentes couches pour leur traitement jusqu'au niveau d'une application, seul résultat intéressant en fin de compte ...
Experimental Investigation of the Influence of the Laser Beam Waist on Cold Atom Guiding Efficiency.
Song, Ningfang; Hu, Di; Xu, Xiaobin; Li, Wei; Lu, Xiangxiang; Song, Yitong
2018-02-28
The primary purpose of this study is to investigate the influence of the vertical guiding laser beam waist on cold atom guiding efficiency. In this study, a double magneto-optical trap (MOT) apparatus is used. With an unbalanced force in the horizontal direction, a cold atomic beam is generated by the first MOT. The cold atoms enter the second chamber and are then re-trapped and cooled by the second MOT. By releasing a second atom cloud, the process of transferring the cold atoms from MOT to the dipole trap, which is formed by a red-detuned converged 1064-nm laser, is experimentally demonstrated. And after releasing for 20 ms, the atom cloud is guided to a distance of approximately 3 mm. As indicated by the results, the guiding efficiency depends strongly on the laser beam waist; the efficiency reaches a maximum when the waist radius ( w ₀) of the laser is in the range of 15 to 25 μm, while the initial atom cloud has a radius of 133 μm. Additionally, the properties of the atoms inside the dipole potential trap, such as the distribution profile and lifetime, are deduced from the fluorescence images.
Le traitement macrostructural de l'emprunt au français dans les ...
African Journals Online (AJOL)
«ciment, brique, … surfer (Internet), s'abonner, affecter. (être), nommer (être), etc. Nous allons nous intéresser précisément aux mots locaux qui ont été créés pour remplacer les mots empruntés. Les emprunts sont souvent spontanément et naturellement remplacés à long terme par les termes locaux lorsque les choses et ...
Ulku, Huseyin Arda
2014-07-06
Effects of material nonlinearities on electromagnetic field interactions become dominant as field amplitudes increase. A typical example is observed in plasmonics, where highly localized fields “activate” Kerr nonlinearities. Naturally, time domain solvers are the method of choice when it comes simulating these nonlinear effects. Oftentimes, finite difference time domain (FDTD) method is used for this purpose. This is simply due to the fact that explicitness of the FDTD renders the implementation easier and the material nonlinearity can be easily accounted for using an auxiliary differential equation (J.H. Green and A. Taflove, Opt. Express, 14(18), 8305-8310, 2006). On the other hand, explicit marching on-in-time (MOT)-based time domain integral equation (TDIE) solvers have never been used for the same purpose even though they offer several advantages over FDTD (E. Michielssen, et al., ECCOMAS CFD, The Netherlands, Sep. 5-8, 2006). This is because explicit MOT solvers have never been stabilized until not so long ago. Recently an explicit but stable MOT scheme has been proposed for solving the time domain surface magnetic field integral equation (H.A. Ulku, et al., IEEE Trans. Antennas Propag., 61(8), 4120-4131, 2013) and later it has been extended for the time domain volume electric field integral equation (TDVEFIE) (S. B. Sayed, et al., Pr. Electromagn. Res. S., 378, Stockholm, 2013). This explicit MOT scheme uses predictor-corrector updates together with successive over relaxation during time marching to stabilize the solution even when time step is as large as in the implicit counterpart. In this work, an explicit MOT-TDVEFIE solver is proposed for analyzing electromagnetic wave interactions on scatterers exhibiting Kerr nonlinearity. Nonlinearity is accounted for using the constitutive relation between the electric field intensity and flux density. Then, this relation and the TDVEFIE are discretized together by expanding the intensity and flux - sing half
Testez vos connaissances en langue française
Bouvet, Stéphanie
2009-01-01
C'est bien connu, la langue française est riche, très riche. Le " petit " Larousse ne compte pas moins de 150 000 définitions ! Le problème, c'est qu'elle est même tellement riche que vous y perdez parfois votre latin. Avec Testez vos connaissances en langue française, vous allez pouvoir réviser vos classiques tout en découvrant des trésors bien cachés du lexique français : étymologies surprenantes, sens insoupçonné de mots régionaux ou d'argotismes, équivalences entre mots de niveau de langage différents, etc. Ludique et instructif, Testez vos connaissances en langue française est un voyage à travers l'histoire des mots et des usages.
Myositis ossificans traumatica in young children: report of three cases and review of the literature
International Nuclear Information System (INIS)
Gindele, A.; Benz-Bohm, G.; Schwamborn, D.; Tsironis, K.
2000-01-01
Myositis ossificans traumatica (MOT) is a rare musculoskeletal disorder in young children. Clinical and imaging presentation in the early stage of disease makes it difficult to differentiate between infection and musculoskeletal neoplasms, particularly in the absence of a history of trauma. Three cases of MOT in children under the age of 10 years, two with inferential trauma, are presented and the findings on different imaging modalities are discussed with reference to the existing literature. While findings based on a single imaging technique, including MRI, may be rather non-specific and even misleading, the combination of different modalities can assist in the consideration of MOT as a possible diagnosis. For example, the demonstration of soft-tissue haematoma on US would suggest the traumatic origin. A rational imaging approach is proposed. (orig.)
Myositis ossificans traumatica in young children: report of three cases and review of the literature
Energy Technology Data Exchange (ETDEWEB)
Gindele, A.; Benz-Bohm, G. [Department of Diagnostic Radiology, Pediatric Radiology, University of Cologne, Medical School, Kerpener Strasse 68, 50 924 Cologne (Germany); Schwamborn, D. [Paediatric Oncology, University Children' s Hospital, Cologne (Germany); Tsironis, K. [Department of Surgery, Leverkusen Hospital, Cologne (Germany)
2000-07-01
Myositis ossificans traumatica (MOT) is a rare musculoskeletal disorder in young children. Clinical and imaging presentation in the early stage of disease makes it difficult to differentiate between infection and musculoskeletal neoplasms, particularly in the absence of a history of trauma. Three cases of MOT in children under the age of 10 years, two with inferential trauma, are presented and the findings on different imaging modalities are discussed with reference to the existing literature. While findings based on a single imaging technique, including MRI, may be rather non-specific and even misleading, the combination of different modalities can assist in the consideration of MOT as a possible diagnosis. For example, the demonstration of soft-tissue haematoma on US would suggest the traumatic origin. A rational imaging approach is proposed. (orig.)
DEFF Research Database (Denmark)
Pilkington, Alan
2014-01-01
This paper reports a bibliometric analysis (co-citation network analysis) of 10 journals in the management of technology (MOT) field. As well as introducing various bibliometric ideas, network analysis tools identify and explore the concepts covered by the field and their inter-relationships. Spe......This paper reports a bibliometric analysis (co-citation network analysis) of 10 journals in the management of technology (MOT) field. As well as introducing various bibliometric ideas, network analysis tools identify and explore the concepts covered by the field and their inter......-relationships. Specific results from different levels of analysis show the different dimensions of technology management: • Co-word terms identify themes • Journal co-citation network: linking to other disciplines • Co-citation network show concentrations of themes The analysis shows that MOT has a bridging role...
Visual attention measures predict pedestrian detection in central field loss: a pilot study.
Alberti, Concetta F; Horowitz, Todd; Bronstad, P Matthew; Bowers, Alex R
2014-01-01
The ability of visually impaired people to deploy attention effectively to maximize use of their residual vision in dynamic situations is fundamental to safe mobility. We conducted a pilot study to evaluate whether tests of dynamic attention (multiple object tracking; MOT) and static attention (Useful Field of View; UFOV) were predictive of the ability of people with central field loss (CFL) to detect pedestrian hazards in simulated driving. 11 people with bilateral CFL (visual acuity 20/30-20/200) and 11 age-similar normally-sighted drivers participated. Dynamic and static attention were evaluated with brief, computer-based MOT and UFOV tasks, respectively. Dependent variables were the log speed threshold for 60% correct identification of targets (MOT) and the increase in the presentation duration for 75% correct identification of a central target when a concurrent peripheral task was added (UFOV divided and selective attention subtests). Participants drove in a simulator and pressed the horn whenever they detected pedestrians that walked or ran toward the road. The dependent variable was the proportion of timely reactions (could have stopped in time to avoid a collision). UFOV and MOT performance of CFL participants was poorer than that of controls, and the proportion of timely reactions was also lower (worse) (84% and 97%, respectively; p = 0.001). For CFL participants, higher proportions of timely reactions correlated significantly with higher (better) MOT speed thresholds (r = 0.73, p = 0.01), with better performance on the UFOV divided and selective attention subtests (r = -0.66 and -0.62, respectively, pattention may provide useful measures of functional visual ability of individuals with CFL relevant to more complex mobility tasks.
Cognitive-motor dual-task ability of athletes with and without intellectual impairment.
Van Biesen, Debbie; Jacobs, Lore; McCulloch, Katina; Janssens, Luc; Vanlandewijck, Yves C
2018-03-01
Cognition is important in many sports, for example, making split-second-decisions under pressure, or memorising complex movement sequences. The dual-task (DT) paradigm is an ecologically valid approach for the assessment of cognitive function in conjunction with motor demands. This study aimed to determine the impact of impaired intelligence on DT performance. The motor task required balancing on one leg on a beam, and the cognitive task was a multiple-object-tracking (MOT) task assessing dynamic visual-search capacity. The sample included 206 well-trained athletes with and without intellectual impairment (II), matched for sport, age and training volume (140 males, 66 females, M age = 23.2 ± 4.1 years, M training experience = 12.3 ± 5.7 years). In the single-task condition, II-athletes showed reduced balance control (F = 55.9, P balance and the MOT task between both groups. The DT costs were significantly larger for the II-athletes (-8.28% versus -1.34% for MOT and -33.13% versus -12.89% for balance). The assessment of MOT in a DT paradigm provided insight in how impaired intelligence constrains the ability of II-athletes to successfully perform at the highest levels in the complex and dynamical sport-environment.
Theoretical Perspectives of Enterprise Architecture for Technological Transformation
DEFF Research Database (Denmark)
Tambo, Torben
2017-01-01
The purpose of this article is to investigate the completeness of the theoretical foundations of Enterprise Architecture (EA) by reviewing four selected disciplines from Management of Technology (MOT). Often theory on EA is based on prior EA contributions or more distant contributions such as ser......The purpose of this article is to investigate the completeness of the theoretical foundations of Enterprise Architecture (EA) by reviewing four selected disciplines from Management of Technology (MOT). Often theory on EA is based on prior EA contributions or more distant contributions...... such as service science, semiotics, psycho-social constructs, business process analytics, and systems science. It is here argued that other theories might be more supportive to EA. The current article is based on a review of the MOT literature and a subsequent literature review within each of the four specialized...
AFRREV IJAH, Vol.1 (4) November, 2012
African Journals Online (AJOL)
First Lady
de Pride and Prejudice de Jane Austen. On nřa trouvé aucun signe ni dans le dictionnaire bilingue ni sur lřinternet qui correspond au sens du mot. Nous avons décidé de faire une analyse exégétique de tous les mots de la langue dřarrivée qui nous surgissent à la mémoire, tels que: complicated, assimilated, inhibited ...
Directory of Open Access Journals (Sweden)
Lina Sonia Videla
2008-12-01
Full Text Available La materia orgánica particulada (MOP es un componente dinámico del suelo, que responde selectiva y rápidamente a los cambios de manejo y distintos tipos de disturbios. El objetivo de este estudio fue comparar dos técnicas de determinación de MOP en distintos suelos y evaluar el potencial de esta variable como indicadora de calidad de los mismos. Se estudiaron tres sitios ecológicos de la provincia del Chubut con distinto manejo o afectados por distintos disturbios: Media Luna Clausura (ML C, Media Luna Pastoreo (ML P, Puerto Madryn bioperturbado (PM B, Puerto Madryn no bioperturbado (PM NB, Punta Ninfas no erosionado (PN NE y Punta Ninfas erosionado (PN E. En muestras de suelos extraídas de 0 a 5 cm (PM y PN y de 0 a 10 cm (ML de profundidad se determinó la materia orgánica total (MOT y la MOP por vía húmeda (MOPh (Método Walkley y Black y por ignición en mufla (MOPi a 430 °C. En los Molisoles de ML y en los Aridisoles de PM la MOPi fue mayor que la MOPh, mientras que para los Aridisoles de PN no se registraron diferencias significativas entre los dos métodos. Para los suelos con carbonatos (PM o con alofanos (ML, el método por ignición sobreestimó los contenidos de MOP. La MOT presentó una alta correlación con la MOPh y con la MOPi para todos los suelos en conjunto (r² = 0,89 y r² = 0,73, respectivamente. El suelo que presentó una mayor relación MOP/MOT fue PN NE. En contraste, el suelo PN E, mostró los valores más bajos para esta relación, lo que indicaría, por un lado, que la poca MO que contienen estos suelos está predominantemente asociada a la fracciónParticulate organic-matter (MOP is a dynamic soil component that quickly and selectively responds to management changes and to different disturbance regimes. We compared two techniques to determine the MOP content in different soils and assessed the potential of this variable as an indicator of soil quality. We studied the soils of three ecological sites located
High data-rate atom interferometers through high recapture efficiency
Biedermann, Grant; Rakholia, Akash Vrijal; McGuinness, Hayden
2015-01-27
An inertial sensing system includes a magneto-optical trap (MOT) that traps atoms within a specified trapping region. The system also includes a cooling laser that cools the trapped atoms so that the atoms remain within the specified region for a specified amount of time. The system further includes a light-pulse atom interferometer (LPAI) that performs an interferometric interrogation of the atoms to determine phase changes in the atoms. The system includes a controller that controls the timing of MOT and cooling laser operations, and controls the timing of interferometric operations to substantially recapture the atoms in the specified trapping region. The system includes a processor that determines the amount inertial movement of the inertial sensing system based on the determined phase changes in the atoms. Also, a method of inertial sensing using this inertial sensing system includes recapture of atoms within the MOT following interferometric interrogation by the LPAI.
Public awareness of human papillomavirus as a causative factor for oropharyngeal cancer.
Williams, Michael U; Carr, Michele M; Goldenberg, David
2015-06-01
To assess the public's awareness of human papillomavirus (HPV) as a causative factor for oropharyngeal cancer. Twenty-three-item survey. Local shopping malls and Maxwell Air Force Base in 2012. Respondents were randomly chosen to participate in 23-item survey at various local shopping malls and at Maxwell Air Force Base in 2012. The χ(2) test was used in statistical analysis. The majority of respondents (n = 319) were civilians; 158 were military officer trainees (MOTs). All MOTs had a bachelor's degree or higher, while 37% of civilian respondents had a bachelor's degree or higher. Most MOTs (82%) were aware of oropharyngeal cancer, and 53% of civilians had not heard of oropharyngeal cancer (P aware of the association between HPV and cervical cancer. Conversely, 75% of civilian population and 49% of MOTs were not aware of the association between HPV and oropharyngeal cancer (P aware that HPV is a causative agent of cervical cancer. However, the majority were not aware of the association between oropharyngeal cancer and HPV. Furthermore, many respondents were not aware that HPV equally affects males and females and that the vaccine is available for both sexes. This underscores the need to educate the public on the availability of HPV vaccine and the association between HPV and oropharyngeal cancer. © American Academy of Otolaryngology—Head and Neck Surgery Foundation 2015.
Using complaints to enhance quality improvement: developing an analytical tool.
Hsieh, Sophie Yahui
2012-01-01
This study aims to construct an instrument for identifying certain attributes or capabilities that might enable healthcare staff to use complaints to improve service quality. PubMed and ProQuest were searched, which in turn expanded access to other literature. Three paramount dimensions emerged for healthcare quality management systems: managerial, operational, and technical (MOT). The paper reveals that the managerial dimension relates to quality improvement program infrastructure. It contains strategy, structure, leadership, people and culture. The operational dimension relates to implementation processes: organizational changes and barriers when using complaints to enhance quality. The technical dimension emphasizes the skills, techniques or information systems required to achieve successfully continuous quality improvement. The MOT model was developed by drawing from the relevant literature. However, individuals have different training, interests and experiences and, therefore, there will be variance between researchers when generating the MOT model. The MOT components can be the guidelines for examining whether patient complaints are used to improve service quality. However, the model needs testing and validating by conducting further research before becoming a theory. Empirical studies on patient complaints did not identify any analytical tool that could be used to explore how complaints can drive quality improvement. This study developed an instrument for identifying certain attributes or capabilities that might enable healthcare professionals to use complaints and improve service quality.
Lhakhang, Pempa; Lippke, Sonia; Knoll, Nina; Schwarzer, Ralf
2015-02-04
Frequent handwashing can prevent infections, but non-compliance to hand hygiene is pervasive. Few theory- and evidence-based interventions to improve regular handwashing are available. Therefore, two intervention modules, a motivational and a self-regulatory one, were designed and evaluated. In a longitudinal study, 205 young adults, aged 18 to 26 years, were randomized into two intervention groups. The Mot-SelfR group received first a motivational intervention (Mot; risk perception and outcome expectancies) followed by a self-regulatory intervention (SelfR; perceived self-efficacy and planning) 17 days later. The SelfR-Mot group received the same two intervention modules in the opposite order. Follow-up data were assessed 17 and 34 days after the baseline. Both intervention sequences led to an increase in handwashing frequency, intention, self-efficacy, and planning. Also, overall gains were found for the self-regulatory module (increased planning and self-efficacy levels) and the motivational module (intention). Within groups, the self-regulatory module appeared to be more effective than the motivational module, independent of sequence. Self-regulatory interventions can help individuals to exhibit more handwashing. Sequencing may be important as a motivation module (Mot) first helps to set the goal and a self-regulatory module (SelfR) then helps to translate this goal into actual behavior, but further research is needed to evaluate mechanisms.
Beskytter moderat alkoholforbruk mot hjerte-karsykdom?
Directory of Open Access Journals (Sweden)
Inger Stensvold
2009-10-01
Full Text Available SAMMENDRAGTre store utenlandske oppfølgingsstudier fra 1994-95 har funnet en U-formet sammenheng mellom selvrapportertalkoholinntak og dødelighet av hjerte-karsykdom. For menn er det vist at tre alkoholenheter(drinker pr. dag og for kvinner én til to, kan redusere risikoen med opptil 50%. Det synes videre som omeffekten er størst hos eldre personer (over 50 år, og de med minst én viktig koronar risikofaktor. En nyoversiktsartikkel konkluderer med at den gunstige effekten er knyttet til alkoholinnholdet og ikke til andrekomponenter for de ulike alkoholtypene. Det er presentert norske spørreskjema fra 1977 og fram til i dagvedrørende alkohol. Disse er av svært ujevn kvalitet, bl.a. uten spørsmål om mengde alkohol eller type, ogspørsmålene har variert over tid og fra fylke til fylke. Tverrsnittsdata fra Oppland (1986-88 for menn ogkvinner 40-54 år viser en positiv sammenheng mellom alkoholinntak og HDL-kolesterol for begge kjønn ogfor systolisk blodtrykk for menn, sterkest for drikkere av brennevin og øl. For kvinner er det en U-formetsammenheng mellom drikkere av vin og øl og systolisk blodtrykk. Resultater fra en dødelighetsoppfølging(hjerte-kardød viser en forhøyet risiko for menn som har drukket øl siste uke og en gunstigere risiko for desom har drukket vin/brennevin siste uke i forhold til de som ikke har svart på alkoholspørsmålene.Stensvold I. Does moderate alcohol consumption protect against cardiovascular disease?Nor J Epidemiol ENGLISH SUMMARYThree large prospective population studies from 1994-95 have shown a U-shaped relationship betweenalcohol intake and mortality from cardiovascular disease. For men it was shown that three units a day and forwomen one to two units can reduce mortality risk with 50%. The effect was stronger in older people (above50 years and those at greater risk for coronary heart disease. The conclusion, in a recent review, was that thebenefit is from alcohol rather than from other components of each type of drink. Norwegian questionnairesfrom 1977 to 1995 on alcohol are commented upon. The quality of these questions varies; many do notaccount for the amount of intake or the type of alcohol, and they have not been identical from screening toscreening and between counties. Cross-sectional results from Oppland (1986-88 for men and women aged40-54 years, indicated a positive relation between alcohol intake and HDL-cholesterol for both sexes, forsystolic blood pressure in men, strongest for consumers of spirits and beer. A U-shaped association betweenintake of wine and beer with systolic blood pressure was seen in women. A follow-up study with cardiovasculardeath as endpoint indicated a higher risk for men drinking beer during the last week, and a lower risk forthose drinking wine/spirits, compared with men not answering the questions about alcohol intake.1996; 6 (1: 69-71.
Mot et læringsorientert estetikkbegrep
DEFF Research Database (Denmark)
Austring, Bennyé D.; Sørensen, Merete
2010-01-01
Rundt omkring i den pædagogiske og didaktiske debat støder man i dag ofte på begrebet æstetik, formuleret som f.eks. den æstetiske dimension, æstetiske læreprocesser og æstetisk praksis. Når man ser nærmere på disse tekster og udsagn, kan man få det indtryk, at det æstetiske har udviklet sig til et...
An explicit marching on-in-time solver for the time domain volume magnetic field integral equation
Sayed, Sadeed Bin
2014-07-01
Transient scattering from inhomogeneous dielectric objects can be modeled using time domain volume integral equations (TDVIEs). TDVIEs are oftentimes solved using marching on-in-time (MOT) techniques. Classical MOT-TDVIE solvers expand the field induced on the scatterer using local spatio-temporal basis functions. Inserting this expansion into the TDVIE and testing the resulting equation in space and time yields a system of equations that is solved by time marching. Depending on the type of the basis and testing functions and the time step, the time marching scheme can be implicit (N. T. Gres, et al., Radio Sci., 36(3), 379-386, 2001) or explicit (A. Al-Jarro, et al., IEEE Trans. Antennas Propag., 60(11), 5203-5214, 2012). Implicit MOT schemes are known to be more stable and accurate. However, under low-frequency excitation, i.e., when the time step size is large, they call for inversion of a full matrix system at very time step.
Dictionnaire étymologique du français
Picoche, Jacqueline
1979-01-01
Cette nouvelle édition du Dictionnaire étymologique du français, largement enrichie, présente l'arbre généalogique de près de 35 000 mots. Savez-vous que concerto, décret et discernement ont la même racine que crible ?. Que chauvin, espiègle et rocambolesque viennent de noms de personnages de la littérature ?. Que le sens premier de amadouer est " frotter avec de l'amadou " pour se jaunir le teint ?. Pour chaque mot, retrouvez sa famille, son origine, son sens originel ou le sens de sa racine, les diverses formes qu'il a prises depuis sa première attestation et les règles phonétiques expliquant son évolution. Des annexes traitent plus particulièrement des mots à syllabes redoublées (coco, zigzag), de ceux formés sur des onomatopées (hennir, ouistiti) et de ceux venant de noms de personnes (dahlia, praline) ou de lieux (bougie, rugby).
An explicit marching on-in-time solver for the time domain volume magnetic field integral equation
Sayed, Sadeed Bin; Ulku, Huseyin Arda; Bagci, Hakan
2014-01-01
Transient scattering from inhomogeneous dielectric objects can be modeled using time domain volume integral equations (TDVIEs). TDVIEs are oftentimes solved using marching on-in-time (MOT) techniques. Classical MOT-TDVIE solvers expand the field induced on the scatterer using local spatio-temporal basis functions. Inserting this expansion into the TDVIE and testing the resulting equation in space and time yields a system of equations that is solved by time marching. Depending on the type of the basis and testing functions and the time step, the time marching scheme can be implicit (N. T. Gres, et al., Radio Sci., 36(3), 379-386, 2001) or explicit (A. Al-Jarro, et al., IEEE Trans. Antennas Propag., 60(11), 5203-5214, 2012). Implicit MOT schemes are known to be more stable and accurate. However, under low-frequency excitation, i.e., when the time step size is large, they call for inversion of a full matrix system at very time step.
Tapered optical fibers as tools for probing magneto-optical trap characteristics
International Nuclear Information System (INIS)
Morrissey, Michael J.; Deasy, Kieran; Wu Yuqiang; Nic Chormaic, Sile; Chakrabarti, Shrabana
2009-01-01
We present a novel technique for measuring the characteristics of a magneto-optical trap (MOT) for cold atoms by monitoring the spontaneous emission from trapped atoms coupled into the guided mode of a tapered optical nanofiber. We show that the nanofiber is highly sensitive to very small numbers of atoms close to its surface. The size and shape of the MOT, determined by translating the cold atom cloud across the tapered fiber, is in excellent agreement with measurements obtained using the conventional method of fluorescence imaging using a charge coupled device camera. The coupling of atomic fluorescence into the tapered fiber also allows us to monitor the loading and lifetime of the trap. The results are compared to those achieved by focusing the MOT fluorescence onto a photodiode and it was seen that the tapered fiber gives slightly longer loading and lifetime measurements due to the sensitivity of the fiber, even when very few atoms are present.
Directory of Open Access Journals (Sweden)
Antonio Sergio Varela Junior
2009-12-01
Full Text Available
Generation of a cold pulsed beam of Rb atoms by transfer from a 3D magneto-optic trap
Chanu, Sapam Ranjita; Rathod, Ketan D.; Natarajan, Vasant
2016-01-01
We demonstrate a technique for producing a cold pulsed beam of atoms by transferring a cloud of atoms trapped in a three dimensional magneto-optic trap (MOT). The MOT is loaded by heating a getter source of Rb atoms. We show that it is advantageous to transfer with two beams (with a small angle between them) compared to a single beam, because the atoms stop interacting with the beams in the two-beam technique, which results in a Gaussian velocity distribution. The atoms are further cooled in ...
Directory of Open Access Journals (Sweden)
Mostafeezur Rahman
2012-04-01
Full Text Available Abstract Background To determine the effects of inferior alveolar nerve transection (IAN-X on masticatory movements in freely moving rats and to test if microglial cells in the trigeminal principal sensory nucleus (prV or motor nucleus (motV may be involved in modulation of mastication, the effects of microglial cell inhibitor minocycline (MC on masticatory jaw movements, microglia (Iba1 immunohistochemistry and the masticatory jaw movements and related masticatory muscle EMG activities were studied in IAN-X rats. Results The number of Iba1-immunoreactive (IR cells both in prV and motV was significantly larger in IAN-X rats compared with sham rats on day 3 after IAN-X. The intraperitoneal (i.p. administration of MC caused a significant reduction of the number of Iba1-IR cells both in prV and motV that was evident on day 14 after IAN-X. Furthermore, a significant reduction of the number of Iba1-IR cells could be observed in motV but not in prV after microinjection (m.i. of MC into the motV of IAN-X rats. The rats also exhibited a significant decrease in the head-withdrawal threshold on the side ipsilateral to the IAN-X compared to the threshold before IAN-X and it lasted to day 14. In addition, IAN-X markedly affected the ability to rat to carry out mastication. The number of complete masticatory sequences was significantly decreased. Furthermore, the total masticatory sequence time and food preparatory (PP period duration was significantly elongated in compared to sham rats. Although IAN-X significantly affected the total number of chewing cycles within the RC period of a masticatory sequence, it had no effect on the duration of the chewing cycles. On the other hand, systemic administration of MC (both i.p. and m.i. in IAN-X rats significantly improved decreased head-withdrawal threshold and the impaired masticatory jaw movements. Conclusions The present findings reveal that the strong modulation of masticatory jaw movements occurs following
Additivity of Feature-based and Symmetry-based Grouping Effects in Multiple Object Tracking
Directory of Open Access Journals (Sweden)
Chundi eWang
2016-05-01
Full Text Available Multiple object tracking (MOT is an attentional process wherein people track several moving targets among several distractors. Symmetry, an important indicator of regularity, is a general spatial pattern observed in natural and artificial scenes. According to the laws of perceptual organization proposed by Gestalt psychologists, regularity is a principle of perceptual grouping, such as similarity and closure. A great deal of research reported that feature-based similarity grouping (e.g., grouping based on color, size, or shape among targets in MOT tasks can improve tracking performance. However, no additive feature-based grouping effects have been reported where the tracking objects had two or more features. Additive effect refers to a greater grouping effect produced by grouping based on multiple cues instead of one cue. Can spatial symmetry produce a similar grouping effect similar to that of feature similarity in MOT tasks? Are the grouping effects based on symmetry and feature similarity additive? This study includes four experiments to address these questions. The results of Experiments 1 and 2 demonstrated the automatic symmetry-based grouping effects. More importantly, an additive grouping effect of symmetry and feature similarity was observed in Experiments 3 and 4. Our findings indicate that symmetry can produce an enhanced grouping effect in MOT and facilitate the grouping effect based on color or shape similarity. The where and what pathways might have played an important role in the additive grouping effect.
Mixed Discretization of the Time Domain MFIE at Low Frequencies
Ulku, Huseyin Arda
2017-01-10
Solution of the magnetic field integral equation (MFIE), which is obtained by the classical marching on-in-time (MOT) scheme, becomes inaccurate when the time step is large, i.e., under low-frequency excitation. It is shown here that the inaccuracy stems from the classical MOT scheme’s failure to predict the correct scaling of the current’s Helmholtz components for large time steps. A recently proposed mixed discretization strategy is used to alleviate the inaccuracy problem by restoring the correct scaling of the current’s Helmholtz components under low-frequency excitation.
De Caniba ou Cannibale de Christophe Colomb à Caliban d’Aime Cesaire
Directory of Open Access Journals (Sweden)
Ece Yassıtepe Ayyıldız
2017-12-01
Full Text Available Le mot « caniba » apparaît dans la littérature dès le début de la colonisation du Nouveau Monde. Christophe Colomb, explorateur du nouveau continent, a appelé des Indiens comme « caniba » qui devient « cannibale » dans les « Essais » de Montaigne. Ce mot a un sens péjoratif qui signifie « mangeurs d’hommes » dans la langue des Indiens. William Shakespeare a écrit une pièce de théâtre intitulée « La Tempête » dans laquelle il a nommé l’un de ses caractères principaux comme Caliban qui est un substantif transformé du mot « Cannibale ». Caliban, le roi d’une île, a déjà perdu son règne et est devenu esclave après l’arrivée de Prospero, duc de Milan, sur l'île de Caliban. La pièce intitulée « La Tempête » écrite en 1611 est la dernière pièce de Shakespeare dont le sujet est la relation maître-esclave entre Caliban et Prospero. Aimé Césaire, aussi, dramaturge martiniquais, a écrit une pièce de théâtre intitulée « Une Tempête » qui est une adaptation pour un « théâtre nègre ». Aimé Césaire qui a écrit cette pièce dans la période postcoloniale et utilise Caliban comme le porte-parole des Noirs opprimés au cours de l’histoire. Dans cette étude, notre but est d'insister sur l’étymologie du mot « caniba » et ses apparitions dans le théâtre shakespearien et césairien et de montrer en analysant le changement du mot caniba, qui a un sens péjoratif dès le départ.
Visual attention measures predict pedestrian detection in central field loss: a pilot study.
Directory of Open Access Journals (Sweden)
Concetta F Alberti
Full Text Available The ability of visually impaired people to deploy attention effectively to maximize use of their residual vision in dynamic situations is fundamental to safe mobility. We conducted a pilot study to evaluate whether tests of dynamic attention (multiple object tracking; MOT and static attention (Useful Field of View; UFOV were predictive of the ability of people with central field loss (CFL to detect pedestrian hazards in simulated driving.11 people with bilateral CFL (visual acuity 20/30-20/200 and 11 age-similar normally-sighted drivers participated. Dynamic and static attention were evaluated with brief, computer-based MOT and UFOV tasks, respectively. Dependent variables were the log speed threshold for 60% correct identification of targets (MOT and the increase in the presentation duration for 75% correct identification of a central target when a concurrent peripheral task was added (UFOV divided and selective attention subtests. Participants drove in a simulator and pressed the horn whenever they detected pedestrians that walked or ran toward the road. The dependent variable was the proportion of timely reactions (could have stopped in time to avoid a collision.UFOV and MOT performance of CFL participants was poorer than that of controls, and the proportion of timely reactions was also lower (worse (84% and 97%, respectively; p = 0.001. For CFL participants, higher proportions of timely reactions correlated significantly with higher (better MOT speed thresholds (r = 0.73, p = 0.01, with better performance on the UFOV divided and selective attention subtests (r = -0.66 and -0.62, respectively, p<0.04, with better contrast sensitivity scores (r = 0.54, p = 0.08 and smaller scotomas (r = -0.60, p = 0.05.Our results suggest that brief laboratory-based tests of visual attention may provide useful measures of functional visual ability of individuals with CFL relevant to more complex mobility tasks.
Uysal, Ismail Enes
2016-08-09
Transient electromagnetic interactions on plasmonic nanostructures are analyzed by solving the Poggio-Miller-Chan-Harrington-Wu-Tsai (PMCHWT) surface integral equation (SIE). Equivalent (unknown) electric and magnetic current densities, which are introduced on the surfaces of the nanostructures, are expanded using Rao-Wilton-Glisson and polynomial basis functions in space and time, respectively. Inserting this expansion into the PMCHWT-SIE and Galerkin testing the resulting equation at discrete times yield a system of equations that is solved for the current expansion coefficients by a marching on-in-time (MOT) scheme. The resulting MOT-PMCHWT-SIE solver calls for computation of additional convolutions between the temporal basis function and the plasmonic medium\\'s permittivity and Green function. This computation is carried out with almost no additional cost and without changing the computational complexity of the solver. Time-domain samples of the permittivity and the Green function required by these convolutions are obtained from their frequency-domain samples using a fast relaxed vector fitting algorithm. Numerical results demonstrate the accuracy and applicability of the proposed MOT-PMCHWT solver. © 2016 Optical Society of America.
OS MOTÉIS EM CAMPO MOURÃO-PR COMO OPÇÃO PARA HOSPEDAGEM E EVENTOS
Directory of Open Access Journals (Sweden)
Aline Angeli
2016-09-01
Full Text Available Esta pesquisa buscou analisar nos sete motéis da cidade de Campo Mourão-PR, as condições para hospedagem de turistas e os espaços para a realização de eventos. Para isso foram avaliados os serviços ofertados, a infraestrutura disponível, o interesse do cliente e a viabilidade do uso dos motéis para a realização de eventos e hospedagem. Como metodologia de pesquisa, foram utilizados: o levantamento histórico e legal dos motéis; a observação como cliente oculto; pesquisa através de rede social e e-mail; e, por m, a entrevista e observação orientada. Veri cou-se que, de forma geral, os serviços prestados estão dentro de um padrão aceitável pelos clientes, porém há falta de espaço apropriado para a realização de um evento nesse ambiente. Palavras-chave: Motel. Eventos em Motel. Hospedagem alternativa.
Dual-channel amplification in a single-mode diode laser for multi-isotope laser cooling
International Nuclear Information System (INIS)
Booth, James L.; Van Dongen, Janelle; Lebel, Paul; Klappauf, Bruce G.; Madison, Kirk W.
2007-01-01
The output from two grating-stabilized external-cavity diode lasers were injected into a single-mode diode laser. Operating at a wavelength of 780 nm, this laser produced ∼50 mW of power with two main frequency components of the same spectral characteristics of the seed lasers. The power ratio of the amplified components was freely adjustable due to gain saturation, and amplification was observed for frequency differences of the two seed lasers in the range from 73 MHz to 6.6 GHz. This system was used to realize a dual isotope magneto-optic trap (MOT) for rubidium ( 85 Rb and 87 Rb). The resulting position and cloud size of the dual isotope MOT was the same as that of the single species MOTs to within ±10 and ±20 μm, respectively. We also characterized the additional spectral components produced by four wave mixing (FWM) in the diode laser amplifier and utilized a particular FWM sideband to realize hyperfine pumping and subsequent laser trapping of 85 Rb in the absence of a 'repump' laser dedicated to hyperfine pumping
Energy Technology Data Exchange (ETDEWEB)
Tanner, R.
2005-12-15
This annual report for the Swiss Federal Office of Energy (SFOE) takes a look at the development of the software basis for a tool for making decisions when selecting electrical drives. Work in a three-phase project is described. The phases involve the integration of existing components in a software-system, the Europe-wide distribution of the tool and, finally, various marketing activities. The concept behind an Internet-based system is described and its Content Management System is discussed. Examples of web-pages are presented.
Directory of Open Access Journals (Sweden)
Sonia GUTIÉRREZ GÓMEZ-CALCERRADA
2015-12-01
Full Text Available El punto de partida para ofrecer una educación universitaria personalizada basada en entornos de educación online a personas con diversidad funcional debe centrarse en garantizar la óptima accesibilidad a su contenido web y a los recursos de aprendizaje. En la actualidad, la mayoría de las universidades disponen de plataformas virtuales de educación, con un importante peso para el correcto desarrollo de sus estudios y para la optimización del aprendizaje de su alumnado. Por otro lado, los entornos virtuales suponen un importante punto de acceso a la posible matriculación en dichas universidades del alumnado con discapacidad. Este trabajo tiene dos objetivos. El primero de ellos consiste en definir cuáles son las condiciones óptimas de accesibilidad web de las plataformas virtuales de educación y de los sitios web de las universidades para personas que presentan discapacidad visual o discapacidad motórica, de acuerdo a los estándares internacionales. El segundo objetivo del trabajo persigue ofrecer una breve aproximación al grado de accesibilidad de los sitios web de las universidades españolas para el alumnado con esas dos discapacidades. El trabajo sigue un diseño descriptivo basado en dos elementos de análisis. Por un lado, la revisión de estudios de accesibilidad y diversidad funcional y, por otro, el análisis de la accesibilidad web de los sitios web de las 78 universidades españolas. Se concluye que existen dificultades de accesibilidad web y navegación en los entornos virtuales de las universidades españolas, situación que, por lo tanto, redunda en limitaciones en el aprendizaje de los colectivos de estudiantes con limitaciones.
Coherence effects in three- and four-level laser-cooled rubidium systems
International Nuclear Information System (INIS)
De Echaniz, Sebastian R.
2002-01-01
This thesis presents developmental work on the existing magneto-optical trap (MOT) system and novel studies of coherence effects. The developmental work was carried out on the experimental apparatus used previously in this laboratory in order to perform experiments to study coherence effects in three- and four-level rubidium systems in the MOT. This developmental work includes the upgrading and installation of new laser systems, the improvement of the MOT, the installation of data acquisition hardware and software, and the commissioning of a new 'second generation' MOT. As part of our studies of coherence effects, we present a wide-ranging theoretical and experimental study of non-adiabatic transient phenomena in a Λ system which exhibits electromagnetically induced transparency when a strong coupling field is rapidly switched on or off using a Pockels cell. The theoretical treatment uses a Laplace transform approach as well as standard numerical methods to solve the time-dependent density matrix equation. The results show clear Rabi oscillations and transient gain without population inversion of a weak probe in parameter regions not previously studied, and provide insight into the transition dynamics between bare a dressed states. Experimental studies of a doubly driven V system are also reported, together with a theoretical dressed-state analysis of such systems. The expected three-peak spectrum is explored for various coupling field strengths and detunings. In all this work we have found good agreement between the theory and the experimental spectra once light shifts and uncoupled absorption in the rubidium system are taken into account. (author)
Al Jarro, Ahmed
2012-11-01
An explicit marching-on-in-time (MOT) scheme for solving the time domain volume integral equation is presented. The proposed method achieves its stability by employing, at each time step, a corrector scheme, which updates/corrects fields computed by the explicit predictor scheme. The proposedmethod is computationally more efficient when compared to the existing filtering techniques used for the stabilization of explicit MOT schemes. Numerical results presented in this paper demonstrate that the proposed method maintains its stability even when applied to the analysis of electromagnetic wave interactions with electrically large structures meshed using approximately half a million discretization elements.
Towards the mass production of slow, trappable molecules
McCarron, Daniel J.
2018-05-01
The Fast Track Communication by Petzold et al (2018 New J. Phys. 20 042001) demonstrates the first Zeeman slowing scheme for species with type-II optical cycling transitions. This new approach is directly applicable to those 2Σ molecules that have recently been captured and cooled in molecular magneto-optical traps (MOTs) and has the potential to efficiently and continuously load these traps for the first time. This advance could produce molecular MOTs with populations comparable to their atomic counterparts and realize an ideal platform for a wide range of studies using large, dense samples of ultracold molecules.
Al Jarro, Ahmed; Salem, Mohamed; Bagci, Hakan; Benson, Trevor; Sewell, Phillip D.; Vuković, Ana
2012-01-01
An explicit marching-on-in-time (MOT) scheme for solving the time domain volume integral equation is presented. The proposed method achieves its stability by employing, at each time step, a corrector scheme, which updates/corrects fields computed by the explicit predictor scheme. The proposedmethod is computationally more efficient when compared to the existing filtering techniques used for the stabilization of explicit MOT schemes. Numerical results presented in this paper demonstrate that the proposed method maintains its stability even when applied to the analysis of electromagnetic wave interactions with electrically large structures meshed using approximately half a million discretization elements.
Rechercher avec Google : quelques conseils
Ginouvès, Véronique
2004-01-01
Quoi de neuf ? (août 2006) : Toute la recherche Google sur une seule page : Le Googdesk : http://googdesk.com/ Google Trends Google Trends est un outil d'analyse de mots ou expressions clés, censé vous permettre de voir ce que le monde cherche ("See what the world is searching for''). Il compare et analyse dans un graphique l’usage et le comportement des mots clés dans le moteur sur deux années en arrière, et il spécifie cette utilisation par ville, pays et langue. http://www.google.com/tr...
Generation of 99-mW continuous-wave 285-nm radiation for magneto-optical trapping of Mg atoms
DEFF Research Database (Denmark)
Madsen, Dorte Nørgaard; Yu, Ping; Balslev, Søren
2002-01-01
We have developed a tunable intense narrow-band 285 nm light source based on frequency doubling of 570 nm light in BBO. At input powers of 840 mW (including 130 mW used for locking purposes) we generate 99 mW UV radiation with an intensity profile suitable for laser-cooling experiments. The light...... is used for laser cooling of neutral magnesium atoms in a magneto-optical trap (MOT). We capture about 5 x 10(6) atoms directly from a thermal beam and find that the major loss mechanism of the magnesium MOT is a near-resonant two-photon ionization process....
Directory of Open Access Journals (Sweden)
Nathalie Cochoy
2010-10-01
Full Text Available Seule une écriture infiniment attentive aux ombres des mots saurait en éclairer les blessures sans toutefois en exposer et en expliquer les intimes secrets. C’est ainsi avec une admirable alliance de sensibilité et de respect que Marc Amfreville aborde les « écrits en souffrance » de la littérature américaine — la manière dont les mots disent et taisent la douleur, en diffèrent la manifestation, mais aussi en dessinent les contours, comme dans un « champ » de recherche commun. Dans sa structu...
Kirchner, G L; Stone, R G; Holm, M B
2001-01-01
The relationships among clinical outcomes, academic success, and predictors used to screen applicants for entrance into a Master in Occupational Therapy Program (MOT) were examined. The dependent variables were grade point average in occupational therapy courses (OT-GPA), client therapy outcomes at the clinic, and ratings of MOT students by Level II Fieldwork supervisors. Predictor variables included undergraduate GPA, scores on the Graduate Record Examination (GRE), and an essay. Both undergraduate GPA and scores on the GRE were found to predict OT-GPA. The analytical section of the GRE was also positively correlated with fieldwork supervisors' ratings of students.
Directory of Open Access Journals (Sweden)
Martha Lopes Schuch de Castro
1996-12-01
Full Text Available O presente trabalho teve como objetivo determinar ainfluência do ano e mês de coleta sobre o volume (VOL, motilidade (MOT e doses de sêmen produzidas (DO, as correlações existentes entre as variáveis e as suas repetibilidades. Foram analisadas amostras de sêmen de 96 machos pertencentes as raças Landrace (41, Large White (31 e Duroc (24, durante o período (1981 a 1987 de permanência dos mesmos na Central de Inseminação Artificial de Suínos de Estrela - RS. O número de amostras dês sêmen coletadas foi de 7.264 da raça Landrace, 3.589 da raça Large White e 3.051 da raça Duroc. Os resultados mostraram haver influência (PThe aim of this experiment was to determine the influence of the collection period on volume (VOL, motility (MOT and semen doses (DO, and the correlation among the six variables and their repeatibilities. Semen samples from ninety (96 boars belonging to Landrace (41, Large White (31 and Duroc (24 breeds were analyzed, taken into account the permanence period (1981 to 1987 of the boars at the Artificial Insemination Center -Estrela - RS. The number of semen samples collected were: Landrace 7,264, Large White 3,589 and Duroc, 3,051. Year and month of collection had influence (P<0.01 on the variables analyzed. Minimum and maximum average values, within each breed, were VOL 236.9 and 300.4ml (Landrace, 238.1 and 284.1ml (Large White and 150.0 and 201.1ml (Duroc: MOT 79.2 and 80.3% (Landrace, 76.7 and 78.0% (Large White and 77.8 and 79.1% (Duroc; DO 12.0 and 14.7 (Landrace, 10.1 and 13.0 (Large White and 9.1 and 11.9 (Duroc, respectively. Correlations between VOL and DO were 0.30 (Landrace, 0.36 (Large White and 0.36 (Duroc. Correlations between VOL and MOT were close to zero (Landrace -0.05, Large White 0.03 and Duroc 0.01, and between MOT and DO were 0.08 (Landrace, 0.15 (Large White and 0.13 (Duroc. Repeatibilities were VOL 0.49 (Landrace, 0.59 (Large White and 0.54 (Duroc; MOT 0.18 (Landrace, 0.27 (Large White and
Directory of Open Access Journals (Sweden)
Isabelle Gérardin
2011-04-01
Full Text Available Cet article se propose d’étudier une œuvre publiée en 1991 par la romancière anglaise Pat Barker : Regeneration. Ce roman, qui a pour toile de fond la Grande Guerre, ne dépeint ni combats ni scènes de la vie des tranchées. Barker préfère représenter toute la dimension agonistique de ce conflit mondial à travers la question de la prise en charge des traumatismes de guerre des soldats par l’institution psychiatrique. Ces traumatismes, ayant diverses manifestations psychosomatiques, témoignent d’une forte tension entre une profonde aversion de l’individu pour l’extrême violence des affrontements et un appel à se conformer à une certaine culture de guerre collective fondée sur un idéal fort de virilité martiale et patriotique. Face à ces traumatismes, ainsi que Pat Barker le met en lumière, la psychiatrie de guerre se révèle souvent fort ambiguë. En effet, l’institution psychiatrique œuvre en continuité avec l’institution militaire, désirant imposer un contrôle sur les âmes autant que sur les corps. Regeneration nous invite donc à lire combien les maux/mots de la Grande Guerre ont eu grand peine à se faire entendre.This article deals with a novel, entitled Regeneration, published in 1991 by the English female author Pat Barker. This novel, although set against the backdrop of World War One, depicts neither battles nor scenes of everyday life in the trenches. Instead, the agonistic dimension of this world conflict is tackled by Pat Barker through the prism of the way the psychiatric institution dealt with war traumas endured by soldiers, traumas of the body and of the mind. These traumas, causing a variety of psychosomatic symptoms, reveal a powerful tension between a deep individual aversion to the extreme violence of combat and an appeal to conform to some collective culture of war rooted in a strong ideal of soldierly and patriotic manliness. Wartime psychiatry, as Barker highlights, often turns out to
Effekt av ulike desinfeksjonsstrategier mot Listeria monocytogenes
Fossmo, Sabine
2013-01-01
Kontroll med bakterier som Listeria utgjør en stor utfordring for mange matprodusenter. Listeria monocytogenes er hovedsakelig et produksjonshygienisk problem, forbedret hygiene kan derfor være tiltak for å redusere overlevelse og smitteoverføring av bakterien i produksjonsmiljø. Hensikten med forsøkene i oppgaven var å undersøke effekten av ulike desinfeksjonsstrategier på drap av L. monocytogenes, både når bakteriene var i biofilm og i suspensjon. Dette inkluderte bruk av tradisjonelle desi...
Jouer face à Deleuze, mot à mot…
Directory of Open Access Journals (Sweden)
Hervé Regnauld
2009-11-01
Full Text Available La pensée de Gilles Deleuze n’a pas la réputation d’être simple ni facile à comprendre. Cela n’empêche aucunement que certains de ses concepts soient largement tombés dans l’usage commun et que de très nombreuses publications scientifiques les utilisent. Certains artistes les mobilisent dans la conception de leurs œuvres. Ainsi le duo « territorialisation »-« déterritorialisation » est-il souvent employé par des géographes pour étudier des formes d’inscription ...
An atomic beam source for fast loading of a magneto-optical trap under high vacuum
DEFF Research Database (Denmark)
McDowall, P.D.; Hilliard, Andrew; Grünzweig, T.
2012-01-01
We report on a directional atomic beam created using an alkali metal dispenser and a nozzle. By applying a high current (15 A) pulse to the dispenser at room temperature we can rapidly heat it to a temperature at which it starts dispensing, avoiding the need for preheating. The atomic beam produced...... is capable of loading 90 of a magneto-optical trap (MOT) in less than 7 s while maintaining a low vacuum pressure of 10 -11 Torr. The transverse velocity components of the atomic beam are measured to be within typical capture velocities of a rubidium MOT. Finally, we show that the atomic beam can be turned...
Protein (Cyanobacteria): 652997457 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_027249923.1 ... 1117:7063 ... 1150:51701 1301283:72835 ... 54304:160 1160:1002 ... chem...otaxis protein MotB Planktothrix agardhii MSDLSELELETELQEEQDSGVYLSIGDLMSGLLMFFALLFITVMVQLNKTQDIIKRIPDEMFTTMQ
A circularly polarized optical dipole trap and other developments in laser trapping of atoms
Corwin, Kristan Lee
Several innovations in laser trapping and cooling of alkali atoms are described. These topics share a common motivation to develop techniques for efficiently manipulating cold atoms. Such advances facilitate sensitive precision measurements such as parity non- conservation and 8-decay asymmetry in large trapped samples, even when only small quantities of the desired species are available. First, a cold, bright beam of Rb atoms is extracted from a magneto-optical trap (MOT) using a very simple technique. This beam has a flux of 5 × 109 atoms/s and a velocity of 14 m/s, and up to 70% of the atoms in the MOT were transferred to the atomic beam. Next, a highly efficient MOT for radioactive atoms is described, in which more than 50% of 221Fr atoms contained in a vapor cell are loaded into a MOT. Measurements were also made of the 221Fr 7 2P1/2 and 7 2P3/2 energies and hyperfine constants. To perform these experiments, two schemes for stabilizing the frequency of the light from a diode laser were developed and are described in detail. Finally, a new type of trap is described and a powerful cooling technique is demonstrated. The circularly polarized optical dipole trap provides large samples of highly spin-polarized atoms, suitable for many applications. Physical processes that govern the transfer of large numbers of atoms into the trap are described, and spin-polarization is measured to be 98(1)%. In addition, the trap breaks the degeneracy of the atomic spin states much like a magnetic trap does. This allows for RF and microwave cooling via both forced evaporation and a Sisyphus mechanism. Preliminary application of these techniques to the atoms in the circularly polarized dipole trap has successfully decreased the temperature by a factor of 4 while simultaneously increasing phase space density.
Leatham-Jensen, Mary P; Frimodt-Møller, Jakob; Adediran, Jimmy; Mokszycki, Matthew E; Banner, Megan E; Caughron, Joyce E; Krogfelt, Karen A; Conway, Tyrrell; Cohen, Paul S
2012-05-01
Previously, we reported that the streptomycin-treated mouse intestine selected nonmotile Escherichia coli MG1655 flhDC deletion mutants of E. coli MG1655 with improved colonizing ability that grow 15% faster in vitro in mouse cecal mucus and 15 to 30% faster on sugars present in mucus (M. P. Leatham et al., Infect. Immun. 73:8039-8049, 2005). Here, we report that the 10 to 20% remaining motile E. coli MG1655 are envZ missense mutants that are also better colonizers of the mouse intestine than E. coli MG1655. One of the flhDC mutants, E. coli MG1655 ΔflhD, and one of the envZ missense mutants, E. coli MG1655 mot-1, were studied further. E. coli MG1655 mot-1 is more resistant to bile salts and colicin V than E. coli MG1655 ΔflhD and grows ca. 15% slower in vitro in mouse cecal mucus and on several sugars present in mucus compared to E. coli MG1655 ΔflhD but grows 30% faster on galactose. Moreover, E. coli MG1655 mot-1 and E. coli MG1655 ΔflhD appear to colonize equally well in one intestinal niche, but E. coli MG1655 mot-1 appears to use galactose to colonize a second, smaller intestinal niche either not colonized or colonized poorly by E. coli MG1655 ΔflhD. Evidence is also presented that E. coli MG1655 is a minority member of mixed bacterial biofilms in the mucus layer of the streptomycin-treated mouse intestine. We offer a hypothesis, which we call the "Restaurant" hypothesis, that explains how nutrient acquisition in different biofilms comprised of different anaerobes can account for our results.
Alnæs, Dag; Sneve, Markus Handal; Espeseth, Thomas; Endestad, Tor; van de Pavert, Steven Harry Pieter; Laeng, Bruno
2014-04-01
Attentional effort relates to the allocation of limited-capacity attentional resources to meet current task demands and involves the activation of top-down attentional systems in the brain. Pupillometry is a sensitive measure of this intensity aspect of top-down attentional control. Studies relate pupillary changes in response to cognitive processing to activity in the locus coeruleus (LC), which is the main hub of the brain's noradrenergic system and it is thought to modulate the operations of the brain's attentional systems. In the present study, participants performed a visual divided attention task known as multiple object tracking (MOT) while their pupil sizes were recorded by use of an infrared eye tracker and then were tested again with the same paradigm while brain activity was recorded using fMRI. We hypothesized that the individual pupil dilations, as an index of individual differences in mental effort, as originally proposed by Kahneman (1973), would be a better predictor of LC activity than the number of tracked objects during MOT. The current results support our hypothesis, since we observed pupil-related activity in the LC. Moreover, the changes in the pupil correlated with activity in the superior colliculus and the right thalamus, as well as cortical activity in the dorsal attention network, which previous studies have shown to be strongly activated during visual tracking of multiple targets. Follow-up pupillometric analyses of the MOT task in the same individuals also revealed that individual differences to cognitive load can be remarkably stable over a lag of several years. To our knowledge this is the first study using pupil dilations as an index of attentional effort in the MOT task and also relating these to functional changes in the brain that directly implicate the LC-NE system in the allocation of processing resources.
The hidden face of academic researches on classified highly pathogenic microorganisms.
Devaux, Christian A
2015-01-01
microorganisms and toxins experimentation in France; these regulations apply for any operation of production, manufacturing, transportation, import, export, possession, supply, transfer, acquisition and use of highly pathogenic microorganisms and toxins, referred to as "MOT" (for "MicroOrganismes et Toxines hautement pathogènes") by the French law. Finally, laboratories conducting researches on such infectious pathogens are henceforth classified restricted area or ZRR (for "Zone à Régime Restrictif"), according an order of July 2012. In terms of economic protection, biosafety and biosecurity, these regulations represent an undeniable progress as compared to the previous condition. However, the competitiveness of research laboratories handling MOTs is likely to suffer the side effects of these severe constraints. For example research teams working on MOTs can be drastically affected both by (i) the indirect costs generated by the security measure to be applied; (ii) the working time devoted to samples recording; (iii) the establishment of traceability and reporting to national security agency ANSM, (iv) the latency period required for staff members being officially authorized to conduct experiments on MOTs; (v) the consequent reduced attractiveness for recruiting new trainees whose work would be significantly hampered by theses administrative constraints; and (vi) the limitations in the exchange of material with external laboratories and collaborators. Importantly, there is a risk that French academic researchers gradually abandon research on MOTs in favor of other projects that are less subject to legal restrictions. This would reduce the acquisition of knowledge in the field of MOTs which, in the long term, could be highly detrimental to the country by increasing its vulnerability to natural epidemics due to pathogenic microorganisms that are classified as MOTs and, by reducing its preparedness against possible bioterrorist attacks that would use such microorganisms
A comparative study on the efficacy of four anthelmintics on some important reindeer parasites
Directory of Open Access Journals (Sweden)
Magnus Nordkvist
1983-05-01
Full Text Available Four anthelmintic preparations were tested against some of the most important parasites of reindeer, i.e. warble fly (Oedemagena tarandi, nostril fly (Cephenemyia trompe, brainworm (Elaphostrongylus rangiferi, and lungworm (Dictyocaulus viviparus. Their efficacy against intestinal nematodes was also registered. Test drugs were Fenthion (Bayer, Fenbendazole (Hoechst, Mebendazole (Janssen, and Ivermectin (Merk Sharp & Dohme. Against O. tarandi and C. trompe Ivermectin was 100% effective and Fenthion 86 and 100% respectively. The efficacy of Fen- and Mebendazole against these parasites was not significant. Against E. rangiferi the benzimidazole compounds were highly effective, with Mebendazole a bit ahead. Ivermectin had a moderate effect and Fenthion had no effect on this parasite. Against D. viviparus Fenbendazole, Mebendazole and Ivermectin were of equal, moderate-high effectiveness. No drug had a complete effect on the «arrested» larvae of D. viviparus. Fenthion had no effect at all. Fenbendazole and Ivermectin were both 100% effective against intestinal nematodes. Mebendazole was less effective and Fenthion had no effects. Ivermectin is considered to be the overall most effective anthelmintic in this test.En jamforande studie av effekten av fyra anthelmintika mot några betydelsesfulla parasiter hos ren.Abstract in Swedish / Sammandrag: Fyra antiparasitmedel har prôvats mot några av renens viktigaste parasiter, nàmligen hudkorm (Oedemagena tarandi, svalgkorm (Cephenemyia trompe, hjårnmask (Elaphostrongylus rangiferi och lungmask (Dictyocaulus viviparus. Vidare har medlens effekt på mag- tarmnematoder (Trichostongylider också noterats. De prôvade medicinerna var Fenthion (Bayer, Mebendazole (Leo/Janssen, Fenbendazole (Hoechst och Ivermectin (Merck Sharp & Dohme. Mot hud- och svalgkorm var Ivermectin 100% effektivt medan for Fenthion effekten var 86 resp 100%. Effekten av Fen- och Mebendazole mot de båda parasiterna var inte
Sayed, Sadeed Bin
2014-07-01
A marching on-in-time (MOT)-based time domain volume electric field integral equation (TD-VEFIE) solver is proposed for accurate and stable analysis of electromagnetic wave interactions on high-contrast scatterers. The stability is achieved using band-limited but two-sided (non-causal) temporal interpolation functions and an extrapolation scheme to cast the time marching into a causal form. The extrapolation scheme is designed to be highly accurate for oscillating and exponentially decaying fields, hence it accurately captures the physical behavior of the resonant modes that are excited inside the dielectric scatterer. Numerical results demonstrate that the resulting MOT scheme maintains its stability as the number of resonant modes increases with the contrast of the scatterer.
Systembolagets monopol kontra EU:s fria rörlighet för varor
Edqvist, Daniel; Gisslén, Kristofer
2006-01-01
Denna uppsats strävar efter att besvara frågorna: Har systembolaget rätt att som ensam aktör bedriva detaljhandel av alkohol i Sverige? Strider nuvarande reglering av svensk import och export av vin och sprit mot EG-rätten? EG-domstolen har i flera fall rörande offentliga monopol fastslagit att dessa i sig inte utgör något brott mot EG-rätten, under förutsättning att de anpassas till övrig EG-rätt på konkurrensrättens område. Det är därför med anledning av detta fullt möjligt för Systembolage...
Explicit solution of Calderon preconditioned time domain integral equations
Ulku, Huseyin Arda
2013-07-01
An explicit marching on-in-time (MOT) scheme for solving Calderon-preconditioned time domain integral equations is proposed. The scheme uses Rao-Wilton-Glisson and Buffa-Christiansen functions to discretize the domain and range of the integral operators and a PE(CE)m type linear multistep to march on in time. Unlike its implicit counterpart, the proposed explicit solver requires the solution of an MOT system with a Gram matrix that is sparse and well-conditioned independent of the time step size. Numerical results demonstrate that the explicit solver maintains its accuracy and stability even when the time step size is chosen as large as that typically used by an implicit solver. © 2013 IEEE.
Passing the NBCOT Examination: Preadmission, Academic, and Fieldwork Factors
Directory of Open Access Journals (Sweden)
Sharon D. Novalis
2017-10-01
Full Text Available All occupational therapy students are required to successfully complete the certification examination administered by the National Board for Certification in Occupational Therapy (NBCOT before they can practice independently. The need to repeat the examination can result in stress, anxiety, and financial hardship. This paper explores the relationship of preadmission factors, academic and fieldwork performance, and demographic variables to successful first-time attempts on the certification examination for occupational therapists. Data were gathered from 144 student files in a Master of Occupational Therapy (MOT Program at a single university. Of the sample, 82% passed and 18% failed their first NBCOT test trial. Considered independently, preadmission recommendation letters and writing sample scores, graduate MOT program GPA, lack of MOT program difficulty, fieldwork self-reports, and gender predicted NBCOT certification examination outcomes. When considered together in logistic regression models predicting outcome, this combination of factors correctly predicted 86.2% of student outcomes (or 20% to 32% of the variance in certification examination success, with OT program GPA and preadmission recommendation scores predicting unique outcome variance. This information may be helpful to admissions committees as well as to occupational therapy faculty as they identify strategies and practices to facilitate first-time test taking success on the NBCOT certification examination
Tomlinson, Mathew J; Naeem, Asad
2018-03-21
CASA has been used in reproductive medicine and pathology laboratories for over 25 years, yet the 'fertility industry' generally remains sceptical and has avoided automation, despite clear weaknesses in manual semen analysis. Early implementers had difficulty in validating CASA-Mot instruments against recommended manual methods (haemocytometer) due to the interference of seminal debris and non-sperm cells, which also affects the accuracy of grading motility. Both the inability to provide accurate sperm counts and a lack of consensus as to the value of sperm kinematic parameters appear to have continued to have a negative effect on CASA-Mot's reputation. One positive interpretation from earlier work is that at least one or more measures of sperm velocity adds clinical value to the semen analysis, and these are clearly more objective than any manual motility analysis. Moreover, recent CASA-Mot systems offer simple solutions to earlier problems in eliminating artefacts and have been successfully validated for sperm concentration; as a result, they should be viewed with more confidence in relation to motility grading. Sperm morphology and DNA testing both require an evidence-based consensus and a well-validated (reliable, reproducible) assay to be developed before automation of either can be of real clinical benefit.
In vivo and in vitro hyperthermia in a murine ovarian tumor model
International Nuclear Information System (INIS)
Hacker, N.F.; Ghozland, S.A.; Berek, J.S.; Resnick, B.; Lagasse, L.D.
1984-01-01
Preliminary studies using a noninvasive circumferential electrode to deliver low-frequency radiowave heat to a murine ovarian tumor (MOT) model demonstrated that noncancer-bearing anesthetised female C3FeJ/HeB mice could tolerate temperatures to the pelvis and abdomen of up to 43 0 C for 1 hour and that uniform heating of abdominal organs could be obtained. Following in vitro heating of 5 x 10/sup 6/ MOT cells and subsequent transfer of these cells into the naive mouse, a dose-response effect was noted, all animals inoculated with cells heated to 41 0 C for 1 hour dying of disease, compared to 50% of animals innoculated with cells heated to 42 0 C for 1 hour, and 25% of animals innoculated with cells heated to 43 0 C for 1 hour. Following intraperitoneal transfer of 10/sup 5/ MOT cells, in vivo heating to 42 0 C for 30 minutes on 2 occasions 72 hours apart increased median survival from 24 days to 33 days (P 0 C for 30 minutes daily for 5 days, and suggests the development of thermal tolerance with daily heating. The authors are presently investigating the value of indomethacin in preventing thermal tolerance
Täidan, täidan laeva / Andres Maimik
Maimik, Andres, 1970-
2001-01-01
Eesti-saksa ühine teatriprojekt "Piraadid" : Von Krahli Teater & Showcase Beat Le Mot. Lavastajad Dariusz Kostyra, Florian Feigl, Nikolai Duric, Veit Sprenger ja Thorsten Eibeler. Etendused 22.-27. maini
Reflections on the fight agnaist the image of shamanism / Art Leete
Leete, Art, 1969
2013-01-01
Arvustus: Sundström, Olle. Kampen mot "schamanismen" : Sovjetisk religionspolitik gentemot inhemska religioner i Sibirien och norra Ryssland. Studier av inter-religiösa relationer 40. Uppsala: Universitetstryckeriet 2007
2006-01-01
Heliplaadid kauplustest Lasering: Beck "The Information", Enigma "A Posteriori", Kosmikud "Pulmad ja matused", And One "Bodypop", Uno Loop "Viimane suudlus - duetid aastatest 1964-1979", Motörhead "Kiss Of Death"
Brève histoire d’une erreur lexicale. Polysémie et liens lexicaux dans l’enseignement du vocabulaire
Directory of Open Access Journals (Sweden)
Sikora Dorota
2014-07-01
Au-delà d’un diagnostic portant sur un ensemble d’erreurs, cette réflexion mène vers la question plus générale de l’objet de l’enseignement et de l’apprentissage du vocabulaire. Faut-il apprendre des mots, des familles des mots, des lexies ou des réseaux lexicaux ? Une fois de plus, nous chercherons des réponses du côté de lexique, en admettant que la démarche pédagogique et le processus d’apprentissage doivent porter sur ce dont le lexique d’une langue est fait : les lexies (ou unités lexicales et les relations qui les connectent dans le système lexical.
Isoz, Annick; Gremaud, Coralie; Deschoux, Carole-Anne
2016-01-01
Les albums en langues étrangères peuvent-ils être une entrée pour développer les compétences inférentielles et interprétatives? De nombreux élèves présentent des difficultés en compréhension écrite. Or lorsqu’on se penche sur la question, nous constatons que cette dernière est très peu enseignée et que les élèves ont souvent une représentation erronée de ce qu’est l’acte de lire. Ils la réduisent à une compréhension mot à mot et ne prennent pas en compte les dimensions inférentielles et inter...
African Journals Online (AJOL)
Keytvords: Nosocomial infections, epidemiology, multi-drug resistance, medicinal plant preparations. ... Mots clés : Infections nosocomiales, épidémiologie, Résistance aux antibiotiques, plantes médicinales. ..... (1987)- Statistique non.
Eesti-Läti orienteerumisliiga kaardistajate seminar Kanepis / koostanud Markus Puusepp
2010-01-01
Projekti teisest kaardistajate seminarist, mis toimus 30.-31. oktoobril Põlvamaal Kanepis. Vaata ka http://spordilinn.blogspot.com/2010/11/eesti-vs-lati-moned-motted.html ja http://orienteerumine.ee/estlat/seminarid/
DEFF Research Database (Denmark)
Hahonou, Eric Komlavi
2016-01-01
and the classic scientific text. The reflection is structured around four components: the benefits of the audiovisual media as a complementary classical scientific text serving the dissemination of knowledge; the emotional dimension of social life and the use of empathy in the production of knowledge ; using...
Caracterisation de la qualite des eaux de I' oued Kebir Quest (Nord ...
African Journals Online (AJOL)
Mots cles : Kebir Ouest - Skikda - Bassin versant - Qualite - Pollution - Metaux lourds. Abstract .... approche servira au suivi de l 'evolution annuelle des concentrations des ..... Watershed Management: principles and practice. New York, Wiley ...
A wavelet-based PWTD algorithm-accelerated time domain surface integral equation solver
Liu, Yang
2015-10-26
© 2015 IEEE. The multilevel plane-wave time-domain (PWTD) algorithm allows for fast and accurate analysis of transient scattering from, and radiation by, electrically large and complex structures. When used in tandem with marching-on-in-time (MOT)-based surface integral equation (SIE) solvers, it reduces the computational and memory costs of transient analysis from equation and equation to equation and equation, respectively, where Nt and Ns denote the number of temporal and spatial unknowns (Ergin et al., IEEE Trans. Antennas Mag., 41, 39-52, 1999). In the past, PWTD-accelerated MOT-SIE solvers have been applied to transient problems involving half million spatial unknowns (Shanker et al., IEEE Trans. Antennas Propag., 51, 628-641, 2003). Recently, a scalable parallel PWTD-accelerated MOT-SIE solver that leverages a hiearchical parallelization strategy has been developed and successfully applied to the transient problems involving ten million spatial unknowns (Liu et. al., in URSI Digest, 2013). We further enhanced the capabilities of this solver by implementing a compression scheme based on local cosine wavelet bases (LCBs) that exploits the sparsity in the temporal dimension (Liu et. al., in URSI Digest, 2014). Specifically, the LCB compression scheme was used to reduce the memory requirement of the PWTD ray data and computational cost of operations in the PWTD translation stage.
Zuhd and Pleasure : A Comparative Account between Imam Ali’s Nahj Al-Balāgha and Moore’s Ethics
Directory of Open Access Journals (Sweden)
Qusthan Firdaus
2014-06-01
Full Text Available Abstrak : Artikel ini mendiskusikan zuhd sebagai sebuah penanda etis (an ethical bon mot sekaligus membandingkannya dengan argumen Moore mengenai kesenangan. Memaksimalkan output dan meminimalkan input merupakan dua premis dasar yang menyusun zuhd. Keduanya membawa kepada kewajiban positif dan negatif. Kewajiban positif berakar pada hak untuk berekspresi secara bebas sementara kewajiban negatif berakar pada hak untuk bekerja pada lingkungan yang adil dan disukai. Di samping itu, argumen Moore mengenai kesenangan tidak memadai untuk menjadi sebuah penanda etis karena bersifat subjektif. Dengan demikian, zuhd memiliki kualitas yang lebih baik daripada kesenangan untuk menjadi sebuah penanda etis.Kata Kunci : Zuhud, pleasure (Kesenangan, Penanda etis, Kewajiban posistif, Kewajiban negatifAbstract : This article discusses about Zuhd as an ethical sign (an ethical bon mot, all at once to compare it with Moor’s argument on pleasure. Maximizing output and minimizing input constitute two basic premises which composed zuhd. Both of them lead to positive and negative duties. Positive duty is rooted on right to express freely, while negative duty is rooted on right to work in just and prefer domain. Moreover, Moor’s argument of pleasure is unsufficient to be an ethical sigh, for it is very subjective argument. By this, Zuhd has a better quality than pleasure to be an ethical sign or marker.Keywords : Zuhud, Pleasure, Ethical bon mot, Positive duties, Negative duties
2001-01-01
Showcase Beat Le Mot, viiest mehest koosnev füüsilise teatri vallas tegutsev sõltumatu teatritrupp Saksamaalt Hamburgist mängib 6. mail Tallinnas Kanuti Gildi hoones oma tipplavastust "Burn Cities Burn"
Etude de la faisabilite d'un composite a matrice cimentaire renforce ...
African Journals Online (AJOL)
Mots cles: Composite cimentaire - Mortier de fibres - Fibres de jute - Compatibilite chimique. Abstract ... potential use of jute fibers as reinforcing elements for mortars. The jute fiber ...... kenaf fiber reinforced concrete, Construction and Building.
Cost of increasing access to artemisinin combination therapy: the Cambodian experience
Directory of Open Access Journals (Sweden)
Socheat Duong
2008-05-01
Full Text Available Abstract Background Malaria-endemic countries are switching antimalarial drug policy from cheap ineffective monotherapies to artemisinin combination therapies (ACTs for the treatment of Plasmodium falciparum malaria and the global community are considering setting up a global subsidy to fund their purchase. However, in order to ensure that ACTs are correctly used and are accessible to the poor and remote communities who need them, specific interventions will be necessary and the additional costs need to be considered. Methods This paper presents an incremental cost analysis of some of these interventions in Cambodia, the first country to change national antimalarial drug policy to an ACT of artesunate and mefloquine. These costs include the cost of rapid diagnostic tests (RDTs, the cost of blister-packaging the drugs locally and the costs of increasing access to diagnosis and treatment to remote communities through malaria outreach teams (MOTs and Village Malaria Workers (VMW. Results At optimum productive capacity, the cost of blister-packaging cost under $0.20 per package but in reality was significantly more than this because of the low rate of production. The annual fixed cost (exclusive of RDTs and drugs per capita of the MOT and VMW schemes was $0.44 and $0.69 respectively. However because the VMW scheme achieved a higher rate of coverage than the MOT scheme, the cost per patient treated was substantially lower at $5.14 compared to $12.74 per falciparum malaria patient treated. The annual cost inclusive of the RDTs and drugs was $19.31 for the MOT scheme and $11.28 for the VMW scheme given similar RDT positivity rates of around 22% and good provider compliance to test results. Conclusion In addition to the cost of ACTs themselves, substantial additional investments are required in order to ensure that they reach the targeted population via appropriate delivery systems and to ensure that they are used appropriately. In addition, differences
Maintenance of Traffic for Innovative Geometric Design Work Zones
2015-12-01
Currently there are no guidelines within the Manual on Uniform Traffic Control Devices (MUTCD) on construction phasing and maintenance of traffic (MOT) for retrofit construction and maintenance projects involving innovative geometric designs. The res...
Directory of Open Access Journals (Sweden)
Antonio Emidio Dias Feliciano Silva
2002-06-01
Full Text Available Em 960 touros da raça Nelore, PO, de 11,4 a 135 meses de idade, pertencentes a fazendas localizadas nos Estados de São Paulo, Goiás e Pará, estudou-se a possível associação entre o tamanho da circunferência escrotal (CE e os parâmetros da qualidade do sêmen, motilidade progressiva (MOT e patologias espermáticas: defeitos maiores (DEFMAI, menores (DEFMEN e totais (DEFTOT. Os touros foram divididos por faixas etárias em: menores que 18, de 18 a 24, de 24 a 30, de 30 a 36 e maiores que 36 meses de idade. Este estudo foi realizado com a finalidade de obter tamanhos de CE que possam indicar o estatus funcional dos testículos, ou seja, a qualidade do sêmen, a serem utilizados para predizer o potencial reprodutivo dos animais destinados à seleção de reprodutores. Da correlação da CE com a MOT, por faixa etária, resultou uma associação (R=0,60; PIn 960 Nellore purebred bulls, of 11.4 to 135 months of age, belonging to farms located in the São Paulo, Goiás and Para states, was studied the possible association among the size of the scrotal circumference (CE and sperm quality parameters, progressive motility (MOT and sperm pathologies: the major (DEFMAI, minor (DEFMIN and total (DEFTOT defects. The bulls were divided by age in groups: minor than 18, from 18 to 24, from 24 to 30, from 30 to 36 and major than 36 months of age. This study was accomplished with the purpose of obtaining sizes of CE that may indicate the functional status of the testicles through the quality of the semen that can be used to predict the reproductive potential of the animals destined to the selection of bulls. Of the correlation of CE with MOT, by age group, resulted an association (R = 0,60; P<0.0001 of these parameters in the bulls up to 18 months of age, which CE above 26 cm indicated semen of high MOT (60 to 80%. The correlation between CE and sperm pathologies was very low and negatives. It was concluded that in the young bulls the size of CE indicates
Quand la maison devient papier, et le papier refuge
Directory of Open Access Journals (Sweden)
Clara Domingues
2010-05-01
Full Text Available Le voyageur de nulle part, un exilé dénommé Alfred, élit domicile au dernier sous-sol de l’aéroport Charles de Gaulle où il entasse des valises pleines de liasses de papiers et de journaux. Car Alfred écrit tout autant qu’il fait écrire les journalistes intrigués par son personnage, et l’intrication de son écriture et de celle des journalistes lui bâtit progressivement un refuge : refuge mental de mots et refuge physique de papiers entassés, comme autant de protections face à une société qui disloque la vie des humains au point que leur unique refuge ne soit plus que de papier, et leurs livres des mots sur des feuillets volatiles.
Tracing Impact in a Usability Improvement Process
DEFF Research Database (Denmark)
Uldall-Espersen, Tobias; Frøkjær, Erik; Hornbæk, Kasper Anders Søren
2008-01-01
Analyzing usability improvement processes as they take place in real-life organizations is necessary to understand the practice of usability work. This paper describes a case study where the usability of an information system is improved and a relationship between the improvements...... and the evaluation efforts is established. Results show that evaluation techniques complemented each other by suggesting different kinds of usability improvement. Among the techniques applied, a combination of questionnaires and Metaphors of Human Thinking (MOT) showed the largest mean impact and MOT produced...... the largest number of impacts. Logging of real-life use of the system over 6 months indicated six aspects of improved usability, where significant differences among evaluation techniques were found. Concerning five of the six aspects Think Aloud evaluations and the above-mentioned combination of questionnaire...
Activité antibactérienne des flavonoides d'une plante médicinale ...
African Journals Online (AJOL)
Mots clés : Activité antibactérienne - Flavonoïdes - Marrubium vulgare L. - Souches multirésistantes. ... Keywords: Antibacterial Activity - Flavonoids - Marrubium vulgare L. - Multiresistant strains. ..... antimicrobial activities of the essential oil of.
Integrering av flyktninger. De frivillige organisasjoners rolle
Hussein, Ali
2017-01-01
Denne oppgaven tar for seg de frivillige organisasjonene i Tromsø og integrasjon. Oppgaven retter søkelyset mot de frivillige organisasjoners integreringstiltak og hvorvidt dette kan være et supplement til det offentlige tilbudet.
Ergü l, Ö zgü r; Feki, Saber; Al-Jarro, Ahmed; Clo, Alain M.; Bagci, Hakan
2014-01-01
-level approach, utilizing the OpenACC directive-based parallel programming model, is used to minimize two often-faced challenges in GPU programming: developer productivity and code portability. The MOT-TDVIE solver code, originally developed for CPUs
Indian Academy of Sciences (India)
The second important development was the serendipitous discovery that, under the right conditions, laser cooling works much better than what is ... For example, our Rb MOT uses commercial diode lasers that are commonly used in CD.
African Journals Online (AJOL)
MTRAOREABOU
21 déc. 2008 ... Mots-clés : lagune Aghien, métaux lourds, sources anthropiques, ... Keywords : Aghien lagoon, heavy metals, anthropic origin, factors of enrichment. 1. ...... elements in Kosovo: a source identification and apportionment study.
Sayed, Sadeed Bin; Ulku, Huseyin Arda; Bagci, Hakan
2014-01-01
A marching on-in-time (MOT)-based time domain volume electric field integral equation (TD-VEFIE) solver is proposed for accurate and stable analysis of electromagnetic wave interactions on high-contrast scatterers. The stability is achieved using
changement climatique, mécanisme actuel de prévention
African Journals Online (AJOL)
ACSS
19 févr. 2015 ... Ainsi, dans un contexte des changements climatiques, cette étude vise ... Mots Clés: Adaptations, Banikoara, Bénin, changement climatique, ...... pastorale sahélienne: cas de l'arrondissement ... Global Environmental Politics.
Sakslased tulevad! Ärevad ajad Tallinnas Von Krahli Teatris
2001-01-01
Von Krahli Teater ja Showcase Beat Le Mot valmistuvad oma esimeseks koostööprojektiks - lavastuseks "Pirates", kus osalevad mõlema teatri näitlejad ja tehnikud. Ühisprojekti toetavad Goethe Instituut, Hamburgi Linnavalitsus ja Eesti Kultuurkapital
The Ebola Virus and Human Rights Concerns in Africa
African Journals Online (AJOL)
AJRH Managing Editor
2015-09-03
Sep 3, 2015 ... Keywords: Ebola, Public Health, human right. Résumé ... Mots clé : Ebola, de santé publique, droit humain. Introduction ... public health and human rights. This article .... Political Rights (ICCPR)21 and the International.
2010-09-08
.... (``MOT''), Newmont Mining Corporation (``NEM''), NetFlix Inc. (``NFLX''), NVIDIA Corporation (``NVDA... (``QQQQ''), Bank of America Corporation (``BAC''), Citigroup, Inc. (``C''), Standard and Poor's Depositary..., Inc. (``AAPL''), General Electric Company (``GE''), JPMorgan Chase & Co. (``JPM''), Intel Corporation...
Directory of Open Access Journals (Sweden)
Ina MARCHITAN
2016-12-01
Full Text Available La compréhension de la terminologie du droit reste toujours une terra incognito pour les profanes, mais il y a quand même des outils qui la font plus accessible: plus claire et plus concise. Les communiqués et les travaux des organisations non-gouvernementales et les articles de presse représentent un tel instrument. Notamment là-bas on peut identifier de différents degrés de spécialisation, fait qui peut générer les changements sémantiques des termes. Les termes pouvant se transformer dans des mots communs, notre but étant d’identifier le rapport terme/mot, observer le niveau de spécialisation des textes et la polysémie des mots, s’il sera le cas.THE LEGAL TERMINOLOGY FOR THE UNINITIATED (The case of domestic violence and discrimination reflected in the mediaThe comprehension of the legal terminology has always been a terra incognita for the laymen though, there are still tools that make it more accessible i.e., clearer and more concise. Press releases of non-governmental organisations and newspaper articles serve as such tools. Here we can identify various degrees of specialisation which may generate the semantic change of terms. Given that terms may be transformed into common words, we aim at determining the relationship term/word and analysing the level of specialisation of the texts and the phenomenon of polysemy, if need be.
The E. coli Global Regulator DksA Reduces Transcription during T4 Infection
Directory of Open Access Journals (Sweden)
Jennifer Patterson-West
2018-06-01
Full Text Available Bacteriophage T4 relies on host RNA polymerase to transcribe three promoter classes: early (Pe, requires no viral factors, middle (Pm, requires early proteins MotA and AsiA, and late (Pl, requires middle proteins gp55, gp33, and gp45. Using primer extension, RNA-seq, RT-qPCR, single bursts, and a semi-automated method to document plaque size, we investigated how deletion of DksA or ppGpp, two E. coli global transcription regulators, affects T4 infection. Both ppGpp0 and ΔdksA increase T4 wild type (wt plaque size. However, ppGpp0 does not significantly alter burst size or latent period, and only modestly affects T4 transcript abundance, while ΔdksA increases burst size (2-fold without affecting latent period and increases the levels of several Pe transcripts at 5 min post-infection. In a T4motAam infection, ΔdksA increases plaque size and shortens latent period, and the levels of specific middle RNAs increase due to more transcription from Pe’s that extend into these middle genes. We conclude that DksA lowers T4 early gene expression. Consequently, ΔdksA results in a more productive wt infection and ameliorates the poor expression of middle genes in a T4motAam infection. As DksA does not inhibit Pe transcription in vitro, regulation may be indirect or perhaps requires additional factors.
Assessing reflective thinking and approaches to learning.
Dunn, Louise; Musolino, Gina M
2011-01-01
Facilitation of reflective practice is critical for the ongoing demands of health care practitioners. Reflective thinking concepts, grounded in the work of Dewey and Schön, emphasize critical reflection to promote transformation in beliefs and learning necessary for reflective practice. The Reflective Thinking Questionnaire (QRT) and Revised Study Process Questionnaire (RSPQ-2F) assess skill aspects of professional reasoning, with promise for measuring changes over time. The purpose of this study was to examine the reliability and responsiveness and the model validity of reflective thinking and approaches to learning measures for U.S. health professions students enrolled in entry-level occupational (MOT) and physical therapy (DPT) programs. This measurement study addressed reliability and responsiveness of two measures, the QRT and RSPQ-2F, for graduate health professionals. A convenience sample of 125 MOT and DPT students participated in the two-measure, test-retest investigation, with electronic data collection. Outcomes support the stability of the four-scale QRT (ICC 0.63 to 0.82) and the two-scale RSPQ-2F (ICC 0.91 and 0.87). Descriptive data supporting responsiveness are presented. With noted limitations, the results support the use of the QRT and RSPQ-2F measures to assess changes in reflective thinking and approaches to learning. Measurement of these learning outcomes furthers our understanding and knowledge about instructional strategies, development of professional reasoning, and fostering of self-directed learning within MOT and DPT programs.
An Integrated Model of Work Motivation Applied in a Multicultural Sample
Directory of Open Access Journals (Sweden)
José Navarro
2011-01-01
Full Text Available Un modelo integrado de motivación en el trabajo (ASH-Mot se puso a prueba en una muestra multicultural mediante el análisis de la validez de constructo y convergente. Este modelo integra, dentro de una red de relaciones, varios constructos motivacionales que operan a distintos niveles: necesidades, instrumentalidad, creencias de auto-eficacia, equidad y estados psicológicos críticos (conocimiento de los resultados, responsabilidad y significado. Dos estudios transversales se llevaron a cabo. En el primero participaron cuatro muestras diferentes de Chile, España, Inglaterra y Portugal. La validez de constructo de los instrumentos de medición se estudió por medio del AFC. En el segundo estudio, participó una muestra de México; se analizó la convergencia entre la medida de motivación propuesto por el ASH-Mot y otras medidas de motivación. Los resultados fueron positivos; reveló altos índices de ajuste entre los datos y el modelo teórico (valores superiores a 0,90 y residuos inferiores a 0,08, así como una alta convergencia entre las diferentes medidas de motivación (correlaciones superiores a 0,6. El modelo de ASH-Mot muestra unos valores adecuados de validez de sus herramientas y, más importante, proporciona información clave para la adaptación de las intervenciones una vez que los bajos niveles de motivación han sido detectados.
Gołaś, H.; Mazur, A.; Gruszka, J.; Szafer, P.
2016-08-01
The elaboration is a case study and the research was carried out in the company Alco-Mot Ltd., which employs 120 people. The company specializes in the production of lead poles for industrial and traction batteries using gravity casting. The elements embedded in the cast are manufactured on a machining centre, which provides the stability of the process and of the dimensions of the product as well as a very short production time. As a result of observation and analysis the authors have developed a concept for the implementation of a dynamic suggestion system in ALCO-MOT, including, among others, a standard for actions in the implementation of the suggestion system, as well as clear guidelines for the processing and presentation of the activities undertaken in the time between the establishment of the concept (suggestions) and the benefits analysis after the proposed solutions have been implemented. The authors also present how suggestions proposed by ALCO-MOT staff contributed to the improvement of the processes of production and quality control. Employees offered more than 30 suggestions, of which more than a half are being implemented now and further actions are being prepared for implementation. The authors will present the results of improvements in, for example, tool replacement time, scrap reduction. The authors will present how kaizen can improve the production and quality control processes. They will present how the production and quality control processes looked before and after the implementation of employee suggestions.
Al Jarro, Ahmed; Bagci, Hakan
2011-01-01
A hybrid MPI/OpenMP scheme for efficiently parallelizing the explicit marching-on-in-time (MOT)-based solution of the time-domain volume (Volterra) integral equation (TD-VIE) is presented. The proposed scheme equally distributes tested field values
Mixed Discretization of the Time Domain MFIE at Low Frequencies
Ulku, Huseyin Arda; Bogaert, Ignace; Cools, Kristof; Andriulli, Francesco Paolo; Bagci, Hakan
2017-01-01
stems from the classical MOT scheme’s failure to predict the correct scaling of the current’s Helmholtz components for large time steps. A recently proposed mixed discretization strategy is used to alleviate the inaccuracy problem by restoring
African Journals Online (AJOL)
abp
un cas. Rev Chir Orthop Reparatrice. Appar Mot. 2000;86(1):98-103. PubMed | Google Scholar. 7. Nagamine N, Nohara Y, Ito E. Elastofibroma in Okinawa. A clinicopathologic study of 170 cases. Cancer. 1982;50(9):1794-.
etude physico-chimique et parasitologique des eaux usees
African Journals Online (AJOL)
AISA
pollution ont été relativement faibles, comparativement à la moyenne des concentrations habituellement rencontrées pour les ... Mots clés : Pollution, eaux usées, physico-chimie, Helminthes, lac Fouarat, Maroc. ...... Paris, 1383 p. SDNAL.
IT4IT™ as a Management of Technology framework: Perspectives, implications and contributions
DEFF Research Database (Denmark)
Tambo, Torben; Filtenborg, Jacob
2017-01-01
Information technology (IT) is at the core of digitisation of existing business models and dominates in the innovation efforts of many industries. IT has until now in many ways been regarded as exempted from the structuration and automation represented by IT. The IT4IT framework released...... as a practical implementation of a Management of Technology framework and to review its perspectives and implications to the MoT society as well as the contributions it has to IT professionals, innovators and MoT practitioners. Methodologically this paper is based on an extensive case study of a large IT service...... from relative mature innovations to operational environments and life-cycle management. (2) IT4IT is driving IT further in the direction of commoditization and consumerization reducing uncertainty in IT implementation and operations and giving business stakeholders better opportunities for innovation...
Laser Cooling without Repumping: A Magneto-Optical Trap for Erbium Atoms
International Nuclear Information System (INIS)
McClelland, J.J.; Hanssen, J.L.
2006-01-01
We report on a novel mechanism that allows for strong laser cooling of atoms that do not have a closed cycling transition. This mechanism is observed in a magneto-optical trap (MOT) for erbium, an atom with a very complex energy level structure with multiple pathways for optical-pumping losses. We observe surprisingly high trap populations of over 10 6 atoms and densities of over 10 11 atoms cm -3 , despite the many potential loss channels. A model based on recycling of metastable and ground state atoms held in the quadrupole magnetic field of the trap explains the high trap population, and agrees well with time-dependent measurements of MOT fluorescence. The demonstration of trapping of a rare-earth atom such as erbium opens a wide range of new possibilities for practical applications and fundamental studies with cold atoms
African Journals Online (AJOL)
ebutamanya
11 mai 2016 ... Mots clés: Cancer, new therapies, cost, public health ... targeted therapies in oncology made it possible to modify the natural history of some ... management as well as a broader poor patient's access to innovative medicines.
Effets des extraits ou de la poudre de Spirulina platensis et Jatropha ...
African Journals Online (AJOL)
SARAH
30 juin 2015 ... générale, les extraits ou la poudre de Spirulina platensis ont eu des ... Mots clés: Biostimulant, croissance, Spirulina platensis, Jatropha curcas, Solanum lycopersicum .... Le test de ..... in antioxidant metabolites, enzymes, and.
Reference: 689 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available the high affinity of MOT1 allows plants to obtain scarce Mo from soil. An Arabidopsis thaliana high-affinity... molybdate transporter required for efficient uptake of molybdate from soil. 47 18807-12 18003916 2007 Nov P
A wavelet-based PWTD algorithm-accelerated time domain surface integral equation solver
Liu, Yang; Yucel, Abdulkadir C.; Gilbert, Anna C.; Bagci, Hakan; Michielssen, Eric
2015-01-01
© 2015 IEEE. The multilevel plane-wave time-domain (PWTD) algorithm allows for fast and accurate analysis of transient scattering from, and radiation by, electrically large and complex structures. When used in tandem with marching-on-in-time (MOT
Étude ethnobotanique et phytochimique de Momordica charantia ...
African Journals Online (AJOL)
Mots clés: Momordica charantia ; Ethnobotanique ; Ecotoxicologique ; Cotonou Benin. English Title: Ethnobotanical and phytochemical study of Momordica charantia Linn (Cucurbitaceae) in Cotonou Benin. English Abstract. Objective: This study, on Momordica charantia Linn (Cucurbitaceae), commonly known as margose ...
optimisation of a somatic embryogenesis and transformation ...
African Journals Online (AJOL)
ACSS
3Department of Agricultural Science and Technology, Kenyatta University, P. O. Box 43844-00100,. Nairobi, Kenya ... Mots Clés: Cytokinine, Manihot esculenta, protocole de génération ..... Z., Xiang, C., Fonger, T.M., Pegg, S.E.K, Li,.
Mesure de la vitesse d'infiltration des eaux dans le sol : Cas des sols ...
African Journals Online (AJOL)
SARAH
30 avr. 2016 ... Pour ceux, il est nécessaire d'opter pour une agriculture moderne ... à une telle agriculture. Mots clés : mesure, vitesse, infiltration, sols, pollutions, eau, Niari, Congo .... une porosité tubulaire d'origine biologique. Toutes ces.
Eesti europiraadid Saksamaal / Juhan Ulfsak ; interv. Esme Kassak
Ulfsak, Juhan, 1973-
2006-01-01
Von Krahli Teatri ja Saksa teatri Showcase Beat Le Mot koostöös esietendus 17. mail Düsseldorfis "Europiraadid". Eesti poolel kaasategev Juhan Ulfsak räägib koostööst Saksa trupiga ja sellest, mis teemasid lavastus puudutab
et du neem (Azadirachta indica A. Juss.)
African Journals Online (AJOL)
SARAH
30 nov. 2015 ... Mots clés : tomate ; ravageurs, extraits végétaux, activité insecticide. ABSTRACT. Objective: ... obtained with the decis unlike Lippia that has been mitigated. Indeed, neem extract can be recommended as an alternative against ...
2010-06-09
...''), American Express Company (``AXP''), Ciena Corp. (``CIEN''), Star Scientific, Inc. (``CIGX''), Dendreon Corp. (``DNDN''), eBay Inc. (``EBAY''), Corning Inc. (``GLW''), Halliburton Company (``HAL''), iShares Dow Jones US Real Estate (``IYR''), Motorola, Inc., (``MOT''), NVIDIA Corporation (``NVDA''), ON Semiconductor...
2010-06-02
...''), American Express Company (``AXP''), Ciena Corp. (``CIEN''), Star Scientific, Inc. (``CIGX''), Dendreon Corp. (``DNDN''), eBay Inc. (``EBAY''), Corning Inc. (``GLW''), Halliburton Company (``HAL''), iShares Dow Jones US Real Estate (``IYR''), Motorola, Inc., (``MOT''), NVIDIA Corporation (``NVDA''), ON Semiconductor...
Laser frequency stabilization and large detuning by Doppler-free ...
Indian Academy of Sciences (India)
c Indian Academy of Sciences. Vol. 65, No. 3. — journal of. September 2005 physics .... magneto-optical trap; BS: beam splitter plate; S: stopper; PBS: polarizing .... The MOT is of standard design and basically consists of a glass cell with eight.
African Journals Online (AJOL)
Physical fitness of some Cameroon division one soccer players: ... conditions, the known poor nutritional status fréquent in developing countries and to an insufficient level and intensity of ... championnat d'élite camerounais. Mots clés ...
Evaluating Multiple Object Tracking Performance: The CLEAR MOT Metrics
Directory of Open Access Journals (Sweden)
Bernardin Keni
2008-01-01
Full Text Available Abstract Simultaneous tracking of multiple persons in real-world environments is an active research field and several approaches have been proposed, based on a variety of features and algorithms. Recently, there has been a growing interest in organizing systematic evaluations to compare the various techniques. Unfortunately, the lack of common metrics for measuring the performance of multiple object trackers still makes it hard to compare their results. In this work, we introduce two intuitive and general metrics to allow for objective comparison of tracker characteristics, focusing on their precision in estimating object locations, their accuracy in recognizing object configurations and their ability to consistently label objects over time. These metrics have been extensively used in two large-scale international evaluations, the 2006 and 2007 CLEAR evaluations, to measure and compare the performance of multiple object trackers for a wide variety of tracking tasks. Selected performance results are presented and the advantages and drawbacks of the presented metrics are discussed based on the experience gained during the evaluations.
225-IJBCS-Article-Dr A Toguyeni
African Journals Online (AJOL)
RHUMSIKI
Mots clés: Diversité ichtyologique, dynamique des populations, bassin de la Comoé, Burkina Faso. INTRODUCTION ... projet Gestion de la Pêche dans le Sud-Ouest. (GPSO) a .... contrôle des ressources piscicoles au regard de la législation ...
2530-IJBCS-Article-Alain S A Ambe
African Journals Online (AJOL)
hp
2015 International Formulae Group. All rights ... Mots clés: Mode de préparation, Candida albicans, cytotoxicité, Cellules HFF ; Enantia polycarpa. ... marché et utilisées en thérapeutique ont perdu ...... Manque d'Accès aux Médicaments.
Managing technological and environmental dynamics
DEFF Research Database (Denmark)
Madsen, Henning; Ulhøi, John Parm
2001-01-01
The field of MoT cannot continue indefinitely to ignore the importance of the natural environment as a fundamental basis for technological development. This paper will therefore focus on the various linkages between management of technology and sustainable development, discussing both the current...
Word Frequencies in Written and Spoken English
African Journals Online (AJOL)
R.B. Ruthven
data of the corpus and includes more formal audio material (lectures, TV and ... meticulous word-class tagging of nouns, adjectives, verbs etc., this book is not limited to word ... Fréquences d'utilisation des mots en français écrit contemporain.
199 Étude de la qualité des eaux d'une retenue située sous climat ...
African Journals Online (AJOL)
Afrique Sciences
Mots-clés : barrage Hassan II, Maroc, climat, eau, qualité, eutrophisation. Abstract ... However, the feasibility and management of these structures are ..... Figure 5 : Evolution spatio-temporelle de la température au barrage Hassan II. De S à P6 ...
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
2016-01-27
Jan 27, 2016 ... Keywords. Telescopes; method: observational; stars: oscillation. Abstract. The Maidanak One-meter Telescope (MOT) is a Ritchey-Chretien telescope by Carl Zeiss, located atop Maidanak in Uzbekistan, where site parameters indicate excellent atmospheric seeing conditions. An effort to computerize the ...
Mihkelson, Immo, 1959-
2002-01-01
Uutest plaatidest Vanessa Carlton "Be Not Nobody", Nine Inch Nails "And All That Could have...", peeter Selis Thomson "Vaba kui tuul", Killer "Sickeningly Pretty", mylene Farmer "Les Mots", Marianne Faithfull "A Stranger On Earth", faultline "Your Love Means Everything" "Mozart in Egyt"
Evaluation of TOGAF as a Management of Technology Framework
DEFF Research Database (Denmark)
Tambo, Torben; Bargholz, Jonas Magleby; Yde, Lars
2016-01-01
of several companies. Architectural views of studied companies do provide interesting observations on employee and corporate self-perception and potential and relevance for new technologies and change. The studied case provides such a platform for experiments in MOT practice and tentative introduction...
1090-IJBCS-Article-Fatiha Zidane
African Journals Online (AJOL)
DR GATSING
1Laboratoire Science de l'Eau et d'Environnement, Département de Chimie, Faculté des Sciences Ain Chock,. Université ... élevée en divers types de polluants. ... Mots clés: traitement, hydroxyde, coagulation, demande chimique en oxygène.
Energy Technology Data Exchange (ETDEWEB)
Hafner, M.; Isermann, R. [Technische Univ. Darmstadt (Germany). Inst. fuer Automatisierungstechnik
2002-07-01
The OptiMot toolbox is a simple interface to the complex optimization algorithms of the model-based engine optimization process developed under MATLAB. Defaults enable also inexpert users to achieve good results. The optimization algorithms are based on static and dynamic neuronal emission models. The training data required for the neuronal nets were recorded on an engine test stand with in a very short time (about 1 h) using new dynamic measuring strategies. [German] Zusammenfassend konnte in diesem Beitrag die OptiMot-Toolbox als einfache Schnittstelle zu den komplexen Optimierungsalgorithmen der unter MATLAB entwickelten modellbasierten Motoroptimierung vorgestellt werden. Default-Einstellungen ermoeglichen hierbei auch ungeuebten Benutzern, schnell Ergebnisse zu erarbeiten. Die verwendeten Optimierungsalgorithmen selbst basieren auf statischen und dynamischen neuronalen Emissionsmodellen. Die benoetigten Trainingsdaten fuer die neuronalen Netze wurden mit Hilfe von neuen dynamischen Messstrategien in kurzer Zeit (ca. 1 h) am Motorenpruefstand erfasst. (orig.)
Shi, Yifei; Bagci, Hakan; Lu, Mingyu
2013-01-01
Internal resonant modes are always observed in the marching-on-in-time (MOT) solution of the time domain electric field integral equation (EFIE), although 'relaxed initial conditions,' which are enforced at the beginning of time marching, should in theory prevent these spurious modes from appearing. It has been conjectured that, numerical errors built up during time marching establish the necessary initial conditions and induce the internal resonant modes. However, this conjecture has never been proved by systematic numerical experiments. Our numerical results in this communication demonstrate that, the internal resonant modes' amplitudes are indeed dictated by the numerical errors. Additionally, it is shown that in a few cases, the internal resonant modes can be made 'invisible' by significantly suppressing the numerical errors. These tests prove the conjecture that the internal resonant modes are induced by numerical errors when the time domain EFIE is solved by the MOT method. © 2013 IEEE.
Atom Trap Trace Analysis for radiokrypton and radioargon dating
Williams, William; Jiang, Wei; Sun, Yun; Bailey, Kevin; Davis, Andrew; Hu, Shuiming; Lu, Zheng-Tian; Mueller, Peter; O'Connor, Thomas; Purtschert, Roland; Sturchio, Neil
2011-05-01
Atom Trap Trace Analysis (ATTA), a MOT-based atom counting method, is used to analyze three noble gas radioisotopes (81Kr, 85Kr, 39Ar) covering a wide range of geological ages and applications in the earth sciences. Their isotopic abundances are extremely low, in the range of 10-16 - 10-11. Yet, ATTA can trap and unmistakably detect these rare isotopes one atom at a time. The system is currently limited by the excitation efficiency of the RF discharge that produces the metastable atoms (Kr* & Ar*) needed for laser trapping. To further improve the MOT loading rate, we plan to replace the RF discharge with a photon excitation scheme that employs a VUV light source at 124 nm. The VUV source can be a lamp or a free electron laser. This work is supported by DOE, Office of Nuclear Physics and by NSF, Division of Earth Sciences.
Lundblad, Nathan; Jarvis, Thomas; Paseltiner, Daniel; Lannert, Courtney
2016-05-01
We have proposed using NASA's Cold Atom Laboratory (CAL, launching to the International Space Station in 2017) to generate bubble-geometry Bose-Einstein condensates through radiofrequency dressing of an atom-chip magnetic trap. This geometry has not been truly realized terrestrially due to the perturbing influence of gravity, making it an ideal candidate for microgravity investigation aboard CAL. We report progress in the construction of a functional prototype of the orbital BEC apparatus: a compact atom-chip machine loaded by a 2D+MOT source, conventional 3D MOT, quadrupole trap, and transfer coil. We also present preliminary modeling of the dressed trap uniformity, which will crucially inform the geometric closure of the BEC shell surface as atom number, bubble radius, and bubble aspect ratio are varied. Finally, we discuss plans for experimental sequences to be run aboard CAL guided by intuition from ground-based prototype operation. JPL 1502172.
Shi, Yifei
2013-08-01
Internal resonant modes are always observed in the marching-on-in-time (MOT) solution of the time domain electric field integral equation (EFIE), although \\'relaxed initial conditions,\\' which are enforced at the beginning of time marching, should in theory prevent these spurious modes from appearing. It has been conjectured that, numerical errors built up during time marching establish the necessary initial conditions and induce the internal resonant modes. However, this conjecture has never been proved by systematic numerical experiments. Our numerical results in this communication demonstrate that, the internal resonant modes\\' amplitudes are indeed dictated by the numerical errors. Additionally, it is shown that in a few cases, the internal resonant modes can be made \\'invisible\\' by significantly suppressing the numerical errors. These tests prove the conjecture that the internal resonant modes are induced by numerical errors when the time domain EFIE is solved by the MOT method. © 2013 IEEE.
Parallel, explicit, and PWTD-enhanced time domain volume integral equation solver
Liu, Yang
2013-07-01
Time domain volume integral equations (TDVIEs) are useful for analyzing transient scattering from inhomogeneous dielectric objects in applications as varied as photonics, optoelectronics, and bioelectromagnetics. TDVIEs typically are solved by implicit marching-on-in-time (MOT) schemes [N. T. Gres et al., Radio Sci., 36, 379-386, 2001], requiring the solution of a system of equations at each and every time step. To reduce the computational cost associated with such schemes, [A. Al-Jarro et al., IEEE Trans. Antennas Propagat., 60, 5203-5215, 2012] introduced an explicit MOT-TDVIE method that uses a predictor-corrector technique to stably update field values throughout the scatterer. By leveraging memory-efficient nodal spatial discretization and scalable parallelization schemes [A. Al-Jarro et al., in 28th Int. Rev. Progress Appl. Computat. Electromagn., 2012], this solver has been successfully applied to the analysis of scattering phenomena involving 0.5 million spatial unknowns. © 2013 IEEE.
International Nuclear Information System (INIS)
Barbosa, A.P.
1976-08-01
The influence of temperature on sterilizing dosages of gamma radiation was studied for Sitophilus zeamais Mots. in corn, Sitophilus oryzae (L.) in rice, Araecerus fasciculatus (DeGeer) in coffee, and Zabrotes subfasciatus (Boh.) in beans. It was found that temperature has a significant influence on the amount of radiation required to sterilize these species. The highest radiation dosages were required at those temperature most nearly optimum for insect development. The minimum radiation doses required for complete sterility of each species at the indicated temperatures were as follows: Sitophilus zeamais Mots. in corn, 8 krad at 24 0 C; Sitophilus oryzae (L.) in rice, 9 krad at 24 0 C; Araecerus fasciculatus (DeGeer) in coffee, 6 krad at 30 0 C; Zabrotes subfasciatus (Boh.) in beans, 9 krad at 24 - 27 0 C. At either higher or lower temperature smaller radiation dosages were required. (author) [pt
Molecules cooled below the Doppler limit
Truppe, S.; Williams, H. J.; Hambach, M.; Caldwell, L.; Fitch, N. J.; Hinds, E. A.; Sauer, B. E.; Tarbutt, M. R.
2017-12-01
Magneto-optical trapping and sub-Doppler cooling have been essential to most experiments with quantum degenerate gases, optical lattices, atomic fountains and many other applications. A broad set of new applications await ultracold molecules, and the extension of laser cooling to molecules has begun. A magneto-optical trap (MOT) has been demonstrated for a single molecular species, SrF, but the sub-Doppler temperatures required for many applications have not yet been reached. Here we demonstrate a MOT of a second species, CaF, and we show how to cool these molecules to 50 μK, well below the Doppler limit, using a three-dimensional optical molasses. These ultracold molecules could be loaded into optical tweezers to trap arbitrary arrays for quantum simulation, launched into a molecular fountain for testing fundamental physics, and used to study collisions and chemistry between atoms and molecules at ultracold temperatures.
Ergül, Özgür
2014-04-01
Graphics processing units (GPUs) are gradually becoming mainstream in high-performance computing, as their capabilities for enhancing performance of a large spectrum of scientific applications to many fold when compared to multi-core CPUs have been clearly identified and proven. In this paper, implementation and performance-tuning details for porting an explicit marching-on-in-time (MOT)-based time-domain volume-integral-equation (TDVIE) solver onto GPUs are described in detail. To this end, a high-level approach, utilizing the OpenACC directive-based parallel programming model, is used to minimize two often-faced challenges in GPU programming: developer productivity and code portability. The MOT-TDVIE solver code, originally developed for CPUs, is annotated with compiler directives to port it to GPUs in a fashion similar to how OpenMP targets multi-core CPUs. In contrast to CUDA and OpenCL, where significant modifications to CPU-based codes are required, this high-level approach therefore requires minimal changes to the codes. In this work, we make use of two available OpenACC compilers, CAPS and PGI. Our experience reveals that different annotations of the code are required for each of the compilers, due to different interpretations of the fairly new standard by the compiler developers. Both versions of the OpenACC accelerated code achieved significant performance improvements, with up to 30× speedup against the sequential CPU code using recent hardware technology. Moreover, we demonstrated that the GPU-accelerated fully explicit MOT-TDVIE solver leveraged energy-consumption gains of the order of 3× against its CPU counterpart. © 2014 IEEE.
Antúnez-Lamas, María; Cabrera-Ordóñez, Ezequiel; López-Solanilla, Emilia; Raposo, Rosa; Trelles-Salazar, Oswaldo; Rodríguez-Moreno, Andrés; Rodríguez-Palenzuela, Pablo
2009-02-01
Dickeya dadantii 3937 (ex Erwinia chrysanthemi), a member of the Enterobacteriaceae, causes soft rot in many economically important crops. A successful pathogen has to reach the interior of the plant in order to cause disease. To study the role of motility and chemotaxis in the pathogenicity of D. dadantii 3937, genes involved in the chemotactic signal transduction system (cheW, cheB, cheY and cheZ) and in the structure of the flagellar motor (motA) were mutagenized. All the mutant strains grew like the wild-type in culture media, and the production and secretion of pectolytic enzymes was not affected. As expected, the swimming ability of the mutant strains was reduced with respect to the wild-type: motA (94%), cheY (80%), cheW (74%), cheB (54%) and cheZ (48%). The virulence of the mutant strains was analysed in chicory, Saintpaulia and potato. The mutant strains were also tested for their capability to enter into Arabidopsis leaves. All the mutants showed a significant decrease of virulence in certain hosts; however, the degree of virulence reduction varied depending on the virulence assay. The ability to penetrate Arabidopsis leaves was impaired in all the mutants, whereas the capacity to colonize potato tubers after artificial inoculation was affected in only two mutant strains. In general, the virulence of the mutants could be ranked as motA
Optimized coupling of cold atoms into a fiber using a blue-detuned hollow-beam funnel
Energy Technology Data Exchange (ETDEWEB)
Poulin, Jerome; Light, Philip S.; Kashyap, Raman; Luiten, Andre N. [Frequency Standards and Metrology Group, School of Physics, University of Western Australia, Western Australia 6009, Perth (Australia); Department of Engineering Physics, Ecole Polytechnique de Montreal, Montreal, Quebec, Canada H3C 3A7 (Canada); Frequency Standards and Metrology, School of Physics, University of Western Australia, Western Australia 6009, Perth (Australia)
2011-11-15
We theoretically investigate the process of coupling cold atoms into the core of a hollow-core photonic-crystal optical fiber using a blue-detuned Laguerre-Gaussian beam. In contrast to the use of a red-detuned Gaussian beam to couple the atoms, the blue-detuned hollow beam can confine cold atoms to the darkest regions of the beam, thereby minimizing shifts in the internal states and making the guide highly robust to heating effects. This single optical beam is used as both a funnel and a guide to maximize the number of atoms into the fiber. In the proposed experiment, Rb atoms are loaded into a magneto-optical trap (MOT) above a vertically oriented optical fiber. We observe a gravito-optical trapping effect for atoms with high orbital momentum around the trap axis, which prevents atoms from coupling to the fiber: these atoms lack the kinetic energy to escape the potential and are thus trapped in the laser funnel indefinitely. We find that by reducing the dipolar force to the point at which the trapping effect just vanishes, it is possible to optimize the coupling of atoms into the fiber. Our simulations predict that by using a low-power (2.5 mW) and far-detuned (300 GHz) Laguerre-Gaussian beam with a 20-{mu}m-radius core hollow fiber, it is possible to couple 11% of the atoms from a MOT 9 mm away from the fiber. When the MOT is positioned farther away, coupling efficiencies over 50% can be achieved with larger core fibers.
Gouws, Eleanor; Cuchi, Paloma
2012-01-01
Objective An increasing number of countries have been estimating the distribution of new adult HIV infections by modes of transmission (MOT) to help prioritise prevention efforts. We compare results from studies conducted between 2008 and 2012 and discuss their use for planning and responding to the HIV epidemic. Methods The UNAIDS recommended MOT model helps countries to estimate the proportion of new HIV infections that occur through key transmission modes including sex work, injecting drug use (IDU), men having sex with men (MSM), multiple sexual partnerships, stable relationships and medical interventions. The model typically forms part of a country-led process that includes a comprehensive review of epidemiological data. Recent revisions to the model are described. Results Modelling results from 25 countries show large variation between and within regions. In sub-Saharan Africa, new infections occur largely in the general heterosexual population because of multiple partnerships or in stable discordant relationships, while sex work contributes significantly to new infections in West Africa. IDU and sex work are the main contributors to new infections in the Middle East and North Africa, with MSM the main contributor in Latin America. Patterns vary substantially between countries in Eastern Europe and Asia in terms of the relative contribution of sex work, MSM, IDU and spousal transmission. Conclusions The MOT modelling results, comprehensive review and critical assessment of data in a country can contribute to a more strategically focused HIV response. To strengthen this type of research, improved epidemiological and behavioural data by risk population are needed. PMID:23172348
Prescribing of asthma drugs for children 2004-2015.
Mikalsen, Ingvild Bruun; Karlstad, Øystein; Furu, Kari; Øymar, Knut
2018-02-20
Astma kan være vanskelig å diagnostisere hos barn. For barn under skolealder finnes det få tilgjengelige objektive diagnostiske undersøkelser, og retningslinjene for diagnose og behandling er basert på sykehistorie og klinisk undersøkelse. Dette kan gi rom for varierende behandlingspraksis. Data fra Reseptregisteret ble brukt til å studere forskrivning av legemidler mot astma til barn i aldersgruppene 0-4 år og 5-9 år fordelt på fylker fra 2004-15. Det var stor variasjon mellom fylkene i andelen per 1 000 barn som fikk forskrevet legemidler mot astma i perioden 2012-14 (aldersgruppen 0-4 år: median: 104/1 000; ekstremverdier: 64-147, aldersgruppen 5-9 år: 68/1000; 46-86). Inhalasjonssteroider var hyppigst forskrevet, og det var her variasjonen mellom fylkene var størst i begge aldersgruppene (aldersgruppen 0-4 år: 85/1 000; 42-116, aldersgruppen 5-9 år: 51/1 000; 31-70). De fleste fikk kun en eller få forskrivninger med inhalasjonssteroider over en treårsperiode. Endring i forskrivningen av inhalasjonssteroider fra 2004 til 2015 varierte betydelig mellom fylkene, mest for aldersgruppen 0-4 år. Stor forskjell i forskrivning av legemidler mot astma fylkene imellom, høy andel sporadisk bruk og endring over tid, særlig i den yngste aldersgruppen, kan tyde på en unaturlig variasjon i behandlingen som ikke kan forklares av forskjeller i astmaforekomst. Uklare retningslinjer som ikke er tilstrekkelig innarbeidet i klinisk praksis kan være én årsak.
Zamani, Peyman; Rezai, Hossein; Garmatani, Neda Tahmasebi
2017-08-01
Repetitive articulatory rate or Oral Diadochokinesis (oral-DDK) shows a guideline for appraisal and diagnosis of subjects with oral-motor disorder. Traditionally, meaningless words repetition has been utilized in this task and preschool children have challenges with them. Therefore, we aimed to determine some meaningful words in order to test oral-DDK in Persian speaking preschool children. Participants were 142 normally developing children, (age range 4-6 years), who were asked to produce /motæka, golabi/ as two meaningful Persian words and /pa-ta-ka/ as non-word in conventional oral-DDK task. We compared the time taken for 10-times fast repetitions of two meaningful Persian words and the tri-syllabic nonsense word /pa-ta-ka/. Praat software was used to calculate the average time that subjects took to produce the target items. In 4-5 year old children, [Formula: see text] of time taken for 10-times repetitions of /pa-ta-ka, motæka, golabi/ were [Formula: see text], and [Formula: see text] seconds respectively, and in 5-6 year old children were [Formula: see text], and [Formula: see text] seconds respectively. Findings showed that the main effect of type of words on oral diadochokinesis was significant ([Formula: see text]). Children repeated meaningful words /motæka, golabi/ faster than the non-word /pa-ta-ka/. Sex and age factors had no effect on time taken for repetition of oral-DDK test. It is suggested that Speech Therapists can use meaningful words to facilitate oral-DDK test for children.
Cannabis et thrombose du sinus caverneux | Agba | Journal de la ...
African Journals Online (AJOL)
Mots clés: Thrombose-sinus caverneux-cannabis. English Abstract. Introduction: Cerebral venous thrombosis (CVT) is a rare cause of Cerebro Vascular Accidents (CVA). Their clinical manifestations are often atypical, which can simulate transient ischemic attacks, migraines with aura, thunder headaches and hemorrhages ...
African Journals Online (AJOL)
Winnie
Mots clés: Education par les pairs et le soutien, prévention du VIH, éducation sur le VIH à l'école, ..... HIV and drug awareness days including drama, song, dance and ...... Sexual and Relationships Therapy, 15(3), 283-296. .... Family Planning.
2195-IJBCS-Article-Rachidi Saliou
African Journals Online (AJOL)
hp
Mots clés : Distribution géographique, variabilités climatiques, herbacées fourragères, Moyen-Bénin. INTRODUCTION ... définie sur la zone d'étude, qui satisfait à un ensemble de ..... Global Ecology ... agropastoraux Soudano Sahéliens du.
DEFF Research Database (Denmark)
Kim, Boa; Xylakis, Emmanouil; Predescu, Andrei-Ducu
2018-01-01
This paper investigates how VR technology can support the process of designing light installations. Specifically, how visual immersion through digital means can create spatial awareness of an area, without the need of physical presence, thus facilitating the fluency of the design process. The mot...
Explicit solution of Calderon preconditioned time domain integral equations
Ulku, Huseyin Arda; Bagci, Hakan; Michielssen, Eric
2013-01-01
operators and a PE(CE)m type linear multistep to march on in time. Unlike its implicit counterpart, the proposed explicit solver requires the solution of an MOT system with a Gram matrix that is sparse and well-conditioned independent of the time step size
Justice organisationnelle perçue des pratiques de gestion des ...
African Journals Online (AJOL)
Mots clés : Pratiques de GRH, Justice organisationnelle perçue, Engagement organisationnel. ABSTRACT. This study aims at measuring the mediator effect of the organizational justice perceived in the relation between the practices of human stock management and the organizational commitment of the employees.
AMELIORATON GENETIQUE DE Coffea canephora Pierre PAR ...
African Journals Online (AJOL)
AISA
Mots clés : Café, descendance, robusta, C. canephora, congusta, Côte d'Ivoire. ABSTRACT. GENETIC BREEDING OF coffea canephoraPierre BY INTERSPECIFIC HYBRIDIZATION : STUDY OF FIRST GENERATION. HYBRIDES OF coffea cannephoraPierre X coffea congensis Froenhner. Coffee represents one of the most ...
Étude hydrochimique et microbiologique des eaux de source de l ...
African Journals Online (AJOL)
SARAH
30 mars 2013 ... Mot clés : Assainissement, eaux de source, pollution, Hydrochimie, Environnement, Éléments Traces. Métalliques. ..... Demande Biologique en Oxygène sur 5 jours (DBO5), la ..... La région étant une zone forestière agricole,.
Le point sur les indices du bien-être national | CRDI - Centre de ...
International Development Research Centre (IDRC) Digital Library (Canada)
21 janv. 2011 ... Les indices économiques sont des outils statistiques qui résument des ... En quelques mots, le PIB correspond à la valeur totale des biens et ... copieux menu d'instruments de mesure allant du réjouissant Happy Planet Index, ...
caracterisation des systemes de production a base d'anacardier
African Journals Online (AJOL)
AISA
Mots clés : Systèmes de culture, anacardier, gestion des plantations, rentabilité économique, Bénin. .... qui élimine au fur et à mesure les variables .... regard à la performance des arbres. ..... le contrôle des mauvaises herbes et la meilleure.
Deling av personbilder på Snapchat - med vekt på retten til eget bilde etter åndsverkloven § 45c.
Heiberg, Henrik
2017-01-01
Avbildedes vern mot offentliggjøring av personbildet og fotografens rettigheter til personbildet belyses i oppgaven. En sentral problemstilling er hva som følger av offentlig-begrepet etter åndsverkloven § 45c. Når er et bilde delt offentlig på Snapchat?
Coping with Technological Dynamics
DEFF Research Database (Denmark)
Ulhøi, John Parm; Drejer, A.
It is argued that, up to now, MOT and TS have primarily been addressed from different rationalistic and planning based perspectives. Based on an extensive literature review this paper identifies four such approaches within Management of Technology which have dominated the discipline from the very...
1678-IJBCS-Article-Jacques Fatombi
African Journals Online (AJOL)
hp
Elimination du fer et du manganèse d'une eau de surface par les graines de. Moringa oleifera. Jacques K. ... Mot clés: Moringa oleifera - fer - manganèse adjuvant de coagulation - jar-test. .... coagulation-floculation types jar-test. Des volumes ...
Impact de l'activité anthropique sur la dégradation de l ...
African Journals Online (AJOL)
Mots clés : El Kala - IPO - Diagramme de Piper - Impact anthropique – Piézométrie. Abstract ..... quelques recommandations afin de participer à la protection du parc ... hydrochimique de quelques hydro systèmes de la Numidie. (Régions d'El ...
Indian Academy of Sciences (India)
Upgradation of MOT and its Relevance to WET Campaigns (Alisher S. Hojaev), 311. Argos: An Optimized Time-Series Photometer (Anjum S. Mukadam & R. E. Nather),. 321. Small-scale Magnetic Field Diagnostics Outside Sunspots: Comparison of Different. Methods (D. N. Rachkovsky, T. T. Tsap & V. G. Lozitsky), 435.
Boutiques d'alimentation turques et chypriotes dans le quartier Hackney de Londres
Rigoni , Isabelle
2002-01-01
Sur la gauche, une épicerie turque vendant des produits du Moyen-Orient ; sur la droite, une patisserie chypriote (le mot patisserie est écrit à la fois en turc et en grec). Un véhicule utilitaire garé mentionne un restaurant de tapas espagnol.
Données préliminaires sur la diversité du zooplancton du lac Nokoué
African Journals Online (AJOL)
SARAH
31 juil. 2017 ... contribuera davantage à la compréhension de la dynamique de cette communauté biologique du lac. Mots clés ... dans une perspective de gestion durable de la .... ramenés au Laboratoire de Contrôle de Qualité des Eaux.
African Journal of Neurological Sciences - 2009 Vol. 28 No 1
African Journals Online (AJOL)
Mots clés : Arbre, Accident, Chute, Mali, Rachis, Traumatisme ... Les chutes du haut d'un arbre sont des accidents graves et fréquents au MALI. ..... s'agir de traumatismes crâniens dans 39% des cas, de lésions musculo-squelettiques dans ...
Women in the child bearing age of 15 to 44 years and, in particular, pregnant and lactating women in this age cohort are considered a sensitive subpopulation when assessing risk from ingestion of contaminated water because ingested contaminants may pose a risk not only to the mot...
L'adoption des produits cosmétiques par les consommateurs ...
African Journals Online (AJOL)
Mots clés : adoption des produits cosmétiques, consommateurs, perception de la ... Keywords: adoption of cosmetics, consumers, perception of novelty, methods of ...... Bauer R (1960), Consumer Behavior as Risk Taking Dynamic Marketing for a changing ... via job mobility, Journal of economic Behaviour and Organization, ...
113 Étude de la qualité des eaux épurées par le lagunage naturel ...
African Journals Online (AJOL)
sam
Mots-clés : lagunage naturel, performances, eaux usées, Algérie. Abstract ... domaine de l'irrigation agricole. Le ratio entre les ... traitement biologique : Cette filière est composée de six bassins, qui sont réparties suivant trois étages : • .
Optimization of transfer of laser-cooled atom cloud to a quadrupole ...
Indian Academy of Sciences (India)
2014-02-08
Feb 8, 2014 ... Laser Physics Applications Section, Raja Ramanna Centre for Advanced Technology,. Indore 452 013 ... Laser cooling; optical molasses; double-MOT; magnetic trapping; phase-space density. PACS Nos 52.55. ... this method, the transfer of laser-cooled atom cloud to magnetic trap is an important step,.
Existe-t-il une corrélation entre la taille tumorale au scanner et les ...
African Journals Online (AJOL)
Mots-Clés: cancer; rein; tomodensitométrie; anatomie pathologique; imagerie. English Title: Is there a correlation between tumor size on CT scan and pathological characteristics of kidney cancer? English Abstract. Introduction: Renal cell carcinoma (RCC) may vary in prognosis according to staging, histological subtype, ...
Contamination métallique de l'eau et du sédiment d'Oued Bouhamra ...
African Journals Online (AJOL)
d'identifier les origines industrielle, agricole et domestique de cette pollution. Mots-clés : éléments traces métalliques- rejets urbains en mer – eau superficielle – sédiment - Golfe d'Annaba. Abstract ...... thermique des déchets). Ed. TEC & DOC ...
Premier isolement de Stephanoascus ciferrii dans des infections ...
African Journals Online (AJOL)
Il faut garder à l'esprit que des pathogènes inhabituels peuvent causer ces infections vaginales. Mots clés : Stephanoascus ciferrii, Vitek 2, candidose vaginale. ABSTRACT. Introduction: Fungal infections know an extraordinary expansion with therapeutic progress and apparition of immunodepressive diseases such as HIV.
169 Résumé Abstract Measure of uranium in some samples of ...
African Journals Online (AJOL)
youness
puits et par activation neutronique. Mots-clés : Uranium, Radioactivité naturelle, Coraux, Coquilles de mollusques, lichens, travertins, Carbonates. Abstract. Measure of uranium in some samples of natural deposits in Morocco: environmental implications. In this work, we report the measurement results of uranium content in.
Foreign Language Workshop on French Culture.
Reynolds, Sue, Ed.; And Others
A compilation of French cultural units for use in secondary school language classes is presented in this text. Units include: (1) "Les mots et leur implication culturelle," (2) "Le telephone--une capsule culturelle," (3) "Le repas," (4) "La femme francaise 1972," (5) "Les Parents," (6)…
Efficacité des champignons mycorhiziens contre les nématodes ...
African Journals Online (AJOL)
SARAH
30 mai 2015 ... Mots clés : Glomus sp., Lycopersicon esculentum, lutte biologique, Meloidogyne spp. Effectiveness of the arbuscular mycorrhizal fungi on the parasitic nematodes of tomato in Togo. ABSTRACT. Objectives : To find alternatives to the synthetic pesticides used against nematodes the present work aimed at.
1957-IJBCS-Article-Koura Kourouma
African Journals Online (AJOL)
hp
des sous-populations de Parkia biglobosa (néré) du Nord-Bénin, en vue d'une gestion durable de l'espèce. ... Mots clés : Sous-population, Parkia biglobosa, phénotype, structure, Nord-Bénin. ...... nutrition et alimentation dans les pays en.
2431-IJBCS-Article -Dougna Akpene A
African Journals Online (AJOL)
hp
Physico-chimie et qualité des eaux des forages d'hydraulique villageoise dans la région ... Mots clés : Région centrale, Togo, faciès hydrochimiques, pollution, eaux souterraines, socle. Physical ...... total) ont un pH< 6 et présentent des indices.
Carcinome épidermoïde primitif du colon: à propos d'un cas ...
African Journals Online (AJOL)
cliniques et thérapeutiques ainsi que les hypothèses étiopathogéniques de cette entité peu commune. Mots clés: Colon, carcinome épidermoïde, pronostic. English Title: Primary squamous cell carcinoma of the colon: about a case. English Abstract.
Lithiases vésicales géantes: A propos de 2 cas
African Journals Online (AJOL)
S. Ouedraogo
Disponible sur Internet le 27 octobre 2016. MOTS CLÉS .... Il n'y pas eu de récidive au bout de 14 mois. ... Le patient a eu recours à la médecine traditionnelle, utilisant des .... Mamadou T. TRAORE: a participé à la recherche documentaire.
Statut nutritionnel et parasitoses (intestinales et urinaires) chez les ...
African Journals Online (AJOL)
... d'y associer un traitement efficace contre les parasites intestinaux et urinaires. Mots-cles: Enfant, Ecole, Statut nutritionnel, IMC pour age, parasitoses, Burkina Faso. Nutritional status and parasites (intestinal and urinary) infections among school-age children in Burkina Faso: case study of Yamtenga, Koubri and Daguilma ...
Bréal, un antinaturalisme d’inspiration humboldtienne
Directory of Open Access Journals (Sweden)
Babu Jean-Philippe
2014-07-01
Full Text Available Dans De la forme et de la fonction des mots, Bréal formulait, dès 1866, outre une critique générale du formalisme de la philologie comparative depuis Bopp, une thèse radicalement opposée à l’orientation naturaliste de l’évolutionnisme linguistique de Schleicher. Cette thèse, que nous prendrons le risque de définir comme thèse du primat de la fonction sur la forme linguistique, est au coeur de ce programme de linguistique générale pour lequel Bréal allait forger, quelques années plus tard, le mot de sémantique. Fortement marqué par la notion humboldtienne d’innere Sprachform, Bréal, contrairement à Saussure, n'abandonnera jamais le changement linguistique au hasard de l'histoire et maintiendra l'intelligence comme premier moteur des langues, quitte à poser la nécessité de repenser cette intelligence.
International Nuclear Information System (INIS)
Haendel, S.; Marchant, A. L.; Wiles, T. P.; Hopkins, S. A.; Cornish, S. L.
2012-01-01
We present an apparatus designed for studies of atom-surface interactions using quantum degenerate gases of 85 Rb and 87 Rb in the vicinity of a room temperature dielectric surface. The surface to be investigated is a super-polished face of a glass Dove prism mounted in a glass cell under ultra-high vacuum. To maintain excellent optical access to the region surrounding the surface, magnetic transport is used to deliver ultracold atoms from a separate vacuum chamber housing the magneto-optical trap (MOT). We present a detailed description of the vacuum apparatus highlighting the novel design features; a low profile MOT chamber and the inclusion of an obstacle in the transport path. We report the characterization and optimization of the magnetic transport around the obstacle, achieving transport efficiencies of 70% with negligible heating. Finally, we demonstrate the loading of a hybrid optical-magnetic trap with 87 Rb and the creation of Bose-Einstein condensates via forced evaporative cooling close to the dielectric surface.
Valdés, Felipe
2013-03-01
Single-source time-domain electric-and magnetic-field integral equations for analyzing scattering from homogeneous penetrable objects are presented. Their temporal discretization is effected by using shifted piecewise polynomial temporal basis functions and a collocation testing procedure, thus allowing for a marching-on-in-time (MOT) solution scheme. Unlike dual-source formulations, single-source equations involve space-time domain operator products, for which spatial discretization techniques developed for standalone operators do not apply. Here, the spatial discretization of the single-source time-domain integral equations is achieved by using the high-order divergence-conforming basis functions developed by Graglia alongside the high-order divergence-and quasi curl-conforming (DQCC) basis functions of Valdés The combination of these two sets allows for a well-conditioned mapping from div-to curl-conforming function spaces that fully respects the space-mapping properties of the space-time operators involved. Numerical results corroborate the fact that the proposed procedure guarantees accuracy and stability of the MOT scheme. © 2012 IEEE.
Diao, Wenting; He, Jun; Liu, Zhi; Yang, Baodong; Wang, Junmin
2012-03-26
By optical injection of an 852-nm extended-cavity diode laser (master laser) to lock the + 1-order sideband of a ~9-GHz-current-modulated diode laser (slave laser), we generate a pair of phase-locked lasers with a frequency difference up to ~9-GHz for a cesium (Cs) magneto-optical trap (MOT) with convenient tuning capability. For a cesium MOT, the master laser acts as repumping laser, locked to the Cs 6S₁/₂ (F = 3) - 6P₃/₂ (F' = 4) transition. When the + 1-order sideband of the 8.9536-GHz-current-modulated slave laser is optically injection-locked, the carrier operates on the Cs 6S₁/₂ (F = 4) - 6P₃/₂ (F' = 5) cooling cycle transition with -12 MHz detuning and acts as cooling/trapping laser. When carrying a 9.1926-GHz modulation signal, this phase-locked laser system can be applied in the fields of coherent population trapping and coherent manipulation of Cs atomic ground states.
High-resolution structure of TBP with TAF1 reveals anchoring patterns in transcriptional regulation.
Anandapadamanaban, Madhanagopal; Andresen, Cecilia; Helander, Sara; Ohyama, Yoshifumi; Siponen, Marina I; Lundström, Patrik; Kokubo, Tetsuro; Ikura, Mitsuhiko; Moche, Martin; Sunnerhagen, Maria
2013-08-01
The general transcription factor TFIID provides a regulatory platform for transcription initiation. Here we present the crystal structure (1.97 Å) and NMR analysis of yeast TAF1 N-terminal domains TAND1 and TAND2 bound to yeast TBP, together with mutational data. We find that yeast TAF1-TAND1, which in itself acts as a transcriptional activator, binds TBP's concave DNA-binding surface by presenting similar anchor residues to TBP as does Mot1 but from a distinct structural scaffold. Furthermore, we show how TAF1-TAND2 uses an aromatic and acidic anchoring pattern to bind a conserved TBP surface groove traversing the basic helix region, and we find highly similar TBP-binding motifs also presented by the structurally distinct TFIIA, Mot1 and Brf1 proteins. Our identification of these anchoring patterns, which can be easily disrupted or enhanced, provides insight into the competitive multiprotein TBP interplay critical to transcriptional regulation.
Zhou, Mingxu; Duan, Qiangde; Zhu, Xiaofang; Guo, Zhiyan; Li, Yinchau; Hardwidge, Philip R; Zhu, Guoqiang
2013-05-13
The role of flagella in the pathogenesis of F4ac+ Enterotoxigenic Escherichia coli (ETEC) mediated neonatal and post-weaning diarrhea (PWD) is not currently understood. We targeted the reference C83902 ETEC strain (O8:H19:F4ac+ LT+ STa+ STb+), to construct isogenic mutants in the fliC (encoding the major flagellin protein), motA (encoding the flagella motor), and faeG (encoding the major subunit of F4 fimbriae) genes. Both the ΔfliC and ΔfaeG mutants had a reduced ability to adhere to porcine intestinal epithelial IPEC-J2 cells. F4 fimbriae expression was significantly down-regulated after deleting fliC, which revealed that co-regulation exists between flagella and F4 fimbriae. However, there was no difference in adhesion between the ΔmotA mutant and its parent strain. These data demonstrate that both flagella and F4 fimbriae are required for efficient F4ac+ ETEC adhesion in vitro.
Directory of Open Access Journals (Sweden)
Cédric Manara
2004-09-01
Full Text Available A French court has ruled against Google France in an intellectual property dispute, saying the company infringed trademark laws for allowing advertisers to combine their text notices to trademarked search terms. This decision, which is not a temporary injunction, is unique, and it is also the first in the world to find Google liable for its AdWords program. This short analysis recaps the reason how the law applied to the search tool, and highlights that the judicial decision has probably no effect for the defendant: not because it has been ruled in France, but because advertisers who buy AdWords agree to indemnify Google for any liability and cause of action. Therefore, this shows that these conflicts of laws in cyberspace are not those we thought so
Problematique de l'utilisation des tic dans l'enseignement superieur ...
African Journals Online (AJOL)
Mots clés : Technologies de l'Information et de la Communication (TIC), Internet, enseignants chercheurs, étudiants, université. Communication and Information Technologies (TIC) plays today an important part in the sectors of the life. Appearing as a means of supplementing the traditional educational techniques they make ...
Performance de six cultivars de tomates Lycopersicon esculentum ...
African Journals Online (AJOL)
Administrateur
mêmes sont plus performantes que la variété. Petomech. Mots clés : Performance, tomate, jaunisse en cuillère, flétrissement bactérien, nématodes, Côte d'Ivoire. Abstract. Performance of six cultivars of tomato Lycopersicon esculentum Mills. against ...
adaptation et selection de varietes performantes de riz pluvi
African Journals Online (AJOL)
PROJET SOJA
Mots- clés : Résistivité, phosphates, filtrage, contours, Sidi Chennane, Maroc. .... Toutes les formations reposent par discordance sur les schistes et les .... L'image de départ I(x,y) n'étant pas une fonction continue mais discrète à cause de la.
African Journal of Neurological Sciences 2010 - Vol. 29, No 1 25
African Journals Online (AJOL)
kim
Mots-clés: Traumatisme crânio-encéphalique, Accident de la circulation, Epidémiologie. Keywords: ... and severe in 171 (22.7%) for all cases. TBI was lone in 135 ..... patient traumatisé crânien suite à un accident de la circulation. Figure 4 ...
Cancer de la Vessie au Togo : Aspects Diagnostiques Et ...
African Journals Online (AJOL)
Mots clés : cancer de la vessie, diagnostic, traitement ;. ABSTRACT. Cancer of the Bladder in Togo. Clinical and Management Aspects at the Teaching Hospital of Sylvanus Olympio. Objective: to describe the clinical and management features in patients followed for bladder cancer at the teaching hospital of Sylvanus ...
Analyse comparative entre la distribution des fréquences de ...
African Journals Online (AJOL)
2016 International Formulae Group. All rights reserved. Mots clés: Hydrogéochimie, conductivité électrique, diagramme de Piper, socle cristallin et cristallophyllien, Côte d'Ivoire. English Title: Comparative analysis of electrical conductivity frequencies distribution and geochemical facies of hard rock aquifers waters (Ivory ...
Metastases cerebrales d'un cancer de l'endometre: a propos d'une ...
African Journals Online (AJOL)
Mots clés: cancer, endomètre, métastases, cerveau, Lomé, Togo. English Title: Brain metastases of endometrial cancer: an observation at Lome and literature review. English Abstract. Introduction: document the clinical, paraclinical, therapeutic and prognostic of brain metastases of endometrial cancer in hospital in Togo.
Activités anti-radicalaires de l'huile essentielle et des extraits bruts ...
African Journals Online (AJOL)
une haute capacité de blocage du peroxyde d'hydrogène en comparaison avec les contrôles positifs de l'acide gallique et l'acide caféique. Mots-clés : Thymus numidicus, extraits bruts, activité antioxydante. Anti-radical activities of essential oil ...
African Journal of Neurological Sciences 2013 - Vol. 32, No 1 http ...
African Journals Online (AJOL)
Service de Neurochirurgie, Hôpital Avicenne, Rabat. 2. Service de neuroradiologie, Rabat, Royaume du Maroc. Mots clés : Epidermoïde - Intra médullaire - IRM - Kyste - Moelle spinale. Keywords: Cyst - Epidermoid - Intramedullary -Medullary spinal -MRI. RESUME. Introduction. Les kystes épidermoïdes sont des tumeurs ...
Developing a Standard Method of Test for Packaged, Solid-Desiccant Based Dehumidification Systems
International Nuclear Information System (INIS)
Sand, J.R.
2001-01-01
A draft Method of Test (MOT) has been proposed for packaged, air-to-air, desiccant-based dehumidifier systems that incorporate a thermally-regenerated desiccant material for dehumidification. This MOT is intended to function as the ''system'' testing and rating compliment to the desiccant ''component'' (desiccant wheels and/or cassettes) MOT (ASHRAE 1998) and rating standard (ARI 1998) already adopted by industry. This draft standard applies to ''packaged systems'' that: Use desiccants for dehumidification of conditioned air for buildings; Use heated air for regeneration of the desiccant material; Include fans for moving process and regeneration air; May include other system components for filtering, pre-cooling, post-cooling, or heating conditioned air; and May include other components for humidification of conditioned air. The proposed draft applies to four different system operating modes depending on whether outdoor or indoor air is used for process air and regeneration air streams . Only the ''ventilation'' mode which uses outdoor air for both process and regeneration inlets is evaluated in this paper. Performance of the dehumidification system is presented in terms that would be most familiar and useful to designers of building HVAC systems to facilitate integration of desiccant equipment with more conventional hardware. Parametric performance results from a modified, commercial desiccant dehumidifier undergoing laboratory testing were used as data input to evaluate the draft standard. Performance results calculated from this experimental input, results from an error-checking/heat-balance verification test built into the standard, and estimated comparisons between desiccant and similarly performing conventional dehumidification equipment are calculated and presented. Some variations in test procedures are suggested to aid in analytical assessment of individual component performance
Relação da circunferência escrotal e parâmetros da qualidade do sêmen em touros da raça Nelore, PO
Directory of Open Access Journals (Sweden)
Silva Antonio Emidio Dias Feliciano
2002-01-01
Full Text Available Em 960 touros da raça Nelore, PO, de 11,4 a 135 meses de idade, pertencentes a fazendas localizadas nos Estados de São Paulo, Goiás e Pará, estudou-se a possível associação entre o tamanho da circunferência escrotal (CE e os parâmetros da qualidade do sêmen, motilidade progressiva (MOT e patologias espermáticas: defeitos maiores (DEFMAI, menores (DEFMEN e totais (DEFTOT. Os touros foram divididos por faixas etárias em: menores que 18, de 18 a 24, de 24 a 30, de 30 a 36 e maiores que 36 meses de idade. Este estudo foi realizado com a finalidade de obter tamanhos de CE que possam indicar o estatus funcional dos testículos, ou seja, a qualidade do sêmen, a serem utilizados para predizer o potencial reprodutivo dos animais destinados à seleção de reprodutores. Da correlação da CE com a MOT, por faixa etária, resultou uma associação (R=0,60; P<0,0001 destes parâmetros nos touros até 18 meses de idade, em que CEs acima de 26 cm indicaram sêmen de alta MOT (60 a 80%. As correlações entre CE e patologias espermáticas foram baixas e a maioria, negativa. Foi concluído, neste estudo, que nos touros jovens o tamanho da CE indica a qualidade do sêmen, portanto pode ser utilizado como um dos critérios na seleção de animais de alto potencial reprodutivo.
Directory of Open Access Journals (Sweden)
Taha Soliman
2017-12-01
Full Text Available Structure and diversity of microbial communities are an important research topic in biology, since microbes play essential roles in the ecology of various environments. Different DNA isolation protocols can lead to data bias and can affect results of next-generation sequencing. To evaluate the impact of protocols for DNA isolation from soil samples and also the influence of individual handling of samples, we compared results obtained by two researchers (R and T using two different DNA extraction kits: (1 MO BIO PowerSoil® DNA Isolation kit (MO_R and MO_T and (2 NucleoSpin® Soil kit (MN_R and MN_T. Samples were collected from six different sites on Okinawa Island, Japan. For all sites, differences in the results of microbial composition analyses (bacteria, archaea, fungi, and other eukaryotes, obtained by the two researchers using the two kits, were analyzed. For both researchers, the MN kit gave significantly higher yields of genomic DNA at all sites compared to the MO kit (ANOVA; P < 0.006. In addition, operational taxonomic units for some phyla and classes were missed in some cases: Micrarchaea were detected only in the MN_T and MO_R analyses; the bacterial phylum Armatimonadetes was detected only in MO_R and MO_T; and WIM5 of the phylum Amoebozoa of eukaryotes was found only in the MO_T analysis. Our results suggest the possibility of handling bias; therefore, it is crucial that replicated DNA extraction be performed by at least two technicians for thorough microbial analyses and to obtain accurate estimates of microbial diversity.
Event and Apparent Horizon Finders for 3 + 1 Numerical Relativity.
Thornburg, Jonathan
2007-01-01
Event and apparent horizons are key diagnostics for the presence and properties of black holes. In this article I review numerical algorithms and codes for finding event and apparent horizons in numerically-computed spacetimes, focusing on calculations done using the 3 + 1 ADM formalism. The event horizon of an asymptotically-flat spacetime is the boundary between those events from which a future-pointing null geodesic can reach future null infinity and those events from which no such geodesic exists. The event horizon is a (continuous) null surface in spacetime. The event horizon is defined nonlocally in time : it is a global property of the entire spacetime and must be found in a separate post-processing phase after all (or at least the nonstationary part) of spacetime has been numerically computed. There are three basic algorithms for finding event horizons, based on integrating null geodesics forwards in time, integrating null geodesics backwards in time, and integrating null surfaces backwards in time. The last of these is generally the most efficient and accurate. In contrast to an event horizon, an apparent horizon is defined locally in time in a spacelike slice and depends only on data in that slice, so it can be (and usually is) found during the numerical computation of a spacetime. A marginally outer trapped surface (MOTS) in a slice is a smooth closed 2-surface whose future-pointing outgoing null geodesics have zero expansion Θ. An apparent horizon is then defined as a MOTS not contained in any other MOTS. The MOTS condition is a nonlinear elliptic partial differential equation (PDE) for the surface shape, containing the ADM 3-metric, its spatial derivatives, and the extrinsic curvature as coefficients. Most "apparent horizon" finders actually find MOTSs. There are a large number of apparent horizon finding algorithms, with differing trade-offs between speed, robustness, accuracy, and ease of programming. In axisymmetry, shooting algorithms work well
À propos de l' influence de la langue Portugaise
Directory of Open Access Journals (Sweden)
Fernando V. Peixoto da Fonseca
1986-12-01
Full Text Available Sur les mots castillans d'origine portugaise, le Prof. Rodrigo de Sá Noguiera écrit: "Il y a une série de mots castillans d'origine claire ou probable portugaise, que le Dictionnaire de l'Académie Espagnole dans la plupart des cas ou omet, ou considère comme d'origine différente". Ceux d'origine claire portugaise, ajoute cet étymologiste, sont ceux qui phonétiquement n'auraient pu avoir en espagnol la forme qu'ils revêtent dans cette langue, tandis qu'ils sont d'accord avec les règles de notre phonétique historique, existant, en outre, sous la même forme (p. ex. chato ou sembllable (p. ex. follaje dans la langue portugaise. Les suivants se trouvent dans ce cas: achantarse, achubascarse, afeitar, aldorta, brinco, barroco, canela, caramelo, cariño, chamada, chapa, chato, chaveta, chinela, chocal!o, chocho, chopa, choza, chubasco, chumacera, chus, chusma, cobra, conchabar, cortiña, desvaído, desvergoñadamente, fado, follaje, fuera, macho, malla, mermelada, morriña, nonio, pintada, vaivén, vergoña. Les vocables d'origine probable (et souvent sûre sont les exotiques, lesquels, dans l'opinion de Sá Nogueira, citée plus haut, ont pénétré dans l'espagnol à travers le portugais. Cet auteur en étudie les suivants: abada, albino, almadía, ananás, bambu, banana, bengala, betel, biombo, bonzo, cacatúa, cachimbo, cacimba, cafre, carcunda, carimbo, catinga, cha, coco, cobra, cornaca, fetiche, jangada, junco, macaco, malagueta, mandarín, mandinga, mandioca, manga, marimba, monzón, naire, pagoda et palanquín. Il est certain qu'ils sont beaucoup plus nombreux, ainsi que l'on s'en rend compte par les ouvrages de Monseigneur Sebastião Rodolfo Dalgado et Georg Friederici. Quant au mot chapéu, dit le Prof. Sá Nogueira, il est difficile de garantir si l'espagnol l'a reçu du portugais, ou si le contraire a eu lieu, et c'est également compliqué le problème du mot castillan jeito, à acception differénte de la nôtre, raison pour
Linear quadratic regulator design for an unpowered, winged re-entry vehicle
Mooij, E.
1998-01-01
This report describes the design of an attitude controller for an unpowered, winged re-entry vehicle. The decoupling of the symmetric and asymmetric motion makes it possible to design two separate controllers, one for the pitch mot ion and one for the lateral motion. The design of the controller, a
Original Paper Inventaire et essais phytochimiques sur quelques ...
African Journals Online (AJOL)
astrid
2017 International Formulae Group. All rights reserved. Mots clés : Plantes médicinales, goutte, phytochimie, Tchad. Inventory and phytochemical screening of some plants used in Chad for the treatment of gout. ABSTRACT. The practice of herbal medicine is a worldwide custom that preoccupied mankind in the evolution of.
2006-01-01
In the Netherlands, all vehicles using public roads must meet so-called permanent requirements. This is enforced by the police and, for some categories, also during the MOT. In the Netherlands, most types of motor vehicle1 can only be introduced to the market if they meet the entry requirements. For
TRANSIENT EXPRESSION OF β-GLUCURONIDASE IN ...
African Journals Online (AJOL)
ACSS
2014-08-28
Aug 28, 2014 ... production des cultivars de résistance adaptée aux charançons de la patate douce. Mots Clés: Agrobacterium tumefaciens, β-glucuronidase, Ipomoea batatas. INTRODUCTION. Plant transformation through Agrobacterium species is the most commonly used system since the transferred DNA has minimal ...
Évolution qualitative et quantitative des composantes de l'œuf ...
African Journals Online (AJOL)
SARAH
28 févr. 2014 ... contrôle de coquille et de calibre dans les fermes. Mots clés : œuf, pondeuse, ... dynamique qualitative des composantes de l'œuf . Certains auteurs ont ... programme de conduite et de gestion d'élevage. Élevées en bande ...
La politique intellectuelle de Mvemba N'zinga (Dom Afonso 1er ...
African Journals Online (AJOL)
Le Kongo venait de rater un grand rendez-vous avec l'histoire. Mots-Clés: enseignement; élite intellectuelle; Bakongo; Mvemba N'zinga; Mbanza Kongo; Lisbonne; Mani Kongo Summary Taking advantage of the opportunities that he offered to the Portuguese monarch - consignment of missionaries, study of the young " ...
Etude numérique de la convection naturelle dans une enceinte ...
African Journals Online (AJOL)
Mots-clés: convection naturelle, chaos, méthode de Lattice Boltzmann, methode des différences finies. Numerical Study of natural convection in an inclined enclosure. Lattice Boltzmann Method (LBM ) , Finite Difference Explicit ( DFE ) , Hybrid combines the two previous methods and Finite Elements (FE) are used to study ...
Influence de l'activité des termites sur les propriétés du sol dans la ...
African Journals Online (AJOL)
SARAH
30 sept. 2016 ... Mots Clés : Fertilité, sol dégradé, termites, infiltration de l'eau, matière organique, Lamto, Côte d'Ivoire. ABSTRACT ... des cultures et à la bonne production agricole se ..... et un début de dégradation chimique, biologique et.
Algorithmic Issues in Modeling Motion
DEFF Research Database (Denmark)
Agarwal, P. K; Guibas, L. J; Edelsbrunner, H.
2003-01-01
This article is a survey of research areas in which motion plays a pivotal role. The aim of the article is to review current approaches to modeling motion together with related data structures and algorithms, and to summarize the challenges that lie ahead in producing a more unified theory of mot...
Page 1 Rev. Sci. Technol., Synthese 26: 57 - 64 (2013) D. Ali ...
African Journals Online (AJOL)
Une augmentation de la teneur en proline est observee dans les plantes traitees ou non par !'hormone la kinetine. Mots cles: ... hormone in plants under stress induced a proportional increase in chlorophyll (a) and (b) with the concentration of used salt. ..... grains and vegetables, Agronomy Journal, Vol. 66,. 412-421.
African Journals Online (AJOL)
Items 1 - 50 of 167 ... Vol 1, No 1 (2010), Agricultural Marketing Cooperatives in Developing Society in Relation to Poverty Alleviation and Sustainable Development: The Case of Lesotho, Abstract. MMM Daemane, KA Mot'soene, VZ Nyawo-Shava. Vol 8, No 1 (2017), An alternative approach to financing development in Africa ...
Les obstacles a l'action des ong Au Togo | Gbemouk | Journal de la ...
African Journals Online (AJOL)
Mots clés : Action, autonomie, dynamique, Obstacle, ONG, participation. Hurdles to the NGOs' activities in Togo. NGOs play a key role - by the government's side - in the fight against poverty. In many areas, they are working towards the improved living conditions of local populations. But their effort encounters many ...
African Journals Online (AJOL)
19 déc. 2007 ... té au type histologique permet d'améliorer la survie et la qualité de vie chez les patients atteints de ces tumeurs. Mots-clés ... management of these tumors. Materials ... La durée moyenne d'évolution de la symptomatologie.
Déchets solides encombrants les plages d'Annaba Rabah Chaouch ...
African Journals Online (AJOL)
Les rejets des déchets solides sur nos plages constituent une véritable plaie qui dégrade la beauté des paysages. ... Mots clés : environnement; déchets solides; gestion; littoral; santé. Abstract ..... déchets soldes et liquides apportés par les ...
Motivation Monitoring and Assessment Extension for Input-Process-Outcome Game Model
Ghergulescu, Ioana; Muntean, Cristina Hava
2014-01-01
This article proposes a Motivation Assessment-oriented Input-Process-Outcome Game Model (MotIPO), which extends the Input-Process-Outcome game model with game-centred and player-centred motivation assessments performed right from the beginning of the game-play. A feasibility case-study involving 67 participants playing an educational game and…
Etude des proprietes antioxydantes d'un extrait d'ecorces d ...
African Journals Online (AJOL)
acide ascorbique. Ces résultats suggèrent une activité ... Ces résultats peuvent constituer un apport réel dans la recherche de molécules bioactives, pouvant prévenir ou traiter des pathologies liées au stress oxydatifs. Mots clés : Anacardium ...
Intérêt pronostique de l'infiltration du chorion dans les tumeurs ...
African Journals Online (AJOL)
W. Zakhama
Disponible sur Internet le 27 octobre 2016. MOTS CLÉS tumeur vésicale; survie; .... ont eu une récidive précoce (inférieur à 6 mois). La récidive n'était ... recherche de nouvelles sous classification dans le but de trouver de nouveaux facteurs ...
Caracteristiques des malnutris aigus severes decedes en milieu ...
African Journals Online (AJOL)
Mots clés: audit, enfant, malnutrition, mortalité, Côte d'Ivoire. English Title: Characteristics of people suffering from acute and severe malnutrition, deceased in a hospital environment in Abidjan (Republic of Cote d'Ivoire). English Abstract. Introduction: The infant and juvenile mortality linked to acute malnutrition remains high ...
Infections du site Operatoire en Chirurgie Orthopedique ...
African Journals Online (AJOL)
Mots clés: Infection site opératoire chirurgie orthopédique. English Title: Infections of the operative site in orthopedic surgery: clinical presentations, etiologies and management. English Abstract. Introduction: In orthopedic surgery, wound site infections constitute a difficult situation to the surgeon; and for the patient. The aim ...
1959-IJBCS-Article-Diarrassoubo Nafan
African Journals Online (AJOL)
hp
... un système d'exploitation agricole à base de coton dans le département de Sinématiali – Côte d'Ivoire ... Mots clés : Systèmes de culture, coton, vivriers, marge brute, Côte d'Ivoire. ..... La prise en compte de toutes ces recommandations.
African Journals Online (AJOL)
cation thérapeutique doit être bien étudiée. Mots-clés : hyperparathyroïdie primaire, adénome, glande parathyroïde, parathormone, scintigraphie, parathyroïdectomie. SUMMARY. Objective : Primary hyperparathyroidism (PhPT) is defined as excessive and inappropriate production of parathormone (PTh). Asymptomatic and ...
Cooling and trapping of neutral mercury atoms; Kuehlen und Fangen von neutralen Hg-Atomen
Energy Technology Data Exchange (ETDEWEB)
Villwock, Patrick
2010-01-15
Mercury offers numerous opportunities for experiments in cold atomic and molecular physics. Due to the particular energy level structure of the Hg-dimer it should be possible to efficiently populate the rovibrational ground state by employing a particular absorption-emission scheme after the dimers have been formed via photo association. Cold {sup 199}Hg-atoms in the ground state are very well suited for testing the Bell equations with atoms, because they are ideal spin-1/2-particles. Hg-dimers would be optimal for the search of a permanent electrical dipole moment, due to their mass. An optical lattice clock based on neutral mercury atoms using the {sup 1}S{sub 0}-{sup 3}P{sub 0} clock transition at 265.6 nm with a natural linewidth of about 100 mHz is predicted to reach an accuracy better than 10{sup -18}. The frequency ratio of two optical clocks exhibits the opportunity to test the temporal variation of the fine-structure constant. Laser-cooled neutral Hg-atoms in a magneto-optical trap (MOT) represent a high quality source for a focused ion beam. The isotope selectivity of a MOT offers the potential of producing pure Hg-Isotopes. Mercury has two stable fermionic and five stable bosonic isotopes. The {sup 1}S{sub 0}-{sup 3}P{sub 1} intercombination line at 253.7 nm has a saturation intensity of 10.2 {sup mW}/{sub cm{sup 2}}, with a natural linewidth of 1.27 MHz. This cooling transition is closed since the ground state is free of fine- and hyperfine structure. Consequently no additional repumping is required. Due to the relatively long lifetime of this trapping transition the Doppler limited temperature is 30 μK. This thesis presents the development and experimental setup of a magneto-optical trap for neutral mercury atoms. This undertaking required the development of a commercially unavailable laser source in order to cool and trap Hg-atoms. The cooling transition sets high demands on such a cutting-edge laser, due to its relatively high saturation intensity
Czech Academy of Sciences Publication Activity Database
Valterová, Irena; Kalinová, Blanka; Kindl, Jiří
2016-01-01
Roč. 95, č. 9 (2016), s. 506-507 ISSN 0042-4544 R&D Projects: GA MŠk LD15102 Institutional support: RVO:61388963 Keywords : wax moths * ultrasound communication * courtship behaviour Subject RIV: EG - Zoology
Perception of gamma radiation by adults of Sitophilus zeamais mots
International Nuclear Information System (INIS)
Wiendl, F.M.; Walder, J.M.M.
1975-05-01
Perception of gamma radiation by living organisms has been evidenced only a few times. The occurence of such perception with maize weevil, Sitophilus zeamais Motschulsky is presented. Tubes containing maize weevil were placed in a radial position to a gamma source. Counting of the insects inside the tubes at different distances from the source was made immediately after irradiation. It was noticed that the insects submitted to irradiation had been driven away from the source as compared with those not submitted (control). A possible relationship exists between this effect and the Cerenkov effect which affects directly the visual organs of the insect. This is probably due to the fact that the insects have a large quantity of water in the occular cells
Consistency of eye movements in MOT using horizontally flipped trials
Czech Academy of Sciences Publication Activity Database
Děchtěrenko, F.; Lukavský, Jiří
2013-01-01
Roč. 42, Suppl (2013), s. 42-42 ISSN 0301-0066. [36th European Conference on Visual Perception. 25.08.2013.-29.08.2013, Brémy] R&D Projects: GA ČR GA13-28709S Institutional support: RVO:68081740 Keywords : eye movements * symmetry * consistency Subject RIV: AN - Psychology http://www.ecvp.uni-bremen.de/~ecvpprog/abstract164.html
Valuable cure for cold plugs; Verdifull kur mot kalde plugger
Energy Technology Data Exchange (ETDEWEB)
Toenseth, Svein
2010-07-01
Direct electric pipeline heating (DEH) has replaced the 'anti-freeze' when cold constipation should be prevented in the oil's 'veins' on the seabed. It has saved billions for Statoil. (AG)
Campylobacter jejuni motility is required for infection of the flagellotropic bacteriophage F341
DEFF Research Database (Denmark)
Baldvinsson, Signe Berg; Sørensen, Martine Camilla Holst; Vegge, Christina Skovgaard
2014-01-01
. In contrast, phage F341 does not infect C. jejuni NCTC11168 mutants that either lack the flagellar filaments (ΔflaAB) or that have paralyzed, i.e., nonrotating, flagella (ΔmotA and ΔflgP). Complementing flgP confirmed that phage F341 requires rotating flagella for successful infection. Furthermore, adsorption...
Caractérisation Physico-Chimique de l'Amande d'Hybride de ...
African Journals Online (AJOL)
utilisée en biscuiterie, pâtisserie et savonnerie comme le PB 121 ordinaire. Mots clés: Cocotier, hybride, vitroculture, amande, caractéristique. Abstract. Chemical and physical characterization of kernel from coconut hybrid PB 121 (Cocos nucifera L.) regenerated by in vitro culture at different storage duration and mature ...
African Journals Online (AJOL)
AKA BOKO
Mots-clés : zones volcaniques de Madagascar, minéraux, fertilisant. Abstract. Characterization chemical physico of the volcanic products of Madagascar for its agricultural use. The volcanic zones are reputed to be fertile and have a big agricultural potentiality. Of this fact, a lot of people use the volcanic soils as fertilizing.
Laboratory evaluation of four medicinal plants as protectants against ...
African Journals Online (AJOL)
The petroleum ether extract of four medicinal plants; Aristolochia ringens (Vahl), Allium sativum (L), Ficus exasperata (L) and Garcinia kola (H), were evaluated as grain protectant against the maize weevil, Sitophilus zeamais (Mots) in the laboratory at 0.5, 1.0 and 1.5% (w/v) concentrations. Parameters assessed were adult ...
A comparison of spontaneous combustion susceptibility of coal from ...
African Journals Online (AJOL)
Although the CPT of Onyeama coal and Owukpa coal is identical to each other as they are the sub-bituminous, Owukpa coal has a lower initial oxidation temperature (IOT) and maximum oxidation temperature (MOT) than those of Onyeama coal. This means that although each coal has the same rank and CPT, spontaneous ...
Étude ethnobotanique, phytochimique et écotoxicologique de ...
African Journals Online (AJOL)
... Plante Médicinale a caractère de Légumes feuilles, gage de bonne santé et de Développement Durable. Mots clés: Ocimum gratissimum ; Légume feuille ; Plante médicinale ; Ethnobotanique ; Cotonou ; Bénin. English Abstract. Objective: The use of Ocimum gratissimum Lamiaceae (African Basil) is widespread in Benin.
Holoprosencéphalie alobaire avec diabète insipide et hypothyroïdie ...
African Journals Online (AJOL)
... déceler un diabète insipide central et une hypothyroïdie centrale probablement d'origine hypothalamique. Mots clés: Holoprosencéphalie alobaire, nourrisson, diabète insipide, hypothyroïdie centrale. English Title: Alobar holoprosencephaly associated with diabetes insipidus and hypothyroidism in a 10-month old infant.
Responsabilite societale des entreprises et groupes de societes ...
African Journals Online (AJOL)
Mots clés: Responsabilité Sociétale des Groupes de Sociétés ; développement durable ; protection. English Title: Social responsibility of companies and groups of companies. English Abstract. The social responsibility (CSR) corporate social is the contribution of business to sustainable development issues. The approach is ...
Biodisponibilité et mobilité du phosphore des sédiments de la ...
African Journals Online (AJOL)
Mots clés: Biodisponibilité, mobilité, relargage, fractionnement, extraction séquentielle. English Title: Bioavailability and mobility of phosphorus in the sediments of the Porto-Novo Lagoon. English Abstract. Phosphorus sources in the Porto-Novo lagoon (50 km2 of area, located in southeast Benin) are of two types: diffuse ...
Representation sociale de l'hygiene chez les populations riveraines ...
African Journals Online (AJOL)
Mots clés: Représentation sociale, hygiène, populations riveraines, décharge, environnement, pollution. English Title: Social representation of hygiene in the populations living in the vicinity of Akouedo-Cocody dump (Abidjan-Ivory Coast). English Abstract. Landfills are generally the common option for the final deposit of ...
Bases génétiques et biochimiques de la capacité germinative des ...
African Journals Online (AJOL)
recherche et discute de la relation entre capacité germinative des graines et sécurité alimentaire. Mots clé: Semence, capacité germinative, facteurs biochimiques, gènes, systèmes semenciers, sécurité alimentaire. Abstract. Genetic and biochemical bases of seed germination capacity: implications for seed systems and.
La gestion des rapatriés de Libye dans la commune de ...
African Journals Online (AJOL)
25 juin 2015 ... Mots clés : Tchintabaraden, risque sécuritaire, migration de retour .... Comité international de la croix rouge (CICR), le Programme alimentaire ..... poursuivent malgré la fermeture des maisons d'accueil des migrants à .... Bredeloup, S., Pliez Olivier, 2005, « Migrations entre les deux rives du Sahara »,.
Indian Academy of Sciences (India)
No mutarotation The solution turned deep pyridine and chloroform red on keeping, hence turned Scarlet red imme-. Cd and Ag lines could diately, the readings were mot be read. taken with much diffi- culty. The change in benzene is so rapid that readings could not be taken. TABLE V p-Amino anilinomethylenecamphors.
La libéralisation comme source du dérèglement des transports ...
African Journals Online (AJOL)
Mots clés: Libéralisation - Transport public - Chronologie - Urbain - Organisation. English Title: Liberalization as a source of deregulation of public transport in Annaba city. English Abstract. Similarly at almost of the Algerian cities, after the dissolution of the Municipal Board RMCA, the city of Annaba doesn't escape from the ...
Modelisation du stock de biomasse et dynamique de sequestration ...
African Journals Online (AJOL)
Mots clés: Jatropha curcas, séquestration, carbone, Bénin, Afrique de l'Ouest. English Title: Biomass stock modeling and dynamics of mineral and carbon sequestration of Jatropha curcas L. under different soil types in Benin. English Abstract. In West Africa, carbon sequestration function of Jatropha curcas shrubs and their ...
Janssen, Maarten; Visser, A.
In many disciplines, the notion of a word is of central importance. For instance, morphology studies le mot comme tel, pris isol´ement (Mel’ˇcuk, 1993 [74]). In the philosophy of language the word was often considered to be the primary bearer of meaning. Lexicography has as its fundamental role
High densities and optical collisions in a two-colour magneto-optical trap for metastable helium
Koelemeij, J.C.J.; Tychkov, A.; Jeltes, T.; Hogervorst, W.; Vassen, W.
2004-01-01
We have studied a cloud of cold metastable helium (He*) atoms interacting with near-resonant light at 1083 nm and 389 nm. The 1083 nm light allows for efficient loading of a large magneto-optical trap (MOT) and the 389 nm light is subsequently used to increase the density and reduce the temperature
Directory of Open Access Journals (Sweden)
Sharmistha Mishra
Full Text Available To design HIV prevention programmes, it is critical to understand the temporal and geographic aspects of the local epidemic and to address the key behaviours that drive HIV transmission. Two methods have been developed to appraise HIV epidemics and guide prevention strategies. The numerical proxy method classifies epidemics based on current HIV prevalence thresholds. The Modes of Transmission (MOT model estimates the distribution of incidence over one year among risk-groups. Both methods focus on the current state of an epidemic and provide short-term metrics which may not capture the epidemiologic drivers. Through a detailed analysis of country and sub-national data, we explore the limitations of the two traditional methods and propose an alternative approach.We compared outputs of the traditional methods in five countries for which results were published, and applied the numeric and MOT model to India and six districts within India. We discovered three limitations of the current methods for epidemic appraisal: (1 their results failed to identify the key behaviours that drive the epidemic; (2 they were difficult to apply to local epidemics with heterogeneity across district-level administrative units; and (3 the MOT model was highly sensitive to input parameters, many of which required extraction from non-regional sources. We developed an alternative decision-tree framework for HIV epidemic appraisals, based on a qualitative understanding of epidemiologic drivers, and demonstrated its applicability in India. The alternative framework offered a logical algorithm to characterize epidemics; it required minimal but key data.Traditional appraisals that utilize the distribution of prevalent and incident HIV infections in the short-term could misguide prevention priorities and potentially impede efforts to halt the trajectory of the HIV epidemic. An approach that characterizes local transmission dynamics provides a potentially more effective tool with
Directory of Open Access Journals (Sweden)
Lisa Gorski
Full Text Available The role of flagella and motility in the attachment of the foodborne pathogen Listeria monocytogenes to various surfaces is mixed with some systems requiring flagella for an interaction and others needing only motility for cells to get to the surface. In nature this bacterium is a saprophyte and contaminated produce is an avenue for infection. Previous studies have documented the ability of this organism to attach to and colonize plant tissue. Motility mutants were generated in three wild type strains of L. monocytogenes by deleting either flaA, the gene encoding flagellin, or motAB, genes encoding part of the flagellar motor, and tested for both the ability to colonize sprouts and for the fitness of that colonization. The motAB mutants were not affected in the colonization of alfalfa, radish, and broccoli sprouts; however, some of the flaA mutants showed reduced colonization ability. The best colonizing wild type strain was reduced in colonization on all three sprout types as a result of a flaA deletion. A mutant in another background was only affected on alfalfa. The third, a poor alfalfa colonizer was not affected in colonization ability by any of the deletions. Fitness of colonization was measured in experiments of competition between mixtures of mutant and parent strains on sprouts. Here the flaA and motAB mutants of the three strain backgrounds were impaired in fitness of colonization of alfalfa and radish sprouts, and one strain background showed reduced fitness of both mutant types on broccoli sprouts. Together these data indicate a role for flagella for some strains to physically colonize some plants, while the fitness of that colonization is positively affected by motility in almost all cases.
Interactions variations climatiques – insectes ravageurs et ...
African Journals Online (AJOL)
... calamistis et de E. saccharina. De plus l'analyse de la perception des agriculteurs indique l'apparition de «nouveaux» ravageurs tels que les termites, le criquet puant Zonocerus variegatus et une recrudescence des ravageurs de stock. Mots clés: Changements climatiques, Sesamia calamistis, maïs, générations, termites.
Maladie de kimura: À propos d'un cas | Dib | Journal Tunisien d'ORL ...
African Journals Online (AJOL)
Introduction : Mots-clés : Maladie de Kimura, parotide, chirurgie.La maladie de Kimura ou lymphogranulome éosinophile est une pathologie inflammatoire chronique très rare, d'étiologie inconnue. Nous rapportons un cas de maladie de Kimura à localisation parotidienne et à travers une revue de la littérature, rappelons les ...
A Case of Appendicular Tuberculosis mimicking an Acute Appendicitis
African Journals Online (AJOL)
Les auteurs rapportent un cas rare de tuberculose de siège apendiculaire mimant un tableau d'appendicite aigue. La littérature sur cette question est revisée. Mots clés : tuberculose, appendice. The author report a rare case of appendiceal tuberculosis clinically presenting as acute appendicitis. The litterature is reviewed.
pluviosite en region soudano-sahelienne au nord du cameroun
African Journals Online (AJOL)
AISA
Dans le but de montrer qu'en zone soudano-sahélienne du Nord du ... principaux facteurs responsables de la variation des rendements en culture pluviale, une étude basée sur ... Mots clés : Risque climatique, pluviométrie, variation, rendement agricole, Nord Cameroun. ... d'analyse plus global et fonctionnel, à savoir,.
Slik bør du trene hvis du har høyt blodtrykk
DEFF Research Database (Denmark)
Bjørkelund, Oline Anita
2016-01-01
Svært mange nordmenn lever med lavt eller høyt blodtrykk. Sistnevnte er et utbredt helseproblem i Norge, og Nasjonalforeningen for folkehelsen opplyser at over 100 000 nordmenn bruker medisiner mot det. Høyt blodtrykk er jo ingen sykdom i seg selv, men det krever at man må tenke gjennom vaner og ...
The motivational landscape of first-person shooter games
Finnerman, T. (Tomi); Kuoppala, A. (Antti)
2014-01-01
Abstract The purpose of this research was to gain better understanding of the motivations to play video games, particularly first-person shooter games. The aim was therefore to produce a motivational landscape that describes and categorizes the main motivations to play first-person shooter games (FPS). The study tries to expand the understanding of mot...
African Journals Online (AJOL)
abp
4 déc. 2017 ... &Corresponding author: Meriem Elbachiri, Centre Mohamed VI pour le Traitement Des Cancers, Casablanca, Maroc. Mots clés: Homme, cancer du ... Abstract. Breast cancer in men is rare, accounting for approximately 1% of all breast cancers and less than 1% of all neoplasias in men. This study aimed to.
Exécution de penalties et de tirs au but au football : maîtrise ...
African Journals Online (AJOL)
Mots clés : Penalty, émotion, habileté technique, tireur, gardien de but. English Abstract Football games sometimes end by penalty shoot-out sessions. During these faces to faces between penalty takers and goalkeepers each of the protagonists attempts to guess the intentions of the other to defeat him and win the duel.
African Journals Online (AJOL)
hp
3 Silviculture Division, Forest Research Institute, New Forest, Dehradun, Uttarakhand 248006, India. 4 ISRA/CRZ BP 53 Kolda, ... des parties racinaires évalués à la fin de l'expérience varient en fonction du niveau du stress salin. Les deux ... Mots clés : Stress salin, croissance, biomasse, Jatropha curcas L., provenances.
Wansleeben, C.; van Gurp, L.; de Graaf, P.; Mousson, F.; Timmers, H.T.; Meijlink, F.
2011-01-01
The mouse Btaf1 gene, an ortholog of yeast MOT1, encodes a highly conserved general transcription factor. The function of this SNF2-like ATPase has been studied mainly in yeast and human cells, which has revealed that it binds directly to TBP, forming the B-TFIID complex. This complex binds to core
102-IJBCS-Article-Dr Coulibaly
African Journals Online (AJOL)
RHUMSIKI
Mot-clés: Poisson, longueur-poids, pêcherie continentale, rivière Sourou, Burkina Faso. INTRODUCTION. Chez les poissons, la croissance se manifeste par des variations de poids et de longueur et il existe par ailleurs une relation étroite entre ces deux variables (Le Cren,. 1951 ; Baijot et al., 1994 ; Pauly et Moreau,.
facteurs predictifs d'atteinte ganglionnaire centrale dans les cancers
African Journals Online (AJOL)
9 mai 2013 ... laire, l'envahissement ganglionnaire latéral, la bilatéralité et l'envahissement ganglionnaire central. un évidemment gan- glionnaire central prophylactique doit donc être particulièrement considéré chez ces patients. Mots clés : carcinome thyroïdien, évidement ganglionnaire, métastase ganglionnaire.
African Journals Online (AJOL)
boaz
Methods: A randomized open label study with participants allocated into three ... La division des Sciences Clinique et Laboratoire de Virologie Humaine, l'Institut nigérian de Recherche Médicale, ... Mots clés : La co - infection VIH/HBV, complément de Sélénium, HAART. .... monitor version 1.5 (Roche Diagnostic Systems,.
537-IJBCS-Article-Pr Leonard Simon Tinkeu Ngamo
African Journals Online (AJOL)
DR GATSING
de Tephritidae qui ont émergé des mangues mûres ramassées sous les arbres appartiennent à deux espèces. B. invadens (98,5%) et ... Mots clés: Mouches des fruits, Mangifera indica, Bactrocera invadens, Dacus punctatifrons, Cameroun,. Adamaoua, dynamique ... diversifié leur production de cultures non traditionnelles ...
Effect of Intraoperative Mitomycin C on the Re-currence rate of ...
African Journals Online (AJOL)
... effectif dans les cas recurrents. L'utilisation intra-operative du mitomycin C est fortement recommend après excision du pterygium du type primaire chez les Nigerian pour reduire le taux de recurrence. Mot clés: Pterygium, recurrence, mitomycin. West African Jnl of Pharmacology and Drug Research Vol.18 2002: 17-20 ...
1 Commande multivariable du moteur asynchrone triphasé à cage ...
African Journals Online (AJOL)
AKA BOKO
Correspondance, courriel : rabenarivo.michel@yahoo.fr. Résumé. La commande du moteur asynchrone triphasé à ... synthèse du système à l'aide du logiciel MATLAB. Mots-clés : commande, système multivariable, variation de ... of the system by MATLAB software. Keywords : control, MIMO system, frequency variation, ...
Plantes médicinales utilisées dans le traitement traditionnel du ...
African Journals Online (AJOL)
Les résultats de cette étude pourront ainsi contribuer à la connaissance exhaustive des plantes à visée antipaludique et à une valorisation de la médecine traditionnelle Malienne. © 2016 International Formulae Group. All rights reserved. Mots clés: Paludisme, plantes médicinales, ethnobotanique, Bamako. English Title: ...
African Journals Online (AJOL)
Winnie
Mots clés: CDV,VIH, genre. Kennedy Otwombe is currently a PhD student in statistics at the University of the Witwatersrand with an interest in the application of statistics in health research. His current interest is in monitoring and evaluation of HIV related studies and the analysis of incomplete data in longitudinal studies.
Pratiques Matrimoniales Et Transmission Mere-Enfant Du Vih Au Togo
African Journals Online (AJOL)
Mots clés : Pratiques matrimoniales, transmission mère-enfant, VIH, Togo. Purpose: To study the influence of customs and marriage practices on the mode of sexual transmission and mother-to-child transmission of HIV/AIDS in Togo, to make suggestions to the location of populations and public authorities to avoid customs ...
African Journals Online (AJOL)
abp
29 avr. 2016 ... Mots clés: Accident vasculaire cérébrale, doppler transcrânien, drépanocytose, enfant. Received: 17/05/2015 - Accepted: 07/03/2016 - Published: ... original work is properly cited. Pan African Medical Journal – ISSN: 1937- 8688 ..... Aracaju, Northeast-Brazil. Arq Neuropsiquiatr. 2008 Jun; 66(2):. 360-4.
Composition chimique de l'huile essentielle de Satureja calamintha ...
African Journals Online (AJOL)
Ce travail vise l'étude de la composition chimique de l'huile essentielle de Satureja calamintha (L.) Scheele du Maroc. Les constituants chimiques principaux de cette huile essentielle sont borneol (34.52%), αcampholenic aldehyde (14.26%), cedren-13-ol (6.45%), et manoyloxide (3.78%). Mots-clés : huile essentielle, ...
Caractérisation bactériologique des eaux résiduaires brutes de la ...
African Journals Online (AJOL)
SARAH
4 févr. 2014 ... Objectif : La présente étude vise à évaluer la pollution fécale des eaux usées de Cotonou, ville la plus peuplée du Bénin. ... Mots-clés: pollution fécale, eaux résiduaires, collecteurs, Cotonou. ..... Dunod : Paris. 1384 pp.
Liu, Yang
2013-07-01
The computational complexity and memory requirements of multilevel plane wave time domain (PWTD)-accelerated marching-on-in-time (MOT)-based surface integral equation (SIE) solvers scale as O(NtNs(log 2)Ns) and O(Ns 1.5); here N t and Ns denote numbers of temporal and spatial basis functions discretizing the current [Shanker et al., IEEE Trans. Antennas Propag., 51, 628-641, 2003]. In the past, serial versions of these solvers have been successfully applied to the analysis of scattering from perfect electrically conducting as well as homogeneous penetrable targets involving up to Ns ≈ 0.5 × 106 and Nt ≈ 10 3. To solve larger problems, parallel PWTD-enhanced MOT solvers are called for. Even though a simple parallelization strategy was demonstrated in the context of electromagnetic compatibility analysis [M. Lu et al., in Proc. IEEE Int. Symp. AP-S, 4, 4212-4215, 2004], by and large, progress in this area has been slow. The lack of progress can be attributed wholesale to difficulties associated with the construction of a scalable PWTD kernel. © 2013 IEEE.
Exact extreme-value statistics at mixed-order transitions.
Bar, Amir; Majumdar, Satya N; Schehr, Grégory; Mukamel, David
2016-05-01
We study extreme-value statistics for spatially extended models exhibiting mixed-order phase transitions (MOT). These are phase transitions that exhibit features common to both first-order (discontinuity of the order parameter) and second-order (diverging correlation length) transitions. We consider here the truncated inverse distance squared Ising model, which is a prototypical model exhibiting MOT, and study analytically the extreme-value statistics of the domain lengths The lengths of the domains are identically distributed random variables except for the global constraint that their sum equals the total system size L. In addition, the number of such domains is also a fluctuating variable, and not fixed. In the paramagnetic phase, we show that the distribution of the largest domain length l_{max} converges, in the large L limit, to a Gumbel distribution. However, at the critical point (for a certain range of parameters) and in the ferromagnetic phase, we show that the fluctuations of l_{max} are governed by novel distributions, which we compute exactly. Our main analytical results are verified by numerical simulations.
Feki, Saber
2013-07-01
An explicit marching-on-in-time (MOT)-based time-domain volume integral equation (TDVIE) solver has recently been developed for characterizing transient electromagnetic wave interactions on arbitrarily shaped dielectric bodies (A. Al-Jarro et al., IEEE Trans. Antennas Propag., vol. 60, no. 11, 2012). The solver discretizes the spatio-temporal convolutions of the source fields with the background medium\\'s Green function using nodal discretization in space and linear interpolation in time. The Green tensor, which involves second order spatial and temporal derivatives, is computed using finite differences on the temporal and spatial grid. A predictor-corrector algorithm is used to maintain the stability of the MOT scheme. The simplicity of the discretization scheme permits the computation of the discretized spatio-temporal convolutions on the fly during time marching; no \\'interaction\\' matrices are pre-computed or stored resulting in a memory efficient scheme. As a result, most often the applicability of this solver to the characterization of wave interactions on electrically large structures is limited by the computation time but not the memory. © 2013 IEEE.
Theoretical Technology Research for the International Solar Terrestrial Physics (ISTP) Program
Ashour-Abdalla, Maha; Curtis, Steve (Technical Monitor)
2002-01-01
During the last four years the UCLA (University of California, Los Angeles) IGPP (Institute of Geophysics and Planetary Physics) Space Plasma Simulation Group has continued its theoretical effort to develop a Mission Oriented Theory (MOT) for the International Solar Terrestrial Physics (ISTP) program. This effort has been based on a combination of approaches: analytical theory, large-scale kinetic (LSK) calculations, global magnetohydrodynamic (MHD) simulations and self-consistent plasma kinetic (SCK) simulations. These models have been used to formulate a global interpretation of local measurements made by the ISTP spacecraft. The regions of applications of the MOT cover most of the magnetosphere: solar wind, low- and high- latitude magnetospheric boundary, near-Earth and distant magnetotail, and auroral region. Most recent investigations include: plasma processes in the electron foreshock, response of the magnetospheric cusp, particle entry in the magnetosphere, sources of observed distribution functions in the magnetotail, transport of oxygen ions, self-consistent evolution of the magnetotail, substorm studies, effects of explosive reconnection, and auroral acceleration simulations. A complete list of the activities completed under the grant follow.
A Compact, High-Flux Cold Atom Beam Source
Kellogg, James R.; Kohel, James M.; Thompson, Robert J.; Aveline, David C.; Yu, Nan; Schlippert, Dennis
2012-01-01
The performance of cold atom experiments relying on three-dimensional magneto-optical trap techniques can be greatly enhanced by employing a highflux cold atom beam to obtain high atom loading rates while maintaining low background pressures in the UHV MOT (ultra-high vacuum magneto-optical trap) regions. Several techniques exist for generating slow beams of cold atoms. However, one of the technically simplest approaches is a two-dimensional (2D) MOT. Such an atom source typically employs at least two orthogonal trapping beams, plus an additional longitudinal "push" beam to yield maximum atomic flux. A 2D atom source was created with angled trapping collimators that not only traps atoms in two orthogonal directions, but also provides a longitudinal pushing component that eliminates the need for an additional push beam. This development reduces the overall package size, which in turn, makes the 2D trap simpler, and requires less total optical power. The atom source is more compact than a previously published effort, and has greater than an order of magnitude improved loading performance.
Xing, Junliang; Ai, Haizhou; Liu, Liwei; Lao, Shihong
2011-06-01
Multiple object tracking (MOT) is a very challenging task yet of fundamental importance for many practical applications. In this paper, we focus on the problem of tracking multiple players in sports video which is even more difficult due to the abrupt movements of players and their complex interactions. To handle the difficulties in this problem, we present a new MOT algorithm which contributes both in the observation modeling level and in the tracking strategy level. For the observation modeling, we develop a progressive observation modeling process that is able to provide strong tracking observations and greatly facilitate the tracking task. For the tracking strategy, we propose a dual-mode two-way Bayesian inference approach which dynamically switches between an offline general model and an online dedicated model to deal with single isolated object tracking and multiple occluded object tracking integrally by forward filtering and backward smoothing. Extensive experiments on different kinds of sports videos, including football, basketball, as well as hockey, demonstrate the effectiveness and efficiency of the proposed method.
Hosogi, Naoki; Shigematsu, Hideki; Terashima, Hiroyuki; Homma, Michio; Nagayama, Kuniaki
2011-01-01
Vibrio alginolyticus use flagella to swim. A flagellum consists of a filament, hook and basal body. The basal body is made up of a rod and several ring structures. This study investigates the structure of the T ring which is a unique component of the V. alginolyticus sodium ion-driven flagellar basal body. Using Zernike phase contrast (ZPC) cryo-electron tomography, we compared the 3D structures of purified hook-basal bodies (HBB) from a wild-type strain (KK148) and a deletion mutant lacking MotX and MotY (TH3), which are thought to form the T ring. ZPC images of HBBs had highly improved signal-to-noise ratio compared to conventional phase contrast images. We observed the outline of the HBBs from strains KK148 and TH3, and the TH3 mutant was missing its T ring. In the wild-type strain, the T ring was beneath the LP ring and seemed to form a ring shape with diameter of 32 nm. Copyright © 2010 Elsevier Inc. All rights reserved.
RELATIONSHIP BETWEEN LEVEL OF COPPER IN BOVINE SEMINAL PLASMA AND SPERMATOZOA MOTILITY
Directory of Open Access Journals (Sweden)
Zuzana Kňažická
2013-02-01
Full Text Available The aim of this study was to evaluate relationship between copper (Cu concentration of bovine seminal plasma and spermatozoa motility. Semen samples were collected from 13 breeding bulls. The motility analysis was carried out using the Computer Assisted Sperm Analysis (CASA system. The mean value for the percentage of motile spermatozoa (MOT was 92.46±3.99% and the progressive motility of the spermatozoa (PROG as 90.23±4.02%. The seminal plasma Cu concentrations were analyzed by UV/VIS spectrophotometry. The total Cu concentration of the seminal plasma was 4.28±1.47 μM/L. The correlation analysis revealed a strong negative correlation between MOT and seminal plasma Cu concentration (rp=-0.781; P<0.01 as well as between PROG and Cu content in the seminal plasma (rp=-0.726; P<0.01. The data obtained from this study clearly indicated that concentration of copper in seminal plasma negatively affects the spermatozoa motility parameters and subsequently might cause reproductive alteration in male sexual functions.
Liu, Yang
2014-07-01
The computational complexity and memory requirements of classically formulated marching-on-in-time (MOT)-based surface integral equation (SIE) solvers scale as O(Nt Ns 2) and O(Ns 2), respectively; here Nt and Ns denote the number of temporal and spatial degrees of freedom of the current density. The multilevel plane wave time domain (PWTD) algorithm, viz., the time domain counterpart of the multilevel fast multipole method, reduces these costs to O(Nt Nslog2 Ns) and O(Ns 1.5) (Ergin et al., IEEE Trans. Antennas Mag., 41, 39-52, 1999). Previously, PWTD-accelerated MOT-SIE solvers have been used to analyze transient scattering from perfect electrically conducting (PEC) and homogeneous dielectric objects discretized in terms of a million spatial unknowns (Shanker et al., IEEE Trans. Antennas Propag., 51, 628-641, 2003). More recently, an efficient parallelized solver that employs an advanced hierarchical and provably scalable spatial, angular, and temporal load partitioning strategy has been developed to analyze transient scattering problems that involve ten million spatial unknowns (Liu et. al., in URSI Digest, 2013).
Dictionnaire Le Robert et Collins anglais senior
2016-01-01
Le plus complet et le plus actuel des grands dictionnaires bilingues anglais : près d'1 million de mots, expressions et traductions ; 2 dictionnaires de synonymes (un pour chaque langue) ; un dictionnaire business de 15 000 termes. La référence pour les ensiengnants et les traducteurs Une richesse inégalée de sens et de nuances : plus de 950 000 mots, expressions et traductions des milliers d'exemples tirés de la presse et de la littérature le vocabulaire terminologique : sciences, économie, nouvelles technologies,... tous les niveaux de langue : littéraire, familier, argotique... Une langue mise à jour et actuelle : des milliers de traductions nouvelles : zero-hour contract, sunset clause, culture fund... Une dimension internationale l'anglais britannique, américain, écossais, irlandais, australien... Les références culturelles anglo-saxonnes : institutions, traditions, événements, personnages importants, phrases célèbres de la littérature, du cinéma... Des aides pointues : 800 notes su...
Africa Development - Vol 35, No 3 (2010)
African Journals Online (AJOL)
(Re)produire, marquer et (s')approprier des « lieux (publics) de ville » par les mots ou comment les murs (dé)font les langues à Dschang · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JB Tsofack, 93-117. http://dx.doi.org/10.4314/ad.v35i3.70209 ...
Approche SIG pour une analyse spatiale des infrastructures ...
African Journals Online (AJOL)
SARAH
31 janv. 2014 ... SIG jouent un rôle primordial dans l'implantation, le suivi et la gestion des infrastructures hydrauliques. L'utilisation de ces outils peut atténuer les difficultés d'approvisionnement en eau. Mots clés : SIG, distribution spatiale, infrastructure hydraulique, Zè, Bénin. ... accès à un dispositif d'assainissement de.
La tuberculose iléo-caecale : à propos de deux cas au CHU ...
African Journals Online (AJOL)
Le traitement antituberculeux instauré était conforme au protocole du programme national burkinabè de lutte contre la tuberculose. L'évolution a été favorable dans les deux cas. Mots clés: tuberculose - jonction iléocaécale - traitement antituberculeux - chirurgie. English Abstract. The ileo-caecal tuberculosis is rare and ...
Formulation de farine de fonio enrichie en ressources alimentaires ...
African Journals Online (AJOL)
Mots clés: fonio (Digitaria exilis), alimentation complémentaire, ressources alimentaires locales au Bénin, enfants de 6 – 23 mois, formulation de farine de céréale. English Title: Developing a fonio flour enriched with local food resources for complementary feeding of young children in Benin. English Abstract. The objective ...
Militantisme Politique et Entrepreneuriat :: relations de dépendance ...
African Journals Online (AJOL)
d'entreprise doivent rimer et concourir au développement de l'économie d'une nation. Mots clés: militantisme politique- entrepreneurs politiques- entrepreneuriat -politique- économie ..... à des facilités économiques.9 Cette stratégie n'est pas nouvelle au Cameroun lorsque l'on sait .... Le recrutement se fait sous la base.
Original Paper Evaluation de la fonction rénale chez les patients ...
African Journals Online (AJOL)
Evaluation de la fonction rénale chez les patients atteints de maladie cardio vasculaire (MCV) : comparaison entre ... Mots clés : Cystatine C, créatinine, insuffisance rénale, débit de filtration glomérulaire, maladies cardiovasculaires. Evaluation of the ... L'insuffisance rénale chronique (IRC) et les maladies cardiovasculaires ...
La contribution du sport dans le règlement du conflit Casamançais ...
African Journals Online (AJOL)
En tant que chercheur, nous avons étudié la question en se fondant sur la recherche documentaire fournie et l'analyse compréhensive et fonctionnaliste. Mots-clés: Sport, conflit, lutte, paix, culture. English Abstract Senegal, a country that lies in west African, is facing a serious armed conflict in the South of Casamance since ...
Dégradation photocatalytique du 5-fluorouracile par un système UV ...
African Journals Online (AJOL)
Mots clés : 5-fluorouracile, UV-A/TiO2, eau ultra pure, eau bicarbonatée, eau usée. Photocatalytic degradation of 5-fluorouracil by a UV-A / TiO2 system: effect of catalyst concentration and pollutant, pH and dilution matrices. ABSTRACT. Residues of anticancer drugs are among the emerging micropollutants often identified ...
(Glycine max L. (Merril) à l'apport des biomasses vertes de Tithonia ...
African Journals Online (AJOL)
SARAH
30 mars 2013 ... des biomasses de Tithonia diversifolia (10143 kg /hectare) comme fertilisant constituerait un atout majeur pour l'accroissement des rendements du soja dans un contexte de dégradation des sols et de prix élevé des engrais minéraux. Mots clés : biomasse de Tithonia diversifolia, fumure organique, soja, ...
Gender, Succession and Dynastic Politics: The Saga of Senate and ...
African Journals Online (AJOL)
Similarly it depicts the multiple of feuds within the Lesotho Kingdom. Indeed the story provides many other glimpses into the period of Senate's life. In the process Motšoene, who was meant to weld the nation together, became instead a cruel victim of the chimeric social experiment by Moshoeshoe I, founder of the nation ...
La surveillance des abords vasculaires chez les hémodialysés ...
African Journals Online (AJOL)
La fistule artério veineuse a présenté très peu de complications chez les patients. Mots clés : Abord vasculaire, Hémodialyse, insuffisance rénale chronique. English abstract. Monitoring of vascular access in chronic hemodialysis patients at the National Hospital of Niamey Lamordé The purpose of this cross-sectional study ...
Effect of School-based Human Papillomavirus (HPV) Vaccination on ...
African Journals Online (AJOL)
... de comportement des pairs positifs. Des obstacles majeurs à l'acceptation du vaccin ont été: les rumeurs et les idées fausses au sujet des effets secondaires possibles, information inadéquate perçue sur le vaccin, et la peur des effets secondaires. Mots clés: adolescentes; connaissances; acceptabilité; vaccin; Ouganda ...
utilisation du semoir philippin, une alternative au repiquage du riz ...
African Journals Online (AJOL)
1Institut d'Economie Rurale (IER) - Equipe Système et Gestion des Ressources Naturelles (ESPGRN), Centre Régional de Recherche ... Mots clés : Riziculture irriguée, semoir philippin, économie semences, économie temps de travail, rendement riz .... échantillons, mais qui fait appel à la mémoire et la subjectivité de ...
Effet variétal et du traitement fongicide sur la sévérité de la maladie ...
African Journals Online (AJOL)
utilisation intégrée des variétés moins sensibles (PNG, PNN et TY 3396-12), des variétés fortement productives (MEX 142 et MAC 33) et du fongicide manèbe améliore la production du haricot commun. Mots clés : Variétés, taches angulaires, ...
Von Krahli teater kolib mõneks ajaks Saksamaale / Rain Tolk
Tolk, Rain, 1977-
2006-01-01
Von Krahli Teatri selle hooaja eelviimane esietendus "Europiraadid" on 17. mail Düsseldorfis, koostöös Saksamaa teatrirühmaga Showcase Beat Le Mot. Eesti poole pealt teevad kaasa Juhan Ulfsak, Taavi Eelmaa, Maarja Jakobson ja üllatusmängijana filmimees Rain Tolk, kes räägib oma suhtumisest teatrisse ja suhetest Von Krahli Teatriga
2011-07-01
when it is ingested during pregnancy [20,21]. Aside from its role in development, Hh signaling also supports stem cells in adult tissues [22-24]. However...For the mo.~t commonly uti - lized human prostate cancer cell lines (LNCaP and derivatives, DUI45, PC3 or CWR22rvl) grown in culture, Shh, Glil/2 and
Jeux et enjeux autour de l'insertion professionnelle des jeunes ...
African Journals Online (AJOL)
S'inscrivant dans une certaine logique d'action, ces stratégies sont développées autant sur les plans physique, que métaphysique. Mots clés : Jeux, enjeux, insertion professionnelle. Graduates of higher education in general, and those of professional schools of the Université Abomey-Calavi (UAC) in particular, are facing ...
1087-IJBCS-Article-Chouti Waris
African Journals Online (AJOL)
DR GATSING
2011 International Formulae Group. All rights reserved. Mots-clés : pollution, phosphore, azote, eaux de ruissellement, eutrophisation. INTRODUCTION. Les déchets agricoles et ménagers continuent d'être rejetés sans traitement dans les rivières et lacs de plusieurs pays africains, empêchant ainsi ces cours d'eau de jouer.
Ce que nous faisons | Page 52 | CRDI - Centre de recherches pour ...
International Development Research Centre (IDRC) Digital Library (Canada)
Consultez notre bibliothèque de projets. Nous avons financé plus de 1 000 projets au cours de la dernière décennie. Vous pouvez les consulter tous ici. Mots-clés. Sujet(s). - Tout -, Développement, Économie, Environnement, Évaluation, Alimentation et agriculture, Gouvernance, Santé, Information et communication, Divers ...
Caractéristiques morphologiques et optiques du silicium ...
African Journals Online (AJOL)
Mots clés: silicium nanoporeux; modèle de Bruggeman; indice de réfraction; degrés d'oxydation. The silicon anodisation in hydrofluoric acid solutions HF is an acquired method in the preparation of porous silicon, with potential applications in many fields such as electronics, optics as well as chemical technology and that of ...
Comparative efficacy of sweet orange, Citrus sinensis (l) rind ...
African Journals Online (AJOL)
Sweet orange, Citrus sinensis((L.) rind powder and oil were evaluated for the control of maize weevil, Sitophilus zeamais(Mot.) under ambient laboratory conditions (28 ± 2o C and 75 ± 20% R.H.). Experiments consisted of exposing adult S. zeamais to both the powder and oil for 42 days. Mortality counts were taken from the ...
African Journals Online (AJOL)
Mots clés: Alcools et phénols – Représentation numérique de la structure chimique – Facteur acentrique – Régression linéaire multiple – Modèle RSP hybride. English Title: Structure / acentric factor relationship of alcohols and phenols: genetic algorithm – multiple linear regression approach. English Abstract. The acentric ...
Evaluation de la qualité et de l'acceptabilité de couscous à base de ...
African Journals Online (AJOL)
Mots clés : qualité, acceptabilité, enrichissement, soja, moringa, couscous. Evaluation of the quality and .... ont été lavés à l'eau potable puis rincés à l'eau déminéralisée. ... Détermination de l'indice de gonflement. L'indice de gonflement a été ...
Les fistules congenitales de la levre inferieure : a propos d'une ...
African Journals Online (AJOL)
Conclusion : la découverte de fistules labiales inférieures impose un bilan complet à la recherche de malformations associées ainsi qu'une enquête familiale. Mots-clés : fistules labiales - malformations congénitales. Purpose of study: Congenital lower lip fistulae are rare and can be either isolated or associated with other ...
African Journals Online (AJOL)
abp
26 avr. 2016 ... Thumb trapeziometacarpal arthrosis treated with a prosthesis. Adil El Alaoui1,&, Ilyas Rabhi1. 1Service de Chirurgie Orthopédique du Centre Hospitalier de Chambéry, France. &Corresponding author: El Alaoui Adil, Service de Chirurgie Orthopédique du Centre Hospitalier de Chambéry, France. Mots clés: ...
African Journals Online (AJOL)
PNLC
décrit. Les pronostics maternels et foetal sont discutés à la lumière de la revue de la littérature. MOTS CLES: Rupture utérine - Grossesse - Traumatisme abdominal - Accident de la voie publique. UTERINE RUPTURE FOLLOWING A ROAD TRAFFIC ACCIDENT: A case report. ABSTRACT: A case of a ruptured gravid uterus ...
African Journals Online (AJOL)
with spotted high readings in a few individualshence the overall response was mot significantly different (P>0.05). However. IgG4 responses to 013 were very low or negligible in both groups. Pronounced IgG3 responses to the recombinant antigens OV25 and OV47 were observed for the protected individuals against lower ...
angiomyxome agressif de la joue
African Journals Online (AJOL)
Les aspects cliniques, histologiques et thérapeutiques de la tumeur ont été discutés. Mots-clés : L'angiomyxome agressif, tumeur mésenchymateuse, exérèse, récidive. SUMMARY. An aggressive angiomyxoma is a mesenchymal tumour arising from connective tissues with a predilection for the fema- le pelvic soft parts.
655-IJBCS-Article- Dr Madjidou Oumarou
African Journals Online (AJOL)
DR GATSING
4 Laboratoire d'Ecologie Appliquée, Faculté des sciences Agronomiques,. Université d'Abomey-Calavi 01 BP ... All rights reserved. Mots clés : potentiel pastoral, Invasion biologique, écologie, conduite de l'élevage, Bénin. INTRODUCTION ..... problème d'alimentation est aggravé avec l'arrivée des bovins transhumants ...
Capacité de la biopsie de la prostate à prédire le score réel du ...
African Journals Online (AJOL)
Y. Dehayni
Disponible sur Internet le 8 août 2016. MOTS CLÉS .... Les résultats de notre étude ont démontré que bien qu'il y ait eu une bonne concordance, un .... tion des stratégies thérapeutiques, dans l'espoir que des recherches futures améliorent les ...
Effective Methods and Emerging Trends in Engineering Education ...
African Journals Online (AJOL)
Mots clés: ingénierie; éducation; approches; qualité; certification. Engineering education plays a very important role in the social and economic development of a nation as well as its standing in the world. During the 19th and 20th centuries, engineering “disintegrated” into specific disciplines. The 21st century will instead be ...
Résultats du traitement chirurgical des traumatismes du rachis à l ...
African Journals Online (AJOL)
incomplète était prédictive de bon pronostic P< 0,001. Les traumatismes du rachis cervical sont des urgences neurologiques qui mettent en jeu le pronostic vital et fonctionnel des patients. Mots clés : Traumatisme, rachis, traitement. The purpose of this series was to describe the results of surgical treatment of spinal injury.
L'Algérie, intégration de l'évaluation citoyenne comme maîtrise d ...
African Journals Online (AJOL)
L'objectif étant de tenir compte tenu de la mobilisation des populations riveraines qui luttent quotidiennement contre les risques sanitaires nocifs pour leur santé et leur sécurité. Mots-clés : Ressources naturelles – préservation - évaluation citoyenne - Algérie. Algeria, integration of citizen evaluation as a mastery of creative ...
75 caracteristiques et evolution des operations de fusions
African Journals Online (AJOL)
Elles apparaissent enfin comme un moyen à la disposition des entreprises de grande taille afin de se développer en acquérant des PME. Mots clés : Fusions & Acquisitions, Tunisie, Industrie, Commerce. Classification JEL : L26, G34. *. Chercheur associé au CEPN, Université Paris 13, PRES Sorbonne Paris-Cité,. France.
Les fruits de Cycas (Cycadacea) des Comores : utilisation ...
African Journals Online (AJOL)
... gras mono et polyinsaturés. L'analyse des protéines a permis d'identifier une diversité d'acides aminés dans ces amandes. La prédominance glucidique, 89% dont 72% d'amidon, fait du fruit de Cycas une ressource amylacée potentielle. Mots-clés : Cycas, amandes, amidon, analyse nutritionnelle, farine, transformation.
utilisation des donnees pour l'evaluation de l'heterogeneite des sols
African Journals Online (AJOL)
AISA
étude a permis de caractériser l'hétérogénéité des sols ferrallitiques, à travers sa couleur. Mots-clés : Couleur ... ainsi qu'à l'application des recommandations des doses de fertilisant. ..... de « système sol » en zone de contact forêt- savane du ...
Les Protocoles de routage dans les réseaux mobiles Ad Hoc ...
African Journals Online (AJOL)
Dans cet article nous présentons un état de l'art sur les protocoles de routage dans les réseaux mobiles Ad hoc. Mots clés : Réseaux mobiles ad hoc/, Protocoles de routage. Routing protocols in wireless mobile ad hoc networks. Abstract:The communication between users with handheld computers interconnected through ...
Event and Apparent Horizon Finders for 3+1 Numerical Relativity
Directory of Open Access Journals (Sweden)
Thornburg Jonathan
2007-06-01
Full Text Available Event and apparent horizons are key diagnostics for the presence and properties of black holes. In this article I review numerical algorithms and codes for finding event and apparent horizons in numerically-computed spacetimes, focusing on calculations done using the 3+1 ADM formalism. The event horizon of an asymptotically-flat spacetime is the boundary between those events from which a future-pointing null geodesic can reach future null infinity and those events from which no such geodesic exists. The event horizon is a (continuous null surface in spacetime. The event horizon is defined nonlocally in time: it is a global property of the entire spacetime and must be found in a separate post-processing phase after all (or at least the nonstationary part of spacetime has been numerically computed.There are three basic algorithms for finding event horizons, based on integrating null geodesics forwards in time, integrating null geodesics backwards in time, and integrating null surfaces backwards in time. The last of these is generally the most efficient and accurate.In contrast to an event horizon, an apparent horizon is defined locally in time in a spacelike slice and depends only on data in that slice, so it can be (and usually is found during the numerical computation of a spacetime. A marginally outer trapped surface (MOTS in a slice is a smooth closed 2-surface whose future-pointing outgoing null geodesics have zero expansion Theta. An apparent horizon is then defined as a MOTS not contained in any other MOTS. The MOTS condition is a nonlinear elliptic partial differential equation (PDE for the surface shape, containing the ADM 3-metric, its spatial derivatives, and the extrinsic curvature as coefficients. Most “apparent horizon” finders actually find MOTSs.There are a large number of apparent horizon finding algorithms, with differing trade-offs between speed, robustness, accuracy, and ease of programming. In axisymmetry, shooting
African Journals Online (AJOL)
Tsofack, JB. Vol 35, No 3 (2010) - Articles (Re)produire, marquer et (s')approprier des « lieux (publics) de ville » par les mots ou comment les murs (dé)font les langues à Dschang Abstract PDF. ISSN: 0850-3907. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More ...
Tuberculose orale secondaire: a propos d'un cas a Lome | Bissa ...
African Journals Online (AJOL)
L'intérêt de cette présentation est d'attirer l'attention sur la tuberculose que l'on peut retrouver de façon exceptionnelle dans certaines localisations, comme la cavité buccale. Mots-clés: tuberculose orale ; nécrose caséeuse ; tuberculose pulmonaire. English Title: Secondary orale tuberculosis: about one case at Lome.
Analyse des images satellitales radar RSO-ERS et optique ETM+ de ...
African Journals Online (AJOL)
... l'analyse des images satellitales est un outil¸ au même titre que par exemple, la géophysique de prospection minière. Les spatio-cartes géologiques obtenues peuvent permettre de mieux planifier les travaux miniers sur le terrain. Mots-clés : images satellitales, Radar RSO-ERS, ETM+ - LANDSAT 7, prospection minière, ...
Hypogammaglobulinémie acquise associée au thymome: le ...
African Journals Online (AJOL)
La tomodensitométrie thoracique a permis de mettre en évidence des dilatations des bronches associées à un thymome confirmé sur pièce opératoire. La découverte d'une hypogammaglobulinémie a permis de porter le diagnostic de syndrome de Good. Mots clés: Thymome, hypogammaglobulinémie, syndrome de Good.
Le "Re" en Idaasha | Ayena | Journal de la Recherche Scientifique ...
African Journals Online (AJOL)
L'usage de ce morphème accorde à l'interrogation le statut d'interrogation totale. Ainsi, dans en idaasha, le foyer de l'interrogation peut porter non seulement sur tout l'énoncé, mais aussi sur l'un des constituants. Mots clés: idaasha, dialecte, interrogation, portée, prosodie. English Title: "Re" in Idaasha. English Abstract.
LE CARCINOME ONCOCYTAIRE DE LA PAROTIDE : A PROPOS D ...
African Journals Online (AJOL)
Après chirurgie, les récidives sont fréquentes. Le rôle de la radio- thérapie et de chimiothérapie est toujours controversé.Le pronostic est mauvais. Mots clés : Carcinome oncocytaire, parotide, chirurgie, radiothérapie. SUMMARY. Introduction : Oncocyticcarcinomais a rare salivary gland tumor. its management is not codified ...
Étude des lésions anatomo-pathologiques des Tilapia et Clarias ...
African Journals Online (AJOL)
SARAH
29 déc. 2014 ... marchés de Lubumbashi témoignent de la mauvaise qualité du produit consommé à cause du danger présenté pour l'homme (toxi- ... Mots- clés: Poisson, Tilapia, Clarias, lésions anatomo-pathologiques, marché, Lubumbashi. ABSTRACT ... sequestration of fishing products that pose a danger to the public.
A new approach to the classification of African oral texts | Kam ...
African Journals Online (AJOL)
Toutes ces raisons ont conduit à un nouvel examen des différents genres oraux dans le cadre africain et à proposer une division de ces textes en cinq grandes catégories. Mots clés: littérature orale, genres oraux, textes oraux, discours, énoncés, jeux de plaisanterie, chercheurs en littérature orale. Tydskrif vir Letterkunde ...
Bonneau, Cécile; Grousson, Mathieu; Pajot, Philippe
2007-01-01
What is the nature of the black matter? And the one of the dark energy? and antimatter? Extraterrestrial life? All these questions, and some others, put today the physicians at the challenge. Because it's the last enigma of the Universe and the matter. But also because they threaten the mots fundamental certainties of the physics. Should we thus talk of crisis? (13 pages)
Mesure de la vitesse d'infiltration des eaux dans le sol : Cas des sols ...
African Journals Online (AJOL)
C'est donc une infiltration superficielle qui ne peut pas modifier la composition des eaux de l'aquifère. Ces sols sont alors favorables à une telle agriculture. Mots clés: mesure, vitesse, infiltration, sols, pollutions, eau, Niari, Congo. English Title: Measuring the speed of the water infiltration into the soil: case of the soil of the ...
adaptation et selection de varietes performantes de riz pluvi
African Journals Online (AJOL)
PROJET SOJA
Mots-clés : « Web usage mining », extraction de connaissances, fichier Log, méthode. « A Priori », algorithme, théorie de décision. Abstract. Log file treatment and exploration of the web site, for extracting and mining the knowledges : Web usage mining. The aim of this work is to design and produce one tool and implement, ...
Etat des lieux sur l'entrepreneuriat feminin dans la wilaya de Djelfa ...
African Journals Online (AJOL)
Abstract. En Algérie, l'entrepreneuriat féminin est faible malgré la politique volontariste de l'Etat pour booster l'activité féminine qui se trouve être la plus faible dans le Maghreb. Seulement 5 % des ... et la gestion de leur projet. Mots clefs: Entreprenariat féminin, Djelfa, Investissement, Micro crédit, Développement social ...
Datation de l'infection a Toxoplasma gondii chez 128 femmes ...
African Journals Online (AJOL)
L'utilisation de ce test dans les laboratoires de biologie médicale au Togo pourrait contribuer à améliorer la prise charge adéquate des femmes enceintes au Togo. Mots clés: Toxoplasmose, sérologie, test d'avidité, femmes enceintes, Togo. English Title: Datation of Toxoplasma gondii infection among pregnant women in a ...
Knowledge and attitudes of parents toward children with epilepsy ...
African Journals Online (AJOL)
Certains parents pensaient que l'épilepsie était lié avec l'attaque de mauvais esprit/démoniaque et contagieuse. Quelques-uns d'entre eux a rejeté l'épilepsie mot et ne pensent pas qu'un enfant épileptique pourrait atteindre beaucoup dans la vie. Les connaissances sur les caractéristiques cliniques et les procédures ...
Le chomage endemique: un effet dysfonctionnel du modele ivoirien ...
African Journals Online (AJOL)
... de l'action des différents gouvernements qui se sont succédés et contrarient leur projet d'assurer le plein-emploi. Mots-clés: Crise de l'emploi ; Chômage ; Côte d'Ivoire ; miracle ivoirien ; Economie-politique de la Côte d'Ivoire. English Title: Endemic unemployment: a dysfunctional effect of the Ivoirian Development Model.
Société de l'information (Algerian) | Bounadja | Revue d'Information ...
African Journals Online (AJOL)
... la quelle, l'information est la base de toutes les activités scientifique, technique, économique, politique, sociale et culturelle. Mots clés: Société de l'information / Internet / Education / Formation / Industrie de l'information. Revue d'Information Scientifique & Technique Vol.9(1) 1999. http://dx.doi.org/10.4314/rist.v9i1.26724.
Agrodiversite, gestion paysanne et importance de Dioscorea ...
African Journals Online (AJOL)
biologique, sociale, culturelle locale et dispose d'une potentialité non négligeable lui permettant de jouer un rôle important dans le maintien des moyens de subsistance, le bien-être humain et l'amélioration de la santé. Mots clés: Igname, bayèrè, Dioscorea praehensilis, agrodiversité, gestion, valeurs, contraintes ...
Voir toutes les initiatives | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Voici les projets appuyés par The William and Flora Hewlett Foundation. Votre recherche n'a donné aucun résultat. Vous pourriez essayer : d'utiliser des synonymes,; d'enlever les filtres de recherche, ou; d'utiliser des mots-clés plus généraux. Nous finançons des chercheurs qui inspirent des changements mondiaux.
Évaluation des pratiques agricoles des légumes feuilles : le cas des ...
African Journals Online (AJOL)
Face à ce constat, le défi de la recherche serait la détermination du niveau actuel de contamination des légumes feuilles et des eaux du barrage et celui de l'État serait l'initiation de programmes de sensibilisation des producteurs par rapport à une gestion plus rigoureuse des pesticides. Mots-clés : pratiques paysannes, ...
Analyse des précipitations annuelles à la station de Yaoundé de ...
African Journals Online (AJOL)
Mots-clés: Yaoundé, précipitations, saisons, sécheresse, El Niño. Analysis of the annual rainfalls in the Yaounde station from 1895 to 2006. In the context of climate change, we propose for the Yaounde weather station, in the area of the classic equatorial climate, to study the behavior of interannual rainfalls. It follows a ...
Etude des propriétés fluorescentes d'un naphtopyranone isolé de ...
African Journals Online (AJOL)
Mots clés : Naphtopyranone, Guiera senegalensis, analyse par fluorescence ... son intérêt en thérapeutique (Silva et al., 2003 ; Silva,. 2004; Silva et al., ... spectrofluorimétriques ... composé a été préparée dans l'eau et des ..... analysis of the fungicide carbendazim and its metabolite. 2- aminobenzimidazole in natural water.
Tseronis, A.
2010-01-01
Jusqu’à présent, la plupart des études qui font le point sur l’inscription linguistique de l’argumentation s’intéressent plutôt au « potentiel indiciaire » des mots et des locutions étudiés et négligent leur effet stratégique potentiel dans le discours argumentatif. Dans cet article, je propose une
Nécrose drépanocytaire de la tête fémorale chez l'enfant et l ...
African Journals Online (AJOL)
... sociaux de la méthode ambulatoire méritent d'en faire un protocole codifié qui pourrait faire l'objet d'une étude multicentrique régionale. Mots clés : Drépanocytose, hanche, enfant, traitement ambulatoire. Objective: The taking care of avascular necrosis of femoral head on sickle cell disease young patients is very difficult.
1 Analyse de l'impact des ondes électromagnétiques sur l'homme ...
African Journals Online (AJOL)
AKA BOKO
Correspondance, courriel : belmiencarlos2002@yahoo.fr. Résumé. Cet article présente ... MATLAB montrent que, l'utilisation d'un téléphone portable peut entraîner une augmentation de la température du cerveau. Mots-clés ... Simulation results using MATLAB show that the usage of a mobile phone could lead to an ...
Freuchen, Fredrik
2013-01-01
Masteroppgave - Norges idrettshøgskole, 2013 Antioksidanter kan beskytte celler mot alvorlig skade ved å hindre oksidering av cellulære bestanddeler. Likevel er det antydet at store doser antioksidanter kan hemme gunstige treningseffekter. Formålet med studien var å undersøke hvilken effekt antioksidanttilskudd kombinert med 12 ukers utholdenhetstrening har på aerob kapasitet, lungefunksjon og luftveisinflammasjon.
Tsitutu , ou mecanisme local de mediation et de reconciliation « par ...
African Journals Online (AJOL)
Par ailleurs, ce rituel qui tente de proposer des solutions endogènes aux crises, fait office d'une médiation qui retrace une diplomatie africaine de résolution des conflits. Mots clés: Tsitutu, mécanisme, médiation, réconciliation, rituel, sociopolitiques. English Title: Tsitutu, or a local mechanism of mediation and reconciliation ...
39 VetoMed : un système expert à base d'icônes pour la médecine ...
African Journals Online (AJOL)
PR BOKO
Mots-clés: système expert, générateur de systèmes expert, base de connaissances, médecine traditionnelle vétérinaire, plantes médicinales, interface iconique, tradipraticien. Abstract. VetoMed : An icon-based expert system for Traditional Veterinary Medicine. In this paper we propose an expert system in which, icons are ...
Modélisation d'une turbine hydroélectrique adaptée à un cours d ...
African Journals Online (AJOL)
user
formé par la turbine. Des lois d'interdépendance entre les grandeurs caractéristiques de la turbine sont obtenues, ce qui permet de mieux exploiter les résultats de ce travail. Mots-clés : vague, modélisation, turbine, conversion, énergie électrique, alternateur. Abstract. Study of a mechanic system to transform the kinetic ...
African Journals Online (AJOL)
AKA BOKO
Résumé. L'Algérie a mis en place un réseau industriel dense, concentrant des secteurs polluants et gros ... Mots-clés : métaux lourds, rejet liquide, déchets industriels, pollution, environnement, oued Meboudja, ... Pour évaluer les concentrations en éléments traces métalliques (ETM) dans les eaux de l'oued Meboudja.
Grossesse et accouchement des patientes ayant un antécédent de ...
African Journals Online (AJOL)
L'épreuve utérine est une procédure à encourager pour réduire le taux de césarienne itérative. Mots clés: Grossesse, utérus cicatriciel, accouchement, Sénégal. English Title: Pregnancy and delivery in patients with a personal history of cesarean section in Dakar: epidemiological, clinical, therapeutic and prognostic aspects.
Lundesgaard, Jon
2005-01-01
Norsk: Med tusenårsskiftet fikk vi også et skifte i hvordan en i Europa går videre i møtet med utfordringene på regnskapsreguleringsområdet. I stedet for å satse på en “har-monisering” ved direktiver (som det enkelte land i noen grad står fritt i forhold til) går en over på det som er omtalt som en forordningslinje. Dvs. retningslinjer som har karakteren av lov, og med dette får en i Europa et felles regnskapsreguleringsregime for “større” foretak (først og framst gjelder retningslinjene kons...
De l’harmonie dans la construction des mots français
Directory of Open Access Journals (Sweden)
Roché Michel
2016-01-01
Full Text Available La formation des gentilés, particulièrement sensible aux contraintes d’euphonie, permet de mettre en évidence, pour le français, deux manifestations complémentaires de la contrainte dissimilative. L’une, négative, tend à éviter la consécution à faible distance du même phonème ou de deux phonèmes proches. Elle explique la sous-représentation des deux principaux suffixes, -ais et -ois, après une accroche en sifflante, à cause de la sifflante conte-nue par le suffixe au féminin, ainsi que la sous-représentation de -ais après /E/ et de -ois après /A/. L’autre, positive, favorise entre les voyelles une harmonie fondée sur les contrastes. De-vant les suffixes dont la voyelle est une voyelle d’avant moyenne ou haute (-ais, -ain, -in, -ier…, sont privilégiés les radicaux dont la dernière voyelle est une voyelle d’arrière moyenne ou basse, et de préférence un /O/ plutôt qu’un /A/. Devant les suffixes dont la voyelle est une voyelles d’arrière moyenne ou basse (-ois, -ot, -on, -and, -at, -ard…, sont privilégiés les radi-caux dont la dernière voyelle est une voyelle d’avant moyenne ou haute, et de préférence un /i/ plutôt qu’un /E/. Pour cela, un yod au contact du suffixe joue le même rôle qu’un /i/ dans la syllabe précédente. Cette harmonie est obtenue soit par la sélection du suffixe, soit par un aménagement – substitution, épenthèse, troncation, insertion d’un interfixe, etc. – du radical fourni par la base. On observe d’autre part une harmonisation de l’accroche consonantique du radical avec la voyelle du suffixe. Devant -ois, sont privilégiées les attaques en labiale ou en vélaire, en accord avec le double caractère du /w/ propre à ce suffixe. Devant -ais et -ain, ce sont les attaques en dentale. Devant -ot, -on, -and, -at, -ard, la tendance à rapprocher l’articu-lation de la consonne de celle de la voyelle peut aller jusqu’aux vélaires mais elle s’arrête sou-vent aux palatales à cause de la rareté des moyens offerts par les vélaires en français et de la contrainte portant sur les voyelles, qui privilégie devant ces suffixes une attaque en yod.
Direction information acquired from attended objects not from distractors in MOT
Czech Academy of Sciences Publication Activity Database
Lukavský, Jiří
2012-01-01
Roč. 41, Supplement (2012), s. 140-140 ISSN 0301-0066. [European Conference on Visual Perception . 02.09.2012-06.09.2012, Alghero] R&D Projects: GA ČR GPP407/10/P607 Institutional support: RVO:68081740 Keywords : Multiple Object Tracking * random dot motion * visual attention Subject RIV: AN - Psychology http://www. perception web.com/ecvp/ecvp12_jkt_crop.pdf
Countermeasures to corrosion on water walls; Aatgaerder mot eldstadskorrosion paa panntuber
Energy Technology Data Exchange (ETDEWEB)
Storesund, Jan; Sund, Goeran; Pettersson, Rachel; Nordling, Magnus; Hoegberg, Jan
2007-12-15
Corrosion of water walls is becoming a problem for an increasing number of boilers. Wider use of biomass and waste for fuel, as well as requirements of reduced NO{sub x} emissions, makes it much more difficult to avoid combustion in a reducing atmosphere adjacent to the water walls. This has increased the need for corrosion protection in many existing boilers. In addition, biomass and waste fuelled plants currently being planned or built require well-functioning water wall protection from the start. The traditional water wall materials - ferritic low alloyed steels - are not easy to replace because of their outstanding heat transfer properties, ability to form a protective oxide layer on the inside of the tubes and low thermal expansion. For this reason, corrosion protection generally involves the use of some kind of coating on the tubes. In this report, the state-of-the-art regarding water wall corrosion protection is described in a literature survey. Methods covered are the use of refractories, overlay weld cladding, composite tubes and thermal spraying. The interest for overlay welding has increased recently since it can offer similar corrosion protection to composite tubes at a significantly reduced cost. Test panels have been exposed and monitored in different boilers. Six weld overlay materials were tested: the well-proven Alloy 625, a modified Alloy 625 in which niobium has been replaced by tungsten, Alloy 59, Alloy 22, a cheaper nickel base alloy 650 which contains some iron and a 310 grade stainless steel. A total of six panels were exposed in the most vulnerable positions in three different boilers. These included waste and biomass combustion as well as different steam data, sizes and types of boilers. Two further facilities, in which the test materials Alloy 625 and Sanicro 28 had already been installed, were also included in the investigation. The duration of service exposure was one operating season. The weld cladding was measured with a thickness gauge before service exposure and at inspection intervals. Disc samples of each test material were also removed from the test panels for metallographic analysis. The results showed significant corrosion of all six weld overlay materials in the boiler with relatively high steam data and highly corrosive fuel. Metal losses were in the range 0.3 - 1.2 mm after one operating season. The 310 stainless steel suffered fairly uniform corrosion, while the nickel-base alloys exhibited localised pitting. Corrosion in the other boilers was much less pronounced, and in many cases no significant reduction in cladding thickness was observed. Chemical analyses of corrosion products and deposits showed large variations in composition, even within small areas, and indicated that the local environment fluctuates widely. Appreciable levels of chloride, alkali and heavy metals were present, and it was concluded that molten salt fluxing is a primary damage mechanism. The large variations in composition mean that more extensive sampling should be carried out to obtain a complete picture of the corrosion processes on water walls. Nevertheless, the results so far indicate that stainless steels of type 310 or Sanicro 28 can compete with the more expensive Ni-base alloys. Service exposure should be continued for another one or two operating seasons in order rank all the materials in relation to the different types of boilers and to draw more general conclusions
Le sens des mots : le vocabulaire du genre en Espagne
Directory of Open Access Journals (Sweden)
Sofía Rodríguez
2011-12-01
Full Text Available Cet article dresse le bilan des études de genre menées en Espagne et revient sur les concepts-clé ayant orienté la recherche dans ce domaine. Il montre la relation entre l´évolution du féminisme théorique et l´apparition progressive d´un vocabulaire qui défini les femmes comme des sujets politiques. Si les relations de pouvoir sont l´épicentre des catégories structurant l´analyse historique, la violence, les demandes sociales et le matérialisme traversent la société civile et s’inscrivent dans l´agenda des États. L´avenir, néanmoins, s’accompagne de nouveaux défis et dialogues interculturels qui, sans aucun doute, transformeront le discours des femmes et le langage des genres au XXIe siècle.In these lines there is an account of gender studies in Spain and the key concepts on which this research has pivoted. The aim of this article is to show the relationship between the evolution of feminist theory and the gradual emergence of a vocabulary that explain women as political subjects. If power relationships are the epicenter of the categories of historical analysis, violence, social demands and maternalism are on the street and the agendas of state. But the future brings new challenges and intercultural dialogue, no doubt, will expand or transform the discourse of women and gender language in the XXI century.En estas líneas se hace balance de los estudios de género en España, así como los conceptos clave sobre los que la ha pivotado la investigación. El objetivo del artículo es mostrar la relación entre la evolución del feminismo teórico y la progresiva aparición de un vocabulario que explica a las mujeres como sujetos políticos. Si las relaciones de poder son el epicentro de las categorías de análisis histórico, la violencia, las demandas sociales y el maternalismo están en la calle y las agendas de Estado. Pero el futuro trae consigo nuevos retos y diálogos interculturales que, sin duda, habrán de ampliar o transformar el discurso de las mujeres y el lenguaje de género en el siglo XXI.
Recent advances in marching-on-in-time schemes for solving time domain volume integral equations
Sayed, Sadeed Bin; Ulku, Huseyin Arda; Bagci, Hakan
2015-01-01
Transient electromagnetic field interactions on inhomogeneous penetrable scatterers can be analyzed by solving time domain volume integral equations (TDVIEs). TDVIEs are constructed by setting the summation of the incident and scattered field intensities to the total field intensity on the volumetric support of the scatterer. The unknown can be the field intensity or flux/current density. Representing the total field intensity in terms of the unknown using the relevant constitutive relation and the scattered field intensity in terms of the spatiotemporal convolution of the unknown with the Green function yield the final form of the TDVIE. The unknown is expanded in terms of local spatial and temporal basis functions. Inserting this expansion into the TDVIE and testing the resulting equation at discrete times yield a system of equations that is solved by the marching on-in-time (MOT) scheme. At each time step, a smaller system of equations, termed MOT system is solved for the coefficients of the expansion. The right-hand side of this system consists of the tested incident field and discretized spatio-temporal convolution of the unknown samples computed at the previous time steps with the Green function.
Directory of Open Access Journals (Sweden)
Jongchan Kim
2016-05-01
Full Text Available A humanoid, which refers to a robot that resembles a human body, imitates a human’s intelligence, behavior, sense, and interaction in order to provide various types of services to human beings. Humanoids have been studied and developed constantly in order to improve their performance. Humanoids were previously developed for simple repetitive or hard work that required significant human power. However, intelligent service robots have been developed actively these days to provide necessary information and enjoyment; these include robots manufactured for home, entertainment, and personal use. It has become generally known that artificial intelligence humanoid technology will significantly benefit civilization. On the other hand, Successful Research and Development (R & D on humanoids is possible only if they are developed in a proper direction in accordance with changes in markets and society. Therefore, it is necessary to analyze changes in technology markets and society for developing sustainable Management of Technology (MOT strategies. In this study, patent data related to humanoids are analyzed by various data mining techniques, including topic modeling, cross-impact analysis, association rule mining, and social network analysis, to suggest sustainable strategies and methodologies for MOT.
Shared filtering processes link attentional and visual short-term memory capacity limits.
Bettencourt, Katherine C; Michalka, Samantha W; Somers, David C
2011-09-30
Both visual attention and visual short-term memory (VSTM) have been shown to have capacity limits of 4 ± 1 objects, driving the hypothesis that they share a visual processing buffer. However, these capacity limitations also show strong individual differences, making the degree to which these capacities are related unclear. Moreover, other research has suggested a distinction between attention and VSTM buffers. To explore the degree to which capacity limitations reflect the use of a shared visual processing buffer, we compared individual subject's capacities on attentional and VSTM tasks completed in the same testing session. We used a multiple object tracking (MOT) and a VSTM change detection task, with varying levels of distractors, to measure capacity. Significant correlations in capacity were not observed between the MOT and VSTM tasks when distractor filtering demands differed between the tasks. Instead, significant correlations were seen when the tasks shared spatial filtering demands. Moreover, these filtering demands impacted capacity similarly in both attention and VSTM tasks. These observations fail to support the view that visual attention and VSTM capacity limits result from a shared buffer but instead highlight the role of the resource demands of underlying processes in limiting capacity.
High-performance liquid chromatographic radioenzymatic assay for plasma catecyholamines
International Nuclear Information System (INIS)
Klaniecki, T.S.; Corder, C.N.; McDonald, R.H. Jr.; Feldman, J.A.
1977-01-01
A new assay method for plasma catecholamimes (CA) requiring only 50 μl has been developed, which uses high performance liquid chromatography (HPLC). The norepinephrine (NE), dopamine (D), and epinephrine (E) compounds found in plasma are radioactively o-methylated with S-[methyl- 3 H]-adenosyl-L-methionine ( 3 H-SAM) 3 H-SAM by the reaction of catechol-o-methyl transferase (COMT). The reaction is terminated and a standard mixture of nonradioactive o-methylated analogues of NE, D, and E is added to act as a carrier. Following separation by HPLC, the D,L-normetanephrine (NMN), 3-methoxy-4-hydroxyphenylethyl-amine or 3-methoxytyramine (3-MOT), and metanephrine (MN) radioactive peaks are collected which represent NE, D, and E, respectively. Then MNM and MN are oxidized to vanillin, and 3-MOT is acetylated. The products are subsequently separated by solvent extraction. This is necessary in order to avoid high radioactive blanks and to allow quantitation of the radioactivity by liquid scintillation spectrometry. The mean supine levels of NE, D, and E in normal subjects were respectively 182, 33, and 87 pg/ml of plasma. Similar assays on patients with pheochromocytoma revealed 797, 80, and 470 pg/ml
5. Interpréter les faits. Dialogue entre histoire et droit
Directory of Open Access Journals (Sweden)
Manuela Albertone
2017-08-01
Full Text Available Droit et histoire se mêlent dans le parcours intellectuel de Michel Troper, réputé parmi les juristes pour sa théorie réaliste de l’interprétation, apprécié par les historiens notamment pour ses travaux sur la séparation des pouvoirs et la Constitution de l’an III. La valeur de l’interdisciplinarité est une évidence et une nécessité pour ce juriste pour qui la curiosité pour les autres disciplines et le dialogue entre les spécialistes de différentes formations font partie de la recherche et de son propre parcours d’éducation. Dans le dialogue entre Albertone et Troper – le premier d'une série que notre Journal va publier –, autour du langage et des mots, droit et histoire se rapprochent: reconstruire le contexte, saisir la valeur et l’utilisation des mots et des concepts par les acteurs du passé sont autant d’éléments essentiels pour le travail aussi bien celui des juristes que celui des historiens.
Bounds on area and charge for marginally trapped surfaces with a cosmological constant
International Nuclear Information System (INIS)
Simon, Walter
2012-01-01
We sharpen the known inequalities AΛ ≤ 4π(1 - g) (Hayward et al 1994 Phys. Rev. D 49 5080, Woolgar 1999 Class. Quantum Grav. 16 3005) and A ≤ 4πQ 2 (Dain et al 2012 Class. Quantum Grav. 29 035013) between the area A and the electric charge Q of a stable marginally outer-trapped surface (MOTS) of genus g in the presence of a cosmological constant Λ. In particular, instead of requiring stability we include the principal eigenvalue λ of the stability operator. For Λ* Λ+λ > 0, we obtain a lower and an upper bound for Λ*A in terms of Λ*Q 2 , as well as the upper bound Q≤1/(2√(Λ * )) for the charge, which reduces to Q≤1/(2√(Λ)) in the stable case λ ≥ 0. For Λ* < 0, there only remains a lower bound on A. In the spherically symmetric, static, stable case, one of our area inequalities is saturated iff the surface gravity vanishes. We also discuss implications of our inequalities for 'jumps' and mergers of charged MOTS. (fast track communication)
Recent advances in marching-on-in-time schemes for solving time domain volume integral equations
Sayed, Sadeed Bin
2015-05-16
Transient electromagnetic field interactions on inhomogeneous penetrable scatterers can be analyzed by solving time domain volume integral equations (TDVIEs). TDVIEs are constructed by setting the summation of the incident and scattered field intensities to the total field intensity on the volumetric support of the scatterer. The unknown can be the field intensity or flux/current density. Representing the total field intensity in terms of the unknown using the relevant constitutive relation and the scattered field intensity in terms of the spatiotemporal convolution of the unknown with the Green function yield the final form of the TDVIE. The unknown is expanded in terms of local spatial and temporal basis functions. Inserting this expansion into the TDVIE and testing the resulting equation at discrete times yield a system of equations that is solved by the marching on-in-time (MOT) scheme. At each time step, a smaller system of equations, termed MOT system is solved for the coefficients of the expansion. The right-hand side of this system consists of the tested incident field and discretized spatio-temporal convolution of the unknown samples computed at the previous time steps with the Green function.
¿Es el liderazgo transformacional determinante en la motivación intrínseca de los seguidores?
Directory of Open Access Journals (Sweden)
Rodrigo Godoy
2013-01-01
Full Text Available El liderazgo transformacional (LT destaca, en su formulación teórica, por su influencia sobre la motivación. Sin embargo, los estudios empíricos han considerado la motivación como un constructo general y no de forma integrada, distinguiendo distintos constructos motivacionales. Este estudio empírico analiza la influencia del LT sobre la motivación intrínseca esperada (MIEs basada en el modelo ASH-Mot. Para ello se tomó una muestra de 575 empleados correspondientes a dos organizaciones españolas a quienes se aplicaron los cuestionarios ASH-Mot y ASH-Lid (este último basado en el Multifactor Leadership Questionnaire, MLQ. Los análisis de modelos de ecuaciones estructurales muestran apoyo empírico a la relación entre LT y la MIEs. También los resultados muestran apoyo empírico a la mediación de la instrumentalidad entre el LT y la MIEs. Por otra parte, el análisis multi-grupo con modelos de ecuaciones estructurales muestra la invarianza del modelo, poniendo en evidencia la robustez del modelo postulado.
Le corps, instrument de connaissance du monde: la connaissance des Anciens Toltèques
Directory of Open Access Journals (Sweden)
Mabel Franzone
2009-10-01
Full Text Available Cet article traite le corps comme instrument de la connaissance de l’univers. Le corps s’étend vers des contrées infinies, se prolonge, atteint d’autres règnes, cherche l’unité absolue de ce qu’on appelle l’intention. L’intention est le mot clé pour les Anciens Toltèques, réunissant sous ce mot le visible et l’invisible, la volonté de la Nature et celle de l’univers. Le corps n’est qu’un instrument et pour arriver à le parfaire devons chercher la totalité de nous-mêmes, réussir la communication de deux côtés, droit et gauche, aller à la quête d’autres expériences, inimaginables. Les conditions nécessaires sont d’avoir un corps puissant et d’emmagasiner de l’énergie. Tout l’enseignement des sorciers est fondé dans un vrai changement de conception du monde et de la perception de ce monde. L’objectif final est celui de pouvoir choisir sa propre mort ; la vraie, la seule, l’unique liberté de l’homme.
Slowing techniques for loading a magneto-optical trap of CaF molecules
Truppe, Stefan; Fitch, Noah; Williams, Hannah; Hambach, Moritz; Sauer, Ben; Hinds, Ed; Tarbutt, Mike
2016-05-01
Ultracold molecules in a magneto-optical trap (MOT) are useful for testing fundamental physics and studying strongly-interacting quantum systems. With experiments starting with a relatively fast (50-200 m/s) buffer-gas beam, a primary concern is decelerating molecules to below the MOT capture velocity, typically 10 m/s. Direct laser cooling, where the molecules are slowed via momentum transfer from a chirped counter-propagating narrowband laser, is a natural choice. However, chirping the cooling and repump lasers requires precise control of multiple laser frequencies simultaneously. Another approach, called ``white-light slowing'' uses a broadband laser such that all fast molecules in the beam are decelerated. By addressing numerous velocities no chirping is needed. Unfortunately, both techniques have significant losses as molecules are transversely heated during the optical cycling. Ideally, the slowing method would provide simultaneous deceleration and transverse guiding. A newly developed technique, called Zeeman-Sisyphus deceleration, is potentially capable of both. Using permanent magnets and optical pumping, the number of scattered photons is reduced, lessening transverse heating and relaxing the repump requirements. Here we compare all three options for CaF.
2015-06-01
Environment Public Works Rural Development Science, Technology, & Innovation Tourism Transport (MOT) Women, Family, & Community Affairs Youth... Sports 8 2. The Role of Ministries The ministries discussed in the paper are of those that are relevant to the administration and management of...and tourism , and ultimately jeopardize defense and security. 2. History A Nucleus Team for the MMEA’s establishment was initiated in 2002 with the
Integration et exclusion des communautes : La curieuse ...
African Journals Online (AJOL)
Les données que nous y présentons procèdent d'une démarche méthodologique qui a consisté à combiner la recherche documentaire et l'observation des pratiques sportives de diverses communautés aussi bien à l'échelle locale que globale. Mots clés : Sport, société, socialisation, intégration, exclusion. English Abstract.
African Journals Online (AJOL)
FOBUR
smgle mo~• important means o-f preventing hosp~t~J acquired infection.'".~ kobo l~ba&ed hand. Nbs (liquiru; geJs or foams) are the· preferred melluxl for hEUld hygiene in mo~t situations du-e to tln: superior effie~>· or the~ El.,gents in rapidly. reduGing tmcte.rlal counts on hands and their cue of usc.'Hnnd hygiene is done ...
Caractérisation de la variabilité climatique : cas du bassin versant ...
African Journals Online (AJOL)
DK
Cette étude présente l'intérêt de certaines méthodes statistiques, pour interpréter la variabilité spatiotemporelle ... Mots-clés : Sécheresse - Variabilité climatique - Fraction pluviométrique - Bassin versant Medjerda - Est de .... global actuel, aussi bien l'espérance ...... de l'Afrique de l'Ouest non sahélienne entre 1950-1989.
bacteriologie de l'otite moyenne suppuree chronique de l'enfant au ...
African Journals Online (AJOL)
Conclusion : Ainsi le rôle pathogène de staphylococcus aureus est prépondérant dans les otites moyennes suppurées chroniques de l'enfant dans notre unité. Mots-clés : bactériologie - otite moyenne suppurée chronique - enfant. Introduction: L'otite moyenne suppurée chronique est une affection fréquente chez l'enfant.
Recherche et Titrage des Hémolysines Anti-A et Anti-B Chez Les ...
African Journals Online (AJOL)
Les hémolysines apparaissent suite à une immunisation ABO et peuvent causer, à titre élevé, une hémolyse chez le receveur de sang ou chez le nouveau-né. ... Mots Clés: Hémolysines anti-A et anti-A, Incompatibilité foeto-maternelle ABO, Maladie hémolytique du nouveau-né, Période du post-partum immédiate ...
Impact de la variabilité climatique sur le régime des cours d'eau du ...
African Journals Online (AJOL)
... pluies de la “saison sèche” d'été (juillet et août) sont plus élevées depuis quelques décennies, ce qui entretient vraisemblablement une humidité du sol plus élevée favorable au ruissellement au début de la crue d'automne. Mots clefs : changement climatique ; climat équatorial ; séries chronologiques ; Sud Cameroun.
Downsizing Survivors and their Post-Era Behavior
Karjalainen, Petra; Tyynelä, Jonna
2016-01-01
The interest towards managing structural change successfully through downsizing activities has increased as a result of globalization and the recent economic, technological and demographic changes occurring across Europe. As a result of downsizing activities companies often break a Psychological Contract that an employee has established with the organization when starting the employment contract. This results in employees experiencing negative feelings, lack of motivation, inability to re-mot...
Coordonnateur, Gestion des documents | CRDI - Centre de ...
International Development Research Centre (IDRC) Digital Library (Canada)
Classifier, indexer, faire des références croisées et identifier les documents relatifs aux projets et aux activités administratives du CRDI en attribuant, conformément au plan de classification des documents du Centre, le numéro de dossier et le titre appropriés de chaque dossier et les mots-clés servant à la recherche;.
Les bactéries sporulées dans les conserves de légumes (petits pois ...
African Journals Online (AJOL)
Unicornis
brevis (4.53%). Mots clés : Conserves végétales - Petits pois- Bactéries sporulées - Identification biochimique. Abstract. For a consumer more and more aware about the risks for his health, regarding the food he buys, the aim of this study is to verify the hygienic quality of ten batches, each one contains five green peas cans, ...
Angiomyolipome rénal agressif avec extension à la veine rénale: à ...
African Journals Online (AJOL)
Exceptionnellement la tumeur peut avoir un caractère agressive avec extension locorégionale et veineuse (la veine rénale et la veine cave inferieure). Nous présentons une observation d'une patiente âgée de 37 ans présentant un Angiomyolipome rénal volumineux avec extension à la veine rénale. Mots clés: Rein ...
Étude floristique et ethnobotanique de la flore médicinale dans la ...
African Journals Online (AJOL)
SARAH
30 sept. 2015 ... Mots-clés : Ethnobotanique, Gharb, Plantes Médicinales, Médecine Traditionnelles. Abstract. Objective: An ... des plantes à la sécurité alimentaire et aux soins de santé primaire n'est plus à démontrer car près de. 80% de la population .... Tableau 1 : Profil général des utilisateurs (N= 520). Caractéristiques.
Caractéristiques végétales, typologie et fonctions des bois sacrés au ...
African Journals Online (AJOL)
Les bois sacrés assurent aux populations, plusieurs fonctions: écologique, cultuelle, socio-culturelle, magique et mixte. Parmi les bois sacrés, seuls ceux qui suscitent la crainte à l'endroit de la population sont intégralement protégés. Mots clés: Bois sacré, enquête ethnobotanique, caractéristiques végétales, fonctions, ...
Mastery of Fundamental Movement Skills among 6-Year-Old Flemish Pre-School Children
Vandaele, Bart; Cools, Wouter; de Decker, Steve; de Martelaer, Kristine
2011-01-01
The purpose of this study was to assess mastery of Fundamental Movement Skills (FMS) in 6- to 6.5-year-old Flemish pre-school children. The subjects were 236 6-year-old children (138 boys, 98 girls; mean age 6 years 2.4 months, SD 2.4). Children were individually assessed with the Motoriktest fur Vier- bis Sechsjahrige Kinder (MOT 4-6) in four…
Fertilisation du maïs (Zea mays L.) à base d'urines humaines ...
African Journals Online (AJOL)
maturité, les traitements à l'urine pour 90, 120 et 150 kg N/ha respectivement indiquent une production de biomasse sèche de 12 ... Mots clés : Toilette écologique, urine hygiénisée, fertilisation, biomasse sèche, rendement grain, maïs. Fertilization of the corn ...... and spring barley in organic farming. Skara series B Crops ...
Static and dynamic optimization of CAPE problems using a Model Testbed
DEFF Research Database (Denmark)
This paper presents a new computer aided tool for setting up and solving CAPE related static and dynamic optimisation problems. The Model Testbed (MOT) offers an integrated environment for setting up and solving a very large range of CAPE problems, including complex optimisation problems...... and dynamic optimisation, and how interfacing of solvers and seamless information flow can lead to more efficient solution of process design problems....
Les catastrophes naturelles présentent une menace pour les ...
African Journals Online (AJOL)
toufik
L'événement sismique a été simulé en utilisant le catalogue algérien des failles actives. Les résultats obtenus montrent que les constructions les plus endommagées sont celles qui reposent sur des sols meubles. Mots-clés : SIG, risque sismique, probabilité de dommages, courbes de fragilité, Hazus. Abstract. Use of a GIS ...
Simulation de la répartition de température dans un bloc en acier ...
African Journals Online (AJOL)
Simulation of the temperature distribution within a steel block ... Mots clés: Simulation – Fortran – Différences finies – Equation de la chaleur – Température. ..... TM = (15). La méthode de sur-relaxation successive obtenue à partir de la méthode de Gausse-Seidel est utilisée pour accélérer la convergence du système.
La libéralisation comme source du dérèglement des transports ...
African Journals Online (AJOL)
proposant un phasage chronologique relatif à son évolution, tout en mettant la lumière sur ses effets les plus manifestes à l'échelle nationale et surtout sur le plan urbain par rapport au périmètre de transport de la ville d'Annaba, ceci à travers ses différents volets organisationnels et fonctionnels. Mots clés: Libéralisation ...
LA MÉTAPLASIE MALPIGhIENNE DANS LE CARCINOME ...
African Journals Online (AJOL)
Conclusion : bien que rare, la métaplasie malpighienne peut se voir dans la thyroïde. Elle doit être distinguée d'un car- cinome épidermoïde de la thyroïde par la recherche systématique, devant tout foyer de métaplasie malpighienne, des signes de malignité. Mots clés : métaplasie malpighienne, carcinome papillaire, ...
Exploring the learnings derived from catalytic experiences in a leadership context
Daphna S. Horowitz; René van Eeden
2015-01-01
Orientation: Personal leadership comprises self-awareness, authenticity, inspiration and passion. The concept of personal leadership was explored together with its relationship with leadership-related learnings derived from a catalytic experience. Research purpose: The objective of the study was to explore the leadership-related learnings derived from a catalytic experience and any connection between these learnings, personal leadership and leadership in an organisational context. Mot...
1746-IJBCS-Article-Momar Ndiaye
African Journals Online (AJOL)
hp
2013 International Formulae Group. All rights reserved. Mots clés: Métaux lourds, moule, sédiment, toxicité, émission atomique. ... teneurs des métaux lourds cadmium, chrome et plomb dans les sédiments et les moules. MATERIEL ET ..... les sédiments, des éléments minéraux et organiques provenant des eaux usées, des.
Distribution spatio-temporelle du zooplancton en relation avec les ...
African Journals Online (AJOL)
SARAH
31 oct. 2014 ... lotique. Mots clés : zooplancton, eutrophisation, distribution spatio-temporelle, rivière Kondi, Douala. Journal of Applied Biosciences 82:7326 – 7338. ISSN 1997–5902 ...... Maroc subissent une nette augmentation après avoir reçu les effluents de la ville de Taourirt. La légère amélioration observée à la ...
Le drainage pelvien après adénometomie prostatique transvésicale ...
African Journals Online (AJOL)
O. Ghoundale
Service d'Urologie, Hôpital Militaire Avicenne, Marrakech 40 000, Maroc. Reçu le 26 septembre 2012; reçu sous la forme révisée le 22 avril 2014; accepté le 29 avril 2014. MOTS CLÉS prostate; hyperplasie; adénomectomie; drainage; complication. Résumé. Objectif: La chirurgie ouverte garde encore sa place dans la prise ...
adaptation et selection de varietes performantes de riz pluvi
African Journals Online (AJOL)
PROJET SOJA
elles ne présentent pas de risque pour la santé de la population. Les activités et les rapports d'activité mesurés sont comparables à ceux que l'on trouve habituellement dans d'autres régions du Maroc ou du monde. Mots-clés : uranium, radium, thorium, phosphate, le Sahara marocain, eau naturelle. Abstract. Measure of ...
José G. Vargas Hernández; Mohammad Reza Noruzi
2010-01-01
Organizational economics makes important contributions to management theory. The focus of structural contingency theory is on the phenomena of the economy significant in organizational management theory and other new paradigms of organizational theories. However, the theory of organizational economics has hardly taken the multiple disciplines of organizational behaviour, strategy and theory, but is aligned with the management theories of psychology, sociology and policy dealing with human mot...
Répartition des paramètres physico-chimiques et métalliques des ...
African Journals Online (AJOL)
ibaa
Mots clés: Eaux usées, eau de mer, paramètres physiques et métalliques, spectrophotométrie, interaction, .... la solubilité des gaz. Elle favorise aussi l'auto épuration et accroit la vitesse de sédimentation, ce qui peut présenter un intérêt dans les stations d'épuration (Djermakoye,. 2005). ..... atomic absorption spectrometry. J.
Directory of Open Access Journals (Sweden)
Eitaro Aihara
2014-07-01
Full Text Available Helicobacter pylori (H. pylori is a pathogen contributing to peptic inflammation, ulceration, and cancer. A crucial step in the pathogenic sequence is when the bacterium first interacts with gastric tissue, an event that is poorly understood in vivo. We have shown that the luminal space adjacent to gastric epithelial damage is a microenvironment, and we hypothesized that this microenvironment might enhance H. pylori colonization. Inoculation with 106 H. pylori (wild-type Sydney Strain 1, SS1 significantly delayed healing of acetic-acid induced ulcers at Day 1, 7 and 30 post-inoculation, and wild-type SS1 preferentially colonized the ulcerated area compared to uninjured gastric tissue in the same animal at all time points. Gastric resident Lactobacillus spp. did not preferentially colonize ulcerated tissue. To determine whether bacterial motility and chemotaxis are important to ulcer healing and colonization, we analyzed isogenic H. pylori mutants defective in motility (ΔmotB or chemotaxis (ΔcheY. ΔmotB (10(6 failed to colonize ulcerated or healthy stomach tissue. ΔcheY (10(6 colonized both tissues, but without preferential colonization of ulcerated tissue. However, ΔcheY did modestly delay ulcer healing, suggesting that chemotaxis is not required for this process. We used two-photon microscopy to induce microscopic epithelial lesions in vivo, and evaluated accumulation of fluorescently labeled H. pylori at gastric damage sites in the time frame of minutes instead of days. By 5 min after inducing damage, H. pylori SS1 preferentially accumulated at the site of damage and inhibited gastric epithelial restitution. H. pylori ΔcheY modestly accumulated at the gastric surface and inhibited restitution, but did not preferentially accumulate at the injury site. H. pylori ΔmotB neither accumulated at the surface nor inhibited restitution. We conclude that bacterial chemosensing and motility rapidly promote H. pylori colonization of injury sites
Vocabulaire du droit pénal français: cas de polysémie externe
Directory of Open Access Journals (Sweden)
Olivera Vušović
2013-12-01
Full Text Available La polysémie constitue un moyen important de lʼéconomie linguistique. Si les langues de spécialité ne disposent pas dʼun terme spécifique, elles trouvent la solution dans le vocabulaire général auquel elles empruntent des mots comprenant de nombreuses acceptions. Lʼune dʼelles sera précisée dʼaprès les besoins du domaine en question. Dans le présent article, nous rendons compte de lʼinterpénétration existant entre le vocabulaire du droit pénal français (issu de Code de procédure pénale et de Vocabulaire juridique, le vocabulaire général et dʼautres vocabulaires de spécialité. Les approches contemporaines de la terminologie qui prennent en considération les dimensions discursive, sociale, cognitive et culturelle permettent dʼaborder le terme avec plus de flexibilité et de ne pas le considérer comme une simple étiquette destinée à classer les connaissances. Les migrations qui sʼeffectuent entre vocabulaire général et vocabulaires de spécialité, connues sous les noms de terminologisation et déterminologisation,sʼaccompagnent des modifications sémantiques. En fonction du contexte et du domaine spécialisé, un mot peut avoir des acceptions différentes. A titre dʼexemple, le mot blanchiment ne renverra pas à la même notion pour un agent qui lutte contre la criminalité financière, un horticulteur, un cuisinier, un photographe ou un dentiste. Nous nous proposons de vérifier à quel point la polysémie externe est un phénomène répandu. Notre objectif est dʼexplorer ces transferts sémantiques, cʼest-à-dire les diverses facettes dʼun terme
Directory of Open Access Journals (Sweden)
Madison Floyd
2016-11-01
Full Text Available Pseudomonas aeruginosa is an opportunistic pathogen causing severe infections often characterized by robust neutrophilic infiltration. Neutrophils provide the first line of defense against P. aeruginosa. Aside from their defense conferred by phagocytic activity, neutrophils also release neutrophil extracellular traps (NETs to immobilize bacteria. Although NET formation is an important antimicrobial process, the details of its mechanism are largely unknown. The identity of the main components of P. aeruginosa responsible for triggering NET formation is unclear. In this study, our focus was to identify the main bacterial factors mediating NET formation and to gain insight into the underlying mechanism. We found that P. aeruginosa in its exponential growth phase promoted strong NET formation in human neutrophils while its NET-inducing ability dramatically decreased at later stages of bacterial growth. We identified the flagellum as the primary component of P. aeruginosa responsible for inducing NET extrusion as flagellum-deficient bacteria remained seriously impaired in triggering NET formation. Purified P. aeruginosa flagellin, the monomeric component of the flagellum, does not stimulate NET formation in human neutrophils. P. aeruginosa-induced NET formation is independent of the flagellum-sensing receptors TLR5 and NLRC4 in both human and mouse neutrophils. Interestingly, we found that flagellar motility, not flagellum binding to neutrophils per se, mediates NET release induced by flagellated bacteria. Immotile, flagellar motor-deficient bacterial strains producing paralyzed flagella did not induce NET formation. Forced contact between immotile P. aeruginosa and neutrophils restored their NET-inducing ability. Both the motAB and motCD genetic loci encoding flagellar motor genes contribute to maximal NET release; however the motCD genes play a more important role. Phagocytosis of P. aeruginosa and superoxide production by neutrophils were also
Aihara, Eitaro; Closson, Chet; Matthis, Andrea L.; Schumacher, Michael A.; Engevik, Amy C.; Zavros, Yana; Ottemann, Karen M.; Montrose, Marshall H.
2014-01-01
Helicobacter pylori (H. pylori) is a pathogen contributing to peptic inflammation, ulceration, and cancer. A crucial step in the pathogenic sequence is when the bacterium first interacts with gastric tissue, an event that is poorly understood in vivo. We have shown that the luminal space adjacent to gastric epithelial damage is a microenvironment, and we hypothesized that this microenvironment might enhance H. pylori colonization. Inoculation with 106 H. pylori (wild-type Sydney Strain 1, SS1) significantly delayed healing of acetic-acid induced ulcers at Day 1, 7 and 30 post-inoculation, and wild-type SS1 preferentially colonized the ulcerated area compared to uninjured gastric tissue in the same animal at all time points. Gastric resident Lactobacillus spp. did not preferentially colonize ulcerated tissue. To determine whether bacterial motility and chemotaxis are important to ulcer healing and colonization, we analyzed isogenic H. pylori mutants defective in motility (ΔmotB) or chemotaxis (ΔcheY). ΔmotB (106) failed to colonize ulcerated or healthy stomach tissue. ΔcheY (106) colonized both tissues, but without preferential colonization of ulcerated tissue. However, ΔcheY did modestly delay ulcer healing, suggesting that chemotaxis is not required for this process. We used two-photon microscopy to induce microscopic epithelial lesions in vivo, and evaluated accumulation of fluorescently labeled H. pylori at gastric damage sites in the time frame of minutes instead of days. By 5 min after inducing damage, H. pylori SS1 preferentially accumulated at the site of damage and inhibited gastric epithelial restitution. H. pylori ΔcheY modestly accumulated at the gastric surface and inhibited restitution, but did not preferentially accumulate at the injury site. H. pylori ΔmotB neither accumulated at the surface nor inhibited restitution. We conclude that bacterial chemosensing and motility rapidly promote H. pylori colonization of injury sites, and thereby biases