WorldWideScience

Sample records for loc model predicts

  1. LocTree3 prediction of localization

    DEFF Research Database (Denmark)

    Goldberg, T.; Hecht, M.; Hamp, T.

    2014-01-01

    The prediction of protein sub-cellular localization is an important step toward elucidating protein function. For each query protein sequence, LocTree2 applies machine learning (profile kernel SVM) to predict the native sub-cellular localization in 18 classes for eukaryotes, in six for bacteria a...

  2. MU-LOC: A Machine-Learning Method for Predicting Mitochondrially Localized Proteins in Plants

    Directory of Open Access Journals (Sweden)

    Ning Zhang

    2018-05-01

    Full Text Available Targeting and translocation of proteins to the appropriate subcellular compartments are crucial for cell organization and function. Newly synthesized proteins are transported to mitochondria with the assistance of complex targeting sequences containing either an N-terminal pre-sequence or a multitude of internal signals. Compared with experimental approaches, computational predictions provide an efficient way to infer subcellular localization of a protein. However, it is still challenging to predict plant mitochondrially localized proteins accurately due to various limitations. Consequently, the performance of current tools can be improved with new data and new machine-learning methods. We present MU-LOC, a novel computational approach for large-scale prediction of plant mitochondrial proteins. We collected a comprehensive dataset of plant subcellular localization, extracted features including amino acid composition, protein position weight matrix, and gene co-expression information, and trained predictors using deep neural network and support vector machine. Benchmarked on two independent datasets, MU-LOC achieved substantial improvements over six state-of-the-art tools for plant mitochondrial targeting prediction. In addition, MU-LOC has the advantage of predicting plant mitochondrial proteins either possessing or lacking N-terminal pre-sequences. We applied MU-LOC to predict candidate mitochondrial proteins for the whole proteome of Arabidopsis and potato. MU-LOC is publicly available at http://mu-loc.org.

  3. MultiLoc2: integrating phylogeny and Gene Ontology terms improves subcellular protein localization prediction

    Directory of Open Access Journals (Sweden)

    Kohlbacher Oliver

    2009-09-01

    Full Text Available Abstract Background Knowledge of subcellular localization of proteins is crucial to proteomics, drug target discovery and systems biology since localization and biological function are highly correlated. In recent years, numerous computational prediction methods have been developed. Nevertheless, there is still a need for prediction methods that show more robustness and higher accuracy. Results We extended our previous MultiLoc predictor by incorporating phylogenetic profiles and Gene Ontology terms. Two different datasets were used for training the system, resulting in two versions of this high-accuracy prediction method. One version is specialized for globular proteins and predicts up to five localizations, whereas a second version covers all eleven main eukaryotic subcellular localizations. In a benchmark study with five localizations, MultiLoc2 performs considerably better than other methods for animal and plant proteins and comparably for fungal proteins. Furthermore, MultiLoc2 performs clearly better when using a second dataset that extends the benchmark study to all eleven main eukaryotic subcellular localizations. Conclusion MultiLoc2 is an extensive high-performance subcellular protein localization prediction system. By incorporating phylogenetic profiles and Gene Ontology terms MultiLoc2 yields higher accuracies compared to its previous version. Moreover, it outperforms other prediction systems in two benchmarks studies. MultiLoc2 is available as user-friendly and free web-service, available at: http://www-bs.informatik.uni-tuebingen.de/Services/MultiLoc2.

  4. ngLOC: software and web server for predicting protein subcellular localization in prokaryotes and eukaryotes

    Directory of Open Access Journals (Sweden)

    King Brian R

    2012-07-01

    Full Text Available Abstract Background Understanding protein subcellular localization is a necessary component toward understanding the overall function of a protein. Numerous computational methods have been published over the past decade, with varying degrees of success. Despite the large number of published methods in this area, only a small fraction of them are available for researchers to use in their own studies. Of those that are available, many are limited by predicting only a small number of organelles in the cell. Additionally, the majority of methods predict only a single location for a sequence, even though it is known that a large fraction of the proteins in eukaryotic species shuttle between locations to carry out their function. Findings We present a software package and a web server for predicting the subcellular localization of protein sequences based on the ngLOC method. ngLOC is an n-gram-based Bayesian classifier that predicts subcellular localization of proteins both in prokaryotes and eukaryotes. The overall prediction accuracy varies from 89.8% to 91.4% across species. This program can predict 11 distinct locations each in plant and animal species. ngLOC also predicts 4 and 5 distinct locations on gram-positive and gram-negative bacterial datasets, respectively. Conclusions ngLOC is a generic method that can be trained by data from a variety of species or classes for predicting protein subcellular localization. The standalone software is freely available for academic use under GNU GPL, and the ngLOC web server is also accessible at http://ngloc.unmc.edu.

  5. Study on LOC for modern facility agriculture automatic walking equipment LiFePO4 battery

    Science.gov (United States)

    Liu, Xuepeng; Zhao, Dongmei

    2017-08-01

    LiFePO4 battery LOC (life Of Charge) is the assessment of the ability to work within a cycle of battery charge and discharge period, which likes the miles for vehicle. LOC is related with battery capacity, working condition and stress. LOC consists of the model of the battery's SOC online prediction model, the analysis of RBSOC and the LOC model of multi-condition and multi-stress.

  6. mPLR-Loc: an adaptive decision multi-label classifier based on penalized logistic regression for protein subcellular localization prediction.

    Science.gov (United States)

    Wan, Shibiao; Mak, Man-Wai; Kung, Sun-Yuan

    2015-03-15

    Proteins located in appropriate cellular compartments are of paramount importance to exert their biological functions. Prediction of protein subcellular localization by computational methods is required in the post-genomic era. Recent studies have been focusing on predicting not only single-location proteins but also multi-location proteins. However, most of the existing predictors are far from effective for tackling the challenges of multi-label proteins. This article proposes an efficient multi-label predictor, namely mPLR-Loc, based on penalized logistic regression and adaptive decisions for predicting both single- and multi-location proteins. Specifically, for each query protein, mPLR-Loc exploits the information from the Gene Ontology (GO) database by using its accession number (AC) or the ACs of its homologs obtained via BLAST. The frequencies of GO occurrences are used to construct feature vectors, which are then classified by an adaptive decision-based multi-label penalized logistic regression classifier. Experimental results based on two recent stringent benchmark datasets (virus and plant) show that mPLR-Loc remarkably outperforms existing state-of-the-art multi-label predictors. In addition to being able to rapidly and accurately predict subcellular localization of single- and multi-label proteins, mPLR-Loc can also provide probabilistic confidence scores for the prediction decisions. For readers' convenience, the mPLR-Loc server is available online (http://bioinfo.eie.polyu.edu.hk/mPLRLocServer). Copyright © 2014 Elsevier Inc. All rights reserved.

  7. DeepLoc: prediction of protein subcellular localization using deep learning

    DEFF Research Database (Denmark)

    Almagro Armenteros, Jose Juan; Sønderby, Casper Kaae; Sønderby, Søren Kaae

    2017-01-01

    The prediction of eukaryotic protein subcellular localization is a well-studied topic in bioinformatics due to its relevance in proteomics research. Many machine learning methods have been successfully applied in this task, but in most of them, predictions rely on annotation of homologues from...... knowledge databases. For novel proteins where no annotated homologues exist, and for predicting the effects of sequence variants, it is desirable to have methods for predicting protein properties from sequence information only. Here, we present a prediction algorithm using deep neural networks to predict...... current state-of-the-art algorithms, including those relying on homology information. The method is available as a web server at http://www.cbs.dtu.dk/services/DeepLoc . Example code is available at https://github.com/JJAlmagro/subcellular_localization . The dataset is available at http...

  8. Can the traffic locus of control (T-LOC) scale be successfully used to predict Swedish drivers' speeding behaviour?

    Science.gov (United States)

    Warner, Henriette Wallén; Ozkan, Türker; Lajunen, Timo

    2010-07-01

    The first aim of the present study was to examine the factor structure of the traffic locus of control (T-LOC) scale in a Swedish sample of drivers. The second aim was to examine if this scale can be used to predict drivers' speeding behaviour. A sample of Swedish car owners (N=223) completed a questionnaire including questions based on the traffic locus of control (T-LOC) scale as well as questions about their speeding behaviour. The results showed a five factor solution including own skills, own behaviour, other drivers, vehicle/environment and fate. Own behaviour and vehicle/environment could be used to predict drivers' speeding behaviour on roads with a 90 km/h speed limit while none of the variables included in the traffic locus of control (T-LOC) scale could be used to predict drivers' speeding behaviour on roads with a 50 km/h speed limit. On 90 km/h roads own behaviour was positively related to drivers' speeding behaviour while vehicle/environment was negatively related to their speeding behaviour. Copyright 2010 Elsevier Ltd. All rights reserved.

  9. MU-LOC: A Machine-Learning Method for Predicting Mitochondrially Localized Proteins in Plants

    DEFF Research Database (Denmark)

    Zhang, Ning; Rao, R Shyama Prasad; Salvato, Fernanda

    2018-01-01

    -sequence or a multitude of internal signals. Compared with experimental approaches, computational predictions provide an efficient way to infer subcellular localization of a protein. However, it is still challenging to predict plant mitochondrially localized proteins accurately due to various limitations. Consequently......, the performance of current tools can be improved with new data and new machine-learning methods. We present MU-LOC, a novel computational approach for large-scale prediction of plant mitochondrial proteins. We collected a comprehensive dataset of plant subcellular localization, extracted features including amino...

  10. iLoc-Animal: a multi-label learning classifier for predicting subcellular localization of animal proteins.

    Science.gov (United States)

    Lin, Wei-Zhong; Fang, Jian-An; Xiao, Xuan; Chou, Kuo-Chen

    2013-04-05

    Predicting protein subcellular localization is a challenging problem, particularly when query proteins have multi-label features meaning that they may simultaneously exist at, or move between, two or more different subcellular location sites. Most of the existing methods can only be used to deal with the single-label proteins. Actually, multi-label proteins should not be ignored because they usually bear some special function worthy of in-depth studies. By introducing the "multi-label learning" approach, a new predictor, called iLoc-Animal, has been developed that can be used to deal with the systems containing both single- and multi-label animal (metazoan except human) proteins. Meanwhile, to measure the prediction quality of a multi-label system in a rigorous way, five indices were introduced; they are "Absolute-True", "Absolute-False" (or Hamming-Loss"), "Accuracy", "Precision", and "Recall". As a demonstration, the jackknife cross-validation was performed with iLoc-Animal on a benchmark dataset of animal proteins classified into the following 20 location sites: (1) acrosome, (2) cell membrane, (3) centriole, (4) centrosome, (5) cell cortex, (6) cytoplasm, (7) cytoskeleton, (8) endoplasmic reticulum, (9) endosome, (10) extracellular, (11) Golgi apparatus, (12) lysosome, (13) mitochondrion, (14) melanosome, (15) microsome, (16) nucleus, (17) peroxisome, (18) plasma membrane, (19) spindle, and (20) synapse, where many proteins belong to two or more locations. For such a complicated system, the outcomes achieved by iLoc-Animal for all the aforementioned five indices were quite encouraging, indicating that the predictor may become a useful tool in this area. It has not escaped our notice that the multi-label approach and the rigorous measurement metrics can also be used to investigate many other multi-label problems in molecular biology. As a user-friendly web-server, iLoc-Animal is freely accessible to the public at the web-site .

  11. LocText

    DEFF Research Database (Denmark)

    Cejuela, Juan Miguel; Vinchurkar, Shrikant; Goldberg, Tatyana

    2018-01-01

    trees and was trained and evaluated on a newly improved LocTextCorpus. Combined with an automatic named-entity recognizer, LocText achieved high precision (P = 86%±4). After completing development, we mined the latest research publications for three organisms: human (Homo sapiens), budding yeast...

  12. Results of the first nuclear blowdown test on single fuel rods (LOC-11 Series in PBF)

    International Nuclear Information System (INIS)

    Larson, J.R.; Evans, D.R.; McCardell, R.K.

    1978-01-01

    This paper presents results of the first nuclear blowdown tests (LOC-11A, LOC-11B, LOC-11C) ever conducted. The Loss-of-Coolant Accident (LOCA) Test Series is being conducted in the Power Burst Facility (PBF) reactor at the Idaho National Engineering Laboratory, near Idaho Falls, Idaho, for the Nuclear Regulatory Commission. The objective of the LOC-11 tests was to obtain data on the behavior of pressurized and unpressurized rods when exposed to a blowdown similar to that expected in a pressurized water reactor (PWR) during a hypothesized double-ended cold-leg break. The data are being used for the development and verification of analytical models that are used to predict coolant and fuel rod pressure during a LOCA in a PWR

  13. Increased prognostic accuracy of TBI when a brain electrical activity biomarker is added to loss of consciousness (LOC).

    Science.gov (United States)

    Hack, Dallas; Huff, J Stephen; Curley, Kenneth; Naunheim, Roseanne; Ghosh Dastidar, Samanwoy; Prichep, Leslie S

    2017-07-01

    Extremely high accuracy for predicting CT+ traumatic brain injury (TBI) using a quantitative EEG (QEEG) based multivariate classification algorithm was demonstrated in an independent validation trial, in Emergency Department (ED) patients, using an easy to use handheld device. This study compares the predictive power using that algorithm (which includes LOC and amnesia), to the predictive power of LOC alone or LOC plus traumatic amnesia. ED patients 18-85years presenting within 72h of closed head injury, with GSC 12-15, were study candidates. 680 patients with known absence or presence of LOC were enrolled (145 CT+ and 535 CT- patients). 5-10min of eyes closed EEG was acquired using the Ahead 300 handheld device, from frontal and frontotemporal regions. The same classification algorithm methodology was used for both the EEG based and the LOC based algorithms. Predictive power was evaluated using area under the ROC curve (AUC) and odds ratios. The QEEG based classification algorithm demonstrated significant improvement in predictive power compared with LOC alone, both in improved AUC (83% improvement) and odds ratio (increase from 4.65 to 16.22). Adding RGA and/or PTA to LOC was not improved over LOC alone. Rapid triage of TBI relies on strong initial predictors. Addition of an electrophysiological based marker was shown to outperform report of LOC alone or LOC plus amnesia, in determining risk of an intracranial bleed. In addition, ease of use at point-of-care, non-invasive, and rapid result using such technology suggests significant value added to standard clinical prediction. Copyright © 2017 Elsevier Inc. All rights reserved.

  14. pLoc-mAnimal: predict subcellular localization of animal proteins with both single and multiple sites.

    Science.gov (United States)

    Cheng, Xiang; Zhao, Shu-Guang; Lin, Wei-Zhong; Xiao, Xuan; Chou, Kuo-Chen

    2017-11-15

    Cells are deemed the basic unit of life. However, many important functions of cells as well as their growth and reproduction are performed via the protein molecules located at their different organelles or locations. Facing explosive growth of protein sequences, we are challenged to develop fast and effective method to annotate their subcellular localization. However, this is by no means an easy task. Particularly, mounting evidences have indicated proteins have multi-label feature meaning that they may simultaneously exist at, or move between, two or more different subcellular location sites. Unfortunately, most of the existing computational methods can only be used to deal with the single-label proteins. Although the 'iLoc-Animal' predictor developed recently is quite powerful that can be used to deal with the animal proteins with multiple locations as well, its prediction quality needs to be improved, particularly in enhancing the absolute true rate and reducing the absolute false rate. Here we propose a new predictor called 'pLoc-mAnimal', which is superior to iLoc-Animal as shown by the compelling facts. When tested by the most rigorous cross-validation on the same high-quality benchmark dataset, the absolute true success rate achieved by the new predictor is 37% higher and the absolute false rate is four times lower in comparison with the state-of-the-art predictor. To maximize the convenience of most experimental scientists, a user-friendly web-server for the new predictor has been established at http://www.jci-bioinfo.cn/pLoc-mAnimal/, by which users can easily get their desired results without the need to go through the complicated mathematics involved. xxiao@gordonlifescience.org or kcchou@gordonlifescience.org. Supplementary data are available at Bioinformatics online. © The Author 2017. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com

  15. pLoc-mHum: predict subcellular localization of multi-location human proteins via general PseAAC to winnow out the crucial GO information.

    Science.gov (United States)

    Cheng, Xiang; Xiao, Xuan; Chou, Kuo-Chen

    2018-05-01

    For in-depth understanding the functions of proteins in a cell, the knowledge of their subcellular localization is indispensable. The current study is focused on human protein subcellular location prediction based on the sequence information alone. Although considerable efforts have been made in this regard, the problem is far from being solved yet. Most existing methods can be used to deal with single-location proteins only. Actually, proteins with multi-locations may have some special biological functions that are particularly important for both basic research and drug design. Using the multi-label theory, we present a new predictor called 'pLoc-mHum' by extracting the crucial GO (Gene Ontology) information into the general PseAAC (Pseudo Amino Acid Composition). Rigorous cross-validations on a same stringent benchmark dataset have indicated that the proposed pLoc-mHum predictor is remarkably superior to iLoc-Hum, the state-of-the-art method in predicting the human protein subcellular localization. To maximize the convenience of most experimental scientists, a user-friendly web-server for the new predictor has been established at http://www.jci-bioinfo.cn/pLoc-mHum/, by which users can easily get their desired results without the need to go through the complicated mathematics involved. xcheng@gordonlifescience.org. Supplementary data are available at Bioinformatics online.

  16. GridiLoc: A Backtracking Grid Filter for Fusing the Grid Model with PDR Using Smartphone Sensors

    Directory of Open Access Journals (Sweden)

    Jianga Shang

    2016-12-01

    Full Text Available Although map filtering-aided Pedestrian Dead Reckoning (PDR is capable of largely improving indoor localization accuracy, it becomes less efficient when coping with highly complex indoor spaces. For instance, indoor spaces with a few close corners or neighboring passages can lead to particles entering erroneous passages, which can further cause the failure of subsequent tracking. To address this problem, we propose GridiLoc, a reliable and accurate pedestrian indoor localization method through the fusion of smartphone sensors and a grid model. The key novelty of GridiLoc is the utilization of a backtracking grid filter for improving localization accuracy and for handling dead ending issues. In order to reduce the time consumption of backtracking, a topological graph is introduced for representing candidate backtracking points, which are the expected locations at the starting time of the dead ending. Furthermore, when the dead ending is caused by the erroneous step length model of PDR, our solution can automatically calibrate the model by using the historical tracking data. Our experimental results show that GridiLoc achieves a higher localization accuracy and reliability compared with the commonly-used map filtering approach. Meanwhile, it maintains an acceptable computational complexity.

  17. pLoc-mVirus: Predict subcellular localization of multi-location virus proteins via incorporating the optimal GO information into general PseAAC.

    Science.gov (United States)

    Cheng, Xiang; Xiao, Xuan; Chou, Kuo-Chen

    2017-09-10

    Knowledge of subcellular locations of proteins is crucially important for in-depth understanding their functions in a cell. With the explosive growth of protein sequences generated in the postgenomic age, it is highly demanded to develop computational tools for timely annotating their subcellular locations based on the sequence information alone. The current study is focused on virus proteins. Although considerable efforts have been made in this regard, the problem is far from being solved yet. Most existing methods can be used to deal with single-location proteins only. Actually, proteins with multi-locations may have some special biological functions. This kind of multiplex proteins is particularly important for both basic research and drug design. Using the multi-label theory, we present a new predictor called "pLoc-mVirus" by extracting the optimal GO (Gene Ontology) information into the general PseAAC (Pseudo Amino Acid Composition). Rigorous cross-validation on a same stringent benchmark dataset indicated that the proposed pLoc-mVirus predictor is remarkably superior to iLoc-Virus, the state-of-the-art method in predicting virus protein subcellular localization. To maximize the convenience of most experimental scientists, a user-friendly web-server for the new predictor has been established at http://www.jci-bioinfo.cn/pLoc-mVirus/, by which users can easily get their desired results without the need to go through the complicated mathematics involved. Copyright © 2017 Elsevier B.V. All rights reserved.

  18. pLoc-mPlant: predict subcellular localization of multi-location plant proteins by incorporating the optimal GO information into general PseAAC.

    Science.gov (United States)

    Cheng, Xiang; Xiao, Xuan; Chou, Kuo-Chen

    2017-08-22

    One of the fundamental goals in cellular biochemistry is to identify the functions of proteins in the context of compartments that organize them in the cellular environment. To realize this, it is indispensable to develop an automated method for fast and accurate identification of the subcellular locations of uncharacterized proteins. The current study is focused on plant protein subcellular location prediction based on the sequence information alone. Although considerable efforts have been made in this regard, the problem is far from being solved yet. Most of the existing methods can be used to deal with single-location proteins only. Actually, proteins with multi-locations may have some special biological functions. This kind of multiplex protein is particularly important for both basic research and drug design. Using the multi-label theory, we present a new predictor called "pLoc-mPlant" by extracting the optimal GO (Gene Ontology) information into the Chou's general PseAAC (Pseudo Amino Acid Composition). Rigorous cross-validation on the same stringent benchmark dataset indicated that the proposed pLoc-mPlant predictor is remarkably superior to iLoc-Plant, the state-of-the-art method for predicting plant protein subcellular localization. To maximize the convenience of most experimental scientists, a user-friendly web-server for the new predictor has been established at , by which users can easily get their desired results without the need to go through the complicated mathematics involved.

  19. LocExpress: a web server for efficiently estimating expression of novel transcripts.

    Science.gov (United States)

    Hou, Mei; Tian, Feng; Jiang, Shuai; Kong, Lei; Yang, Dechang; Gao, Ge

    2016-12-22

    The temporal and spatial-specific expression pattern of a transcript in multiple tissues and cell types can indicate key clues about its function. While several gene atlas available online as pre-computed databases for known gene models, it's still challenging to get expression profile for previously uncharacterized (i.e. novel) transcripts efficiently. Here we developed LocExpress, a web server for efficiently estimating expression of novel transcripts across multiple tissues and cell types in human (20 normal tissues/cells types and 14 cell lines) as well as in mouse (24 normal tissues/cell types and nine cell lines). As a wrapper to RNA-Seq quantification algorithm, LocExpress efficiently reduces the time cost by making abundance estimation calls increasingly within the minimum spanning bundle region of input transcripts. For a given novel gene model, such local context-oriented strategy allows LocExpress to estimate its FPKMs in hundreds of samples within minutes on a standard Linux box, making an online web server possible. To the best of our knowledge, LocExpress is the only web server to provide nearly real-time expression estimation for novel transcripts in common tissues and cell types. The server is publicly available at http://loc-express.cbi.pku.edu.cn .

  20. HybridGO-Loc: mining hybrid features on gene ontology for predicting subcellular localization of multi-location proteins.

    Science.gov (United States)

    Wan, Shibiao; Mak, Man-Wai; Kung, Sun-Yuan

    2014-01-01

    Protein subcellular localization prediction, as an essential step to elucidate the functions in vivo of proteins and identify drugs targets, has been extensively studied in previous decades. Instead of only determining subcellular localization of single-label proteins, recent studies have focused on predicting both single- and multi-location proteins. Computational methods based on Gene Ontology (GO) have been demonstrated to be superior to methods based on other features. However, existing GO-based methods focus on the occurrences of GO terms and disregard their relationships. This paper proposes a multi-label subcellular-localization predictor, namely HybridGO-Loc, that leverages not only the GO term occurrences but also the inter-term relationships. This is achieved by hybridizing the GO frequencies of occurrences and the semantic similarity between GO terms. Given a protein, a set of GO terms are retrieved by searching against the gene ontology database, using the accession numbers of homologous proteins obtained via BLAST search as the keys. The frequency of GO occurrences and semantic similarity (SS) between GO terms are used to formulate frequency vectors and semantic similarity vectors, respectively, which are subsequently hybridized to construct fusion vectors. An adaptive-decision based multi-label support vector machine (SVM) classifier is proposed to classify the fusion vectors. Experimental results based on recent benchmark datasets and a new dataset containing novel proteins show that the proposed hybrid-feature predictor significantly outperforms predictors based on individual GO features as well as other state-of-the-art predictors. For readers' convenience, the HybridGO-Loc server, which is for predicting virus or plant proteins, is available online at http://bioinfo.eie.polyu.edu.hk/HybridGoServer/.

  1. Status Report on the LOC ASIC

    CERN Document Server

    Ye, J

    2008-01-01

    Based on a commercially available 0.25 μm Silicon on Sapphire CMOS technology, we are developing the LOC ASIC for high speed serial data transmission in the front-end electronics systems of the ATLAS upgrade for the SLHC1. Evaluation of this technology for applications in the SLHC, based on a dedicated test chip, has been performed with irradiation tests in gamma (Co-60) and in 230 MeV proton beams. Test results indicate that this may be a candidate technology of ASIC developments for the SLHC. More thorough evaluation tests will be carried out under another R&D program supported through the Advanced Detector Research (ADR) from the Department of Energy. Characterization tests on the first prototype serializer, LOC1, have been carried out in lab. Based on the lessons learned from this chip, we propose a new architecture design of the second prototype, LOC2, aiming for a serial data rate in the range of 5 Gbps. Simulation on key components of LOC2 are being carried out and the results we have so far are p...

  2. Crystal structure of Homo sapiens protein LOC79017

    Energy Technology Data Exchange (ETDEWEB)

    Bae, Euiyoung; Bingman, Craig A.; Aceti, David J.; Phillips, Jr., George N. (UW)

    2010-02-08

    LOC79017 (MW 21.0 kDa, residues 1-188) was annotated as a hypothetical protein encoded by Homo sapiens chromosome 7 open reading frame 24. It was selected as a target by the Center for Eukaryotic Structural Genomics (CESG) because it did not share more than 30% sequence identity with any protein for which the three-dimensional structure is known. The biological function of the protein has not been established yet. Parts of LOC79017 were identified as members of uncharacterized Pfam families (residues 1-95 as PB006073 and residues 104-180 as PB031696). BLAST searches revealed homologues of LOC79017 in many eukaryotes, but none of them have been functionally characterized. Here, we report the crystal structure of H. sapiens protein LOC79017 (UniGene code Hs.530024, UniProt code O75223, CESG target number go.35223).

  3. A Preliminary Examination of Loss of Control Eating Disorder (LOC-ED) in Middle Childhood

    Science.gov (United States)

    Matherne, Camden E.; Tanofsky-Kraff, Marian; Altschul, Anne M.; Shank, Lisa M.; Schvey, Natasha A.; Brady, Sheila M.; Galescu, Ovidiu; Demidowich, Andrew P.; Yanovski, Susan Z.; Yanovski, Jack A.

    2015-01-01

    Loss of Control Eating Disorder (LOC-ED) has been proposed as a diagnostic category for children 6–12y with binge-type eating. However, characteristics of youth with LOC-ED have not been examined. We tested the hypothesis that the proposed criteria for LOC-ED would identify children with greater adiposity, more disordered eating attitudes, and greater mood disturbance than those without LOC-ED. Participants were 251 youth (10.29y ± 1.54, 53.8% female, 57.8 % White, 35.5% Black, 2.0% Asian, 4.8% Hispanic, 53.0% overweight). Youth were interviewed regarding eating attitudes and behaviors, completed questionnaires to assess general psychopathology, and underwent measurements of body fat mass. Using previously proposed criteria for LOC-ED, children were classified as LOC-ED (n = 19), LOC in the absence of the full disorder (subLOC, n = 33), and youth not reporting LOC (noLOC, n = 199). LOC-ED youth had higher BMIz (p = 0.001) and adiposity (p = 0.003) and reported greater disordered eating concerns (p eating attitudes (p = 0.02). SubLOC youth had greater disordered eating concerns (p eating cognitions and anthropometric measures compared to youth without LOC-ED. Longitudinal studies are needed to determine if those with LOC-ED are at particularly increased risk for progression of disordered eating and excess weight gain. PMID:25913008

  4. A preliminary examination of Loss of Control Eating Disorder (LOC-ED) in middle childhood.

    Science.gov (United States)

    Matherne, Camden E; Tanofsky-Kraff, Marian; Altschul, Anne M; Shank, Lisa M; Schvey, Natasha A; Brady, Sheila M; Galescu, Ovidiu; Demidowich, Andrew P; Yanovski, Susan Z; Yanovski, Jack A

    2015-08-01

    Loss of Control Eating Disorder (LOC-ED) has been proposed as a diagnostic category for children 6-12years with binge-type eating. However, characteristics of youth with LOC-ED have not been examined. We tested the hypothesis that the proposed criteria for LOC-ED would identify children with greater adiposity, more disordered eating attitudes, and greater mood disturbance than those without LOC-ED. Participants were 251 youth (10.29years±1.54, 53.8% female, 57.8% White, 35.5% Black, 2.0% Asian, 4.8% Hispanic, 53.0% overweight). Youth were interviewed regarding eating attitudes and behaviors, completed questionnaires to assess general psychopathology, and underwent measurements of body fat mass. Using previously proposed criteria for LOC-ED, children were classified as LOC-ED (n=19), LOC in the absence of the full disorder (subLOC, n=33), and youth not reporting LOC (noLOC, n=199). LOC-ED youth had higher BMIz (p=0.001) and adiposity (p=0.003) and reported greater disordered eating concerns (pdisordered eating attitudes (p=0.02). SubLOC youth had greater disordered eating concerns (pdisordered eating cognitions and anthropometric measures compared to youth without LOC-ED. Longitudinal studies are needed to determine if those with LOC-ED are at particularly increased risk for progression of disordered eating and excess weight gain. Published by Elsevier Ltd.

  5. dLocAuth: a dynamic multifactor authentication scheme for mCommerce applications using independent location-based obfuscation

    Science.gov (United States)

    Kuseler, Torben; Lami, Ihsan A.

    2012-06-01

    This paper proposes a new technique to obfuscate an authentication-challenge program (named LocProg) using randomly generated data together with a client's current location in real-time. LocProg can be used to enable any handsetapplication on mobile-devices (e.g. mCommerce on Smartphones) that requires authentication with a remote authenticator (e.g. bank). The motivation of this novel technique is to a) enhance the security against replay attacks, which is currently based on using real-time nonce(s), and b) add a new security factor, which is location verified by two independent sources, to challenge / response methods for authentication. To assure a secure-live transaction, thus reducing the possibility of replay and other remote attacks, the authors have devised a novel technique to obtain the client's location from two independent sources of GPS on the client's side and the cellular network on authenticator's side. The algorithm of LocProg is based on obfuscating "random elements plus a client's data" with a location-based key, generated on the bank side. LocProg is then sent to the client and is designed so it will automatically integrate into the target application on the client's handset. The client can then de-obfuscate LocProg if s/he is within a certain range around the location calculated by the bank and if the correct personal data is supplied. LocProg also has features to protect against trial/error attacks. Analysis of LocAuth's security (trust, threat and system models) and trials based on a prototype implementation (on Android platform) prove the viability and novelty of LocAuth.

  6. VeLoc: Finding Your Car in Indoor Parking Structures.

    Science.gov (United States)

    Gao, Ruipeng; He, Fangpu; Li, Teng

    2018-05-02

    While WiFi-based indoor localization is attractive, there are many indoor places without WiFi coverage with a strong demand for localization capability. This paper describes a system and associated algorithms to address the indoor vehicle localization problem without the installation of additional infrastructure. In this paper, we propose VeLoc, which utilizes the sensor data of smartphones in the vehicle together with the floor map of the parking structure to track the vehicle in real time. VeLoc simultaneously harnesses constraints imposed by the map and environment sensing. All these cues are codified into a novel augmented particle filtering framework to estimate the position of the vehicle. Experimental results show that VeLoc performs well when even the initial position and the initial heading direction of the vehicle are completely unknown.

  7. Long non-coding RNA Loc554202 regulates proliferation and migration in breast cancer cells

    Energy Technology Data Exchange (ETDEWEB)

    Shi, Yongguo, E-mail: 1138303166@qq.com [Department of Oncology, Second Affiliated Hospital, Nanjing Medical University, Nanjing, Jiangsu (China); Lu, Jianwei, E-mail: jianwei2010077@163.com [Cancer Hospital of Jiangsu Province, Nanjing, Jiangsu (China); Zhou, Jing, E-mail: 2310848@163.com [Department of Oncology, Taizhou People’ Hospital, Taizhou, Jiangsu (China); Tan, Xueming, E-mail: 843039795@qq.com [Department of Gastroenterology, Second Affiliated Hospital, Nanjing Medical University, Nanjing, Jiangsu (China); He, Ye, E-mail: 2825636@qq.com [Department of Oncology, Second Affiliated Hospital, Nanjing Medical University, Nanjing, Jiangsu (China); Ding, Jie, E-mail: 9111165@qq.com [Department of Oncology, Second Affiliated Hospital, Nanjing Medical University, Nanjing, Jiangsu (China); Tian, Yun, E-mail: 1815857@qq.com [Department of Oncology, Second Affiliated Hospital, Nanjing Medical University, Nanjing, Jiangsu (China); Wang, Li, E-mail: 2376737@qq.com [Department of Oncology, Second Affiliated Hospital, Nanjing Medical University, Nanjing, Jiangsu (China); Wang, Keming, E-mail: wkmys@sohu.com [Department of Oncology, Second Affiliated Hospital, Nanjing Medical University, Nanjing, Jiangsu (China)

    2014-04-04

    Highlights: • First, we have shown that upregulated of the Loc554202 in breast cancer tissues. • Second, we demonstrated the function of Loc554202 in breast cancer cell. • Finally, we demonstrated that LOC554202 knockdown could inhibit tumor growth in vivo. - Abstract: Data derived from massive cloning and traditional sequencing methods have revealed that long non-coding RNAs (lncRNA) play important roles in the development and progression of cancer. Although many studies suggest that the lncRNAs have different cellular functions, many of them are not yet to be identified and characterized for the mechanism of their functions. To address this question, we assay the expression level of lncRNAs–Loc554202 in breast cancer tissues and find that Loc554202 is significantly increased compared with normal control, and associated with advanced pathologic stage and tumor size. Moreover, knockdown of Loc554202 decreased breast cancer cell proliferation, induced apoptosis and inhibits migration/invasion in vitro and impeded tumorigenesis in vivo. These data suggest an important role of Loc554202 in breast tumorigenesis.

  8. VeLoc: Finding Your Car in Indoor Parking Structures

    Directory of Open Access Journals (Sweden)

    Ruipeng Gao

    2018-05-01

    Full Text Available While WiFi-based indoor localization is attractive, there are many indoor places without WiFi coverage with a strong demand for localization capability. This paper describes a system and associated algorithms to address the indoor vehicle localization problem without the installation of additional infrastructure. In this paper, we propose VeLoc, which utilizes the sensor data of smartphones in the vehicle together with the floor map of the parking structure to track the vehicle in real time. VeLoc simultaneously harnesses constraints imposed by the map and environment sensing. All these cues are codified into a novel augmented particle filtering framework to estimate the position of the vehicle. Experimental results show that VeLoc performs well when even the initial position and the initial heading direction of the vehicle are completely unknown.

  9. Identifying Mechanisms that Predict Loss of Control (LOC) Eating Using Ecological Momentary Assessment: A pilot study

    Science.gov (United States)

    2013-08-30

    not with substance abuse or generalized anxiety (241 ). Furthermore, BED participants were more likely to have undergone therapy and have a family...depressed adolescents by Mufson and colleagues (140). Interpersonal therapy for depressed adolescents (termed IPT-A) focuses on current interpersonal...associated with meals labeled as binges and involving LOC (219). In another study involving measured intake of comfort food ( chocolate ) among 40 obese

  10. Algorithmic, LOCS and HOCS (chemistry) exam questions: performance and attitudes of college students

    Science.gov (United States)

    Zoller, Uri

    2002-02-01

    The performance of freshmen biology and physics-mathematics majors and chemistry majors as well as pre- and in-service chemistry teachers in two Israeli universities on algorithmic (ALG), lower-order cognitive skills (LOCS), and higher-order cognitive skills (HOCS) chemistry exam questions were studied. The driving force for the study was an interest in moving science and chemistry instruction from an algorithmic and factual recall orientation dominated by LOCS, to a decision-making, problem-solving and critical system thinking approach, dominated by HOCS. College students' responses to the specially designed ALG, LOCS and HOCS chemistry exam questions were scored and analysed for differences and correlation between the performance means within and across universities by the questions' category. This was followed by a combined student interview - 'speaking aloud' problem solving session for assessing the thinking processes involved in solving these types of questions and the students' attitudes towards them. The main findings were: (1) students in both universities performed consistently in each of the three categories in the order of ALG > LOCS > HOCS; their 'ideological' preference, was HOCS > algorithmic/LOCS, - referred to as 'computational questions', but their pragmatic preference was the reverse; (2) success on algorithmic/LOCS does not imply success on HOCS questions; algorithmic questions constitute a category on its own as far as students success in solving them is concerned. Our study and its results support the effort being made, worldwide, to integrate HOCS-fostering teaching and assessment strategies and, to develop HOCS-oriented science-technology-environment-society (STES)-type curricula within science and chemistry education.

  11. Fuel-rod response during the large-break LOCA Test LOC-6

    International Nuclear Information System (INIS)

    Vinjamuri, K.; Cook, B.A.; Hobbins, R.R.

    1981-01-01

    The large break Loss of Coolant Accident (LOCA) Test LOC-6 was conducted in the Power Burst Facility (PBF) at the Idaho National Engineering Laboratory by EG and G Idaho, Inc. The objectives of the PBF LOCA tests are to obtain in-pile cladding ballooning data under blowdown and reflood conditions and assess how well out-of-pile ballooning data represent in-pile fuel rod behavior. The primary objective of the LOC-6 test was to determine the effects of internal rod pressures and prior irradiation on the deformation behavior of fuel rods that reached cladding temperatures high in the alpha phase of zircaloy. Test LOC-6 was conducted with four rods of PWR 15 x 15 design with the exception of fuel stack length (89 cm) and enrichment (12.5 W% 235 U). Each rod was surrounded by an individual flow shroud

  12. Physiologically Based Pharmacokinetic Modeling in Lead Optimization. 1. Evaluation and Adaptation of GastroPlus To Predict Bioavailability of Medchem Series.

    Science.gov (United States)

    Daga, Pankaj R; Bolger, Michael B; Haworth, Ian S; Clark, Robert D; Martin, Eric J

    2018-03-05

    When medicinal chemists need to improve bioavailability (%F) within a chemical series during lead optimization, they synthesize new series members with systematically modified properties mainly by following experience and general rules of thumb. More quantitative models that predict %F of proposed compounds from chemical structure alone have proven elusive. Global empirical %F quantitative structure-property (QSPR) models perform poorly, and projects have too little data to train local %F QSPR models. Mechanistic oral absorption and physiologically based pharmacokinetic (PBPK) models simulate the dissolution, absorption, systemic distribution, and clearance of a drug in preclinical species and humans. Attempts to build global PBPK models based purely on calculated inputs have not achieved the optimization. In this work, local GastroPlus PBPK models are instead customized for individual medchem series. The key innovation was building a local QSPR for a numerically fitted effective intrinsic clearance (CL loc ). All inputs are subsequently computed from structure alone, so the models can be applied in advance of synthesis. Training CL loc on the first 15-18 rat %F measurements gave adequate predictions, with clear improvements up to about 30 measurements, and incremental improvements beyond that.

  13. LocZ Is a New Cell Division Protein Involved in Proper Septum Placement in Streptococcus pneumoniae

    Science.gov (United States)

    Holečková, Nela; Molle, Virginie; Buriánková, Karolína; Benada, Oldřich; Kofroňová, Olga; Ulrych, Aleš; Branny, Pavel

    2014-01-01

    ABSTRACT How bacteria control proper septum placement at midcell, to guarantee the generation of identical daughter cells, is still largely unknown. Although different systems involved in the selection of the division site have been described in selected species, these do not appear to be widely conserved. Here, we report that LocZ (Spr0334), a newly identified cell division protein, is involved in proper septum placement in Streptococcus pneumoniae. We show that locZ is not essential but that its deletion results in cell division defects and shape deformation, causing cells to divide asymmetrically and generate unequally sized, occasionally anucleated, daughter cells. LocZ has a unique localization profile. It arrives early at midcell, before FtsZ and FtsA, and leaves the septum early, apparently moving along with the equatorial rings that mark the future division sites. Consistently, cells lacking LocZ also show misplacement of the Z-ring, suggesting that it could act as a positive regulator to determine septum placement. LocZ was identified as a substrate of the Ser/Thr protein kinase StkP, which regulates cell division in S. pneumoniae. Interestingly, homologues of LocZ are found only in streptococci, lactococci, and enterococci, indicating that this close phylogenetically related group of bacteria evolved a specific solution to spatially regulate cell division. PMID:25550321

  14. Blowdown mass flow measurements during the Power Burst Facility LOC-11C test

    International Nuclear Information System (INIS)

    Broughton, J.M.; MacDonald, P.E.

    1979-01-01

    An interpretation and evaluation of the two-phase coolant mass flow measurements obtained during Test LOC-11C performed in the Power Burst Facility (PBF) at the Idaho National Engineering Laboratory (INEL) are presented. Although a density gradient existed within the pipe between 1 and 6 s, the homogeneous flow model used to calculate the coolant mass flow from the measured mixture density, momentum flux, and volumetric flow was found to be generally satisfactory. A cross-sectional average density was determined by fitting a linear density gradient through the upper and lower chordal densities obtained from a three-beam gamma densitometer and then combining the result with the middle beam density. The integrated measured coolant mass flow was subsequently found to be within 5% if the initial mass inventory of the PBF loss-of-coolant accident (LOCA) system. The posttest calculations using the RELAP4/MOD6 computer code to determine coolant mass flow for Test LOC-11C also agreed well with the measured data

  15. Measurement of the complete core plasma flow across the LOC-SOC transition at ASDEX Upgrade

    Science.gov (United States)

    Lebschy, A.; McDermott, R. M.; Angioni, C.; Geiger, B.; Prisiazhniuk, D.; Cavedon, M.; Conway, G. D.; Dux, R.; Dunne, M. G.; Kappatou, A.; Pütterich, T.; Stroth, U.; Viezzer, E.; the ASDEX Upgrade Team

    2018-02-01

    A newly installed core charge exchange recombination spectroscopy (CXRS) diagnostic at ASDEX Upgrade (AUG) enables the evaluation of the core poloidal rotation (upol ) through the inboard-outboard asymmetry of the toroidal rotation with an accuracy of 0.5 to 1 km s-1 . Using this technique, the total plasma flow has been measured in Ohmic L-mode plasmas across the transition from the linear to saturated ohmic confinement (LOC-SOC) regimes. The core poloidal rotation of the plasma around mid-radius is found to be always in the ion diamagnetic direction, in disagreement with neoclassical (NC) predictions. The edge rotation is found to be electron-directed and consistent with NC codes. This measurement provides as well the missing ingredient to evaluate the core E×B velocity (uE×B ) from data only, which can then be compared to measurements of the perpendicular velocity of the turbulent fluctuations (u\\perp ) to gain information on the turbulent phase velocity (vph ). The non neoclassical upol from CXRS leads to good agreement between uE×B and u\\perp indicating that vph is small and at similar values as found with gyrokinetic simulations. Moreover, the data shows a shift of vph in the ion-diamagnetic direction at the edge after the transition from LOC to SOC consistent with a change in the dominant turbulence regime. The upgrade of the core CXRS system provides as well a deeper insight into the intrinsic rotation. This paper shows that the reversal of the core toroidal rotation occurs clearly after the LOC-SOC transition and concomitant with the peaking of the electron density.

  16. Selective in situ functionalization of biosensors on LOC devices using laminar co-flow

    DEFF Research Database (Denmark)

    Parra-Cabrera, C.; Sporer, C.; Rodriguez-Villareal, I.

    2012-01-01

    Many applications involving lab-on-a-chip (LOC) devices are prevented from entering the market because of difficulties to achieve mass production and impart suitable properties allowing long-term storage. To integrate biosensors on these microfluidic chips, one of the main restrictions...... is the fabrication and stability of the molecular modifications that must be performed on the surfaces of the sensors for a given application. The complexity of the problem increases exponentially when the LOC integrates several of these sensors. Here we present a system based on laminar co-flow to perform an on...

  17. Genetic and functional dissection of HTRA1 and LOC387715 in age-related macular degeneration.

    Directory of Open Access Journals (Sweden)

    Zhenglin Yang

    2010-02-01

    Full Text Available A common haplotype on 10q26 influences the risk of age-related macular degeneration (AMD and encompasses two genes, LOC387715 and HTRA1. Recent data have suggested that loss of LOC387715, mediated by an insertion/deletion (in/del that destabilizes its message, is causally related with the disorder. Here we show that loss of LOC387715 is insufficient to explain AMD susceptibility, since a nonsense mutation (R38X in this gene that leads to loss of its message resides in a protective haplotype. At the same time, the common disease haplotype tagged by the in/del and rs11200638 has an effect on the transcriptional upregulation of the adjacent gene, HTRA1. These data implicate increased HTRA1 expression in the pathogenesis of AMD and highlight the importance of exploring multiple functional consequences of alleles in haplotypes that confer susceptibility to complex traits.

  18. Operational requirements for avoidance and eventual elimination of Gz-induced loss of consciousness (G-LOC) in flight.

    Science.gov (United States)

    Wood, E

    1993-02-01

    Fifty years of more or less active research experiences concerning the cardiovascular, respiratory, and neurologic dynamics of G-LOC carried out in healthy humans, both on centrifuges and in flight, have convinced me that on the basis of the physiology involved and because of the risk of the very high cost in pilot lives and their planes due to G-LOC, three operational requirements should be adopted as follows. Operational Requirement I. A noninvasive continuous on-line, real-time recording of arterial pulsations at brain level should be a mandatory requirement for every human centrifuge exposure to Gz accelerations that carry an appreciable likelihood of loss of vision and/or consciousness. A similar system should be a mandatory requirement for every pilot when performing high G air-to-air or air-to-ground combat maneuvers both in training and in actual combat conditions. Operational Requirement II. A physiological G-LOC forewarning system based on arterial pulsations at head level coupled with a last-resort automatic plane recovery system should be installed in all advanced fighter aircraft. Operational Requirement III. Because of the inherent biomedical hazards associated with very high Gz protection and the risk of G-LOC when in conventional upright or partially supinated positions, an automatic 9 Gz or greater activated timer, G-LOC avoidance system should be installed in advanced fighter aircraft. This system should be set to activate an auditory G-LOC forewarning signal when a Gz level of more than 9 is maintained for 3 seconds, i.e., a period less than the cerebral anoxic reserve time. Failure of pilot response, that is, maintenance of Gz levels of greater than 9 for more than 4 seconds following this forewarning signal (i.e., a total sustained very high period of 6-7 seconds, a period equal to the average human cerebral anoxic reserve time), then activates a follow-on automatic plane recovery system.

  19. Investigating and Promoting Trainee Science Teachers' Conceptual Change of the Nature of Science with Digital Dialogue Games `InterLoc'

    Science.gov (United States)

    Mansour, Nasser; Wegerif, Rupert; Skinner, Nigel; Postlethwaite, Keith; Hetherington, Lindsay

    2016-10-01

    The purpose of this study is to explore how an online-structured dialogue environment supported (OSDE) collaborative learning about the nature of science among a group of trainee science teachers in the UK. The software used (InterLoc) is a linear text-based tool, designed to support structured argumentation with openers and `dialogue moves'. A design-based research approach was used to investigate multiple sessions using InterLoc with 65 trainee science teachers. Five participants who showed differential conceptual change in terms of their Nature of Science (NOS) views were purposively selected and closely followed throughout the study by using key event recall interviews. Initially, the majority of participants held naïve views of NOS. Substantial and favourable changes in these views were evident as a result of the OSDE. An examination of the development of the five participants' NOS views indicated that the effectiveness of the InterLoc discussions was mediated by cultural, cognitive, and experiential factors. The findings suggest that InterLoc can be effective in promoting reflection and conceptual change.

  20. Credit Card Misuse, Money Attitudes, and Compulsive Buying Behaviors: A Comparison of Internal and External Locus of Control (LOC) Consumers

    Science.gov (United States)

    Watson, Stevie

    2009-01-01

    This study examined attitudinal and behavioral differences between internal and external locus of control (LOC) consumers on credit card misuse, the importance of money, and compulsive buying. Using multiple analysis of variance and separate analyses of variance, internal LOC consumers were found to have lower scores on credit card misuse and…

  1. Quantitative Analysis of Lens Nuclear Density Using Optical Coherence Tomography (OCT with a Liquid Optics Interface: Correlation between OCT Images and LOCS III Grading

    Directory of Open Access Journals (Sweden)

    You Na Kim

    2016-01-01

    Full Text Available Purpose. To quantify whole lens and nuclear lens densities using anterior-segment optical coherence tomography (OCT with a liquid optics interface and evaluate their correlation with Lens Opacities Classification System III (LOCS III lens grading and corrected distance visual acuity (BCVA. Methods. OCT images of the whole lens and lens nucleus of eyes with age-related nuclear cataract were analyzed using ImageJ software. The lens grade and nuclear density were represented in pixel intensity units (PIU and correlations between PIU, BCVA, and LOCS III were assessed. Results. Forty-seven eyes were analyzed. The mean whole lens and lens nuclear densities were 26.99 ± 5.23 and 19.43 ± 6.15 PIU, respectively. A positive linear correlation was observed between lens opacities (R2 = 0.187, p<0.01 and nuclear density (R2 = 0.316, p<0.01 obtained from OCT images and LOCS III. Preoperative BCVA and LOCS III were also positively correlated (R2 = 0.454, p<0.01. Conclusions. Whole lens and lens nuclear densities obtained from OCT correlated with LOCS III. Nuclear density showed a higher positive correlation with LOCS III than whole lens density. OCT with a liquid optics interface is a potential quantitative method for lens grading and can aid in monitoring and managing age-related cataracts.

  2. Cabin Environment Physics Risk Model

    Science.gov (United States)

    Mattenberger, Christopher J.; Mathias, Donovan Leigh

    2014-01-01

    This paper presents a Cabin Environment Physics Risk (CEPR) model that predicts the time for an initial failure of Environmental Control and Life Support System (ECLSS) functionality to propagate into a hazardous environment and trigger a loss-of-crew (LOC) event. This physics-of failure model allows a probabilistic risk assessment of a crewed spacecraft to account for the cabin environment, which can serve as a buffer to protect the crew during an abort from orbit and ultimately enable a safe return. The results of the CEPR model replace the assumption that failure of the crew critical ECLSS functionality causes LOC instantly, and provide a more accurate representation of the spacecraft's risk posture. The instant-LOC assumption is shown to be excessively conservative and, moreover, can impact the relative risk drivers identified for the spacecraft. This, in turn, could lead the design team to allocate mass for equipment to reduce overly conservative risk estimates in a suboptimal configuration, which inherently increases the overall risk to the crew. For example, available mass could be poorly used to add redundant ECLSS components that have a negligible benefit but appear to make the vehicle safer due to poor assumptions about the propagation time of ECLSS failures.

  3. Predicting the Consequences of MMOD Penetrations on the International Space Station

    Science.gov (United States)

    Hyde, James; Christiansen, E.; Lear, D.; Evans

    2018-01-01

    The threat from micrometeoroid and orbital debris (MMOD) impacts on space vehicles is often quantified in terms of the probability of no penetration (PNP). However, for large spacecraft, especially those with multiple compartments, a penetration may have a number of possible outcomes. The extent of the damage (diameter of hole, crack length or penetration depth), the location of the damage relative to critical equipment or crew, crew response, and even the time of day of the penetration are among the many factors that can affect the outcome. For the International Space Station (ISS), a Monte-Carlo style software code called Manned Spacecraft Crew Survivability (MSCSurv) is used to predict the probability of several outcomes of an MMOD penetration-broadly classified as loss of crew (LOC), crew evacuation (Evac), loss of escape vehicle (LEV), and nominal end of mission (NEOM). By generating large numbers of MMOD impacts (typically in the billions) and tracking the consequences, MSCSurv allows for the inclusion of a large number of parameters and models as well as enabling the consideration of uncertainties in the models and parameters. MSCSurv builds upon the results from NASA's Bumper software (which provides the probability of penetration and critical input data to MSCSurv) to allow analysts to estimate the probability of LOC, Evac, LEV, and NEOM. This paper briefly describes the overall methodology used by NASA to quantify LOC, Evac, LEV, and NEOM with particular emphasis on describing in broad terms how MSCSurv works and its capabilities and most significant models.

  4. Gene ontology based transfer learning for protein subcellular localization

    Directory of Open Access Journals (Sweden)

    Zhou Shuigeng

    2011-02-01

    protein subcellular localization. We evaluate GO-TLM performance against three baseline models: MultiLoc, MultiLoc-GO and Euk-mPLoc on the benchmark datasets the baseline models adopted. 5-fold cross validation experiments show that GO-TLM achieves substantial accuracy improvement against the baseline models: 80.38% against model Euk-mPLoc 67.40% with 12.98% substantial increase; 96.65% and 96.27% against model MultiLoc-GO 89.60% and 89.60%, with 7.05% and 6.67% accuracy increase on dataset MultiLoc plant and dataset MultiLoc animal, respectively; 97.14%, 95.90% and 96.85% against model MultiLoc-GO 83.70%, 90.10% and 85.70%, with accuracy increase 13.44%, 5.8% and 11.15% on dataset BaCelLoc plant, dataset BaCelLoc fungi and dataset BaCelLoc animal respectively. For BaCelLoc independent sets, GO-TLM achieves 81.25%, 80.45% and 79.46% on dataset BaCelLoc plant holdout, dataset BaCelLoc plant holdout and dataset BaCelLoc animal holdout, respectively, as compared against baseline model MultiLoc-GO 76%, 60.00% and 73.00%, with accuracy increase 5.25%, 20.45% and 6.46%, respectively. Conclusions Since direct homology-based GO term transfer may be prone to introducing noise and outliers to the target protein, we design an explicitly weighted kernel learning system (called Gene Ontology Based Transfer Learning Model, GO-TLM to transfer to the target protein the known knowledge about related homologous proteins, which can reduce the risk of outliers and share knowledge between homologous proteins, and thus achieve better predictive performance for protein subcellular localization. Cross validation and independent test experimental results show that the homology-based GO term transfer and explicitly weighing the GO kernels substantially improve the prediction performance.

  5. The role of locus of control and coping style in predicting longitudinal PTSD-trajectories after combat exposure.

    Science.gov (United States)

    Karstoft, Karen-Inge; Armour, Cherie; Elklit, Ask; Solomon, Zahava

    2015-05-01

    While longitudinal posttraumatic stress responses are known to be heterogeneous, little is known about predictors of those responses. We investigated if locus of control (LOC) and coping style are associated with long-term PTSD-trajectories after exposure to combat. Six hundred and seventy five Israeli soldiers with or without combat stress reaction (CSR) from the Lebanon war were assessed 1, 2, and 20 years after the war. Combat exposure, LOC, and coping style were then investigated as covariates of the trajectories of resilience, recovery, delayed onset, and chronicity. Symptomatic trajectories in the CSR and the non-CSR group were significantly associated to varying degrees with perceived life threat during combat (ORs: 1.76-2.53), internal LOC (0.77-0.87), emotional coping style (0.28-0.34), and low use of problem-focused coping (2.12-3.11). In conclusion, assessment of LOC and coping can aid prediction of chronic PTSD outcomes of combat exposure. Copyright © 2015 Elsevier Ltd. All rights reserved.

  6. LocARNA-P: Accurate boundary prediction and improved detection of structural RNAs

    DEFF Research Database (Denmark)

    Will, Sebastian; Joshi, Tejal; Hofacker, Ivo L.

    2012-01-01

    Current genomic screens for noncoding RNAs (ncRNAs) predict a large number of genomic regions containing potential structural ncRNAs. The analysis of these data requires highly accurate prediction of ncRNA boundaries and discrimination of promising candidate ncRNAs from weak predictions. Existing...... methods struggle with these goals because they rely on sequence-based multiple sequence alignments, which regularly misalign RNA structure and therefore do not support identification of structural similarities. To overcome this limitation, we compute columnwise and global reliabilities of alignments based...... on sequence and structure similarity; we refer to these structure-based alignment reliabilities as STARs. The columnwise STARs of alignments, or STAR profiles, provide a versatile tool for the manual and automatic analysis of ncRNAs. In particular, we improve the boundary prediction of the widely used nc...

  7. Three-dimensional models of metal-poor stars

    OpenAIRE

    Collet, R.

    2008-01-01

    I present here the main results of recent realistic, 3D, hydrodynamical simulations of convection at the surface of metal-poor red giant stars. I discuss the application of these convection simulations as time-dependent, 3D, hydrodynamical model atmospheres to spectral line formation calculations and abundance analyses. The impact of 3D models on derived elemental abundances is investigated by means of a differential comparison of the line strengths predicted in 3D under the assumption of loc...

  8. Comparison between measured and predicted turbulence frequency spectra in ITG and TEM regimes

    Science.gov (United States)

    Citrin, J.; Arnichand, H.; Bernardo, J.; Bourdelle, C.; Garbet, X.; Jenko, F.; Hacquin, S.; Pueschel, M. J.; Sabot, R.

    2017-06-01

    The observation of distinct peaks in tokamak core reflectometry measurements—named quasi-coherent-modes (QCMs)—are identified as a signature of trapped-electron-mode (TEM) turbulence (Arnichand et al 2016 Plasma Phys. Control. Fusion 58 014037). This phenomenon is investigated with detailed linear and nonlinear gyrokinetic simulations using the Gene code. A Tore-Supra density scan is studied, which traverses through a linear (LOC) to saturated (SOC) ohmic confinement transition. The LOC and SOC phases are both simulated separately. In the LOC phase, where QCMs are observed, TEMs are robustly predicted unstable in linear studies. In the later SOC phase, where QCMs are no longer observed, ion-temperature-gradient (ITG) modes are identified. In nonlinear simulations, in the ITG (SOC) phase, a broadband spectrum is seen. In the TEM (LOC) phase, a clear emergence of a peak at the TEM frequencies is seen. This is due to reduced nonlinear frequency broadening of the underlying linear modes in the TEM regime compared with the ITG regime. A synthetic diagnostic of the nonlinearly simulated frequency spectra reproduces the features observed in the reflectometry measurements. These results support the identification of core QCMs as an experimental marker for TEM turbulence.

  9. Development of a portable analyzer with polymer lab-on-a-chip (LOC) for continuous sampling and monitoring of Pb(II).

    Science.gov (United States)

    Jang, A; Zou, Z; MacKnight, E; Wu, P M; Kim, I S; Ahn, C H; Bishop, P L

    2009-01-01

    A new portable analyzer with polymer lab-on-a-chip (LOC) has been designed, fabricated and fully characterized for continuous sampling and monitoring of lead (Pb(II)) in this work. As the working electrodes of the sensor, bismuth (Bi (III)) which allowed the advantage of being more environmentally friendly than traditional mercury drop electrodes was used, while maintaining similar sensitivity and other desirable characteristics. The size of a portable analyzer was 30 cmx23 cmx7 cm, and the weight was around 3 kg. The small size gives the advantage of being portable for field use while not sacrificing portability for accuracy of measurement. Furthermore, the autonomous system developed in coordination with the development of new polymer LOC integrated with electrochemical sensors can provide an innovative way to monitor surface waters in an efficient, cost-effective and sustainable manner.

  10. Pathways for scale and discipline reconciliation: current socio-ecological modelling methodologies to explore and reconstitute human prehistoric dynamics

    OpenAIRE

    Saqalli , Mehdi; Baum , Tilman

    2016-01-01

    International audience; This communication elaborates a plea for the necessity of a specific modelling methodology which does not sacrifice two modelling principles: explanation Micro and correlation Macro. Three goals are assigned to modelling strategies: describe, understand and predict. One tendency in historical and spatial modelling is to develop models at a micro level in order to describe and by that way, understand the connection between local ecological contexts, acquired through loc...

  11. GenLocDip: A Generalized Program to Calculate and Visualize Local Electric Dipole Moments.

    Science.gov (United States)

    Groß, Lynn; Herrmann, Carmen

    2016-09-30

    Local dipole moments (i.e., dipole moments of atomic or molecular subsystems) are essential for understanding various phenomena in nanoscience, such as solvent effects on the conductance of single molecules in break junctions or the interaction between the tip and the adsorbate in atomic force microscopy. We introduce GenLocDip, a program for calculating and visualizing local dipole moments of molecular subsystems. GenLocDip currently uses the Atoms-In-Molecules (AIM) partitioning scheme and is interfaced to various AIM programs. This enables postprocessing of a variety of electronic structure output formats including cube and wavefunction files, and, in general, output from any other code capable of writing the electron density on a three-dimensional grid. It uses a modified version of Bader's and Laidig's approach for achieving origin-independence of local dipoles by referring to internal reference points which can (but do not need to be) bond critical points (BCPs). Furthermore, the code allows the export of critical points and local dipole moments into a POVray readable input format. It is particularly designed for fragments of large systems, for which no BCPs have been calculated for computational efficiency reasons, because large interfragment distances prevent their identification, or because a local partitioning scheme different from AIM was used. The program requires only minimal user input and is written in the Fortran90 programming language. To demonstrate the capabilities of the program, examples are given for covalently and non-covalently bound systems, in particular molecular adsorbates. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  12. miR-31 and its host gene lncRNA LOC554202 are regulated by promoter hypermethylation in triple-negative breast cancer

    Directory of Open Access Journals (Sweden)

    Augoff Katarzyna

    2012-01-01

    Full Text Available Abstract Background microRNAs have been established as powerful regulators of gene expression in normal physiological as well as in pathological conditions, including cancer progression and metastasis. Recent studies have demonstrated a key role of miR-31 in the progression and metastasis of breast cancer. Downregulation of miR-31 enhances several steps of the invasion-metastasis cascade in breast cancer, i.e., local invasion, extravasation and survival in the circulation system, and metastatic colonization of distant sites. miR-31 exerts its metastasis-suppressor activity by targeting a cohort of pro-metastatic genes, including RhoA and WAVE3. The molecular mechanisms that lead to the loss of miR-31 and the activation of its pro-metastatic target genes during these specific steps of the invasion-metastasis cascade are however unknown. Results In the present report, we identify promoter hypermethylation as one of the major mechanisms for silencing miR-31 in breast cancer, and in the triple-negative breast cancer (TNBC cell lines of basal subtype, in particular. miR-31 maps to the intronic sequence of a novel long non-coding (lncRNA, LOC554202 and the regulation of its transcriptional activity is under control of LOC554202. Both miR-31 and the host gene LOC554202 are down-regulated in the TNBC cell lines of basal subtype and over-expressed in the luminal counterparts. Treatment of the TNBC cell lines with either a de-methylating agent alone or in combination with a de-acetylating agent resulted in a significant increase of both miR-31 and its host gene, suggesting an epigenetic mechanism for the silencing of these two genes by promoter hypermethylation. Finally, both methylation-specific PCR and sequencing of bisulfite-converted DNA demonstrated that the LOC554202 promoter-associated CpG island is heavily methylated in the TNBC cell lines and hypomethylated in the luminal subtypes. Conclusion Loss of miR-31 expression in TNBC cell lines is

  13. Laser subtractive-additive-welding microfabrication for Lab-On-Chip (LOC) applications

    Science.gov (United States)

    Jonušauskas, Linas; RekštytÄ--, Sima; Buivydas, Ričardas; Butkus, Simas; Paipulas, Domas; Gadonas, Roaldas; Juodkazis, Saulius; Malinauskas, Mangirdas

    2017-02-01

    An approach employing ultrafast laser hybrid microfabrication combining ablation, 3D nanolithography and welding is proposed for the realization of Lab-On-Chip (LOC) device. The same laser setup is shown to be suitable for fabricating microgrooves in glass slabs, polymerization of fine meshes inside them, and, lastly, sealing the whole chip with cover glass into one monolithic piece. The created micro fluidic device proved its particle sorting function by separating 1 μm and 10 μm polystyrene spheres from a mixture. Next, a lens adapter for a cell phone's camera was manufactured via thermal extrusion 3D printing technique which allowed to achieve sufficient magnification to clearly resolve <10 μm features. All together shows fs-laser microfabrication technology as a flexible and versatile tool for study and manufacturing of Lab-On-Chip devices.

  14. A New Role for LOC101928437 in Non-Syndromic Intellectual Disability: Findings from a Family-Based Association Test.

    Science.gov (United States)

    Zhou, Shaohe; Shi, Zhangyan; Cui, Meng; Li, Junlin; Ma, Zhe; Shi, Yuanyu; Zheng, Zijian; Zhang, Fuchang; Jin, Tianbo; Geng, Tingting; Chen, Chao; Guo, Yale; Zhou, Jianping; Huang, Shaoping; Guo, Xingli; Gao, Lin; Gong, Pingyuan; Gao, Xiaocai; Zhang, Kejin

    2015-01-01

    Non-syndromic intellectual disability (NSID) is mental retardation in persons of normal physical appearance who have no recognisable features apart from obvious deficits in intellectual functioning and adaptive ability; however, its genetic etiology of most patients has remained unknown. The main purpose of this study was to fine map and identify specific causal gene(s) by genotyping a NSID family cohort using a panel of markers encompassing a target region reported in a previous work. A total of 139 families including probands, parents and relatives were included in the household survey, clinical examinations and intelligence tests, recruited from the Qinba mountain region of Shannxi province, western China. A collection of 34 tagged single nucleotide polymorphisms (tSNPs) spanning five microsatellite marker (STR) loci were genotyped using an iPLEX Gold assay. The association between tSNPs and patients was analyzed by family-based association testing (FBAT) and haplotype analysis (HBAT). Four markers (rs5974392, rs12164331, rs5929554 and rs3116911) in a block that showed strong linkage disequilibrium within the first three introns of the LOC101928437 locus were found to be significantly associated with NSID (all P<0.01) by the FBAT method for a single marker in additive, dominant and recessive models. The results of haplotype tests of this block also revealed a significant association with NSID (all P<0.05) using 2-window and larger HBAT analyses. These results suggest that LOC101928437 is a novel candidate gene for NSID in Han Chinese individuals of the Qinba region of China. Although the biological function of the gene has not been well studied, knowledge about this gene will provide insights that will increase our understanding of NSID development.

  15. A New Role for LOC101928437 in Non-Syndromic Intellectual Disability: Findings from a Family-Based Association Test.

    Directory of Open Access Journals (Sweden)

    Shaohe Zhou

    Full Text Available Non-syndromic intellectual disability (NSID is mental retardation in persons of normal physical appearance who have no recognisable features apart from obvious deficits in intellectual functioning and adaptive ability; however, its genetic etiology of most patients has remained unknown. The main purpose of this study was to fine map and identify specific causal gene(s by genotyping a NSID family cohort using a panel of markers encompassing a target region reported in a previous work. A total of 139 families including probands, parents and relatives were included in the household survey, clinical examinations and intelligence tests, recruited from the Qinba mountain region of Shannxi province, western China. A collection of 34 tagged single nucleotide polymorphisms (tSNPs spanning five microsatellite marker (STR loci were genotyped using an iPLEX Gold assay. The association between tSNPs and patients was analyzed by family-based association testing (FBAT and haplotype analysis (HBAT. Four markers (rs5974392, rs12164331, rs5929554 and rs3116911 in a block that showed strong linkage disequilibrium within the first three introns of the LOC101928437 locus were found to be significantly associated with NSID (all P<0.01 by the FBAT method for a single marker in additive, dominant and recessive models. The results of haplotype tests of this block also revealed a significant association with NSID (all P<0.05 using 2-window and larger HBAT analyses. These results suggest that LOC101928437 is a novel candidate gene for NSID in Han Chinese individuals of the Qinba region of China. Although the biological function of the gene has not been well studied, knowledge about this gene will provide insights that will increase our understanding of NSID development.

  16. Neural associations of the early retinotopic cortex with the lateral occipital complex during visual perception.

    Directory of Open Access Journals (Sweden)

    Delong Zhang

    Full Text Available Previous studies have demonstrated that the early retinotopic cortex (ERC, i.e., V1/V2/V3 is highly associated with the lateral occipital complex (LOC during visual perception. However, it remains largely unclear how to evaluate their associations in quantitative way. The present study tried to apply a multivariate pattern analysis (MVPA to quantify the neural activity in ERC and its association with that of the LOC when participants saw visual images. To this end, we assessed whether low-level visual features (Gabor features could predict the neural activity in the ERC and LOC according to a voxel-based encoding model (VBEM, and then quantified the association of the neural activity between these regions by using an analogical VBEM. We found that the Gabor features remarkably predicted the activity of the ERC (e.g., the predicted accuracy was 52.5% for a participant instead of that of the LOC (4.2%. Moreover, the MVPA approach can also be used to establish corresponding relationships between the activity patterns in the LOC and those in the ERC (64.2%. In particular, we found that the integration of the Gabor features and LOC visual information could dramatically improve the 'prediction' of ERC activity (88.3%. Overall, the present study provides new evidences for the possibility of quantifying the association of the neural activity between the regions of ERC and LOC. This approach will help to provide further insights into the neural substrates of the visual processing.

  17. Feasibility of Use of a Barbed Suture (V-Loc 180 for Quilting the Donor Site in Latissimus Dorsi Myocutaneous Flap Breast Reconstruction

    Directory of Open Access Journals (Sweden)

    Dinesh Kumar Thekkinkattil

    2013-03-01

    Full Text Available Background Latissimus dorsi (LD myocutaneous flap is a popular method of breastreconstruction which can be associated with high incidence of seroma formation. Quiltingsutures at the harvest site are used to reduce this. Barbed sutures are self anchoring sutureswhich avoid multiple knotting and can be useful in quilting.Methods A retrospective analysis of prospectively maintained database of patients whounderwent LD flap breast reconstruction between January 2009 and January 2011 was carriedout. Seroma formation at the harvest site, wound related complications, inpatient stay andduration of surgery were analysed and a comparison was made between two groups wherequilting was done with barbed (V-Loc suture and conventional polydioxanone (PDS II sutures.Results Fifty-seven patients were included of which 33 had quilting by V-Loc sutures and in24 patients PDS II suture was used. Median age in the PDS group was 55 years (interquartilerange [IQR], 45 to 61 years which was comparable to the V-Loc group (53 years [IQR, 48to 59 years]; P-value 0.948. Sixteen patients (28% had significant seroma formation and5 (9% patients developed superficial wound dehiscence. Incidences of seroma or woundcomplications were comparable (P-value 0.378 and 1.00, respectively. Secondary outcomessuch as total duration of surgery, total inpatient stay, total amount of drain at the donor sitewere also similar in two groups.Conclusions Use of barbed sutures for quilting the donor site in LD flap reconstruction is afeasible option and the associated seroma formation and wound complications are comparablewith conventional sutures.

  18. Localized endomorphisms of the chiral Ising model

    International Nuclear Information System (INIS)

    Boeckenhauer, J.

    1994-07-01

    In the frame of the treatment of the chiral Ising model by Mack and Schomerus, examples of localized endomorphisms ρ 1 loc and ρ 1/2 loc are presented. It is shown that they lead to the same superselection sectors as the global ones in the sense that π 0 oρ 1 log ≅π 1 and π 0 pρ 1/2 loc ≅π 1/2 holds. For proving the latter unitary equivalence, Arakis formalism of the selfdual CAR algebra is used. Further it is shown that the localized endomorphisms obey the Ising fusion rules. (orig.)

  19. The Analysis of the Contribution of Human Factors to the In-Flight Loss of Control Accidents

    Science.gov (United States)

    Ancel, Ersin; Shih, Ann T.

    2012-01-01

    In-flight loss of control (LOC) is currently the leading cause of fatal accidents based on various commercial aircraft accident statistics. As the Next Generation Air Transportation System (NextGen) emerges, new contributing factors leading to LOC are anticipated. The NASA Aviation Safety Program (AvSP), along with other aviation agencies and communities are actively developing safety products to mitigate the LOC risk. This paper discusses the approach used to construct a generic integrated LOC accident framework (LOCAF) model based on a detailed review of LOC accidents over the past two decades. The LOCAF model is comprised of causal factors from the domain of human factors, aircraft system component failures, and atmospheric environment. The multiple interdependent causal factors are expressed in an Object-Oriented Bayesian belief network. In addition to predicting the likelihood of LOC accident occurrence, the system-level integrated LOCAF model is able to evaluate the impact of new safety technology products developed in AvSP. This provides valuable information to decision makers in strategizing NASA's aviation safety technology portfolio. The focus of this paper is on the analysis of human causal factors in the model, including the contributions from flight crew and maintenance workers. The Human Factors Analysis and Classification System (HFACS) taxonomy was used to develop human related causal factors. The preliminary results from the baseline LOCAF model are also presented.

  20. Association between objective and subjective binge eating and psychopathology during a psychological treatment trial for bulimic symptoms.

    Science.gov (United States)

    Goldschmidt, Andrea B; Accurso, Erin C; Crosby, Ross D; Cao, Li; Ellison, Jo; Smith, Tracey L; Klein, Marjorie H; Mitchell, James E; Crow, Scott J; Wonderlich, Stephen A; Peterson, Carol B

    2016-12-01

    Although loss of control (LOC) while eating is a core construct of bulimia nervosa (BN), questions remain regarding its validity and prognostic significance independent of overeating. We examined trajectories of objective and subjective binge eating (OBE and SBE, respectively; i.e., LOC eating episodes involving an objectively or subjectively large amount of food) among adults participating in psychological treatments for BN-spectrum disorders (n = 80). We also explored whether changes in the frequency of these eating episodes differentially predicted changes in eating-related and general psychopathology and, conversely, whether changes in eating-related and general psychopathology predicted differential changes in the frequency of these eating episodes. Linear mixed models with repeated measures revealed that OBE decreased twice as rapidly as SBE throughout treatment and 4-month follow-up. Generalized linear models revealed that baseline to end-of-treatment reductions in SBE frequency predicted baseline to 4-month follow-up changes in eating-related psychopathology, depression, and anxiety, while changes in OBE frequency were not predictive of psychopathology at 4-month follow-up. Zero-inflation models indicated that baseline to end-of-treatment changes in eating-related psychopathology and depression symptoms predicted baseline to 4-month follow-up changes in OBE frequency, while changes in anxiety and self-esteem did not. Baseline to end-of-treatment changes in eating-related psychopathology, self-esteem, and anxiety predicted baseline to 4-month follow-up changes in SBE frequency, while baseline to end-of-treatment changes in depression did not. Based on these findings, LOC accompanied by objective overeating may reflect distress at having consumed an objectively large amount of food, whereas LOC accompanied by subjective overeating may reflect more generalized distress related to one's eating- and mood-related psychopathology. BN treatments should

  1. Bootstrap prediction and Bayesian prediction under misspecified models

    OpenAIRE

    Fushiki, Tadayoshi

    2005-01-01

    We consider a statistical prediction problem under misspecified models. In a sense, Bayesian prediction is an optimal prediction method when an assumed model is true. Bootstrap prediction is obtained by applying Breiman's `bagging' method to a plug-in prediction. Bootstrap prediction can be considered to be an approximation to the Bayesian prediction under the assumption that the model is true. However, in applications, there are frequently deviations from the assumed model. In this paper, bo...

  2. A simple approach to estimate daily loads of total, refractory, and labile organic carbon from their seasonal loads in a watershed.

    Science.gov (United States)

    Ouyang, Ying; Grace, Johnny M; Zipperer, Wayne C; Hatten, Jeff; Dewey, Janet

    2018-05-22

    Loads of naturally occurring total organic carbons (TOC), refractory organic carbon (ROC), and labile organic carbon (LOC) in streams control the availability of nutrients and the solubility and toxicity of contaminants and affect biological activities through absorption of light and complex metals with production of carcinogenic compounds. Although computer models have become increasingly popular in understanding and management of TOC, ROC, and LOC loads in streams, the usefulness of these models hinges on the availability of daily data for model calibration and validation. Unfortunately, these daily data are usually insufficient and/or unavailable for most watersheds due to a variety of reasons, such as budget and time constraints. A simple approach was developed here to calculate daily loads of TOC, ROC, and LOC in streams based on their seasonal loads. We concluded that the predictions from our approach adequately match field measurements based on statistical comparisons between model calculations and field measurements. Our approach demonstrates that an increase in stream discharge results in increased stream TOC, ROC, and LOC concentrations and loads, although high peak discharge did not necessarily result in high peaks of TOC, ROC, and LOC concentrations and loads. The approach developed herein is a useful tool to convert seasonal loads of TOC, ROC, and LOC into daily loads in the absence of measured daily load data.

  3. Risk-Association of Five SNPs in TOX3/LOC643714 with Breast Cancer in Southern China

    Directory of Open Access Journals (Sweden)

    Xuanqiu He

    2014-01-01

    Full Text Available The specific mechanism by which low-risk genetic variants confer breast cancer risk is currently unclear, with contradictory evidence on the role of single nucleotide polymorphisms (SNPs in TOX3/LOC643714 as a breast cancer susceptibility locus. Investigations of this locus using a Chinese population may indicate whether the findings initially identified in a European population are generalizable to other populations, and may provide new insight into the role of genetic variants in the etiology of breast cancer. In this case-control study, 623 Chinese female breast cancer patients and 620 cancer-free controls were recruited to investigate the role of five SNPs in TOX3/LOC643714 (rs8051542, rs12443621, rs3803662, rs4784227, and rs3112612; Linkage disequilibrium (LD pattern analysis was performed. Additionally, we evaluated how these common SNPs influence the risk of specific types of breast cancer, as defined by estrogen receptor (ER status, progesterone receptor (PR status and human epidermal growth factor receptor 2 (HER2 status. Significant associations with breast cancer risk were observed for rs4784227 and rs8051542 with odds ratios (OR of 1.31 ((95% confidence intervals (CI, 1.10–1.57 and 1.26 (95% CI, 1.02–1.56, respectively, per T allele. The T-rs8051542 allele was significantly associated with ER-positive and HER2-negative carriers. No significant association existed between rs12443621, rs3803662, and rs3112612 polymorphisms and risk of breast cancer. Our results support the hypothesis that the applicability of a common susceptibility locus must be confirmed among genetically different populations, which may together explain an appreciable fraction of the genetic etiology of breast cancer.

  4. Predictive Modelling and Time: An Experiment in Temporal Archaeological Predictive Models

    OpenAIRE

    David Ebert

    2006-01-01

    One of the most common criticisms of archaeological predictive modelling is that it fails to account for temporal or functional differences in sites. However, a practical solution to temporal or functional predictive modelling has proven to be elusive. This article discusses temporal predictive modelling, focusing on the difficulties of employing temporal variables, then introduces and tests a simple methodology for the implementation of temporal modelling. The temporal models thus created ar...

  5. Nothing left to chance? The impact of locus of control on physical and mental quality of life in terminal cancer patients.

    Science.gov (United States)

    Brown, Alaina J; Thaker, Premal H; Sun, Charlotte C; Urbauer, Diana L; Bruera, Eduardo; Bodurka, Diane C; Ramondetta, Lois M

    2017-06-01

    The purpose of this study is to evaluate if locus of control (LOC) predicts various quality of life (QOL) and mental well-being measures among terminally ill cancer patients at the time of palliative care consult. Multi-site analysis of patients with advanced cancer being seen as new patients in a Palliative and Supportive Care outpatient clinic. Patients completed the following surveys: locus of control (LOC) scale, Functional Assessment of Chronic Illness Therapy-General (FACT-G), Functional Assessment of Chronic Illness Therapy-Spiritual (FACIT-Sp), Hospital Anxiety Depression Scale (HADS), and Herth Hope Index (HHI). Regression models were created to examine the effect of LOC upon QOL, symptoms, and other measures of mental well-being. These models adjusted for the effect of age, gender, race, partnership status, education, and months since diagnosis as potential confounders. This study enrolled 100 patients. After adjusting for site, race, and partnership status, higher levels of LOC chance predicted decreased QOL (FACT-G) (p cancer patients with a high LOC chance may be at risk for decreased physical and mental well-being at the end of life. Efforts should be made to identify these patients and design interventions to increase their feeling of control over the situation in order to improve physical and mental well-being at the end of life.

  6. Feeling powerless: Locus of control as a potential target for supportive care interventions to increase quality of life and decrease anxiety in ovarian cancer patients.

    Science.gov (United States)

    Brown, Alaina J; Sun, Charlotte C; Urbauer, Diana L; Bodurka, Diane C; Thaker, Premal H; Ramondetta, Lois M

    2015-08-01

    To evaluate if an individual's locus of control (LOC) predicts various quality of life (QOL) and mental well-being measures. To identify targets that might enhance the overall spiritual well-being and QOL of ovarian cancer patients. Multi-site analysis of women with newly diagnosed stages II-IV ovarian, primary peritoneal or fallopian tube cancer. Patients completed the following surveys: Locus of Control Scale (LOC), Functional Assessment of Chronic Illness Therapy-Ovarian (FACT-O), Functional Assessment of Chronic Illness Therapy-Spiritual (FACIT-Sp), Edmonton Symptom Assessment score (ESAS), Hospital Anxiety Depression Scale (HADS), Templer's Death Anxiety Scale (DAS), and Herth Hope Index (HHI). Regression models were created to examine the effect of LOC upon QOL, symptoms, and other measures of mental well-being. These models adjusted for the effect of site of care, race, and partnership status as potential confounders. This study enrolled 104 patients from three separate treatment facilities. After adjusting for site, race and partnership status, higher levels of external LOC predicted decreased QOL (FACT-O) (pcontrol over her situation may improve QOL and overall mental well-being. Copyright © 2015. Published by Elsevier Inc.

  7. EmerLoc: location-based services for emergency medical incidents.

    Science.gov (United States)

    Maglogiannis, I; Hadjiefthymiades, S

    2007-10-01

    Recent developments in positioning systems and telecommunications have provided the technology needed for the development of location aware medical applications. We developed a system, named EmerLoc, which is based upon this technology and uses a set of sensors that are attached to the patient's body, a micro-computing unit which is responsible for processing the sensor readings and a central monitoring unit, which coordinates the data flow. To demonstrate that the proposed system is technically feasible and acceptable for the potential users. Transmission speed is assessed mostly by means of transmission of DICOM compliant images in various operational scenarios. The positioning functionality was established both outdoor using GPS and indoor using the UCLA Nibble system. User acceptability was assessed in a hospital setting by 15 physicians who filled in a questionnaire after having used the system in an experimental setting. Transmission speeds ranged from 88kB/s for a IEEE 802.11 infrastructure to 2.5kB/s for a GSM/GPRS scenario. Positioning accuracy based on GPS was 5-10m. The physicians rated the technical aspects on average above 3 on a 5-point scale. Only the data presentation was assessed to be not satisfactory (2.81 on a 5-point scale). The reported results prove the feasibility of the proposed architecture and its alignment with widely established practices and standards, while the reaction of potential users who evaluated the system is quite positive.

  8. Psychological models for development of motorcycle helmet use among students in Vietnam

    Science.gov (United States)

    Kumphong, J.; Satiennam, T.; Satiennam, W.; Trinh, Tu Anh

    2018-04-01

    A helmet can reduce head accident severity. The aim of this research study was to study the intention for helmet use of students who ride motorcycles in Vietnam, by Structural Equation Modeling (SEM). Questionnaires developed by several traffic psychology modules, including the Theory of Planned Behaviour (TPB), Traffic Locus of Control (T-LOC), and Health Belief Model (HBM), were distributed to students at Ton Thang University and University of Architecture, Ho Chi Minh City. SEM was used to explain helmet use behaviour. The results indicate that TPB, T-LOC and HBM could explain the variance in helmet use behaviour. However, TPB can explain behaviour (helmet use intention) better than T-LOC and HBM. The outcome of this study is useful for the agencies responsible to improve motorcycle safety.

  9. A pharmacogenetics study to predict outcome in patients receiving anti-VEGF therapy in age related macular degeneration

    Science.gov (United States)

    Kitchens, John W; Kassem, Nawal; Wood, William; Stone, Thomas W; Isernhagen, Rick; Wood, Edward; Hancock, Brad A; Radovich, Milan; Waymire, Josh; Li, Lang; Schneider, Bryan P

    2013-01-01

    Purpose To ascertain whether single nucleotide polymorphisms (SNPs) in the Vascular Endothelial Growth factor (VEGFA), Complement Factor H (CFH), and LOC387715 genes could predict outcome to anti-VEGF therapy for patients with age related macular degeneration (AMD). Methods Patients with “wet” AMD were identified by chart review. Baseline optical coherence tomography (OCT) and visual acuity (VA) data, and at least 6 months of clinical follow up after 3 initial monthly injections of bevacizumab or ranibizumab were required for inclusion. Based on OCT and VA, patients were categorized into two possible clinical outcomes: (a) responders and (b) non-responders. DNA was extracted from saliva and genotyped for candidate SNPs in the VEGFA, LOC387715, and CFH genes. Clinical outcomes were statistically compared to patient genotypes. Results 101 patients were recruited, and one eye from each patient was included in the analysis. 97% of samples were successfully genotyped for all SNPs. We found a statistically significant association between the LOC387715 A69S TT genotype and outcome based on OCT. Conclusion Genetic variation may be associated with outcome in patients receiving anti-VEGF therapy. PMID:24143065

  10. Interim Measures Report for the Headquarters Building Area Location of Concern (LOC) 2E East SWMU 104 John F. Kennedy Space Center, Florida

    Science.gov (United States)

    Sager, Eric D.

    2016-01-01

    The Hazardous and Solid Waste Amendment portion of the National Aeronautics and Space Administration (NASA) Resource Conservation and Recovery Act (RCRA) Permit issued by the Florida Department of Environmental Protection (FDEP), requires identification and evaluation of all known Solid Waste Management Units (SWMUs) and Locations of Concern (LOCs) located on Kennedy Space Center (KSC) property. The KSC Headquarters Building Area (KHQA) has been identified as SWMU 104 under KSC's RCRA Program. This report summarizes the Interim Measure (IM) conducted by Geosyntec Consultants (Geosyntec) for NASA under Indefinite Delivery Indefinite Quantity Contract NNK12CA13B at the KHQA to mitigate potential exposure to polychlorinated biphenyl (PCB)-affected media at the eastern side of LOC 2E. The IM activities were conducted in June and July 2015 to remediate PCBs above the FDEP Residential Direct-Exposure (R-) Soil Cleanup Target Level (SCTL) of 0.5 milligram per kilogram (mg/kg) established by Chapter 62-777, Florida Administrative Code. The IM was performed in accordance with the IM Work Plan (IMWP) approved by the FDEP, dated August 2012. IM activities were conducted in accordance with the KSC Generic PCB Work Plan (NASA 2007).

  11. Modelling bankruptcy prediction models in Slovak companies

    Directory of Open Access Journals (Sweden)

    Kovacova Maria

    2017-01-01

    Full Text Available An intensive research from academics and practitioners has been provided regarding models for bankruptcy prediction and credit risk management. In spite of numerous researches focusing on forecasting bankruptcy using traditional statistics techniques (e.g. discriminant analysis and logistic regression and early artificial intelligence models (e.g. artificial neural networks, there is a trend for transition to machine learning models (support vector machines, bagging, boosting, and random forest to predict bankruptcy one year prior to the event. Comparing the performance of this with unconventional approach with results obtained by discriminant analysis, logistic regression, and neural networks application, it has been found that bagging, boosting, and random forest models outperform the others techniques, and that all prediction accuracy in the testing sample improves when the additional variables are included. On the other side the prediction accuracy of old and well known bankruptcy prediction models is quiet high. Therefore, we aim to analyse these in some way old models on the dataset of Slovak companies to validate their prediction ability in specific conditions. Furthermore, these models will be modelled according to new trends by calculating the influence of elimination of selected variables on the overall prediction ability of these models.

  12. Locus of Control Predicts Cortisol Reactivity and Speech Performance in Response to Acute Stress in Undergraduate Students

    Science.gov (United States)

    Szabo, Yvette Z.; Chang, Andrew; Chancellor-Freeland, Cheryl

    2015-01-01

    Previous studies have found that an individual's perception of control in a situation (Locus of Control; LOC) can serve as a protective factor that has physiological and psychological benefits. The present study examines LOC in an acute stress paradigm to examine the relationship between LOC and hypothalamic-pituitary-adrenal axis functioning as…

  13. Predictive modeling of complications.

    Science.gov (United States)

    Osorio, Joseph A; Scheer, Justin K; Ames, Christopher P

    2016-09-01

    Predictive analytic algorithms are designed to identify patterns in the data that allow for accurate predictions without the need for a hypothesis. Therefore, predictive modeling can provide detailed and patient-specific information that can be readily applied when discussing the risks of surgery with a patient. There are few studies using predictive modeling techniques in the adult spine surgery literature. These types of studies represent the beginning of the use of predictive analytics in spine surgery outcomes. We will discuss the advancements in the field of spine surgery with respect to predictive analytics, the controversies surrounding the technique, and the future directions.

  14. Associations of Haplotypes Upstream of IRS1 with Insulin Resistance, Type 2 Diabetes, Dyslipidemia, Preclinical Atherosclerosis, and Skeletal Muscle LOC646736 mRNA Levels

    Directory of Open Access Journals (Sweden)

    Selma M. Soyal

    2015-01-01

    Full Text Available The genomic region ~500 kb upstream of IRS1 has been implicated in insulin resistance, type 2 diabetes, adverse lipid profile, and cardiovascular risk. To gain further insight into this chromosomal region, we typed four SNPs in a cross-sectional cohort and subjects with type 2 diabetes recruited from the same geographic region. From 16 possible haplotypes, 6 haplotypes with frequencies >0.01 were observed. We identified one haplotype that was protective against insulin resistance (determined by HOMA-IR and fasting plasma insulin levels, type 2 diabetes, an adverse lipid profile, increased C-reactive protein, and asymptomatic atherosclerotic disease (assessed by intima media thickness of the common carotid arteries. BMI and total adipose tissue mass as well as visceral and subcutaneous adipose tissue mass did not differ between the reference and protective haplotypes. In 92 subjects, we observed an association of the protective haplotype with higher skeletal muscle mRNA levels of LOC646736, which is located in the same haplotype block as the informative SNPs and is mainly expressed in skeletal muscle, but only at very low levels in liver or adipose tissues. These data suggest a role for LOC646736 in human insulin resistance and warrant further studies on the functional effects of this locus.

  15. Candidate Prediction Models and Methods

    DEFF Research Database (Denmark)

    Nielsen, Henrik Aalborg; Nielsen, Torben Skov; Madsen, Henrik

    2005-01-01

    This document lists candidate prediction models for Work Package 3 (WP3) of the PSO-project called ``Intelligent wind power prediction systems'' (FU4101). The main focus is on the models transforming numerical weather predictions into predictions of power production. The document also outlines...... the possibilities w.r.t. different numerical weather predictions actually available to the project....

  16. Wind power prediction models

    Science.gov (United States)

    Levy, R.; Mcginness, H.

    1976-01-01

    Investigations were performed to predict the power available from the wind at the Goldstone, California, antenna site complex. The background for power prediction was derived from a statistical evaluation of available wind speed data records at this location and at nearby locations similarly situated within the Mojave desert. In addition to a model for power prediction over relatively long periods of time, an interim simulation model that produces sample wind speeds is described. The interim model furnishes uncorrelated sample speeds at hourly intervals that reproduce the statistical wind distribution at Goldstone. A stochastic simulation model to provide speed samples representative of both the statistical speed distributions and correlations is also discussed.

  17. Inverse and Predictive Modeling

    Energy Technology Data Exchange (ETDEWEB)

    Syracuse, Ellen Marie [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-09-27

    The LANL Seismo-Acoustic team has a strong capability in developing data-driven models that accurately predict a variety of observations. These models range from the simple – one-dimensional models that are constrained by a single dataset and can be used for quick and efficient predictions – to the complex – multidimensional models that are constrained by several types of data and result in more accurate predictions. Team members typically build models of geophysical characteristics of Earth and source distributions at scales of 1 to 1000s of km, the techniques used are applicable for other types of physical characteristics at an even greater range of scales. The following cases provide a snapshot of some of the modeling work done by the Seismo- Acoustic team at LANL.

  18. Archaeological predictive model set.

    Science.gov (United States)

    2015-03-01

    This report is the documentation for Task 7 of the Statewide Archaeological Predictive Model Set. The goal of this project is to : develop a set of statewide predictive models to assist the planning of transportation projects. PennDOT is developing t...

  19. Confidence scores for prediction models

    DEFF Research Database (Denmark)

    Gerds, Thomas Alexander; van de Wiel, MA

    2011-01-01

    In medical statistics, many alternative strategies are available for building a prediction model based on training data. Prediction models are routinely compared by means of their prediction performance in independent validation data. If only one data set is available for training and validation,...

  20. Accurate and dynamic predictive model for better prediction in medicine and healthcare.

    Science.gov (United States)

    Alanazi, H O; Abdullah, A H; Qureshi, K N; Ismail, A S

    2018-05-01

    Information and communication technologies (ICTs) have changed the trend into new integrated operations and methods in all fields of life. The health sector has also adopted new technologies to improve the systems and provide better services to customers. Predictive models in health care are also influenced from new technologies to predict the different disease outcomes. However, still, existing predictive models have suffered from some limitations in terms of predictive outcomes performance. In order to improve predictive model performance, this paper proposed a predictive model by classifying the disease predictions into different categories. To achieve this model performance, this paper uses traumatic brain injury (TBI) datasets. TBI is one of the serious diseases worldwide and needs more attention due to its seriousness and serious impacts on human life. The proposed predictive model improves the predictive performance of TBI. The TBI data set is developed and approved by neurologists to set its features. The experiment results show that the proposed model has achieved significant results including accuracy, sensitivity, and specificity.

  1. Multi-model analysis in hydrological prediction

    Science.gov (United States)

    Lanthier, M.; Arsenault, R.; Brissette, F.

    2017-12-01

    Hydrologic modelling, by nature, is a simplification of the real-world hydrologic system. Therefore ensemble hydrological predictions thus obtained do not present the full range of possible streamflow outcomes, thereby producing ensembles which demonstrate errors in variance such as under-dispersion. Past studies show that lumped models used in prediction mode can return satisfactory results, especially when there is not enough information available on the watershed to run a distributed model. But all lumped models greatly simplify the complex processes of the hydrologic cycle. To generate more spread in the hydrologic ensemble predictions, multi-model ensembles have been considered. In this study, the aim is to propose and analyse a method that gives an ensemble streamflow prediction that properly represents the forecast probabilities and reduced ensemble bias. To achieve this, three simple lumped models are used to generate an ensemble. These will also be combined using multi-model averaging techniques, which generally generate a more accurate hydrogram than the best of the individual models in simulation mode. This new predictive combined hydrogram is added to the ensemble, thus creating a large ensemble which may improve the variability while also improving the ensemble mean bias. The quality of the predictions is then assessed on different periods: 2 weeks, 1 month, 3 months and 6 months using a PIT Histogram of the percentiles of the real observation volumes with respect to the volumes of the ensemble members. Initially, the models were run using historical weather data to generate synthetic flows. This worked for individual models, but not for the multi-model and for the large ensemble. Consequently, by performing data assimilation at each prediction period and thus adjusting the initial states of the models, the PIT Histogram could be constructed using the observed flows while allowing the use of the multi-model predictions. The under-dispersion has been

  2. Predictive Modeling in Race Walking

    Directory of Open Access Journals (Sweden)

    Krzysztof Wiktorowicz

    2015-01-01

    Full Text Available This paper presents the use of linear and nonlinear multivariable models as tools to support training process of race walkers. These models are calculated using data collected from race walkers’ training events and they are used to predict the result over a 3 km race based on training loads. The material consists of 122 training plans for 21 athletes. In order to choose the best model leave-one-out cross-validation method is used. The main contribution of the paper is to propose the nonlinear modifications for linear models in order to achieve smaller prediction error. It is shown that the best model is a modified LASSO regression with quadratic terms in the nonlinear part. This model has the smallest prediction error and simplified structure by eliminating some of the predictors.

  3. Adding propensity scores to pure prediction models fails to improve predictive performance

    Directory of Open Access Journals (Sweden)

    Amy S. Nowacki

    2013-08-01

    Full Text Available Background. Propensity score usage seems to be growing in popularity leading researchers to question the possible role of propensity scores in prediction modeling, despite the lack of a theoretical rationale. It is suspected that such requests are due to the lack of differentiation regarding the goals of predictive modeling versus causal inference modeling. Therefore, the purpose of this study is to formally examine the effect of propensity scores on predictive performance. Our hypothesis is that a multivariable regression model that adjusts for all covariates will perform as well as or better than those models utilizing propensity scores with respect to model discrimination and calibration.Methods. The most commonly encountered statistical scenarios for medical prediction (logistic and proportional hazards regression were used to investigate this research question. Random cross-validation was performed 500 times to correct for optimism. The multivariable regression models adjusting for all covariates were compared with models that included adjustment for or weighting with the propensity scores. The methods were compared based on three predictive performance measures: (1 concordance indices; (2 Brier scores; and (3 calibration curves.Results. Multivariable models adjusting for all covariates had the highest average concordance index, the lowest average Brier score, and the best calibration. Propensity score adjustment and inverse probability weighting models without adjustment for all covariates performed worse than full models and failed to improve predictive performance with full covariate adjustment.Conclusion. Propensity score techniques did not improve prediction performance measures beyond multivariable adjustment. Propensity scores are not recommended if the analytical goal is pure prediction modeling.

  4. Model-free and model-based reward prediction errors in EEG.

    Science.gov (United States)

    Sambrook, Thomas D; Hardwick, Ben; Wills, Andy J; Goslin, Jeremy

    2018-05-24

    Learning theorists posit two reinforcement learning systems: model-free and model-based. Model-based learning incorporates knowledge about structure and contingencies in the world to assign candidate actions with an expected value. Model-free learning is ignorant of the world's structure; instead, actions hold a value based on prior reinforcement, with this value updated by expectancy violation in the form of a reward prediction error. Because they use such different learning mechanisms, it has been previously assumed that model-based and model-free learning are computationally dissociated in the brain. However, recent fMRI evidence suggests that the brain may compute reward prediction errors to both model-free and model-based estimates of value, signalling the possibility that these systems interact. Because of its poor temporal resolution, fMRI risks confounding reward prediction errors with other feedback-related neural activity. In the present study, EEG was used to show the presence of both model-based and model-free reward prediction errors and their place in a temporal sequence of events including state prediction errors and action value updates. This demonstration of model-based prediction errors questions a long-held assumption that model-free and model-based learning are dissociated in the brain. Copyright © 2018 Elsevier Inc. All rights reserved.

  5. Nonlinear chaotic model for predicting storm surges

    Directory of Open Access Journals (Sweden)

    M. Siek

    2010-09-01

    Full Text Available This paper addresses the use of the methods of nonlinear dynamics and chaos theory for building a predictive chaotic model from time series. The chaotic model predictions are made by the adaptive local models based on the dynamical neighbors found in the reconstructed phase space of the observables. We implemented the univariate and multivariate chaotic models with direct and multi-steps prediction techniques and optimized these models using an exhaustive search method. The built models were tested for predicting storm surge dynamics for different stormy conditions in the North Sea, and are compared to neural network models. The results show that the chaotic models can generally provide reliable and accurate short-term storm surge predictions.

  6. Extracting falsifiable predictions from sloppy models.

    Science.gov (United States)

    Gutenkunst, Ryan N; Casey, Fergal P; Waterfall, Joshua J; Myers, Christopher R; Sethna, James P

    2007-12-01

    Successful predictions are among the most compelling validations of any model. Extracting falsifiable predictions from nonlinear multiparameter models is complicated by the fact that such models are commonly sloppy, possessing sensitivities to different parameter combinations that range over many decades. Here we discuss how sloppiness affects the sorts of data that best constrain model predictions, makes linear uncertainty approximations dangerous, and introduces computational difficulties in Monte-Carlo uncertainty analysis. We also present a useful test problem and suggest refinements to the standards by which models are communicated.

  7. Fixed recurrence and slip models better predict earthquake behavior than the time- and slip-predictable models 1: repeating earthquakes

    Science.gov (United States)

    Rubinstein, Justin L.; Ellsworth, William L.; Chen, Kate Huihsuan; Uchida, Naoki

    2012-01-01

    The behavior of individual events in repeating earthquake sequences in California, Taiwan and Japan is better predicted by a model with fixed inter-event time or fixed slip than it is by the time- and slip-predictable models for earthquake occurrence. Given that repeating earthquakes are highly regular in both inter-event time and seismic moment, the time- and slip-predictable models seem ideally suited to explain their behavior. Taken together with evidence from the companion manuscript that shows similar results for laboratory experiments we conclude that the short-term predictions of the time- and slip-predictable models should be rejected in favor of earthquake models that assume either fixed slip or fixed recurrence interval. This implies that the elastic rebound model underlying the time- and slip-predictable models offers no additional value in describing earthquake behavior in an event-to-event sense, but its value in a long-term sense cannot be determined. These models likely fail because they rely on assumptions that oversimplify the earthquake cycle. We note that the time and slip of these events is predicted quite well by fixed slip and fixed recurrence models, so in some sense they are time- and slip-predictable. While fixed recurrence and slip models better predict repeating earthquake behavior than the time- and slip-predictable models, we observe a correlation between slip and the preceding recurrence time for many repeating earthquake sequences in Parkfield, California. This correlation is not found in other regions, and the sequences with the correlative slip-predictable behavior are not distinguishable from nearby earthquake sequences that do not exhibit this behavior.

  8. EFFICIENT PREDICTIVE MODELLING FOR ARCHAEOLOGICAL RESEARCH

    OpenAIRE

    Balla, A.; Pavlogeorgatos, G.; Tsiafakis, D.; Pavlidis, G.

    2014-01-01

    The study presents a general methodology for designing, developing and implementing predictive modelling for identifying areas of archaeological interest. The methodology is based on documented archaeological data and geographical factors, geospatial analysis and predictive modelling, and has been applied to the identification of possible Macedonian tombs’ locations in Northern Greece. The model was tested extensively and the results were validated using a commonly used predictive gain, which...

  9. Spatial Economics Model Predicting Transport Volume

    Directory of Open Access Journals (Sweden)

    Lu Bo

    2016-10-01

    Full Text Available It is extremely important to predict the logistics requirements in a scientific and rational way. However, in recent years, the improvement effect on the prediction method is not very significant and the traditional statistical prediction method has the defects of low precision and poor interpretation of the prediction model, which cannot only guarantee the generalization ability of the prediction model theoretically, but also cannot explain the models effectively. Therefore, in combination with the theories of the spatial economics, industrial economics, and neo-classical economics, taking city of Zhuanghe as the research object, the study identifies the leading industry that can produce a large number of cargoes, and further predicts the static logistics generation of the Zhuanghe and hinterlands. By integrating various factors that can affect the regional logistics requirements, this study established a logistics requirements potential model from the aspect of spatial economic principles, and expanded the way of logistics requirements prediction from the single statistical principles to an new area of special and regional economics.

  10. Associations of Adolescent Emotional and Loss of Control Eating with 1-year Changes in Disordered Eating, Weight and Adiposity

    Science.gov (United States)

    Stojek, Monika M. K.; Tanofsky-Kraff, Marian; Shomaker, Lauren B.; Kelly, Nichole R.; Thompson, Katherine A.; Mehari, Rim D.; Marwitz, Shannon E.; Demidowich, Andrew P.; Galescu, Ovidiu A.; Brady, Sheila M.; Yanovski, Susan Z.; Yanovski, Jack A.

    2016-01-01

    Objective Adolescent emotional-eating, referring to eating in response to negative affective states, is frequently reported by those with loss of control (LOC) eating. Although LOC eating has been shown to predict exacerbated disordered eating and excess weight/adiposity gain, the extent to which emotional-eating, either alone or in combination with LOC, predicts adverse outcomes has not been determined. Thus, we examined associations of baseline emotional-eating with changes in disordered eating, BMI, and adiposity over 1-year, and to what degree the presence or absence of baseline LOC moderated these associations. Methods 189 non-treatment-seeking youth (15.4±1.4y; 66% female; 67% non-Hispanic White, 38% overweight [BMI ≥85th %ile]) completed the emotional-eating Scale for Children/Adolescents and the Eating Disorder Examination interview at baseline and again at 1-year. Air displacement plethysmography assessed adiposity at both time points. Results Baseline emotional-eating alone was not significantly associated with the development of objective binge eating or changes in disordered eating attitudes, BMI or adiposity 1-year later. However, baseline emotional-eating interacted with the presence of baseline LOC in the prediction of 1-year outcomes. Among adolescents with LOC eating, greater baseline emotional-eating was related to increased disordered eating attitudes (p=.03), BMI (p=.04), and adiposity (p=.04) at 1-year, after correcting for false discovery rate. Discussion Emotional-eating among youth also reporting LOC was associated with adverse outcomes over 1-year. Adolescents who report both behaviors may represent a subset of individuals at especially high risk for exacerbated disordered eating and excess weight gain. PMID:27753140

  11. Neural Fuzzy Inference System-Based Weather Prediction Model and Its Precipitation Predicting Experiment

    Directory of Open Access Journals (Sweden)

    Jing Lu

    2014-11-01

    Full Text Available We propose a weather prediction model in this article based on neural network and fuzzy inference system (NFIS-WPM, and then apply it to predict daily fuzzy precipitation given meteorological premises for testing. The model consists of two parts: the first part is the “fuzzy rule-based neural network”, which simulates sequential relations among fuzzy sets using artificial neural network; and the second part is the “neural fuzzy inference system”, which is based on the first part, but could learn new fuzzy rules from the previous ones according to the algorithm we proposed. NFIS-WPM (High Pro and NFIS-WPM (Ave are improved versions of this model. It is well known that the need for accurate weather prediction is apparent when considering the benefits. However, the excessive pursuit of accuracy in weather prediction makes some of the “accurate” prediction results meaningless and the numerical prediction model is often complex and time-consuming. By adapting this novel model to a precipitation prediction problem, we make the predicted outcomes of precipitation more accurate and the prediction methods simpler than by using the complex numerical forecasting model that would occupy large computation resources, be time-consuming and which has a low predictive accuracy rate. Accordingly, we achieve more accurate predictive precipitation results than by using traditional artificial neural networks that have low predictive accuracy.

  12. Incorporating uncertainty in predictive species distribution modelling.

    Science.gov (United States)

    Beale, Colin M; Lennon, Jack J

    2012-01-19

    Motivated by the need to solve ecological problems (climate change, habitat fragmentation and biological invasions), there has been increasing interest in species distribution models (SDMs). Predictions from these models inform conservation policy, invasive species management and disease-control measures. However, predictions are subject to uncertainty, the degree and source of which is often unrecognized. Here, we review the SDM literature in the context of uncertainty, focusing on three main classes of SDM: niche-based models, demographic models and process-based models. We identify sources of uncertainty for each class and discuss how uncertainty can be minimized or included in the modelling process to give realistic measures of confidence around predictions. Because this has typically not been performed, we conclude that uncertainty in SDMs has often been underestimated and a false precision assigned to predictions of geographical distribution. We identify areas where development of new statistical tools will improve predictions from distribution models, notably the development of hierarchical models that link different types of distribution model and their attendant uncertainties across spatial scales. Finally, we discuss the need to develop more defensible methods for assessing predictive performance, quantifying model goodness-of-fit and for assessing the significance of model covariates.

  13. Predictive user modeling with actionable attributes

    NARCIS (Netherlands)

    Zliobaite, I.; Pechenizkiy, M.

    2013-01-01

    Different machine learning techniques have been proposed and used for modeling individual and group user needs, interests and preferences. In the traditional predictive modeling instances are described by observable variables, called attributes. The goal is to learn a model for predicting the target

  14. The role of locus of control and coping style in predicting longitudinal PTSD-trajectories after combat exposure

    DEFF Research Database (Denmark)

    Karstoft, K. I.; Armour, C.; Elklit, A.

    2015-01-01

    Israeli soldiers with or without combat stress reaction (CSR) from the Lebanon war were assessed 1, 2, and 20 years after the war. Combat exposure, LOC, and coping style were then investigated as covariates of the trajectories of resilience, recovery, delayed onset, and chronicity. Symptomatic...... trajectories in the CSR and the non-CSR group were significantly associated to varying degrees with perceived life threat during combat (ORs: 1.76-2.53), internal LOC (0.77-0.87), emotional coping style (0.28-0.34), and low use of problem-focused coping (2.12-3.11). In conclusion, assessment of LOC and coping...

  15. MJO prediction skill of the subseasonal-to-seasonal (S2S) prediction models

    Science.gov (United States)

    Son, S. W.; Lim, Y.; Kim, D.

    2017-12-01

    The Madden-Julian Oscillation (MJO), the dominant mode of tropical intraseasonal variability, provides the primary source of tropical and extratropical predictability on subseasonal to seasonal timescales. To better understand its predictability, this study conducts quantitative evaluation of MJO prediction skill in the state-of-the-art operational models participating in the subseasonal-to-seasonal (S2S) prediction project. Based on bivariate correlation coefficient of 0.5, the S2S models exhibit MJO prediction skill ranging from 12 to 36 days. These prediction skills are affected by both the MJO amplitude and phase errors, the latter becoming more important with forecast lead times. Consistent with previous studies, the MJO events with stronger initial amplitude are typically better predicted. However, essentially no sensitivity to the initial MJO phase is observed. Overall MJO prediction skill and its inter-model spread are further related with the model mean biases in moisture fields and longwave cloud-radiation feedbacks. In most models, a dry bias quickly builds up in the deep tropics, especially across the Maritime Continent, weakening horizontal moisture gradient. This likely dampens the organization and propagation of MJO. Most S2S models also underestimate the longwave cloud-radiation feedbacks in the tropics, which may affect the maintenance of the MJO convective envelop. In general, the models with a smaller bias in horizontal moisture gradient and longwave cloud-radiation feedbacks show a higher MJO prediction skill, suggesting that improving those processes would enhance MJO prediction skill.

  16. Evaluating Predictive Uncertainty of Hyporheic Exchange Modelling

    Science.gov (United States)

    Chow, R.; Bennett, J.; Dugge, J.; Wöhling, T.; Nowak, W.

    2017-12-01

    Hyporheic exchange is the interaction of water between rivers and groundwater, and is difficult to predict. One of the largest contributions to predictive uncertainty for hyporheic fluxes have been attributed to the representation of heterogeneous subsurface properties. This research aims to evaluate which aspect of the subsurface representation - the spatial distribution of hydrofacies or the model for local-scale (within-facies) heterogeneity - most influences the predictive uncertainty. Also, we seek to identify data types that help reduce this uncertainty best. For this investigation, we conduct a modelling study of the Steinlach River meander, in Southwest Germany. The Steinlach River meander is an experimental site established in 2010 to monitor hyporheic exchange at the meander scale. We use HydroGeoSphere, a fully integrated surface water-groundwater model, to model hyporheic exchange and to assess the predictive uncertainty of hyporheic exchange transit times (HETT). A highly parameterized complex model is built and treated as `virtual reality', which is in turn modelled with simpler subsurface parameterization schemes (Figure). Then, we conduct Monte-Carlo simulations with these models to estimate the predictive uncertainty. Results indicate that: Uncertainty in HETT is relatively small for early times and increases with transit times. Uncertainty from local-scale heterogeneity is negligible compared to uncertainty in the hydrofacies distribution. Introducing more data to a poor model structure may reduce predictive variance, but does not reduce predictive bias. Hydraulic head observations alone cannot constrain the uncertainty of HETT, however an estimate of hyporheic exchange flux proves to be more effective at reducing this uncertainty. Figure: Approach for evaluating predictive model uncertainty. A conceptual model is first developed from the field investigations. A complex model (`virtual reality') is then developed based on that conceptual model

  17. Modeling, robust and distributed model predictive control for freeway networks

    NARCIS (Netherlands)

    Liu, S.

    2016-01-01

    In Model Predictive Control (MPC) for traffic networks, traffic models are crucial since they are used as prediction models for determining the optimal control actions. In order to reduce the computational complexity of MPC for traffic networks, macroscopic traffic models are often used instead of

  18. Staying Power of Churn Prediction Models

    NARCIS (Netherlands)

    Risselada, Hans; Verhoef, Peter C.; Bijmolt, Tammo H. A.

    In this paper, we study the staying power of various churn prediction models. Staying power is defined as the predictive performance of a model in a number of periods after the estimation period. We examine two methods, logit models and classification trees, both with and without applying a bagging

  19. Prediction Models for Dynamic Demand Response

    Energy Technology Data Exchange (ETDEWEB)

    Aman, Saima; Frincu, Marc; Chelmis, Charalampos; Noor, Muhammad; Simmhan, Yogesh; Prasanna, Viktor K.

    2015-11-02

    As Smart Grids move closer to dynamic curtailment programs, Demand Response (DR) events will become necessary not only on fixed time intervals and weekdays predetermined by static policies, but also during changing decision periods and weekends to react to real-time demand signals. Unique challenges arise in this context vis-a-vis demand prediction and curtailment estimation and the transformation of such tasks into an automated, efficient dynamic demand response (D2R) process. While existing work has concentrated on increasing the accuracy of prediction models for DR, there is a lack of studies for prediction models for D2R, which we address in this paper. Our first contribution is the formal definition of D2R, and the description of its challenges and requirements. Our second contribution is a feasibility analysis of very-short-term prediction of electricity consumption for D2R over a diverse, large-scale dataset that includes both small residential customers and large buildings. Our third, and major contribution is a set of insights into the predictability of electricity consumption in the context of D2R. Specifically, we focus on prediction models that can operate at a very small data granularity (here 15-min intervals), for both weekdays and weekends - all conditions that characterize scenarios for D2R. We find that short-term time series and simple averaging models used by Independent Service Operators and utilities achieve superior prediction accuracy. We also observe that workdays are more predictable than weekends and holiday. Also, smaller customers have large variation in consumption and are less predictable than larger buildings. Key implications of our findings are that better models are required for small customers and for non-workdays, both of which are critical for D2R. Also, prediction models require just few days’ worth of data indicating that small amounts of

  20. Genomic prediction of complex human traits: relatedness, trait architecture and predictive meta-models

    Science.gov (United States)

    Spiliopoulou, Athina; Nagy, Reka; Bermingham, Mairead L.; Huffman, Jennifer E.; Hayward, Caroline; Vitart, Veronique; Rudan, Igor; Campbell, Harry; Wright, Alan F.; Wilson, James F.; Pong-Wong, Ricardo; Agakov, Felix; Navarro, Pau; Haley, Chris S.

    2015-01-01

    We explore the prediction of individuals' phenotypes for complex traits using genomic data. We compare several widely used prediction models, including Ridge Regression, LASSO and Elastic Nets estimated from cohort data, and polygenic risk scores constructed using published summary statistics from genome-wide association meta-analyses (GWAMA). We evaluate the interplay between relatedness, trait architecture and optimal marker density, by predicting height, body mass index (BMI) and high-density lipoprotein level (HDL) in two data cohorts, originating from Croatia and Scotland. We empirically demonstrate that dense models are better when all genetic effects are small (height and BMI) and target individuals are related to the training samples, while sparse models predict better in unrelated individuals and when some effects have moderate size (HDL). For HDL sparse models achieved good across-cohort prediction, performing similarly to the GWAMA risk score and to models trained within the same cohort, which indicates that, for predicting traits with moderately sized effects, large sample sizes and familial structure become less important, though still potentially useful. Finally, we propose a novel ensemble of whole-genome predictors with GWAMA risk scores and demonstrate that the resulting meta-model achieves higher prediction accuracy than either model on its own. We conclude that although current genomic predictors are not accurate enough for diagnostic purposes, performance can be improved without requiring access to large-scale individual-level data. Our methodologically simple meta-model is a means of performing predictive meta-analysis for optimizing genomic predictions and can be easily extended to incorporate multiple population-level summary statistics or other domain knowledge. PMID:25918167

  1. Accuracy assessment of landslide prediction models

    International Nuclear Information System (INIS)

    Othman, A N; Mohd, W M N W; Noraini, S

    2014-01-01

    The increasing population and expansion of settlements over hilly areas has greatly increased the impact of natural disasters such as landslide. Therefore, it is important to developed models which could accurately predict landslide hazard zones. Over the years, various techniques and models have been developed to predict landslide hazard zones. The aim of this paper is to access the accuracy of landslide prediction models developed by the authors. The methodology involved the selection of study area, data acquisition, data processing and model development and also data analysis. The development of these models are based on nine different landslide inducing parameters i.e. slope, land use, lithology, soil properties, geomorphology, flow accumulation, aspect, proximity to river and proximity to road. Rank sum, rating, pairwise comparison and AHP techniques are used to determine the weights for each of the parameters used. Four (4) different models which consider different parameter combinations are developed by the authors. Results obtained are compared to landslide history and accuracies for Model 1, Model 2, Model 3 and Model 4 are 66.7, 66.7%, 60% and 22.9% respectively. From the results, rank sum, rating and pairwise comparison can be useful techniques to predict landslide hazard zones

  2. Mental models accurately predict emotion transitions.

    Science.gov (United States)

    Thornton, Mark A; Tamir, Diana I

    2017-06-06

    Successful social interactions depend on people's ability to predict others' future actions and emotions. People possess many mechanisms for perceiving others' current emotional states, but how might they use this information to predict others' future states? We hypothesized that people might capitalize on an overlooked aspect of affective experience: current emotions predict future emotions. By attending to regularities in emotion transitions, perceivers might develop accurate mental models of others' emotional dynamics. People could then use these mental models of emotion transitions to predict others' future emotions from currently observable emotions. To test this hypothesis, studies 1-3 used data from three extant experience-sampling datasets to establish the actual rates of emotional transitions. We then collected three parallel datasets in which participants rated the transition likelihoods between the same set of emotions. Participants' ratings of emotion transitions predicted others' experienced transitional likelihoods with high accuracy. Study 4 demonstrated that four conceptual dimensions of mental state representation-valence, social impact, rationality, and human mind-inform participants' mental models. Study 5 used 2 million emotion reports on the Experience Project to replicate both of these findings: again people reported accurate models of emotion transitions, and these models were informed by the same four conceptual dimensions. Importantly, neither these conceptual dimensions nor holistic similarity could fully explain participants' accuracy, suggesting that their mental models contain accurate information about emotion dynamics above and beyond what might be predicted by static emotion knowledge alone.

  3. Mental models accurately predict emotion transitions

    Science.gov (United States)

    Thornton, Mark A.; Tamir, Diana I.

    2017-01-01

    Successful social interactions depend on people’s ability to predict others’ future actions and emotions. People possess many mechanisms for perceiving others’ current emotional states, but how might they use this information to predict others’ future states? We hypothesized that people might capitalize on an overlooked aspect of affective experience: current emotions predict future emotions. By attending to regularities in emotion transitions, perceivers might develop accurate mental models of others’ emotional dynamics. People could then use these mental models of emotion transitions to predict others’ future emotions from currently observable emotions. To test this hypothesis, studies 1–3 used data from three extant experience-sampling datasets to establish the actual rates of emotional transitions. We then collected three parallel datasets in which participants rated the transition likelihoods between the same set of emotions. Participants’ ratings of emotion transitions predicted others’ experienced transitional likelihoods with high accuracy. Study 4 demonstrated that four conceptual dimensions of mental state representation—valence, social impact, rationality, and human mind—inform participants’ mental models. Study 5 used 2 million emotion reports on the Experience Project to replicate both of these findings: again people reported accurate models of emotion transitions, and these models were informed by the same four conceptual dimensions. Importantly, neither these conceptual dimensions nor holistic similarity could fully explain participants’ accuracy, suggesting that their mental models contain accurate information about emotion dynamics above and beyond what might be predicted by static emotion knowledge alone. PMID:28533373

  4. Poisson Mixture Regression Models for Heart Disease Prediction.

    Science.gov (United States)

    Mufudza, Chipo; Erol, Hamza

    2016-01-01

    Early heart disease control can be achieved by high disease prediction and diagnosis efficiency. This paper focuses on the use of model based clustering techniques to predict and diagnose heart disease via Poisson mixture regression models. Analysis and application of Poisson mixture regression models is here addressed under two different classes: standard and concomitant variable mixture regression models. Results show that a two-component concomitant variable Poisson mixture regression model predicts heart disease better than both the standard Poisson mixture regression model and the ordinary general linear Poisson regression model due to its low Bayesian Information Criteria value. Furthermore, a Zero Inflated Poisson Mixture Regression model turned out to be the best model for heart prediction over all models as it both clusters individuals into high or low risk category and predicts rate to heart disease componentwise given clusters available. It is deduced that heart disease prediction can be effectively done by identifying the major risks componentwise using Poisson mixture regression model.

  5. Poisson Mixture Regression Models for Heart Disease Prediction

    Science.gov (United States)

    Erol, Hamza

    2016-01-01

    Early heart disease control can be achieved by high disease prediction and diagnosis efficiency. This paper focuses on the use of model based clustering techniques to predict and diagnose heart disease via Poisson mixture regression models. Analysis and application of Poisson mixture regression models is here addressed under two different classes: standard and concomitant variable mixture regression models. Results show that a two-component concomitant variable Poisson mixture regression model predicts heart disease better than both the standard Poisson mixture regression model and the ordinary general linear Poisson regression model due to its low Bayesian Information Criteria value. Furthermore, a Zero Inflated Poisson Mixture Regression model turned out to be the best model for heart prediction over all models as it both clusters individuals into high or low risk category and predicts rate to heart disease componentwise given clusters available. It is deduced that heart disease prediction can be effectively done by identifying the major risks componentwise using Poisson mixture regression model. PMID:27999611

  6. Comparisons of Faulting-Based Pavement Performance Prediction Models

    Directory of Open Access Journals (Sweden)

    Weina Wang

    2017-01-01

    Full Text Available Faulting prediction is the core of concrete pavement maintenance and design. Highway agencies are always faced with the problem of lower accuracy for the prediction which causes costly maintenance. Although many researchers have developed some performance prediction models, the accuracy of prediction has remained a challenge. This paper reviews performance prediction models and JPCP faulting models that have been used in past research. Then three models including multivariate nonlinear regression (MNLR model, artificial neural network (ANN model, and Markov Chain (MC model are tested and compared using a set of actual pavement survey data taken on interstate highway with varying design features, traffic, and climate data. It is found that MNLR model needs further recalibration, while the ANN model needs more data for training the network. MC model seems a good tool for pavement performance prediction when the data is limited, but it is based on visual inspections and not explicitly related to quantitative physical parameters. This paper then suggests that the further direction for developing the performance prediction model is incorporating the advantages and disadvantages of different models to obtain better accuracy.

  7. Unreachable Setpoints in Model Predictive Control

    DEFF Research Database (Denmark)

    Rawlings, James B.; Bonné, Dennis; Jørgensen, John Bagterp

    2008-01-01

    In this work, a new model predictive controller is developed that handles unreachable setpoints better than traditional model predictive control methods. The new controller induces an interesting fast/slow asymmetry in the tracking response of the system. Nominal asymptotic stability of the optimal...... steady state is established for terminal constraint model predictive control (MPC). The region of attraction is the steerable set. Existing analysis methods for closed-loop properties of MPC are not applicable to this new formulation, and a new analysis method is developed. It is shown how to extend...

  8. Improving N-terminal protein annotation of Plasmodium species based on signal peptide prediction of orthologous proteins

    Directory of Open Access Journals (Sweden)

    Neto Armando

    2012-11-01

    Full Text Available Abstract Background Signal peptide is one of the most important motifs involved in protein trafficking and it ultimately influences protein function. Considering the expected functional conservation among orthologs it was hypothesized that divergence in signal peptides within orthologous groups is mainly due to N-terminal protein sequence misannotation. Thus, discrepancies in signal peptide prediction of orthologous proteins were used to identify misannotated proteins in five Plasmodium species. Methods Signal peptide (SignalP and orthology (OrthoMCL were combined in an innovative strategy to identify orthologous groups showing discrepancies in signal peptide prediction among their protein members (Mixed groups. In a comparative analysis, multiple alignments for each of these groups and gene models were visually inspected in search of misannotated proteins and, whenever possible, alternative gene models were proposed. Thresholds for signal peptide prediction parameters were also modified to reduce their impact as a possible source of discrepancy among orthologs. Validation of new gene models was based on RT-PCR (few examples or on experimental evidence already published (ApiLoc. Results The rate of misannotated proteins was significantly higher in Mixed groups than in Positive or Negative groups, corroborating the proposed hypothesis. A total of 478 proteins were reannotated and change of signal peptide prediction from negative to positive was the most common. Reannotations triggered the conversion of almost 50% of all Mixed groups, which were further reduced by optimization of signal peptide prediction parameters. Conclusions The methodological novelty proposed here combining orthology and signal peptide prediction proved to be an effective strategy for the identification of proteins showing wrongly N-terminal annotated sequences, and it might have an important impact in the available data for genome-wide searching of potential vaccine and drug

  9. The Utility of Freedom: A Principal-Agent Model for Unconventional Warfare

    Science.gov (United States)

    2011-06-01

    Lanchester Model of Guerrilla Warfare,‖ Operations Research 10, no. 6 (December 1962): 818–827; William A. Niskanen, ―Review: The Economics of Insurgency...http://galenet.galegroup.com/servlet/DDRS?locID=navalps. Deitchman, S. J. ―A Lanchester Model of Guerrilla Warfare.‖ Operations Research 10, no

  10. APFiLoc: An Infrastructure-Free Indoor Localization Method Fusing Smartphone Inertial Sensors, Landmarks and Map Information

    Science.gov (United States)

    Shang, Jianga; Gu, Fuqiang; Hu, Xuke; Kealy, Allison

    2015-01-01

    The utility and adoption of indoor localization applications have been limited due to the complex nature of the physical environment combined with an increasing requirement for more robust localization performance. Existing solutions to this problem are either too expensive or too dependent on infrastructure such as Wi-Fi access points. To address this problem, we propose APFiLoc—a low cost, smartphone-based framework for indoor localization. The key idea behind this framework is to obtain landmarks within the environment and to use the augmented particle filter to fuse them with measurements from smartphone sensors and map information. A clustering method based on distance constraints is developed to detect organic landmarks in an unsupervised way, and the least square support vector machine is used to classify seed landmarks. A series of real-world experiments were conducted in complex environments including multiple floors and the results show APFiLoc can achieve 80% accuracy (phone in the hand) and around 70% accuracy (phone in the pocket) of the error less than 2 m error without the assistance of infrastructure like Wi-Fi access points. PMID:26516858

  11. Estimating Model Prediction Error: Should You Treat Predictions as Fixed or Random?

    Science.gov (United States)

    Wallach, Daniel; Thorburn, Peter; Asseng, Senthold; Challinor, Andrew J.; Ewert, Frank; Jones, James W.; Rotter, Reimund; Ruane, Alexander

    2016-01-01

    Crop models are important tools for impact assessment of climate change, as well as for exploring management options under current climate. It is essential to evaluate the uncertainty associated with predictions of these models. We compare two criteria of prediction error; MSEP fixed, which evaluates mean squared error of prediction for a model with fixed structure, parameters and inputs, and MSEP uncertain( X), which evaluates mean squared error averaged over the distributions of model structure, inputs and parameters. Comparison of model outputs with data can be used to estimate the former. The latter has a squared bias term, which can be estimated using hindcasts, and a model variance term, which can be estimated from a simulation experiment. The separate contributions to MSEP uncertain (X) can be estimated using a random effects ANOVA. It is argued that MSEP uncertain (X) is the more informative uncertainty criterion, because it is specific to each prediction situation.

  12. Physiological Characterization of Vestibular Efferent Brainstem Neurons Using a Transgenic Mouse Model

    Science.gov (United States)

    Leijon, Sara; Magnusson, Anna K.

    2014-01-01

    The functional role of efferent innervation of the vestibular end-organs in the inner ear remains elusive. This study provides the first physiological characterization of the cholinergic vestibular efferent (VE) neurons in the brainstem by utilizing a transgenic mouse model, expressing eGFP under a choline-acetyltransferase (ChAT)-locus spanning promoter in combination with targeted patch clamp recordings. The intrinsic electrical properties of the eGFP-positive VE neurons were compared to the properties of the lateral olivocochlear (LOC) brainstem neurons, which gives rise to efferent innervation of the cochlea. Both VE and the LOC neurons were marked by their negative resting membrane potential neurons differed significantly in the depolarizing range. When injected with positive currents, VE neurons fired action potentials faithfully to the onset of depolarization followed by sparse firing with long inter-spike intervals. This response gave rise to a low response gain. The LOC neurons, conversely, responded with a characteristic delayed tonic firing upon depolarizing stimuli, giving rise to higher response gain than the VE neurons. Depolarization triggered large TEA insensitive outward currents with fast inactivation kinetics, indicating A-type potassium currents, in both the inner ear-projecting neuronal types. Immunohistochemistry confirmed expression of Kv4.3 and 4.2 ion channel subunits in both the VE and LOC neurons. The difference in spiking responses to depolarization is related to a two-fold impact of these transient outward currents on somatic integration in the LOC neurons compared to in VE neurons. It is speculated that the physiological properties of the VE neurons might be compatible with a wide-spread control over motion and gravity sensation in the inner ear, providing likewise feed-back amplification of abrupt and strong phasic signals from the semi-circular canals and of tonic signals from the gravito-sensitive macular organs. PMID:24867596

  13. Risk terrain modeling predicts child maltreatment.

    Science.gov (United States)

    Daley, Dyann; Bachmann, Michael; Bachmann, Brittany A; Pedigo, Christian; Bui, Minh-Thuy; Coffman, Jamye

    2016-12-01

    As indicated by research on the long-term effects of adverse childhood experiences (ACEs), maltreatment has far-reaching consequences for affected children. Effective prevention measures have been elusive, partly due to difficulty in identifying vulnerable children before they are harmed. This study employs Risk Terrain Modeling (RTM), an analysis of the cumulative effect of environmental factors thought to be conducive for child maltreatment, to create a highly accurate prediction model for future substantiated child maltreatment cases in the City of Fort Worth, Texas. The model is superior to commonly used hotspot predictions and more beneficial in aiding prevention efforts in a number of ways: 1) it identifies the highest risk areas for future instances of child maltreatment with improved precision and accuracy; 2) it aids the prioritization of risk-mitigating efforts by informing about the relative importance of the most significant contributing risk factors; 3) since predictions are modeled as a function of easily obtainable data, practitioners do not have to undergo the difficult process of obtaining official child maltreatment data to apply it; 4) the inclusion of a multitude of environmental risk factors creates a more robust model with higher predictive validity; and, 5) the model does not rely on a retrospective examination of past instances of child maltreatment, but adapts predictions to changing environmental conditions. The present study introduces and examines the predictive power of this new tool to aid prevention efforts seeking to improve the safety, health, and wellbeing of vulnerable children. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.

  14. Case studies in archaeological predictive modelling

    NARCIS (Netherlands)

    Verhagen, Jacobus Wilhelmus Hermanus Philippus

    2007-01-01

    In this thesis, a collection of papers is put together dealing with various quantitative aspects of predictive modelling and archaeological prospection. Among the issues covered are the effects of survey bias on the archaeological data used for predictive modelling, and the complexities of testing

  15. Review of the Local Organizing Committee (LOC) medical services during the 12th FINA World Swimming Championships (25 m) in Doha, Qatar.

    Science.gov (United States)

    Dijkstra, H Paul; Geertsema, Liesel; Benzarti, Nejib; van Dorssen, Elsbeth A L; van den Hoogenband, Cees-Rein; Mountjoy, Margo

    2016-05-01

    One of the primary roles of Fédération Internationale de Natation (FINA) is to promote athlete health. The planning and delivery of major international event medical services is carried out in collaboration with the Local Organizing Committee Medical Commission (LOCMC). Aspetar Orthopaedic and Sports Medicine Hospital provided the medical services to the 12th FINA World Swimming Championships (25 m) creating a unique opportunity for collaboration with FINA. The purpose of this paper is to review the planning and delivery of medical services and athlete health promotion projects during the 12th FINA World Swimming Championships (25 m) to facilitate the planning of future sporting events of this size and scope. The 12th FINA World Swimming Championships (25 m) hosted 974 athletes from 166 countries. The LOC medical team recorded all medical encounters-newly incurred (or acute exacerbations of chronic) injuries and illnesses as well as follow-up consultations. More than 90% of teams did not travel with a team physician and relied on the LOCMC for diagnosis and treatment of injuries and illnesses in athletes and accredited team officials. The LOC medical team had a total of 554 medical encounters: 385 therapy, 34 athlete injury, 65 athlete illness and 70 non-athlete encounters. The LOCMC in collaboration with FINA delivered comprehensive medical services to athletes, officials and spectators attending the 12th FINA World Swimming Championships (25 m). This review paper provides information relevant to the planning and delivery of LOCMC medical services for future international swimming events contributing to the FINA objective of promoting athlete health. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/

  16. Fingerprint verification prediction model in hand dermatitis.

    Science.gov (United States)

    Lee, Chew K; Chang, Choong C; Johor, Asmah; Othman, Puwira; Baba, Roshidah

    2015-07-01

    Hand dermatitis associated fingerprint changes is a significant problem and affects fingerprint verification processes. This study was done to develop a clinically useful prediction model for fingerprint verification in patients with hand dermatitis. A case-control study involving 100 patients with hand dermatitis. All patients verified their thumbprints against their identity card. Registered fingerprints were randomized into a model derivation and model validation group. Predictive model was derived using multiple logistic regression. Validation was done using the goodness-of-fit test. The fingerprint verification prediction model consists of a major criterion (fingerprint dystrophy area of ≥ 25%) and two minor criteria (long horizontal lines and long vertical lines). The presence of the major criterion predicts it will almost always fail verification, while presence of both minor criteria and presence of one minor criterion predict high and low risk of fingerprint verification failure, respectively. When none of the criteria are met, the fingerprint almost always passes the verification. The area under the receiver operating characteristic curve was 0.937, and the goodness-of-fit test showed agreement between the observed and expected number (P = 0.26). The derived fingerprint verification failure prediction model is validated and highly discriminatory in predicting risk of fingerprint verification in patients with hand dermatitis. © 2014 The International Society of Dermatology.

  17. Finding Furfural Hydrogenation Catalysts via Predictive Modelling.

    Science.gov (United States)

    Strassberger, Zea; Mooijman, Maurice; Ruijter, Eelco; Alberts, Albert H; Maldonado, Ana G; Orru, Romano V A; Rothenberg, Gadi

    2010-09-10

    We combine multicomponent reactions, catalytic performance studies and predictive modelling to find transfer hydrogenation catalysts. An initial set of 18 ruthenium-carbene complexes were synthesized and screened in the transfer hydrogenation of furfural to furfurol with isopropyl alcohol complexes gave varied yields, from 62% up to >99.9%, with no obvious structure/activity correlations. Control experiments proved that the carbene ligand remains coordinated to the ruthenium centre throughout the reaction. Deuterium-labelling studies showed a secondary isotope effect (k(H):k(D)=1.5). Further mechanistic studies showed that this transfer hydrogenation follows the so-called monohydride pathway. Using these data, we built a predictive model for 13 of the catalysts, based on 2D and 3D molecular descriptors. We tested and validated the model using the remaining five catalysts (cross-validation, R(2)=0.913). Then, with this model, the conversion and selectivity were predicted for four completely new ruthenium-carbene complexes. These four catalysts were then synthesized and tested. The results were within 3% of the model's predictions, demonstrating the validity and value of predictive modelling in catalyst optimization.

  18. Model Predictive Control for Smart Energy Systems

    DEFF Research Database (Denmark)

    Halvgaard, Rasmus

    pumps, heat tanks, electrical vehicle battery charging/discharging, wind farms, power plants). 2.Embed forecasting methodologies for the weather (e.g. temperature, solar radiation), the electricity consumption, and the electricity price in a predictive control system. 3.Develop optimization algorithms....... Chapter 3 introduces Model Predictive Control (MPC) including state estimation, filtering and prediction for linear models. Chapter 4 simulates the models from Chapter 2 with the certainty equivalent MPC from Chapter 3. An economic MPC minimizes the costs of consumption based on real electricity prices...... that determined the flexibility of the units. A predictive control system easily handles constraints, e.g. limitations in power consumption, and predicts the future behavior of a unit by integrating predictions of electricity prices, consumption, and weather variables. The simulations demonstrate the expected...

  19. An investigation of two dimensions of impulsivity as predictors of loss-of-control eating severity and frequency.

    Science.gov (United States)

    Espel, Hallie M; Muratore, Alexandra F; Lowe, Michael R

    2017-10-01

    Loss-of-control (LOC) eating episodes represent one form of dysregulated eating common to full- and sub-threshold eating disorders. Extensive evidence suggests that impulsivity, particularly in the context of negative affect and/or depression, may play an important etiological role in the development and maintenance of LOC eating. However, most prior studies have considered LOC eating as a dichotomous rather than dimensional construct, and few studies have considered the interaction of multiple dimensions of impulsivity while also accounting for the role of depressive symptoms. The present study examined the independent and interacting effects of two facets of impulsivity-response inhibition and negative urgency-on LOC eating episode severity and frequency among college women (N = 102). Depressive symptom severity was included as a covariate. Results indicated that greater negative urgency was associated with greater LOC severity; this effect was moderated by response inhibition, such that the effect of urgency was particularly pronounced for individuals with higher response inhibition capacity. Negative urgency was the only significant predictor of LOC frequency. Depression had no significant effect on either LOC severity or frequency (ps ≥ 0.16). Results support the importance of considering multiple facets of impulsivity in predicting LOC eating behavior, and further indicate that factors influencing subjective severity and frequency of LOC may be distinct. Copyright © 2017 Elsevier Ltd. All rights reserved.

  20. Locus of Control and Neuropsychological Performance in Chronic Alcoholics.

    Science.gov (United States)

    Shelton, M. D.; And Others

    1982-01-01

    Examined correlated neuropsychological performance in male chronic alcoholics and non-alcoholic controls. Results showed external locus of control (LOC-E) scores to predict performance on neuropsychological tests in alcoholics but not in controls. Suggests the LOC-E variables cannot account for the widespread differences between the groups on…

  1. Prediction skill of rainstorm events over India in the TIGGE weather prediction models

    Science.gov (United States)

    Karuna Sagar, S.; Rajeevan, M.; Vijaya Bhaskara Rao, S.; Mitra, A. K.

    2017-12-01

    Extreme rainfall events pose a serious threat of leading to severe floods in many countries worldwide. Therefore, advance prediction of its occurrence and spatial distribution is very essential. In this paper, an analysis has been made to assess the skill of numerical weather prediction models in predicting rainstorms over India. Using gridded daily rainfall data set and objective criteria, 15 rainstorms were identified during the monsoon season (June to September). The analysis was made using three TIGGE (THe Observing System Research and Predictability Experiment (THORPEX) Interactive Grand Global Ensemble) models. The models considered are the European Centre for Medium-Range Weather Forecasts (ECMWF), National Centre for Environmental Prediction (NCEP) and the UK Met Office (UKMO). Verification of the TIGGE models for 43 observed rainstorm days from 15 rainstorm events has been made for the period 2007-2015. The comparison reveals that rainstorm events are predictable up to 5 days in advance, however with a bias in spatial distribution and intensity. The statistical parameters like mean error (ME) or Bias, root mean square error (RMSE) and correlation coefficient (CC) have been computed over the rainstorm region using the multi-model ensemble (MME) mean. The study reveals that the spread is large in ECMWF and UKMO followed by the NCEP model. Though the ensemble spread is quite small in NCEP, the ensemble member averages are not well predicted. The rank histograms suggest that the forecasts are under prediction. The modified Contiguous Rain Area (CRA) technique was used to verify the spatial as well as the quantitative skill of the TIGGE models. Overall, the contribution from the displacement and pattern errors to the total RMSE is found to be more in magnitude. The volume error increases from 24 hr forecast to 48 hr forecast in all the three models.

  2. Predicting climate-induced range shifts: model differences and model reliability.

    Science.gov (United States)

    Joshua J. Lawler; Denis White; Ronald P. Neilson; Andrew R. Blaustein

    2006-01-01

    Predicted changes in the global climate are likely to cause large shifts in the geographic ranges of many plant and animal species. To date, predictions of future range shifts have relied on a variety of modeling approaches with different levels of model accuracy. Using a common data set, we investigated the potential implications of alternative modeling approaches for...

  3. Predictive Modeling of a Paradigm Mechanical Cooling Tower Model: II. Optimal Best-Estimate Results with Reduced Predicted Uncertainties

    Directory of Open Access Journals (Sweden)

    Ruixian Fang

    2016-09-01

    Full Text Available This work uses the adjoint sensitivity model of the counter-flow cooling tower derived in the accompanying PART I to obtain the expressions and relative numerical rankings of the sensitivities, to all model parameters, of the following model responses: (i outlet air temperature; (ii outlet water temperature; (iii outlet water mass flow rate; and (iv air outlet relative humidity. These sensitivities are subsequently used within the “predictive modeling for coupled multi-physics systems” (PM_CMPS methodology to obtain explicit formulas for the predicted optimal nominal values for the model responses and parameters, along with reduced predicted standard deviations for the predicted model parameters and responses. These explicit formulas embody the assimilation of experimental data and the “calibration” of the model’s parameters. The results presented in this work demonstrate that the PM_CMPS methodology reduces the predicted standard deviations to values that are smaller than either the computed or the experimentally measured ones, even for responses (e.g., the outlet water flow rate for which no measurements are available. These improvements stem from the global characteristics of the PM_CMPS methodology, which combines all of the available information simultaneously in phase-space, as opposed to combining it sequentially, as in current data assimilation procedures.

  4. Model predictive control classical, robust and stochastic

    CERN Document Server

    Kouvaritakis, Basil

    2016-01-01

    For the first time, a textbook that brings together classical predictive control with treatment of up-to-date robust and stochastic techniques. Model Predictive Control describes the development of tractable algorithms for uncertain, stochastic, constrained systems. The starting point is classical predictive control and the appropriate formulation of performance objectives and constraints to provide guarantees of closed-loop stability and performance. Moving on to robust predictive control, the text explains how similar guarantees may be obtained for cases in which the model describing the system dynamics is subject to additive disturbances and parametric uncertainties. Open- and closed-loop optimization are considered and the state of the art in computationally tractable methods based on uncertainty tubes presented for systems with additive model uncertainty. Finally, the tube framework is also applied to model predictive control problems involving hard or probabilistic constraints for the cases of multiplic...

  5. Model predictive Controller for Mobile Robot

    OpenAIRE

    Alireza Rezaee

    2017-01-01

    This paper proposes a Model Predictive Controller (MPC) for control of a P2AT mobile robot. MPC refers to a group of controllers that employ a distinctly identical model of process to predict its future behavior over an extended prediction horizon. The design of a MPC is formulated as an optimal control problem. Then this problem is considered as linear quadratic equation (LQR) and is solved by making use of Ricatti equation. To show the effectiveness of the proposed method this controller is...

  6. Deep Predictive Models in Interactive Music

    OpenAIRE

    Martin, Charles P.; Ellefsen, Kai Olav; Torresen, Jim

    2018-01-01

    Automatic music generation is a compelling task where much recent progress has been made with deep learning models. In this paper, we ask how these models can be integrated into interactive music systems; how can they encourage or enhance the music making of human users? Musical performance requires prediction to operate instruments, and perform in groups. We argue that predictive models could help interactive systems to understand their temporal context, and ensemble behaviour. Deep learning...

  7. Risk prediction model: Statistical and artificial neural network approach

    Science.gov (United States)

    Paiman, Nuur Azreen; Hariri, Azian; Masood, Ibrahim

    2017-04-01

    Prediction models are increasingly gaining popularity and had been used in numerous areas of studies to complement and fulfilled clinical reasoning and decision making nowadays. The adoption of such models assist physician's decision making, individual's behavior, and consequently improve individual outcomes and the cost-effectiveness of care. The objective of this paper is to reviewed articles related to risk prediction model in order to understand the suitable approach, development and the validation process of risk prediction model. A qualitative review of the aims, methods and significant main outcomes of the nineteen published articles that developed risk prediction models from numerous fields were done. This paper also reviewed on how researchers develop and validate the risk prediction models based on statistical and artificial neural network approach. From the review done, some methodological recommendation in developing and validating the prediction model were highlighted. According to studies that had been done, artificial neural network approached in developing the prediction model were more accurate compared to statistical approach. However currently, only limited published literature discussed on which approach is more accurate for risk prediction model development.

  8. Prediction of response to preoperative chemoradiotherapy and establishment of individualized therapy in advanced rectal cancer.

    Science.gov (United States)

    Nakao, Toshihiro; Iwata, Takashi; Hotchi, Masanori; Yoshikawa, Kozo; Higashijima, Jun; Nishi, Masaaki; Takasu, Chie; Eto, Shohei; Teraoku, Hiroki; Shimada, Mitsuo

    2015-10-01

    Preoperative chemoradiotherapy (CRT) has become the standard treatment for patients with locally advanced rectal cancer. However, no specific biomarker has been identified to predict a response to preoperative CRT. The aim of the present study was to assess the gene expression patterns of patients with advanced rectal cancer to predict their responses to preoperative CRT. Fifty-nine rectal cancer patients were subjected to preoperative CRT. Patients were randomly assigned to receive CRT with tegafur/gimeracil/oteracil (S-1 group, n=30) or tegafur-uracil (UFT group, n=29). Gene expression changes were studied with cDNA and miRNA microarray. The association between gene expression and response to CRT was evaluated. cDNA microarray showed that 184 genes were significantly differentially expressed between the responders and the non‑responders in the S-1 group. Comparatively, 193 genes were significantly differentially expressed in the responders in the UFT group. TBX18 upregulation was common to both groups whereas BTNL8, LOC375010, ADH1B, HRASLS2, LOC284232, GCNT3 and ALDH1A2 were significantly differentially lower in both groups when compared with the non-responders. Using miRNA microarray, we found that 7 and 16 genes were significantly differentially expressed between the responders and non-responders in the S-1 and UFT groups, respectively. miR-223 was significantly higher in the responders in the S-1 group and tended to be higher in the responders in the UFT group. The present study identified several genes likely to be useful for establishing individualized therapies for patients with rectal cancer.

  9. Evaluation of CASP8 model quality predictions

    KAUST Repository

    Cozzetto, Domenico

    2009-01-01

    The model quality assessment problem consists in the a priori estimation of the overall and per-residue accuracy of protein structure predictions. Over the past years, a number of methods have been developed to address this issue and CASP established a prediction category to evaluate their performance in 2006. In 2008 the experiment was repeated and its results are reported here. Participants were invited to infer the correctness of the protein models submitted by the registered automatic servers. Estimates could apply to both whole models and individual amino acids. Groups involved in the tertiary structure prediction categories were also asked to assign local error estimates to each predicted residue in their own models and their results are also discussed here. The correlation between the predicted and observed correctness measures was the basis of the assessment of the results. We observe that consensus-based methods still perform significantly better than those accepting single models, similarly to what was concluded in the previous edition of the experiment. © 2009 WILEY-LISS, INC.

  10. Predictive models of moth development

    Science.gov (United States)

    Degree-day models link ambient temperature to insect life-stages, making such models valuable tools in integrated pest management. These models increase management efficacy by predicting pest phenology. In Wisconsin, the top insect pest of cranberry production is the cranberry fruitworm, Acrobasis v...

  11. Model Prediction Control For Water Management Using Adaptive Prediction Accuracy

    NARCIS (Netherlands)

    Tian, X.; Negenborn, R.R.; Van Overloop, P.J.A.T.M.; Mostert, E.

    2014-01-01

    In the field of operational water management, Model Predictive Control (MPC) has gained popularity owing to its versatility and flexibility. The MPC controller, which takes predictions, time delay and uncertainties into account, can be designed for multi-objective management problems and for

  12. Predicting water main failures using Bayesian model averaging and survival modelling approach

    International Nuclear Information System (INIS)

    Kabir, Golam; Tesfamariam, Solomon; Sadiq, Rehan

    2015-01-01

    To develop an effective preventive or proactive repair and replacement action plan, water utilities often rely on water main failure prediction models. However, in predicting the failure of water mains, uncertainty is inherent regardless of the quality and quantity of data used in the model. To improve the understanding of water main failure, a Bayesian framework is developed for predicting the failure of water mains considering uncertainties. In this study, Bayesian model averaging method (BMA) is presented to identify the influential pipe-dependent and time-dependent covariates considering model uncertainties whereas Bayesian Weibull Proportional Hazard Model (BWPHM) is applied to develop the survival curves and to predict the failure rates of water mains. To accredit the proposed framework, it is implemented to predict the failure of cast iron (CI) and ductile iron (DI) pipes of the water distribution network of the City of Calgary, Alberta, Canada. Results indicate that the predicted 95% uncertainty bounds of the proposed BWPHMs capture effectively the observed breaks for both CI and DI water mains. Moreover, the performance of the proposed BWPHMs are better compare to the Cox-Proportional Hazard Model (Cox-PHM) for considering Weibull distribution for the baseline hazard function and model uncertainties. - Highlights: • Prioritize rehabilitation and replacements (R/R) strategies of water mains. • Consider the uncertainties for the failure prediction. • Improve the prediction capability of the water mains failure models. • Identify the influential and appropriate covariates for different models. • Determine the effects of the covariates on failure

  13. Testing the predictive power of nuclear mass models

    International Nuclear Information System (INIS)

    Mendoza-Temis, J.; Morales, I.; Barea, J.; Frank, A.; Hirsch, J.G.; Vieyra, J.C. Lopez; Van Isacker, P.; Velazquez, V.

    2008-01-01

    A number of tests are introduced which probe the ability of nuclear mass models to extrapolate. Three models are analyzed in detail: the liquid drop model, the liquid drop model plus empirical shell corrections and the Duflo-Zuker mass formula. If predicted nuclei are close to the fitted ones, average errors in predicted and fitted masses are similar. However, the challenge of predicting nuclear masses in a region stabilized by shell effects (e.g., the lead region) is far more difficult. The Duflo-Zuker mass formula emerges as a powerful predictive tool

  14. Comparison of Prediction-Error-Modelling Criteria

    DEFF Research Database (Denmark)

    Jørgensen, John Bagterp; Jørgensen, Sten Bay

    2007-01-01

    Single and multi-step prediction-error-methods based on the maximum likelihood and least squares criteria are compared. The prediction-error methods studied are based on predictions using the Kalman filter and Kalman predictors for a linear discrete-time stochastic state space model, which is a r...

  15. Foundation Settlement Prediction Based on a Novel NGM Model

    Directory of Open Access Journals (Sweden)

    Peng-Yu Chen

    2014-01-01

    Full Text Available Prediction of foundation or subgrade settlement is very important during engineering construction. According to the fact that there are lots of settlement-time sequences with a nonhomogeneous index trend, a novel grey forecasting model called NGM (1,1,k,c model is proposed in this paper. With an optimized whitenization differential equation, the proposed NGM (1,1,k,c model has the property of white exponential law coincidence and can predict a pure nonhomogeneous index sequence precisely. We used two case studies to verify the predictive effect of NGM (1,1,k,c model for settlement prediction. The results show that this model can achieve excellent prediction accuracy; thus, the model is quite suitable for simulation and prediction of approximate nonhomogeneous index sequence and has excellent application value in settlement prediction.

  16. Electrostatic ion thrusters - towards predictive modeling

    Energy Technology Data Exchange (ETDEWEB)

    Kalentev, O.; Matyash, K.; Duras, J.; Lueskow, K.F.; Schneider, R. [Ernst-Moritz-Arndt Universitaet Greifswald, D-17489 (Germany); Koch, N. [Technische Hochschule Nuernberg Georg Simon Ohm, Kesslerplatz 12, D-90489 Nuernberg (Germany); Schirra, M. [Thales Electronic Systems GmbH, Soeflinger Strasse 100, D-89077 Ulm (Germany)

    2014-02-15

    The development of electrostatic ion thrusters so far has mainly been based on empirical and qualitative know-how, and on evolutionary iteration steps. This resulted in considerable effort regarding prototype design, construction and testing and therefore in significant development and qualification costs and high time demands. For future developments it is anticipated to implement simulation tools which allow for quantitative prediction of ion thruster performance, long-term behavior and space craft interaction prior to hardware design and construction. Based on integrated numerical models combining self-consistent kinetic plasma models with plasma-wall interaction modules a new quality in the description of electrostatic thrusters can be reached. These open the perspective for predictive modeling in this field. This paper reviews the application of a set of predictive numerical modeling tools on an ion thruster model of the HEMP-T (High Efficiency Multi-stage Plasma Thruster) type patented by Thales Electron Devices GmbH. (copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  17. Predictive validation of an influenza spread model.

    Directory of Open Access Journals (Sweden)

    Ayaz Hyder

    Full Text Available BACKGROUND: Modeling plays a critical role in mitigating impacts of seasonal influenza epidemics. Complex simulation models are currently at the forefront of evaluating optimal mitigation strategies at multiple scales and levels of organization. Given their evaluative role, these models remain limited in their ability to predict and forecast future epidemics leading some researchers and public-health practitioners to question their usefulness. The objective of this study is to evaluate the predictive ability of an existing complex simulation model of influenza spread. METHODS AND FINDINGS: We used extensive data on past epidemics to demonstrate the process of predictive validation. This involved generalizing an individual-based model for influenza spread and fitting it to laboratory-confirmed influenza infection data from a single observed epidemic (1998-1999. Next, we used the fitted model and modified two of its parameters based on data on real-world perturbations (vaccination coverage by age group and strain type. Simulating epidemics under these changes allowed us to estimate the deviation/error between the expected epidemic curve under perturbation and observed epidemics taking place from 1999 to 2006. Our model was able to forecast absolute intensity and epidemic peak week several weeks earlier with reasonable reliability and depended on the method of forecasting-static or dynamic. CONCLUSIONS: Good predictive ability of influenza epidemics is critical for implementing mitigation strategies in an effective and timely manner. Through the process of predictive validation applied to a current complex simulation model of influenza spread, we provided users of the model (e.g. public-health officials and policy-makers with quantitative metrics and practical recommendations on mitigating impacts of seasonal influenza epidemics. This methodology may be applied to other models of communicable infectious diseases to test and potentially improve

  18. Predictive Validation of an Influenza Spread Model

    Science.gov (United States)

    Hyder, Ayaz; Buckeridge, David L.; Leung, Brian

    2013-01-01

    Background Modeling plays a critical role in mitigating impacts of seasonal influenza epidemics. Complex simulation models are currently at the forefront of evaluating optimal mitigation strategies at multiple scales and levels of organization. Given their evaluative role, these models remain limited in their ability to predict and forecast future epidemics leading some researchers and public-health practitioners to question their usefulness. The objective of this study is to evaluate the predictive ability of an existing complex simulation model of influenza spread. Methods and Findings We used extensive data on past epidemics to demonstrate the process of predictive validation. This involved generalizing an individual-based model for influenza spread and fitting it to laboratory-confirmed influenza infection data from a single observed epidemic (1998–1999). Next, we used the fitted model and modified two of its parameters based on data on real-world perturbations (vaccination coverage by age group and strain type). Simulating epidemics under these changes allowed us to estimate the deviation/error between the expected epidemic curve under perturbation and observed epidemics taking place from 1999 to 2006. Our model was able to forecast absolute intensity and epidemic peak week several weeks earlier with reasonable reliability and depended on the method of forecasting-static or dynamic. Conclusions Good predictive ability of influenza epidemics is critical for implementing mitigation strategies in an effective and timely manner. Through the process of predictive validation applied to a current complex simulation model of influenza spread, we provided users of the model (e.g. public-health officials and policy-makers) with quantitative metrics and practical recommendations on mitigating impacts of seasonal influenza epidemics. This methodology may be applied to other models of communicable infectious diseases to test and potentially improve their predictive

  19. Integrating geophysics and hydrology for reducing the uncertainty of groundwater model predictions and improved prediction performance

    DEFF Research Database (Denmark)

    Christensen, Nikolaj Kruse; Christensen, Steen; Ferre, Ty

    the integration of geophysical data in the construction of a groundwater model increases the prediction performance. We suggest that modelers should perform a hydrogeophysical “test-bench” analysis of the likely value of geophysics data for improving groundwater model prediction performance before actually...... and the resulting predictions can be compared with predictions from the ‘true’ model. By performing this analysis we expect to give the modeler insight into how the uncertainty of model-based prediction can be reduced.......A major purpose of groundwater modeling is to help decision-makers in efforts to manage the natural environment. Increasingly, it is recognized that both the predictions of interest and their associated uncertainties should be quantified to support robust decision making. In particular, decision...

  20. Predictive Surface Complexation Modeling

    Energy Technology Data Exchange (ETDEWEB)

    Sverjensky, Dimitri A. [Johns Hopkins Univ., Baltimore, MD (United States). Dept. of Earth and Planetary Sciences

    2016-11-29

    Surface complexation plays an important role in the equilibria and kinetics of processes controlling the compositions of soilwaters and groundwaters, the fate of contaminants in groundwaters, and the subsurface storage of CO2 and nuclear waste. Over the last several decades, many dozens of individual experimental studies have addressed aspects of surface complexation that have contributed to an increased understanding of its role in natural systems. However, there has been no previous attempt to develop a model of surface complexation that can be used to link all the experimental studies in order to place them on a predictive basis. Overall, my research has successfully integrated the results of the work of many experimentalists published over several decades. For the first time in studies of the geochemistry of the mineral-water interface, a practical predictive capability for modeling has become available. The predictive correlations developed in my research now enable extrapolations of experimental studies to provide estimates of surface chemistry for systems not yet studied experimentally and for natural and anthropogenically perturbed systems.

  1. NOx PREDICTION FOR FBC BOILERS USING EMPIRICAL MODELS

    Directory of Open Access Journals (Sweden)

    Jiří Štefanica

    2014-02-01

    Full Text Available Reliable prediction of NOx emissions can provide useful information for boiler design and fuel selection. Recently used kinetic prediction models for FBC boilers are overly complex and require large computing capacity. Even so, there are many uncertainties in the case of FBC boilers. An empirical modeling approach for NOx prediction has been used exclusively for PCC boilers. No reference is available for modifying this method for FBC conditions. This paper presents possible advantages of empirical modeling based prediction of NOx emissions for FBC boilers, together with a discussion of its limitations. Empirical models are reviewed, and are applied to operation data from FBC boilers used for combusting Czech lignite coal or coal-biomass mixtures. Modifications to the model are proposed in accordance with theoretical knowledge and prediction accuracy.

  2. Prediction of pipeline corrosion rate based on grey Markov models

    International Nuclear Information System (INIS)

    Chen Yonghong; Zhang Dafa; Peng Guichu; Wang Yuemin

    2009-01-01

    Based on the model that combined by grey model and Markov model, the prediction of corrosion rate of nuclear power pipeline was studied. Works were done to improve the grey model, and the optimization unbiased grey model was obtained. This new model was used to predict the tendency of corrosion rate, and the Markov model was used to predict the residual errors. In order to improve the prediction precision, rolling operation method was used in these prediction processes. The results indicate that the improvement to the grey model is effective and the prediction precision of the new model combined by the optimization unbiased grey model and Markov model is better, and the use of rolling operation method may improve the prediction precision further. (authors)

  3. Sweat loss prediction using a multi-model approach.

    Science.gov (United States)

    Xu, Xiaojiang; Santee, William R

    2011-07-01

    A new multi-model approach (MMA) for sweat loss prediction is proposed to improve prediction accuracy. MMA was computed as the average of sweat loss predicted by two existing thermoregulation models: i.e., the rational model SCENARIO and the empirical model Heat Strain Decision Aid (HSDA). Three independent physiological datasets, a total of 44 trials, were used to compare predictions by MMA, SCENARIO, and HSDA. The observed sweat losses were collected under different combinations of uniform ensembles, environmental conditions (15-40°C, RH 25-75%), and exercise intensities (250-600 W). Root mean square deviation (RMSD), residual plots, and paired t tests were used to compare predictions with observations. Overall, MMA reduced RMSD by 30-39% in comparison with either SCENARIO or HSDA, and increased the prediction accuracy to 66% from 34% or 55%. Of the MMA predictions, 70% fell within the range of mean observed value ± SD, while only 43% of SCENARIO and 50% of HSDA predictions fell within the same range. Paired t tests showed that differences between observations and MMA predictions were not significant, but differences between observations and SCENARIO or HSDA predictions were significantly different for two datasets. Thus, MMA predicted sweat loss more accurately than either of the two single models for the three datasets used. Future work will be to evaluate MMA using additional physiological data to expand the scope of populations and conditions.

  4. Career Locus of Control and Career Success among Chinese Employees: A Multidimensional Approach

    Science.gov (United States)

    Guan, Yanjun; Wang, Zhen; Dong, Zhilin; Liu, Yukun; Yue, Yumeng; Liu, Haiyang; Zhang, Yuqing; Zhou, Wenxia; Liu, Haihua

    2013-01-01

    The current research aimed to develop a multidimensional measure of career locus of control (LOC) and examine its predictive validity on objective and subjective career success among Chinese employees. Items of career LOC were generated based on literature review of the significant predictors of career success, as well as the open-ended responses…

  5. Finding Furfural Hydrogenation Catalysts via Predictive Modelling

    Science.gov (United States)

    Strassberger, Zea; Mooijman, Maurice; Ruijter, Eelco; Alberts, Albert H; Maldonado, Ana G; Orru, Romano V A; Rothenberg, Gadi

    2010-01-01

    Abstract We combine multicomponent reactions, catalytic performance studies and predictive modelling to find transfer hydrogenation catalysts. An initial set of 18 ruthenium-carbene complexes were synthesized and screened in the transfer hydrogenation of furfural to furfurol with isopropyl alcohol complexes gave varied yields, from 62% up to >99.9%, with no obvious structure/activity correlations. Control experiments proved that the carbene ligand remains coordinated to the ruthenium centre throughout the reaction. Deuterium-labelling studies showed a secondary isotope effect (kH:kD=1.5). Further mechanistic studies showed that this transfer hydrogenation follows the so-called monohydride pathway. Using these data, we built a predictive model for 13 of the catalysts, based on 2D and 3D molecular descriptors. We tested and validated the model using the remaining five catalysts (cross-validation, R2=0.913). Then, with this model, the conversion and selectivity were predicted for four completely new ruthenium-carbene complexes. These four catalysts were then synthesized and tested. The results were within 3% of the model’s predictions, demonstrating the validity and value of predictive modelling in catalyst optimization. PMID:23193388

  6. Alcator C-Mod predictive modeling

    International Nuclear Information System (INIS)

    Pankin, Alexei; Bateman, Glenn; Kritz, Arnold; Greenwald, Martin; Snipes, Joseph; Fredian, Thomas

    2001-01-01

    Predictive simulations for the Alcator C-mod tokamak [I. Hutchinson et al., Phys. Plasmas 1, 1511 (1994)] are carried out using the BALDUR integrated modeling code [C. E. Singer et al., Comput. Phys. Commun. 49, 275 (1988)]. The results are obtained for temperature and density profiles using the Multi-Mode transport model [G. Bateman et al., Phys. Plasmas 5, 1793 (1998)] as well as the mixed-Bohm/gyro-Bohm transport model [M. Erba et al., Plasma Phys. Controlled Fusion 39, 261 (1997)]. The simulated discharges are characterized by very high plasma density in both low and high modes of confinement. The predicted profiles for each of the transport models match the experimental data about equally well in spite of the fact that the two models have different dimensionless scalings. Average relative rms deviations are less than 8% for the electron density profiles and 16% for the electron and ion temperature profiles

  7. Clinical Predictive Modeling Development and Deployment through FHIR Web Services.

    Science.gov (United States)

    Khalilia, Mohammed; Choi, Myung; Henderson, Amelia; Iyengar, Sneha; Braunstein, Mark; Sun, Jimeng

    2015-01-01

    Clinical predictive modeling involves two challenging tasks: model development and model deployment. In this paper we demonstrate a software architecture for developing and deploying clinical predictive models using web services via the Health Level 7 (HL7) Fast Healthcare Interoperability Resources (FHIR) standard. The services enable model development using electronic health records (EHRs) stored in OMOP CDM databases and model deployment for scoring individual patients through FHIR resources. The MIMIC2 ICU dataset and a synthetic outpatient dataset were transformed into OMOP CDM databases for predictive model development. The resulting predictive models are deployed as FHIR resources, which receive requests of patient information, perform prediction against the deployed predictive model and respond with prediction scores. To assess the practicality of this approach we evaluated the response and prediction time of the FHIR modeling web services. We found the system to be reasonably fast with one second total response time per patient prediction.

  8. Predictive Modelling of Heavy Metals in Urban Lakes

    OpenAIRE

    Lindström, Martin

    2000-01-01

    Heavy metals are well-known environmental pollutants. In this thesis predictive models for heavy metals in urban lakes are discussed and new models presented. The base of predictive modelling is empirical data from field investigations of many ecosystems covering a wide range of ecosystem characteristics. Predictive models focus on the variabilities among lakes and processes controlling the major metal fluxes. Sediment and water data for this study were collected from ten small lakes in the ...

  9. Stage-specific predictive models for breast cancer survivability.

    Science.gov (United States)

    Kate, Rohit J; Nadig, Ramya

    2017-01-01

    Survivability rates vary widely among various stages of breast cancer. Although machine learning models built in past to predict breast cancer survivability were given stage as one of the features, they were not trained or evaluated separately for each stage. To investigate whether there are differences in performance of machine learning models trained and evaluated across different stages for predicting breast cancer survivability. Using three different machine learning methods we built models to predict breast cancer survivability separately for each stage and compared them with the traditional joint models built for all the stages. We also evaluated the models separately for each stage and together for all the stages. Our results show that the most suitable model to predict survivability for a specific stage is the model trained for that particular stage. In our experiments, using additional examples of other stages during training did not help, in fact, it made it worse in some cases. The most important features for predicting survivability were also found to be different for different stages. By evaluating the models separately on different stages we found that the performance widely varied across them. We also demonstrate that evaluating predictive models for survivability on all the stages together, as was done in the past, is misleading because it overestimates performance. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  10. Impact of modellers' decisions on hydrological a priori predictions

    Science.gov (United States)

    Holländer, H. M.; Bormann, H.; Blume, T.; Buytaert, W.; Chirico, G. B.; Exbrayat, J.-F.; Gustafsson, D.; Hölzel, H.; Krauße, T.; Kraft, P.; Stoll, S.; Blöschl, G.; Flühler, H.

    2014-06-01

    In practice, the catchment hydrologist is often confronted with the task of predicting discharge without having the needed records for calibration. Here, we report the discharge predictions of 10 modellers - using the model of their choice - for the man-made Chicken Creek catchment (6 ha, northeast Germany, Gerwin et al., 2009b) and we analyse how well they improved their prediction in three steps based on adding information prior to each following step. The modellers predicted the catchment's hydrological response in its initial phase without having access to the observed records. They used conceptually different physically based models and their modelling experience differed largely. Hence, they encountered two problems: (i) to simulate discharge for an ungauged catchment and (ii) using models that were developed for catchments, which are not in a state of landscape transformation. The prediction exercise was organized in three steps: (1) for the first prediction the modellers received a basic data set describing the catchment to a degree somewhat more complete than usually available for a priori predictions of ungauged catchments; they did not obtain information on stream flow, soil moisture, nor groundwater response and had therefore to guess the initial conditions; (2) before the second prediction they inspected the catchment on-site and discussed their first prediction attempt; (3) for their third prediction they were offered additional data by charging them pro forma with the costs for obtaining this additional information. Holländer et al. (2009) discussed the range of predictions obtained in step (1). Here, we detail the modeller's assumptions and decisions in accounting for the various processes. We document the prediction progress as well as the learning process resulting from the availability of added information. For the second and third steps, the progress in prediction quality is evaluated in relation to individual modelling experience and costs of

  11. A multivariate model for predicting segmental body composition.

    Science.gov (United States)

    Tian, Simiao; Mioche, Laurence; Denis, Jean-Baptiste; Morio, Béatrice

    2013-12-01

    The aims of the present study were to propose a multivariate model for predicting simultaneously body, trunk and appendicular fat and lean masses from easily measured variables and to compare its predictive capacity with that of the available univariate models that predict body fat percentage (BF%). The dual-energy X-ray absorptiometry (DXA) dataset (52% men and 48% women) with White, Black and Hispanic ethnicities (1999-2004, National Health and Nutrition Examination Survey) was randomly divided into three sub-datasets: a training dataset (TRD), a test dataset (TED); a validation dataset (VAD), comprising 3835, 1917 and 1917 subjects. For each sex, several multivariate prediction models were fitted from the TRD using age, weight, height and possibly waist circumference. The most accurate model was selected from the TED and then applied to the VAD and a French DXA dataset (French DB) (526 men and 529 women) to assess the prediction accuracy in comparison with that of five published univariate models, for which adjusted formulas were re-estimated using the TRD. Waist circumference was found to improve the prediction accuracy, especially in men. For BF%, the standard error of prediction (SEP) values were 3.26 (3.75) % for men and 3.47 (3.95)% for women in the VAD (French DB), as good as those of the adjusted univariate models. Moreover, the SEP values for the prediction of body and appendicular lean masses ranged from 1.39 to 2.75 kg for both the sexes. The prediction accuracy was best for age < 65 years, BMI < 30 kg/m2 and the Hispanic ethnicity. The application of our multivariate model to large populations could be useful to address various public health issues.

  12. Two stage neural network modelling for robust model predictive control.

    Science.gov (United States)

    Patan, Krzysztof

    2018-01-01

    The paper proposes a novel robust model predictive control scheme realized by means of artificial neural networks. The neural networks are used twofold: to design the so-called fundamental model of a plant and to catch uncertainty associated with the plant model. In order to simplify the optimization process carried out within the framework of predictive control an instantaneous linearization is applied which renders it possible to define the optimization problem in the form of constrained quadratic programming. Stability of the proposed control system is also investigated by showing that a cost function is monotonically decreasing with respect to time. Derived robust model predictive control is tested and validated on the example of a pneumatic servomechanism working at different operating regimes. Copyright © 2017 ISA. Published by Elsevier Ltd. All rights reserved.

  13. Hybrid Corporate Performance Prediction Model Considering Technical Capability

    Directory of Open Access Journals (Sweden)

    Joonhyuck Lee

    2016-07-01

    Full Text Available Many studies have tried to predict corporate performance and stock prices to enhance investment profitability using qualitative approaches such as the Delphi method. However, developments in data processing technology and machine-learning algorithms have resulted in efforts to develop quantitative prediction models in various managerial subject areas. We propose a quantitative corporate performance prediction model that applies the support vector regression (SVR algorithm to solve the problem of the overfitting of training data and can be applied to regression problems. The proposed model optimizes the SVR training parameters based on the training data, using the genetic algorithm to achieve sustainable predictability in changeable markets and managerial environments. Technology-intensive companies represent an increasing share of the total economy. The performance and stock prices of these companies are affected by their financial standing and their technological capabilities. Therefore, we apply both financial indicators and technical indicators to establish the proposed prediction model. Here, we use time series data, including financial, patent, and corporate performance information of 44 electronic and IT companies. Then, we predict the performance of these companies as an empirical verification of the prediction performance of the proposed model.

  14. Efficient computational model for classification of protein localization images using Extended Threshold Adjacency Statistics and Support Vector Machines.

    Science.gov (United States)

    Tahir, Muhammad; Jan, Bismillah; Hayat, Maqsood; Shah, Shakir Ullah; Amin, Muhammad

    2018-04-01

    Discriminative and informative feature extraction is the core requirement for accurate and efficient classification of protein subcellular localization images so that drug development could be more effective. The objective of this paper is to propose a novel modification in the Threshold Adjacency Statistics technique and enhance its discriminative power. In this work, we utilized Threshold Adjacency Statistics from a novel perspective to enhance its discrimination power and efficiency. In this connection, we utilized seven threshold ranges to produce seven distinct feature spaces, which are then used to train seven SVMs. The final prediction is obtained through the majority voting scheme. The proposed ETAS-SubLoc system is tested on two benchmark datasets using 5-fold cross-validation technique. We observed that our proposed novel utilization of TAS technique has improved the discriminative power of the classifier. The ETAS-SubLoc system has achieved 99.2% accuracy, 99.3% sensitivity and 99.1% specificity for Endogenous dataset outperforming the classical Threshold Adjacency Statistics technique. Similarly, 91.8% accuracy, 96.3% sensitivity and 91.6% specificity values are achieved for Transfected dataset. Simulation results validated the effectiveness of ETAS-SubLoc that provides superior prediction performance compared to the existing technique. The proposed methodology aims at providing support to pharmaceutical industry as well as research community towards better drug designing and innovation in the fields of bioinformatics and computational biology. The implementation code for replicating the experiments presented in this paper is available at: https://drive.google.com/file/d/0B7IyGPObWbSqRTRMcXI2bG5CZWs/view?usp=sharing. Copyright © 2018 Elsevier B.V. All rights reserved.

  15. Dynamic Simulation of Human Gait Model With Predictive Capability.

    Science.gov (United States)

    Sun, Jinming; Wu, Shaoli; Voglewede, Philip A

    2018-03-01

    In this paper, it is proposed that the central nervous system (CNS) controls human gait using a predictive control approach in conjunction with classical feedback control instead of exclusive classical feedback control theory that controls based on past error. To validate this proposition, a dynamic model of human gait is developed using a novel predictive approach to investigate the principles of the CNS. The model developed includes two parts: a plant model that represents the dynamics of human gait and a controller that represents the CNS. The plant model is a seven-segment, six-joint model that has nine degrees-of-freedom (DOF). The plant model is validated using data collected from able-bodied human subjects. The proposed controller utilizes model predictive control (MPC). MPC uses an internal model to predict the output in advance, compare the predicted output to the reference, and optimize the control input so that the predicted error is minimal. To decrease the complexity of the model, two joints are controlled using a proportional-derivative (PD) controller. The developed predictive human gait model is validated by simulating able-bodied human gait. The simulation results show that the developed model is able to simulate the kinematic output close to experimental data.

  16. Massive Predictive Modeling using Oracle R Enterprise

    CERN Multimedia

    CERN. Geneva

    2014-01-01

    R is fast becoming the lingua franca for analyzing data via statistics, visualization, and predictive analytics. For enterprise-scale data, R users have three main concerns: scalability, performance, and production deployment. Oracle's R-based technologies - Oracle R Distribution, Oracle R Enterprise, Oracle R Connector for Hadoop, and the R package ROracle - address these concerns. In this talk, we introduce Oracle's R technologies, highlighting how each enables R users to achieve scalability and performance while making production deployment of R results a natural outcome of the data analyst/scientist efforts. The focus then turns to Oracle R Enterprise with code examples using the transparency layer and embedded R execution, targeting massive predictive modeling. One goal behind massive predictive modeling is to build models per entity, such as customers, zip codes, simulations, in an effort to understand behavior and tailor predictions at the entity level. Predictions...

  17. Prediction model for prevalence and incidence of advanced age-related macular degeneration based on genetic, demographic, and environmental variables.

    Science.gov (United States)

    Seddon, Johanna M; Reynolds, Robyn; Maller, Julian; Fagerness, Jesen A; Daly, Mark J; Rosner, Bernard

    2009-05-01

    The joint effects of genetic, ocular, and environmental variables were evaluated and predictive models for prevalence and incidence of AMD were assessed. Participants in the multicenter Age-Related Eye Disease Study (AREDS) were included in a prospective evaluation of 1446 individuals, of which 279 progressed to advanced AMD (geographic atrophy or neovascular disease) and 1167 did not progress during 6.3 years of follow-up. For prevalent AMD, 509 advanced cases were compared with 222 controls. Covariates for the incidence analysis included age, sex, education, smoking, body mass index (BMI), baseline AMD grade, and the AREDS vitamin-mineral treatment assignment. DNA specimens were evaluated for six variants in five genes related to AMD. Unconditional logistic regression analyses were performed for prevalent and incident advanced AMD. An algorithm was developed and receiver operating characteristic curves and C statistics were calculated to assess the predictive ability of risk scores to discriminate progressors from nonprogressors. All genetic polymorphisms were independently related to prevalence of advanced AMD, controlling for genetic factors, smoking, BMI, and AREDS treatment. Multivariate odds ratios (ORs) were 3.5 (95% confidence interval [CI], 1.7-7.1) for CFH Y402H; 3.7 (95% CI, 1.6-8.4) for CFH rs1410996; 25.4 (95% CI, 8.6-75.1) for LOC387715 A69S (ARMS2); 0.3 (95% CI, 0.1-0.7) for C2 E318D; 0.3 (95% CI, 0.1-0.5) for CFB; and 3.6 (95% CI, 1.4-9.4) for C3 R102G, comparing the homozygous risk/protective genotypes to the referent genotypes. For incident AMD, all these variants except CFB were significantly related to progression to advanced AMD, after controlling for baseline AMD grade and other factors, with ORs from 1.8 to 4.0 for presence of two risk alleles and 0.4 for the protective allele. An interaction was seen between CFH402H and treatment, after controlling for all genotypes. Smoking was independently related to AMD, with a multiplicative joint

  18. Prediction of residential radon exposure of the whole Swiss population: comparison of model-based predictions with measurement-based predictions.

    Science.gov (United States)

    Hauri, D D; Huss, A; Zimmermann, F; Kuehni, C E; Röösli, M

    2013-10-01

    Radon plays an important role for human exposure to natural sources of ionizing radiation. The aim of this article is to compare two approaches to estimate mean radon exposure in the Swiss population: model-based predictions at individual level and measurement-based predictions based on measurements aggregated at municipality level. A nationwide model was used to predict radon levels in each household and for each individual based on the corresponding tectonic unit, building age, building type, soil texture, degree of urbanization, and floor. Measurement-based predictions were carried out within a health impact assessment on residential radon and lung cancer. Mean measured radon levels were corrected for the average floor distribution and weighted with population size of each municipality. Model-based predictions yielded a mean radon exposure of the Swiss population of 84.1 Bq/m(3) . Measurement-based predictions yielded an average exposure of 78 Bq/m(3) . This study demonstrates that the model- and the measurement-based predictions provided similar results. The advantage of the measurement-based approach is its simplicity, which is sufficient for assessing exposure distribution in a population. The model-based approach allows predicting radon levels at specific sites, which is needed in an epidemiological study, and the results do not depend on how the measurement sites have been selected. © 2013 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  19. A burnout prediction model based around char morphology

    Energy Technology Data Exchange (ETDEWEB)

    T. Wu; E. Lester; M. Cloke [University of Nottingham, Nottingham (United Kingdom). Nottingham Energy and Fuel Centre

    2005-07-01

    Poor burnout in a coal-fired power plant has marked penalties in the form of reduced energy efficiency and elevated waste material that can not be utilized. The prediction of coal combustion behaviour in a furnace is of great significance in providing valuable information not only for process optimization but also for coal buyers in the international market. Coal combustion models have been developed that can make predictions about burnout behaviour and burnout potential. Most of these kinetic models require standard parameters such as volatile content, particle size and assumed char porosity in order to make a burnout prediction. This paper presents a new model called the Char Burnout Model (ChB) that also uses detailed information about char morphology in its prediction. The model can use data input from one of two sources. Both sources are derived from image analysis techniques. The first from individual analysis and characterization of real char types using an automated program. The second from predicted char types based on data collected during the automated image analysis of coal particles. Modelling results were compared with a different carbon burnout kinetic model and burnout data from re-firing the chars in a drop tube furnace operating at 1300{sup o}C, 5% oxygen across several residence times. An improved agreement between ChB model and DTF experimental data proved that the inclusion of char morphology in combustion models can improve model predictions. 27 refs., 4 figs., 4 tabs.

  20. Clinical Prediction Models for Cardiovascular Disease: Tufts Predictive Analytics and Comparative Effectiveness Clinical Prediction Model Database.

    Science.gov (United States)

    Wessler, Benjamin S; Lai Yh, Lana; Kramer, Whitney; Cangelosi, Michael; Raman, Gowri; Lutz, Jennifer S; Kent, David M

    2015-07-01

    Clinical prediction models (CPMs) estimate the probability of clinical outcomes and hold the potential to improve decision making and individualize care. For patients with cardiovascular disease, there are numerous CPMs available although the extent of this literature is not well described. We conducted a systematic review for articles containing CPMs for cardiovascular disease published between January 1990 and May 2012. Cardiovascular disease includes coronary heart disease, heart failure, arrhythmias, stroke, venous thromboembolism, and peripheral vascular disease. We created a novel database and characterized CPMs based on the stage of development, population under study, performance, covariates, and predicted outcomes. There are 796 models included in this database. The number of CPMs published each year is increasing steadily over time. Seven hundred seventeen (90%) are de novo CPMs, 21 (3%) are CPM recalibrations, and 58 (7%) are CPM adaptations. This database contains CPMs for 31 index conditions, including 215 CPMs for patients with coronary artery disease, 168 CPMs for population samples, and 79 models for patients with heart failure. There are 77 distinct index/outcome pairings. Of the de novo models in this database, 450 (63%) report a c-statistic and 259 (36%) report some information on calibration. There is an abundance of CPMs available for a wide assortment of cardiovascular disease conditions, with substantial redundancy in the literature. The comparative performance of these models, the consistency of effects and risk estimates across models and the actual and potential clinical impact of this body of literature is poorly understood. © 2015 American Heart Association, Inc.

  1. Prediction of resource volumes at untested locations using simple local prediction models

    Science.gov (United States)

    Attanasi, E.D.; Coburn, T.C.; Freeman, P.A.

    2006-01-01

    This paper shows how local spatial nonparametric prediction models can be applied to estimate volumes of recoverable gas resources at individual undrilled sites, at multiple sites on a regional scale, and to compute confidence bounds for regional volumes based on the distribution of those estimates. An approach that combines cross-validation, the jackknife, and bootstrap procedures is used to accomplish this task. Simulation experiments show that cross-validation can be applied beneficially to select an appropriate prediction model. The cross-validation procedure worked well for a wide range of different states of nature and levels of information. Jackknife procedures are used to compute individual prediction estimation errors at undrilled locations. The jackknife replicates also are used with a bootstrap resampling procedure to compute confidence bounds for the total volume. The method was applied to data (partitioned into a training set and target set) from the Devonian Antrim Shale continuous-type gas play in the Michigan Basin in Otsego County, Michigan. The analysis showed that the model estimate of total recoverable volumes at prediction sites is within 4 percent of the total observed volume. The model predictions also provide frequency distributions of the cell volumes at the production unit scale. Such distributions are the basis for subsequent economic analyses. ?? Springer Science+Business Media, LLC 2007.

  2. A burnout prediction model based around char morphology

    Energy Technology Data Exchange (ETDEWEB)

    Tao Wu; Edward Lester; Michael Cloke [University of Nottingham, Nottingham (United Kingdom). School of Chemical, Environmental and Mining Engineering

    2006-05-15

    Several combustion models have been developed that can make predictions about coal burnout and burnout potential. Most of these kinetic models require standard parameters such as volatile content and particle size to make a burnout prediction. This article presents a new model called the char burnout (ChB) model, which also uses detailed information about char morphology in its prediction. The input data to the model is based on information derived from two different image analysis techniques. One technique generates characterization data from real char samples, and the other predicts char types based on characterization data from image analysis of coal particles. The pyrolyzed chars in this study were created in a drop tube furnace operating at 1300{sup o}C, 200 ms, and 1% oxygen. Modeling results were compared with a different carbon burnout kinetic model as well as the actual burnout data from refiring the same chars in a drop tube furnace operating at 1300{sup o}C, 5% oxygen, and residence times of 200, 400, and 600 ms. A good agreement between ChB model and experimental data indicates that the inclusion of char morphology in combustion models could well improve model predictions. 38 refs., 5 figs., 6 tabs.

  3. Comparative Study of Bancruptcy Prediction Models

    Directory of Open Access Journals (Sweden)

    Isye Arieshanti

    2013-09-01

    Full Text Available Early indication of bancruptcy is important for a company. If companies aware of  potency of their bancruptcy, they can take a preventive action to anticipate the bancruptcy. In order to detect the potency of a bancruptcy, a company can utilize a a model of bancruptcy prediction. The prediction model can be built using a machine learning methods. However, the choice of machine learning methods should be performed carefully. Because the suitability of a model depends on the problem specifically. Therefore, in this paper we perform a comparative study of several machine leaning methods for bancruptcy prediction. According to the comparative study, the performance of several models that based on machine learning methods (k-NN, fuzzy k-NN, SVM, Bagging Nearest Neighbour SVM, Multilayer Perceptron(MLP, Hybrid of MLP + Multiple Linear Regression, it can be showed that fuzzy k-NN method achieve the best performance with accuracy 77.5%

  4. A grey NGM(1,1, k) self-memory coupling prediction model for energy consumption prediction.

    Science.gov (United States)

    Guo, Xiaojun; Liu, Sifeng; Wu, Lifeng; Tang, Lingling

    2014-01-01

    Energy consumption prediction is an important issue for governments, energy sector investors, and other related corporations. Although there are several prediction techniques, selection of the most appropriate technique is of vital importance. As for the approximate nonhomogeneous exponential data sequence often emerging in the energy system, a novel grey NGM(1,1, k) self-memory coupling prediction model is put forward in order to promote the predictive performance. It achieves organic integration of the self-memory principle of dynamic system and grey NGM(1,1, k) model. The traditional grey model's weakness as being sensitive to initial value can be overcome by the self-memory principle. In this study, total energy, coal, and electricity consumption of China is adopted for demonstration by using the proposed coupling prediction technique. The results show the superiority of NGM(1,1, k) self-memory coupling prediction model when compared with the results from the literature. Its excellent prediction performance lies in that the proposed coupling model can take full advantage of the systematic multitime historical data and catch the stochastic fluctuation tendency. This work also makes a significant contribution to the enrichment of grey prediction theory and the extension of its application span.

  5. Risk predictive modelling for diabetes and cardiovascular disease.

    Science.gov (United States)

    Kengne, Andre Pascal; Masconi, Katya; Mbanya, Vivian Nchanchou; Lekoubou, Alain; Echouffo-Tcheugui, Justin Basile; Matsha, Tandi E

    2014-02-01

    Absolute risk models or clinical prediction models have been incorporated in guidelines, and are increasingly advocated as tools to assist risk stratification and guide prevention and treatments decisions relating to common health conditions such as cardiovascular disease (CVD) and diabetes mellitus. We have reviewed the historical development and principles of prediction research, including their statistical underpinning, as well as implications for routine practice, with a focus on predictive modelling for CVD and diabetes. Predictive modelling for CVD risk, which has developed over the last five decades, has been largely influenced by the Framingham Heart Study investigators, while it is only ∼20 years ago that similar efforts were started in the field of diabetes. Identification of predictive factors is an important preliminary step which provides the knowledge base on potential predictors to be tested for inclusion during the statistical derivation of the final model. The derived models must then be tested both on the development sample (internal validation) and on other populations in different settings (external validation). Updating procedures (e.g. recalibration) should be used to improve the performance of models that fail the tests of external validation. Ultimately, the effect of introducing validated models in routine practice on the process and outcomes of care as well as its cost-effectiveness should be tested in impact studies before wide dissemination of models beyond the research context. Several predictions models have been developed for CVD or diabetes, but very few have been externally validated or tested in impact studies, and their comparative performance has yet to be fully assessed. A shift of focus from developing new CVD or diabetes prediction models to validating the existing ones will improve their adoption in routine practice.

  6. Model-based uncertainty in species range prediction

    DEFF Research Database (Denmark)

    Pearson, R. G.; Thuiller, Wilfried; Bastos Araujo, Miguel

    2006-01-01

    Aim Many attempts to predict the potential range of species rely on environmental niche (or 'bioclimate envelope') modelling, yet the effects of using different niche-based methodologies require further investigation. Here we investigate the impact that the choice of model can have on predictions...

  7. Survival prediction model for postoperative hepatocellular carcinoma patients.

    Science.gov (United States)

    Ren, Zhihui; He, Shasha; Fan, Xiaotang; He, Fangping; Sang, Wei; Bao, Yongxing; Ren, Weixin; Zhao, Jinming; Ji, Xuewen; Wen, Hao

    2017-09-01

    This study is to establish a predictive index (PI) model of 5-year survival rate for patients with hepatocellular carcinoma (HCC) after radical resection and to evaluate its prediction sensitivity, specificity, and accuracy.Patients underwent HCC surgical resection were enrolled and randomly divided into prediction model group (101 patients) and model evaluation group (100 patients). Cox regression model was used for univariate and multivariate survival analysis. A PI model was established based on multivariate analysis and receiver operating characteristic (ROC) curve was drawn accordingly. The area under ROC (AUROC) and PI cutoff value was identified.Multiple Cox regression analysis of prediction model group showed that neutrophil to lymphocyte ratio, histological grade, microvascular invasion, positive resection margin, number of tumor, and postoperative transcatheter arterial chemoembolization treatment were the independent predictors for the 5-year survival rate for HCC patients. The model was PI = 0.377 × NLR + 0.554 × HG + 0.927 × PRM + 0.778 × MVI + 0.740 × NT - 0.831 × transcatheter arterial chemoembolization (TACE). In the prediction model group, AUROC was 0.832 and the PI cutoff value was 3.38. The sensitivity, specificity, and accuracy were 78.0%, 80%, and 79.2%, respectively. In model evaluation group, AUROC was 0.822, and the PI cutoff value was well corresponded to the prediction model group with sensitivity, specificity, and accuracy of 85.0%, 83.3%, and 84.0%, respectively.The PI model can quantify the mortality risk of hepatitis B related HCC with high sensitivity, specificity, and accuracy.

  8. Methodology for Designing Models Predicting Success of Infertility Treatment

    OpenAIRE

    Alireza Zarinara; Mohammad Mahdi Akhondi; Hojjat Zeraati; Koorsh Kamali; Kazem Mohammad

    2016-01-01

    Abstract Background: The prediction models for infertility treatment success have presented since 25 years ago. There are scientific principles for designing and applying the prediction models that is also used to predict the success rate of infertility treatment. The purpose of this study is to provide basic principles for designing the model to predic infertility treatment success. Materials and Methods: In this paper, the principles for developing predictive models are explained and...

  9. Hidden Semi-Markov Models for Predictive Maintenance

    Directory of Open Access Journals (Sweden)

    Francesco Cartella

    2015-01-01

    Full Text Available Realistic predictive maintenance approaches are essential for condition monitoring and predictive maintenance of industrial machines. In this work, we propose Hidden Semi-Markov Models (HSMMs with (i no constraints on the state duration density function and (ii being applied to continuous or discrete observation. To deal with such a type of HSMM, we also propose modifications to the learning, inference, and prediction algorithms. Finally, automatic model selection has been made possible using the Akaike Information Criterion. This paper describes the theoretical formalization of the model as well as several experiments performed on simulated and real data with the aim of methodology validation. In all performed experiments, the model is able to correctly estimate the current state and to effectively predict the time to a predefined event with a low overall average absolute error. As a consequence, its applicability to real world settings can be beneficial, especially where in real time the Remaining Useful Lifetime (RUL of the machine is calculated.

  10. The SubCons webserver: A user friendly web interface for state-of-the-art subcellular localization prediction.

    Science.gov (United States)

    Salvatore, M; Shu, N; Elofsson, A

    2018-01-01

    SubCons is a recently developed method that predicts the subcellular localization of a protein. It combines predictions from four predictors using a Random Forest classifier. Here, we present the user-friendly web-interface implementation of SubCons. Starting from a protein sequence, the server rapidly predicts the subcellular localizations of an individual protein. In addition, the server accepts the submission of sets of proteins either by uploading the files or programmatically by using command line WSDL API scripts. This makes SubCons ideal for proteome wide analyses allowing the user to scan a whole proteome in few days. From the web page, it is also possible to download precalculated predictions for several eukaryotic organisms. To evaluate the performance of SubCons we present a benchmark of LocTree3 and SubCons using two recent mass-spectrometry based datasets of mouse and drosophila proteins. The server is available at http://subcons.bioinfo.se/. © 2017 The Protein Society.

  11. Modeling and Control of CSTR using Model based Neural Network Predictive Control

    OpenAIRE

    Shrivastava, Piyush

    2012-01-01

    This paper presents a predictive control strategy based on neural network model of the plant is applied to Continuous Stirred Tank Reactor (CSTR). This system is a highly nonlinear process; therefore, a nonlinear predictive method, e.g., neural network predictive control, can be a better match to govern the system dynamics. In the paper, the NN model and the way in which it can be used to predict the behavior of the CSTR process over a certain prediction horizon are described, and some commen...

  12. Consensus models to predict endocrine disruption for all ...

    Science.gov (United States)

    Humans are potentially exposed to tens of thousands of man-made chemicals in the environment. It is well known that some environmental chemicals mimic natural hormones and thus have the potential to be endocrine disruptors. Most of these environmental chemicals have never been tested for their ability to disrupt the endocrine system, in particular, their ability to interact with the estrogen receptor. EPA needs tools to prioritize thousands of chemicals, for instance in the Endocrine Disruptor Screening Program (EDSP). Collaborative Estrogen Receptor Activity Prediction Project (CERAPP) was intended to be a demonstration of the use of predictive computational models on HTS data including ToxCast and Tox21 assays to prioritize a large chemical universe of 32464 unique structures for one specific molecular target – the estrogen receptor. CERAPP combined multiple computational models for prediction of estrogen receptor activity, and used the predicted results to build a unique consensus model. Models were developed in collaboration between 17 groups in the U.S. and Europe and applied to predict the common set of chemicals. Structure-based techniques such as docking and several QSAR modeling approaches were employed, mostly using a common training set of 1677 compounds provided by U.S. EPA, to build a total of 42 classification models and 8 regression models for binding, agonist and antagonist activity. All predictions were evaluated on ToxCast data and on an exte

  13. Energy based prediction models for building acoustics

    DEFF Research Database (Denmark)

    Brunskog, Jonas

    2012-01-01

    In order to reach robust and simplified yet accurate prediction models, energy based principle are commonly used in many fields of acoustics, especially in building acoustics. This includes simple energy flow models, the framework of statistical energy analysis (SEA) as well as more elaborated...... principles as, e.g., wave intensity analysis (WIA). The European standards for building acoustic predictions, the EN 12354 series, are based on energy flow and SEA principles. In the present paper, different energy based prediction models are discussed and critically reviewed. Special attention is placed...... on underlying basic assumptions, such as diffuse fields, high modal overlap, resonant field being dominant, etc., and the consequences of these in terms of limitations in the theory and in the practical use of the models....

  14. Comparison of Simple Versus Performance-Based Fall Prediction Models

    Directory of Open Access Journals (Sweden)

    Shekhar K. Gadkaree BS

    2015-05-01

    Full Text Available Objective: To compare the predictive ability of standard falls prediction models based on physical performance assessments with more parsimonious prediction models based on self-reported data. Design: We developed a series of fall prediction models progressing in complexity and compared area under the receiver operating characteristic curve (AUC across models. Setting: National Health and Aging Trends Study (NHATS, which surveyed a nationally representative sample of Medicare enrollees (age ≥65 at baseline (Round 1: 2011-2012 and 1-year follow-up (Round 2: 2012-2013. Participants: In all, 6,056 community-dwelling individuals participated in Rounds 1 and 2 of NHATS. Measurements: Primary outcomes were 1-year incidence of “ any fall ” and “ recurrent falls .” Prediction models were compared and validated in development and validation sets, respectively. Results: A prediction model that included demographic information, self-reported problems with balance and coordination, and previous fall history was the most parsimonious model that optimized AUC for both any fall (AUC = 0.69, 95% confidence interval [CI] = [0.67, 0.71] and recurrent falls (AUC = 0.77, 95% CI = [0.74, 0.79] in the development set. Physical performance testing provided a marginal additional predictive value. Conclusion: A simple clinical prediction model that does not include physical performance testing could facilitate routine, widespread falls risk screening in the ambulatory care setting.

  15. Preclinical models used for immunogenicity prediction of therapeutic proteins.

    Science.gov (United States)

    Brinks, Vera; Weinbuch, Daniel; Baker, Matthew; Dean, Yann; Stas, Philippe; Kostense, Stefan; Rup, Bonita; Jiskoot, Wim

    2013-07-01

    All therapeutic proteins are potentially immunogenic. Antibodies formed against these drugs can decrease efficacy, leading to drastically increased therapeutic costs and in rare cases to serious and sometimes life threatening side-effects. Many efforts are therefore undertaken to develop therapeutic proteins with minimal immunogenicity. For this, immunogenicity prediction of candidate drugs during early drug development is essential. Several in silico, in vitro and in vivo models are used to predict immunogenicity of drug leads, to modify potentially immunogenic properties and to continue development of drug candidates with expected low immunogenicity. Despite the extensive use of these predictive models, their actual predictive value varies. Important reasons for this uncertainty are the limited/insufficient knowledge on the immune mechanisms underlying immunogenicity of therapeutic proteins, the fact that different predictive models explore different components of the immune system and the lack of an integrated clinical validation. In this review, we discuss the predictive models in use, summarize aspects of immunogenicity that these models predict and explore the merits and the limitations of each of the models.

  16. A Grey NGM(1,1, k) Self-Memory Coupling Prediction Model for Energy Consumption Prediction

    Science.gov (United States)

    Guo, Xiaojun; Liu, Sifeng; Wu, Lifeng; Tang, Lingling

    2014-01-01

    Energy consumption prediction is an important issue for governments, energy sector investors, and other related corporations. Although there are several prediction techniques, selection of the most appropriate technique is of vital importance. As for the approximate nonhomogeneous exponential data sequence often emerging in the energy system, a novel grey NGM(1,1, k) self-memory coupling prediction model is put forward in order to promote the predictive performance. It achieves organic integration of the self-memory principle of dynamic system and grey NGM(1,1, k) model. The traditional grey model's weakness as being sensitive to initial value can be overcome by the self-memory principle. In this study, total energy, coal, and electricity consumption of China is adopted for demonstration by using the proposed coupling prediction technique. The results show the superiority of NGM(1,1, k) self-memory coupling prediction model when compared with the results from the literature. Its excellent prediction performance lies in that the proposed coupling model can take full advantage of the systematic multitime historical data and catch the stochastic fluctuation tendency. This work also makes a significant contribution to the enrichment of grey prediction theory and the extension of its application span. PMID:25054174

  17. Bayesian Predictive Models for Rayleigh Wind Speed

    DEFF Research Database (Denmark)

    Shahirinia, Amir; Hajizadeh, Amin; Yu, David C

    2017-01-01

    predictive model of the wind speed aggregates the non-homogeneous distributions into a single continuous distribution. Therefore, the result is able to capture the variation among the probability distributions of the wind speeds at the turbines’ locations in a wind farm. More specifically, instead of using...... a wind speed distribution whose parameters are known or estimated, the parameters are considered as random whose variations are according to probability distributions. The Bayesian predictive model for a Rayleigh which only has a single model scale parameter has been proposed. Also closed-form posterior...... and predictive inferences under different reasonable choices of prior distribution in sensitivity analysis have been presented....

  18. Modeling and Prediction Using Stochastic Differential Equations

    DEFF Research Database (Denmark)

    Juhl, Rune; Møller, Jan Kloppenborg; Jørgensen, John Bagterp

    2016-01-01

    Pharmacokinetic/pharmakodynamic (PK/PD) modeling for a single subject is most often performed using nonlinear models based on deterministic ordinary differential equations (ODEs), and the variation between subjects in a population of subjects is described using a population (mixed effects) setup...... deterministic and can predict the future perfectly. A more realistic approach would be to allow for randomness in the model due to e.g., the model be too simple or errors in input. We describe a modeling and prediction setup which better reflects reality and suggests stochastic differential equations (SDEs...

  19. Prediction of hourly solar radiation with multi-model framework

    International Nuclear Information System (INIS)

    Wu, Ji; Chan, Chee Keong

    2013-01-01

    Highlights: • A novel approach to predict solar radiation through the use of clustering paradigms. • Development of prediction models based on the intrinsic pattern observed in each cluster. • Prediction based on proper clustering and selection of model on current time provides better results than other methods. • Experiments were conducted on actual solar radiation data obtained from a weather station in Singapore. - Abstract: In this paper, a novel multi-model prediction framework for prediction of solar radiation is proposed. The framework started with the assumption that there are several patterns embedded in the solar radiation series. To extract the underlying pattern, the solar radiation series is first segmented into smaller subsequences, and the subsequences are further grouped into different clusters. For each cluster, an appropriate prediction model is trained. Hence a procedure for pattern identification is developed to identify the proper pattern that fits the current period. Based on this pattern, the corresponding prediction model is applied to obtain the prediction value. The prediction result of the proposed framework is then compared to other techniques. It is shown that the proposed framework provides superior performance as compared to others

  20. Revised predictive equations for salt intrusion modelling in estuaries

    NARCIS (Netherlands)

    Gisen, J.I.A.; Savenije, H.H.G.; Nijzink, R.C.

    2015-01-01

    For one-dimensional salt intrusion models to be predictive, we need predictive equations to link model parameters to observable hydraulic and geometric variables. The one-dimensional model of Savenije (1993b) made use of predictive equations for the Van der Burgh coefficient $K$ and the dispersion

  1. Preprocedural Prediction Model for Contrast-Induced Nephropathy Patients.

    Science.gov (United States)

    Yin, Wen-Jun; Yi, Yi-Hu; Guan, Xiao-Feng; Zhou, Ling-Yun; Wang, Jiang-Lin; Li, Dai-Yang; Zuo, Xiao-Cong

    2017-02-03

    Several models have been developed for prediction of contrast-induced nephropathy (CIN); however, they only contain patients receiving intra-arterial contrast media for coronary angiographic procedures, which represent a small proportion of all contrast procedures. In addition, most of them evaluate radiological interventional procedure-related variables. So it is necessary for us to develop a model for prediction of CIN before radiological procedures among patients administered contrast media. A total of 8800 patients undergoing contrast administration were randomly assigned in a 4:1 ratio to development and validation data sets. CIN was defined as an increase of 25% and/or 0.5 mg/dL in serum creatinine within 72 hours above the baseline value. Preprocedural clinical variables were used to develop the prediction model from the training data set by the machine learning method of random forest, and 5-fold cross-validation was used to evaluate the prediction accuracies of the model. Finally we tested this model in the validation data set. The incidence of CIN was 13.38%. We built a prediction model with 13 preprocedural variables selected from 83 variables. The model obtained an area under the receiver-operating characteristic (ROC) curve (AUC) of 0.907 and gave prediction accuracy of 80.8%, sensitivity of 82.7%, specificity of 78.8%, and Matthews correlation coefficient of 61.5%. For the first time, 3 new factors are included in the model: the decreased sodium concentration, the INR value, and the preprocedural glucose level. The newly established model shows excellent predictive ability of CIN development and thereby provides preventative measures for CIN. © 2017 The Authors. Published on behalf of the American Heart Association, Inc., by Wiley Blackwell.

  2. Time dependent patient no-show predictive modelling development.

    Science.gov (United States)

    Huang, Yu-Li; Hanauer, David A

    2016-05-09

    Purpose - The purpose of this paper is to develop evident-based predictive no-show models considering patients' each past appointment status, a time-dependent component, as an independent predictor to improve predictability. Design/methodology/approach - A ten-year retrospective data set was extracted from a pediatric clinic. It consisted of 7,291 distinct patients who had at least two visits along with their appointment characteristics, patient demographics, and insurance information. Logistic regression was adopted to develop no-show models using two-thirds of the data for training and the remaining data for validation. The no-show threshold was then determined based on minimizing the misclassification of show/no-show assignments. There were a total of 26 predictive model developed based on the number of available past appointments. Simulation was employed to test the effective of each model on costs of patient wait time, physician idle time, and overtime. Findings - The results demonstrated the misclassification rate and the area under the curve of the receiver operating characteristic gradually improved as more appointment history was included until around the 20th predictive model. The overbooking method with no-show predictive models suggested incorporating up to the 16th model and outperformed other overbooking methods by as much as 9.4 per cent in the cost per patient while allowing two additional patients in a clinic day. Research limitations/implications - The challenge now is to actually implement the no-show predictive model systematically to further demonstrate its robustness and simplicity in various scheduling systems. Originality/value - This paper provides examples of how to build the no-show predictive models with time-dependent components to improve the overbooking policy. Accurately identifying scheduled patients' show/no-show status allows clinics to proactively schedule patients to reduce the negative impact of patient no-shows.

  3. Model predictive control using fuzzy decision functions

    NARCIS (Netherlands)

    Kaymak, U.; Costa Sousa, da J.M.

    2001-01-01

    Fuzzy predictive control integrates conventional model predictive control with techniques from fuzzy multicriteria decision making, translating the goals and the constraints to predictive control in a transparent way. The information regarding the (fuzzy) goals and the (fuzzy) constraints of the

  4. Predicting and Modelling of Survival Data when Cox's Regression Model does not hold

    DEFF Research Database (Denmark)

    Scheike, Thomas H.; Zhang, Mei-Jie

    2002-01-01

    Aalen model; additive risk model; counting processes; competing risk; Cox regression; flexible modeling; goodness of fit; prediction of survival; survival analysis; time-varying effects......Aalen model; additive risk model; counting processes; competing risk; Cox regression; flexible modeling; goodness of fit; prediction of survival; survival analysis; time-varying effects...

  5. Evaluating the Predictive Value of Growth Prediction Models

    Science.gov (United States)

    Murphy, Daniel L.; Gaertner, Matthew N.

    2014-01-01

    This study evaluates four growth prediction models--projection, student growth percentile, trajectory, and transition table--commonly used to forecast (and give schools credit for) middle school students' future proficiency. Analyses focused on vertically scaled summative mathematics assessments, and two performance standards conditions (high…

  6. PROTEINS OF THE INTEGUMENTARY SYSTEM OF THE HONEYBEE, Apis mellifera.

    Science.gov (United States)

    Micas, André Fernando Ditondo; Ferreira, Germano Aguiar; Laure, Helen Julie; Rosa, José Cesar; Bitondi, Márcia Maria Gentile

    2016-09-01

    The integument of insects and other arthropods is composed of an inner basal lamina coated by the epidermis, which secretes the bulk of the outer integument layer, the cuticle. The genome sequencing of several insect species has allowed predicting classes of proteins integrating the cuticle. However, only a small proportion of them, as well as other proteins in the integumentary system, have been validated. Using two-dimensional gel electrophoresis coupled with mass spectrometry, we identified 45 different proteins in a total of 112 selected gel spots derived from thoracic integument samples of developing honeybee workers, including 14 cuticular proteins (AmelCPR 3, AmelCPR 12, AmelCPR 16, AmelCPR 27, apidermin 2, apidermin 3, endocuticle structural glycoprotein SgAbd-8-like, LOC100577363, LOC408365, LOC413679, LOC725454, LOC100576916, LOC725838, and peritrophin 3-C analogous). Gene ontology functional analysis revealed that the higher proportions of the identified proteins have molecular functions related to catalytic and structural molecule activities, are involved in metabolic biological processes, and pertain to the protein class of structural or cytoskeletal proteins and hydrolases. It is noteworthy that 26.7% of the identified proteins, including five cuticular proteins, were revealed as protein species resulting from allelic isoforms or derived from posttranslational modifications. Also, 66.7% of the identified cuticular proteins were expressed in more than one developmental phase, thus indicating that they are part of the larval, pupal, and adult cuticle. Our data provide experimental support for predicted honeybee gene products and new information on proteins expressed in the developing integument. © 2016 Wiley Periodicals, Inc.

  7. Uncertainties in model-based outcome predictions for treatment planning

    International Nuclear Information System (INIS)

    Deasy, Joseph O.; Chao, K.S. Clifford; Markman, Jerry

    2001-01-01

    Purpose: Model-based treatment-plan-specific outcome predictions (such as normal tissue complication probability [NTCP] or the relative reduction in salivary function) are typically presented without reference to underlying uncertainties. We provide a method to assess the reliability of treatment-plan-specific dose-volume outcome model predictions. Methods and Materials: A practical method is proposed for evaluating model prediction based on the original input data together with bootstrap-based estimates of parameter uncertainties. The general framework is applicable to continuous variable predictions (e.g., prediction of long-term salivary function) and dichotomous variable predictions (e.g., tumor control probability [TCP] or NTCP). Using bootstrap resampling, a histogram of the likelihood of alternative parameter values is generated. For a given patient and treatment plan we generate a histogram of alternative model results by computing the model predicted outcome for each parameter set in the bootstrap list. Residual uncertainty ('noise') is accounted for by adding a random component to the computed outcome values. The residual noise distribution is estimated from the original fit between model predictions and patient data. Results: The method is demonstrated using a continuous-endpoint model to predict long-term salivary function for head-and-neck cancer patients. Histograms represent the probabilities for the level of posttreatment salivary function based on the input clinical data, the salivary function model, and the three-dimensional dose distribution. For some patients there is significant uncertainty in the prediction of xerostomia, whereas for other patients the predictions are expected to be more reliable. In contrast, TCP and NTCP endpoints are dichotomous, and parameter uncertainties should be folded directly into the estimated probabilities, thereby improving the accuracy of the estimates. Using bootstrap parameter estimates, competing treatment

  8. Prediction error, ketamine and psychosis: An updated model.

    Science.gov (United States)

    Corlett, Philip R; Honey, Garry D; Fletcher, Paul C

    2016-11-01

    In 2007, we proposed an explanation of delusion formation as aberrant prediction error-driven associative learning. Further, we argued that the NMDA receptor antagonist ketamine provided a good model for this process. Subsequently, we validated the model in patients with psychosis, relating aberrant prediction error signals to delusion severity. During the ensuing period, we have developed these ideas, drawing on the simple principle that brains build a model of the world and refine it by minimising prediction errors, as well as using it to guide perceptual inferences. While previously we focused on the prediction error signal per se, an updated view takes into account its precision, as well as the precision of prior expectations. With this expanded perspective, we see several possible routes to psychotic symptoms - which may explain the heterogeneity of psychotic illness, as well as the fact that other drugs, with different pharmacological actions, can produce psychotomimetic effects. In this article, we review the basic principles of this model and highlight specific ways in which prediction errors can be perturbed, in particular considering the reliability and uncertainty of predictions. The expanded model explains hallucinations as perturbations of the uncertainty mediated balance between expectation and prediction error. Here, expectations dominate and create perceptions by suppressing or ignoring actual inputs. Negative symptoms may arise due to poor reliability of predictions in service of action. By mapping from biology to belief and perception, the account proffers new explanations of psychosis. However, challenges remain. We attempt to address some of these concerns and suggest future directions, incorporating other symptoms into the model, building towards better understanding of psychosis. © The Author(s) 2016.

  9. The nature of white matter abnormalities in blast-related mild traumatic brain injury

    Directory of Open Access Journals (Sweden)

    Jasmeet P. Hayes

    2015-01-01

    Full Text Available Blast-related traumatic brain injury (TBI has been a common injury among returning troops due to the widespread use of improvised explosive devices in the Iraq and Afghanistan Wars. As most of the TBIs sustained are in the mild range, brain changes may not be detected by standard clinical imaging techniques such as CT. Furthermore, the functional significance of these types of injuries is currently being debated. However, accumulating evidence suggests that diffusion tensor imaging (DTI is sensitive to subtle white matter abnormalities and may be especially useful in detecting mild TBI (mTBI. The primary aim of this study was to use DTI to characterize the nature of white matter abnormalities following blast-related mTBI, and in particular, examine the extent to which mTBI-related white matter abnormalities are region-specific or spatially heterogeneous. In addition, we examined whether mTBI with loss of consciousness (LOC was associated with more extensive white matter abnormality than mTBI without LOC, as well as the potential moderating effect of number of blast exposures. A second aim was to examine the relationship between white matter integrity and neurocognitive function. Finally, a third aim was to examine the contribution of PTSD symptom severity to observed white matter alterations. One hundred fourteen OEF/OIF veterans underwent DTI and neuropsychological examination and were divided into three groups including a control group, blast-related mTBI without LOC (mTBI - LOC group, and blast-related mTBI with LOC (mTBI + LOC group. Hierarchical regression models were used to examine the extent to which mTBI and PTSD predicted white matter abnormalities using two approaches: 1 a region-specific analysis and 2 a measure of spatial heterogeneity. Neurocognitive composite scores were calculated for executive functions, attention, memory, and psychomotor speed. Results showed that blast-related mTBI + LOC was associated with greater odds of

  10. Predictive Capability Maturity Model for computational modeling and simulation.

    Energy Technology Data Exchange (ETDEWEB)

    Oberkampf, William Louis; Trucano, Timothy Guy; Pilch, Martin M.

    2007-10-01

    The Predictive Capability Maturity Model (PCMM) is a new model that can be used to assess the level of maturity of computational modeling and simulation (M&S) efforts. The development of the model is based on both the authors experience and their analysis of similar investigations in the past. The perspective taken in this report is one of judging the usefulness of a predictive capability that relies on the numerical solution to partial differential equations to better inform and improve decision making. The review of past investigations, such as the Software Engineering Institute's Capability Maturity Model Integration and the National Aeronautics and Space Administration and Department of Defense Technology Readiness Levels, indicates that a more restricted, more interpretable method is needed to assess the maturity of an M&S effort. The PCMM addresses six contributing elements to M&S: (1) representation and geometric fidelity, (2) physics and material model fidelity, (3) code verification, (4) solution verification, (5) model validation, and (6) uncertainty quantification and sensitivity analysis. For each of these elements, attributes are identified that characterize four increasing levels of maturity. Importantly, the PCMM is a structured method for assessing the maturity of an M&S effort that is directed toward an engineering application of interest. The PCMM does not assess whether the M&S effort, the accuracy of the predictions, or the performance of the engineering system satisfies or does not satisfy specified application requirements.

  11. Model complexity control for hydrologic prediction

    NARCIS (Netherlands)

    Schoups, G.; Van de Giesen, N.C.; Savenije, H.H.G.

    2008-01-01

    A common concern in hydrologic modeling is overparameterization of complex models given limited and noisy data. This leads to problems of parameter nonuniqueness and equifinality, which may negatively affect prediction uncertainties. A systematic way of controlling model complexity is therefore

  12. Predictive Model of Systemic Toxicity (SOT)

    Science.gov (United States)

    In an effort to ensure chemical safety in light of regulatory advances away from reliance on animal testing, USEPA and L’Oréal have collaborated to develop a quantitative systemic toxicity prediction model. Prediction of human systemic toxicity has proved difficult and remains a ...

  13. Using Pareto points for model identification in predictive toxicology

    Science.gov (United States)

    2013-01-01

    Predictive toxicology is concerned with the development of models that are able to predict the toxicity of chemicals. A reliable prediction of toxic effects of chemicals in living systems is highly desirable in cosmetics, drug design or food protection to speed up the process of chemical compound discovery while reducing the need for lab tests. There is an extensive literature associated with the best practice of model generation and data integration but management and automated identification of relevant models from available collections of models is still an open problem. Currently, the decision on which model should be used for a new chemical compound is left to users. This paper intends to initiate the discussion on automated model identification. We present an algorithm, based on Pareto optimality, which mines model collections and identifies a model that offers a reliable prediction for a new chemical compound. The performance of this new approach is verified for two endpoints: IGC50 and LogP. The results show a great potential for automated model identification methods in predictive toxicology. PMID:23517649

  14. Physical and JIT Model Based Hybrid Modeling Approach for Building Thermal Load Prediction

    Science.gov (United States)

    Iino, Yutaka; Murai, Masahiko; Murayama, Dai; Motoyama, Ichiro

    Energy conservation in building fields is one of the key issues in environmental point of view as well as that of industrial, transportation and residential fields. The half of the total energy consumption in a building is occupied by HVAC (Heating, Ventilating and Air Conditioning) systems. In order to realize energy conservation of HVAC system, a thermal load prediction model for building is required. This paper propose a hybrid modeling approach with physical and Just-in-Time (JIT) model for building thermal load prediction. The proposed method has features and benefits such as, (1) it is applicable to the case in which past operation data for load prediction model learning is poor, (2) it has a self checking function, which always supervises if the data driven load prediction and the physical based one are consistent or not, so it can find if something is wrong in load prediction procedure, (3) it has ability to adjust load prediction in real-time against sudden change of model parameters and environmental conditions. The proposed method is evaluated with real operation data of an existing building, and the improvement of load prediction performance is illustrated.

  15. Logistic regression modelling: procedures and pitfalls in developing and interpreting prediction models

    Directory of Open Access Journals (Sweden)

    Nataša Šarlija

    2017-01-01

    Full Text Available This study sheds light on the most common issues related to applying logistic regression in prediction models for company growth. The purpose of the paper is 1 to provide a detailed demonstration of the steps in developing a growth prediction model based on logistic regression analysis, 2 to discuss common pitfalls and methodological errors in developing a model, and 3 to provide solutions and possible ways of overcoming these issues. Special attention is devoted to the question of satisfying logistic regression assumptions, selecting and defining dependent and independent variables, using classification tables and ROC curves, for reporting model strength, interpreting odds ratios as effect measures and evaluating performance of the prediction model. Development of a logistic regression model in this paper focuses on a prediction model of company growth. The analysis is based on predominantly financial data from a sample of 1471 small and medium-sized Croatian companies active between 2009 and 2014. The financial data is presented in the form of financial ratios divided into nine main groups depicting following areas of business: liquidity, leverage, activity, profitability, research and development, investing and export. The growth prediction model indicates aspects of a business critical for achieving high growth. In that respect, the contribution of this paper is twofold. First, methodological, in terms of pointing out pitfalls and potential solutions in logistic regression modelling, and secondly, theoretical, in terms of identifying factors responsible for high growth of small and medium-sized companies.

  16. Modelling of Surface Fault Structures Based on Ground Magnetic Survey

    Science.gov (United States)

    Michels, A.; McEnroe, S. A.

    2017-12-01

    The island of Leka confines the exposure of the Leka Ophiolite Complex (LOC) which contains mantle and crustal rocks and provides a rare opportunity to study the magnetic properties and response of these formations. The LOC is comprised of five rock units: (1) harzburgite that is strongly deformed, shifting into an increasingly olivine-rich dunite (2) ultramafic cumulates with layers of olivine, chromite, clinopyroxene and orthopyroxene. These cumulates are overlain by (3) metagabbros, which are cut by (4) metabasaltic dykes and (5) pillow lavas (Furnes et al. 1988). Over the course of three field seasons a detailed ground-magnetic survey was made over the island covering all units of the LOC and collecting samples from 109 sites for magnetic measurements. NRM, susceptibility, density and hysteresis properties were measured. In total 66% of samples with a Q value > 1, suggests that the magnetic anomalies should include both induced and remanent components in the model.This Ophiolite originated from a suprasubduction zone near the coast of Laurentia (497±2 Ma), was obducted onto Laurentia (≈460 Ma) and then transferred to Baltica during the Caledonide Orogeny (≈430 Ma). The LOC was faulted, deformed and serpentinized during these events. The gabbro and ultramafic rocks are separated by a normal fault. The dominant magnetic anomaly that crosses the island correlates with this normal fault. There are a series of smaller scale faults that are parallel to this and some correspond to local highs that can be highlighted by a tilt derivative of the magnetic data. These fault boundaries which are well delineated by the distinct magnetic anomalies in both ground and aeromagnetic survey data are likely caused by increased amount of serpentinization of the ultramafic rocks in the fault areas.

  17. Model output statistics applied to wind power prediction

    Energy Technology Data Exchange (ETDEWEB)

    Joensen, A; Giebel, G; Landberg, L [Risoe National Lab., Roskilde (Denmark); Madsen, H; Nielsen, H A [The Technical Univ. of Denmark, Dept. of Mathematical Modelling, Lyngby (Denmark)

    1999-03-01

    Being able to predict the output of a wind farm online for a day or two in advance has significant advantages for utilities, such as better possibility to schedule fossil fuelled power plants and a better position on electricity spot markets. In this paper prediction methods based on Numerical Weather Prediction (NWP) models are considered. The spatial resolution used in NWP models implies that these predictions are not valid locally at a specific wind farm. Furthermore, due to the non-stationary nature and complexity of the processes in the atmosphere, and occasional changes of NWP models, the deviation between the predicted and the measured wind will be time dependent. If observational data is available, and if the deviation between the predictions and the observations exhibits systematic behavior, this should be corrected for; if statistical methods are used, this approaches is usually referred to as MOS (Model Output Statistics). The influence of atmospheric turbulence intensity, topography, prediction horizon length and auto-correlation of wind speed and power is considered, and to take the time-variations into account, adaptive estimation methods are applied. Three estimation techniques are considered and compared, Extended Kalman Filtering, recursive least squares and a new modified recursive least squares algorithm. (au) EU-JOULE-3. 11 refs.

  18. Neuro-fuzzy modeling in bankruptcy prediction

    Directory of Open Access Journals (Sweden)

    Vlachos D.

    2003-01-01

    Full Text Available For the past 30 years the problem of bankruptcy prediction had been thoroughly studied. From the paper of Altman in 1968 to the recent papers in the '90s, the progress of prediction accuracy was not satisfactory. This paper investigates an alternative modeling of the system (firm, combining neural networks and fuzzy controllers, i.e. using neuro-fuzzy models. Classical modeling is based on mathematical models that describe the behavior of the firm under consideration. The main idea of fuzzy control, on the other hand, is to build a model of a human control expert who is capable of controlling the process without thinking in a mathematical model. This control expert specifies his control action in the form of linguistic rules. These control rules are translated into the framework of fuzzy set theory providing a calculus, which can stimulate the behavior of the control expert and enhance its performance. The accuracy of the model is studied using datasets from previous research papers.

  19. Short-Term Wind Speed Prediction Using EEMD-LSSVM Model

    Directory of Open Access Journals (Sweden)

    Aiqing Kang

    2017-01-01

    Full Text Available Hybrid Ensemble Empirical Mode Decomposition (EEMD and Least Square Support Vector Machine (LSSVM is proposed to improve short-term wind speed forecasting precision. The EEMD is firstly utilized to decompose the original wind speed time series into a set of subseries. Then the LSSVM models are established to forecast these subseries. Partial autocorrelation function is adopted to analyze the inner relationships between the historical wind speed series in order to determine input variables of LSSVM models for prediction of every subseries. Finally, the superposition principle is employed to sum the predicted values of every subseries as the final wind speed prediction. The performance of hybrid model is evaluated based on six metrics. Compared with LSSVM, Back Propagation Neural Networks (BP, Auto-Regressive Integrated Moving Average (ARIMA, combination of Empirical Mode Decomposition (EMD with LSSVM, and hybrid EEMD with ARIMA models, the wind speed forecasting results show that the proposed hybrid model outperforms these models in terms of six metrics. Furthermore, the scatter diagrams of predicted versus actual wind speed and histograms of prediction errors are presented to verify the superiority of the hybrid model in short-term wind speed prediction.

  20. PREDICTED PERCENTAGE DISSATISFIED (PPD) MODEL ...

    African Journals Online (AJOL)

    HOD

    their low power requirements, are relatively cheap and are environment friendly. ... PREDICTED PERCENTAGE DISSATISFIED MODEL EVALUATION OF EVAPORATIVE COOLING ... The performance of direct evaporative coolers is a.

  1. Effect on Prediction when Modeling Covariates in Bayesian Nonparametric Models.

    Science.gov (United States)

    Cruz-Marcelo, Alejandro; Rosner, Gary L; Müller, Peter; Stewart, Clinton F

    2013-04-01

    In biomedical research, it is often of interest to characterize biologic processes giving rise to observations and to make predictions of future observations. Bayesian nonparametric methods provide a means for carrying out Bayesian inference making as few assumptions about restrictive parametric models as possible. There are several proposals in the literature for extending Bayesian nonparametric models to include dependence on covariates. Limited attention, however, has been directed to the following two aspects. In this article, we examine the effect on fitting and predictive performance of incorporating covariates in a class of Bayesian nonparametric models by one of two primary ways: either in the weights or in the locations of a discrete random probability measure. We show that different strategies for incorporating continuous covariates in Bayesian nonparametric models can result in big differences when used for prediction, even though they lead to otherwise similar posterior inferences. When one needs the predictive density, as in optimal design, and this density is a mixture, it is better to make the weights depend on the covariates. We demonstrate these points via a simulated data example and in an application in which one wants to determine the optimal dose of an anticancer drug used in pediatric oncology.

  2. Modeling the prediction of business intelligence system effectiveness.

    Science.gov (United States)

    Weng, Sung-Shun; Yang, Ming-Hsien; Koo, Tian-Lih; Hsiao, Pei-I

    2016-01-01

    Although business intelligence (BI) technologies are continually evolving, the capability to apply BI technologies has become an indispensable resource for enterprises running in today's complex, uncertain and dynamic business environment. This study performed pioneering work by constructing models and rules for the prediction of business intelligence system effectiveness (BISE) in relation to the implementation of BI solutions. For enterprises, effectively managing critical attributes that determine BISE to develop prediction models with a set of rules for self-evaluation of the effectiveness of BI solutions is necessary to improve BI implementation and ensure its success. The main study findings identified the critical prediction indicators of BISE that are important to forecasting BI performance and highlighted five classification and prediction rules of BISE derived from decision tree structures, as well as a refined regression prediction model with four critical prediction indicators constructed by logistic regression analysis that can enable enterprises to improve BISE while effectively managing BI solution implementation and catering to academics to whom theory is important.

  3. [Application of ARIMA model on prediction of malaria incidence].

    Science.gov (United States)

    Jing, Xia; Hua-Xun, Zhang; Wen, Lin; Su-Jian, Pei; Ling-Cong, Sun; Xiao-Rong, Dong; Mu-Min, Cao; Dong-Ni, Wu; Shunxiang, Cai

    2016-01-29

    To predict the incidence of local malaria of Hubei Province applying the Autoregressive Integrated Moving Average model (ARIMA). SPSS 13.0 software was applied to construct the ARIMA model based on the monthly local malaria incidence in Hubei Province from 2004 to 2009. The local malaria incidence data of 2010 were used for model validation and evaluation. The model of ARIMA (1, 1, 1) (1, 1, 0) 12 was tested as relatively the best optimal with the AIC of 76.085 and SBC of 84.395. All the actual incidence data were in the range of 95% CI of predicted value of the model. The prediction effect of the model was acceptable. The ARIMA model could effectively fit and predict the incidence of local malaria of Hubei Province.

  4. PREDICTIVE CAPACITY OF ARCH FAMILY MODELS

    Directory of Open Access Journals (Sweden)

    Raphael Silveira Amaro

    2016-03-01

    Full Text Available In the last decades, a remarkable number of models, variants from the Autoregressive Conditional Heteroscedastic family, have been developed and empirically tested, making extremely complex the process of choosing a particular model. This research aim to compare the predictive capacity, using the Model Confidence Set procedure, than five conditional heteroskedasticity models, considering eight different statistical probability distributions. The financial series which were used refers to the log-return series of the Bovespa index and the Dow Jones Industrial Index in the period between 27 October 2008 and 30 December 2014. The empirical evidences showed that, in general, competing models have a great homogeneity to make predictions, either for a stock market of a developed country or for a stock market of a developing country. An equivalent result can be inferred for the statistical probability distributions that were used.

  5. Seasonal predictability of Kiremt rainfall in coupled general circulation models

    Science.gov (United States)

    Gleixner, Stephanie; Keenlyside, Noel S.; Demissie, Teferi D.; Counillon, François; Wang, Yiguo; Viste, Ellen

    2017-11-01

    The Ethiopian economy and population is strongly dependent on rainfall. Operational seasonal predictions for the main rainy season (Kiremt, June-September) are based on statistical approaches with Pacific sea surface temperatures (SST) as the main predictor. Here we analyse dynamical predictions from 11 coupled general circulation models for the Kiremt seasons from 1985-2005 with the forecasts starting from the beginning of May. We find skillful predictions from three of the 11 models, but no model beats a simple linear prediction model based on the predicted Niño3.4 indices. The skill of the individual models for dynamically predicting Kiremt rainfall depends on the strength of the teleconnection between Kiremt rainfall and concurrent Pacific SST in the models. Models that do not simulate this teleconnection fail to capture the observed relationship between Kiremt rainfall and the large-scale Walker circulation.

  6. Prediction of lithium-ion battery capacity with metabolic grey model

    International Nuclear Information System (INIS)

    Chen, Lin; Lin, Weilong; Li, Junzi; Tian, Binbin; Pan, Haihong

    2016-01-01

    Given the popularity of Lithium-ion batteries in EVs (electric vehicles), predicting the capacity quickly and accurately throughout a battery's full life-time is still a challenging issue for ensuring the reliability of EVs. This paper proposes an approach in predicting the varied capacity with discharge cycles based on metabolic grey theory and consider issues from two perspectives: 1) three metabolic grey models will be presented, including MGM (metabolic grey model), MREGM (metabolic Residual-error grey model), and MMREGM (metabolic Markov-residual-error grey model); 2) the universality of these models will be explored under different conditions (such as various discharge rates and temperatures). Furthermore, the research findings in this paper demonstrate the excellent performance of the prediction depending on the three models; however, the precision of the MREGM model is inferior compared to the others. Therefore, we have obtained the conclusion in which the MGM model and the MMREGM model have excellent performances in predicting the capacity under a variety of load conditions, even using few data points for modeling. Also, the universality of the metabolic grey prediction theory is verified by predicting the capacity of batteries under different discharge rates and different temperatures. - Highlights: • The metabolic mechanism is introduced in a grey system for capacity prediction. • Three metabolic grey models are presented and studied. • The universality of these models under different conditions is assessed. • A few data points are required for predicting the capacity with these models.

  7. Comparison of joint modeling and landmarking for dynamic prediction under an illness-death model.

    Science.gov (United States)

    Suresh, Krithika; Taylor, Jeremy M G; Spratt, Daniel E; Daignault, Stephanie; Tsodikov, Alexander

    2017-11-01

    Dynamic prediction incorporates time-dependent marker information accrued during follow-up to improve personalized survival prediction probabilities. At any follow-up, or "landmark", time, the residual time distribution for an individual, conditional on their updated marker values, can be used to produce a dynamic prediction. To satisfy a consistency condition that links dynamic predictions at different time points, the residual time distribution must follow from a prediction function that models the joint distribution of the marker process and time to failure, such as a joint model. To circumvent the assumptions and computational burden associated with a joint model, approximate methods for dynamic prediction have been proposed. One such method is landmarking, which fits a Cox model at a sequence of landmark times, and thus is not a comprehensive probability model of the marker process and the event time. Considering an illness-death model, we derive the residual time distribution and demonstrate that the structure of the Cox model baseline hazard and covariate effects under the landmarking approach do not have simple form. We suggest some extensions of the landmark Cox model that should provide a better approximation. We compare the performance of the landmark models with joint models using simulation studies and cognitive aging data from the PAQUID study. We examine the predicted probabilities produced under both methods using data from a prostate cancer study, where metastatic clinical failure is a time-dependent covariate for predicting death following radiation therapy. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  8. A Grey NGM(1,1,k Self-Memory Coupling Prediction Model for Energy Consumption Prediction

    Directory of Open Access Journals (Sweden)

    Xiaojun Guo

    2014-01-01

    Full Text Available Energy consumption prediction is an important issue for governments, energy sector investors, and other related corporations. Although there are several prediction techniques, selection of the most appropriate technique is of vital importance. As for the approximate nonhomogeneous exponential data sequence often emerging in the energy system, a novel grey NGM(1,1,k self-memory coupling prediction model is put forward in order to promote the predictive performance. It achieves organic integration of the self-memory principle of dynamic system and grey NGM(1,1,k model. The traditional grey model’s weakness as being sensitive to initial value can be overcome by the self-memory principle. In this study, total energy, coal, and electricity consumption of China is adopted for demonstration by using the proposed coupling prediction technique. The results show the superiority of NGM(1,1,k self-memory coupling prediction model when compared with the results from the literature. Its excellent prediction performance lies in that the proposed coupling model can take full advantage of the systematic multitime historical data and catch the stochastic fluctuation tendency. This work also makes a significant contribution to the enrichment of grey prediction theory and the extension of its application span.

  9. Improving Predictive Modeling in Pediatric Drug Development: Pharmacokinetics, Pharmacodynamics, and Mechanistic Modeling

    Energy Technology Data Exchange (ETDEWEB)

    Slikker, William; Young, John F.; Corley, Rick A.; Dorman, David C.; Conolly, Rory B.; Knudsen, Thomas; Erstad, Brian L.; Luecke, Richard H.; Faustman, Elaine M.; Timchalk, Chuck; Mattison, Donald R.

    2005-07-26

    A workshop was conducted on November 18?19, 2004, to address the issue of improving predictive models for drug delivery to developing humans. Although considerable progress has been made for adult humans, large gaps remain for predicting pharmacokinetic/pharmacodynamic (PK/PD) outcome in children because most adult models have not been tested during development. The goals of the meeting included a description of when, during development, infants/children become adultlike in handling drugs. The issue of incorporating the most recent advances into the predictive models was also addressed: both the use of imaging approaches and genomic information were considered. Disease state, as exemplified by obesity, was addressed as a modifier of drug pharmacokinetics and pharmacodynamics during development. Issues addressed in this workshop should be considered in the development of new predictive and mechanistic models of drug kinetics and dynamics in the developing human.

  10. Prediction models : the right tool for the right problem

    NARCIS (Netherlands)

    Kappen, Teus H.; Peelen, Linda M.

    2016-01-01

    PURPOSE OF REVIEW: Perioperative prediction models can help to improve personalized patient care by providing individual risk predictions to both patients and providers. However, the scientific literature on prediction model development and validation can be quite technical and challenging to

  11. Selecting Optimal Random Forest Predictive Models: A Case Study on Predicting the Spatial Distribution of Seabed Hardness

    Science.gov (United States)

    Li, Jin; Tran, Maggie; Siwabessy, Justy

    2016-01-01

    Spatially continuous predictions of seabed hardness are important baseline environmental information for sustainable management of Australia’s marine jurisdiction. Seabed hardness is often inferred from multibeam backscatter data with unknown accuracy and can be inferred from underwater video footage at limited locations. In this study, we classified the seabed into four classes based on two new seabed hardness classification schemes (i.e., hard90 and hard70). We developed optimal predictive models to predict seabed hardness using random forest (RF) based on the point data of hardness classes and spatially continuous multibeam data. Five feature selection (FS) methods that are variable importance (VI), averaged variable importance (AVI), knowledge informed AVI (KIAVI), Boruta and regularized RF (RRF) were tested based on predictive accuracy. Effects of highly correlated, important and unimportant predictors on the accuracy of RF predictive models were examined. Finally, spatial predictions generated using the most accurate models were visually examined and analysed. This study confirmed that: 1) hard90 and hard70 are effective seabed hardness classification schemes; 2) seabed hardness of four classes can be predicted with a high degree of accuracy; 3) the typical approach used to pre-select predictive variables by excluding highly correlated variables needs to be re-examined; 4) the identification of the important and unimportant predictors provides useful guidelines for further improving predictive models; 5) FS methods select the most accurate predictive model(s) instead of the most parsimonious ones, and AVI and Boruta are recommended for future studies; and 6) RF is an effective modelling method with high predictive accuracy for multi-level categorical data and can be applied to ‘small p and large n’ problems in environmental sciences. Additionally, automated computational programs for AVI need to be developed to increase its computational efficiency and

  12. Robust predictions of the interacting boson model

    International Nuclear Information System (INIS)

    Casten, R.F.; Koeln Univ.

    1994-01-01

    While most recognized for its symmetries and algebraic structure, the IBA model has other less-well-known but equally intrinsic properties which give unavoidable, parameter-free predictions. These predictions concern central aspects of low-energy nuclear collective structure. This paper outlines these ''robust'' predictions and compares them with the data

  13. An approach to model validation and model-based prediction -- polyurethane foam case study.

    Energy Technology Data Exchange (ETDEWEB)

    Dowding, Kevin J.; Rutherford, Brian Milne

    2003-07-01

    Enhanced software methodology and improved computing hardware have advanced the state of simulation technology to a point where large physics-based codes can be a major contributor in many systems analyses. This shift toward the use of computational methods has brought with it new research challenges in a number of areas including characterization of uncertainty, model validation, and the analysis of computer output. It is these challenges that have motivated the work described in this report. Approaches to and methods for model validation and (model-based) prediction have been developed recently in the engineering, mathematics and statistical literatures. In this report we have provided a fairly detailed account of one approach to model validation and prediction applied to an analysis investigating thermal decomposition of polyurethane foam. A model simulates the evolution of the foam in a high temperature environment as it transforms from a solid to a gas phase. The available modeling and experimental results serve as data for a case study focusing our model validation and prediction developmental efforts on this specific thermal application. We discuss several elements of the ''philosophy'' behind the validation and prediction approach: (1) We view the validation process as an activity applying to the use of a specific computational model for a specific application. We do acknowledge, however, that an important part of the overall development of a computational simulation initiative is the feedback provided to model developers and analysts associated with the application. (2) We utilize information obtained for the calibration of model parameters to estimate the parameters and quantify uncertainty in the estimates. We rely, however, on validation data (or data from similar analyses) to measure the variability that contributes to the uncertainty in predictions for specific systems or units (unit-to-unit variability). (3) We perform statistical

  14. Predictive modeling of liquid-sodium thermal–hydraulics experiments and computations

    International Nuclear Information System (INIS)

    Arslan, Erkan; Cacuci, Dan G.

    2014-01-01

    Highlights: • We applied the predictive modeling method of Cacuci and Ionescu-Bujor (2010). • We assimilated data from sodium flow experiments. • We used computational fluid dynamics simulations of sodium experiments. • The predictive modeling method greatly reduced uncertainties in predicted results. - Abstract: This work applies the predictive modeling procedure formulated by Cacuci and Ionescu-Bujor (2010) to assimilate data from liquid-sodium thermal–hydraulics experiments in order to reduce systematically the uncertainties in the predictions of computational fluid dynamics (CFD) simulations. The predicted CFD-results for the best-estimate model parameters and results describing sodium-flow velocities and temperature distributions are shown to be significantly more precise than the original computations and experiments, in that the predicted uncertainties for the best-estimate results and model parameters are significantly smaller than both the originally computed and the experimental uncertainties

  15. Interpreting Disruption Prediction Models to Improve Plasma Control

    Science.gov (United States)

    Parsons, Matthew

    2017-10-01

    In order for the tokamak to be a feasible design for a fusion reactor, it is necessary to minimize damage to the machine caused by plasma disruptions. Accurately predicting disruptions is a critical capability for triggering any mitigative actions, and a modest amount of attention has been given to efforts that employ machine learning techniques to make these predictions. By monitoring diagnostic signals during a discharge, such predictive models look for signs that the plasma is about to disrupt. Typically these predictive models are interpreted simply to give a `yes' or `no' response as to whether a disruption is approaching. However, it is possible to extract further information from these models to indicate which input signals are more strongly correlated with the plasma approaching a disruption. If highly accurate predictive models can be developed, this information could be used in plasma control schemes to make better decisions about disruption avoidance. This work was supported by a Grant from the 2016-2017 Fulbright U.S. Student Program, administered by the Franco-American Fulbright Commission in France.

  16. In silico modeling to predict drug-induced phospholipidosis

    International Nuclear Information System (INIS)

    Choi, Sydney S.; Kim, Jae S.; Valerio, Luis G.; Sadrieh, Nakissa

    2013-01-01

    Drug-induced phospholipidosis (DIPL) is a preclinical finding during pharmaceutical drug development that has implications on the course of drug development and regulatory safety review. A principal characteristic of drugs inducing DIPL is known to be a cationic amphiphilic structure. This provides evidence for a structure-based explanation and opportunity to analyze properties and structures of drugs with the histopathologic findings for DIPL. In previous work from the FDA, in silico quantitative structure–activity relationship (QSAR) modeling using machine learning approaches has shown promise with a large dataset of drugs but included unconfirmed data as well. In this study, we report the construction and validation of a battery of complementary in silico QSAR models using the FDA's updated database on phospholipidosis, new algorithms and predictive technologies, and in particular, we address high performance with a high-confidence dataset. The results of our modeling for DIPL include rigorous external validation tests showing 80–81% concordance. Furthermore, the predictive performance characteristics include models with high sensitivity and specificity, in most cases above ≥ 80% leading to desired high negative and positive predictivity. These models are intended to be utilized for regulatory toxicology applied science needs in screening new drugs for DIPL. - Highlights: • New in silico models for predicting drug-induced phospholipidosis (DIPL) are described. • The training set data in the models is derived from the FDA's phospholipidosis database. • We find excellent predictivity values of the models based on external validation. • The models can support drug screening and regulatory decision-making on DIPL

  17. Return Predictability, Model Uncertainty, and Robust Investment

    DEFF Research Database (Denmark)

    Lukas, Manuel

    Stock return predictability is subject to great uncertainty. In this paper we use the model confidence set approach to quantify uncertainty about expected utility from investment, accounting for potential return predictability. For monthly US data and six representative return prediction models, we...... find that confidence sets are very wide, change significantly with the predictor variables, and frequently include expected utilities for which the investor prefers not to invest. The latter motivates a robust investment strategy maximizing the minimal element of the confidence set. The robust investor...... allocates a much lower share of wealth to stocks compared to a standard investor....

  18. Effective modelling for predictive analytics in data science ...

    African Journals Online (AJOL)

    Effective modelling for predictive analytics in data science. ... the nearabsence of empirical or factual predictive analytics in the mainstream research going on ... Keywords: Predictive Analytics, Big Data, Business Intelligence, Project Planning.

  19. Statistical and Machine Learning Models to Predict Programming Performance

    OpenAIRE

    Bergin, Susan

    2006-01-01

    This thesis details a longitudinal study on factors that influence introductory programming success and on the development of machine learning models to predict incoming student performance. Although numerous studies have developed models to predict programming success, the models struggled to achieve high accuracy in predicting the likely performance of incoming students. Our approach overcomes this by providing a machine learning technique, using a set of three significant...

  20. Predicting Protein Secondary Structure with Markov Models

    DEFF Research Database (Denmark)

    Fischer, Paul; Larsen, Simon; Thomsen, Claus

    2004-01-01

    we are considering here, is to predict the secondary structure from the primary one. To this end we train a Markov model on training data and then use it to classify parts of unknown protein sequences as sheets, helices or coils. We show how to exploit the directional information contained...... in the Markov model for this task. Classifications that are purely based on statistical models might not always be biologically meaningful. We present combinatorial methods to incorporate biological background knowledge to enhance the prediction performance....

  1. On the Predictiveness of Single-Field Inflationary Models

    CERN Document Server

    Burgess, C.P.; Trott, Michael

    2014-01-01

    We re-examine the predictiveness of single-field inflationary models and discuss how an unknown UV completion can complicate determining inflationary model parameters from observations, even from precision measurements. Besides the usual naturalness issues associated with having a shallow inflationary potential, we describe another issue for inflation, namely, unknown UV physics modifies the running of Standard Model (SM) parameters and thereby introduces uncertainty into the potential inflationary predictions. We illustrate this point using the minimal Higgs Inflationary scenario, which is arguably the most predictive single-field model on the market, because its predictions for $A_s$, $r$ and $n_s$ are made using only one new free parameter beyond those measured in particle physics experiments, and run up to the inflationary regime. We find that this issue can already have observable effects. At the same time, this UV-parameter dependence in the Renormalization Group allows Higgs Inflation to occur (in prin...

  2. Predictive modeling of neuroanatomic structures for brain atrophy detection

    Science.gov (United States)

    Hu, Xintao; Guo, Lei; Nie, Jingxin; Li, Kaiming; Liu, Tianming

    2010-03-01

    In this paper, we present an approach of predictive modeling of neuroanatomic structures for the detection of brain atrophy based on cross-sectional MRI image. The underlying premise of applying predictive modeling for atrophy detection is that brain atrophy is defined as significant deviation of part of the anatomy from what the remaining normal anatomy predicts for that part. The steps of predictive modeling are as follows. The central cortical surface under consideration is reconstructed from brain tissue map and Regions of Interests (ROI) on it are predicted from other reliable anatomies. The vertex pair-wise distance between the predicted vertex and the true one within the abnormal region is expected to be larger than that of the vertex in normal brain region. Change of white matter/gray matter ratio within a spherical region is used to identify the direction of vertex displacement. In this way, the severity of brain atrophy can be defined quantitatively by the displacements of those vertices. The proposed predictive modeling method has been evaluated by using both simulated atrophies and MRI images of Alzheimer's disease.

  3. Development and validation of a risk model for prediction of hazardous alcohol consumption in general practice attendees: the predictAL study.

    Science.gov (United States)

    King, Michael; Marston, Louise; Švab, Igor; Maaroos, Heidi-Ingrid; Geerlings, Mirjam I; Xavier, Miguel; Benjamin, Vicente; Torres-Gonzalez, Francisco; Bellon-Saameno, Juan Angel; Rotar, Danica; Aluoja, Anu; Saldivia, Sandra; Correa, Bernardo; Nazareth, Irwin

    2011-01-01

    Little is known about the risk of progression to hazardous alcohol use in people currently drinking at safe limits. We aimed to develop a prediction model (predictAL) for the development of hazardous drinking in safe drinkers. A prospective cohort study of adult general practice attendees in six European countries and Chile followed up over 6 months. We recruited 10,045 attendees between April 2003 to February 2005. 6193 European and 2462 Chilean attendees recorded AUDIT scores below 8 in men and 5 in women at recruitment and were used in modelling risk. 38 risk factors were measured to construct a risk model for the development of hazardous drinking using stepwise logistic regression. The model was corrected for over fitting and tested in an external population. The main outcome was hazardous drinking defined by an AUDIT score ≥8 in men and ≥5 in women. 69.0% of attendees were recruited, of whom 89.5% participated again after six months. The risk factors in the final predictAL model were sex, age, country, baseline AUDIT score, panic syndrome and lifetime alcohol problem. The predictAL model's average c-index across all six European countries was 0.839 (95% CI 0.805, 0.873). The Hedge's g effect size for the difference in log odds of predicted probability between safe drinkers in Europe who subsequently developed hazardous alcohol use and those who did not was 1.38 (95% CI 1.25, 1.51). External validation of the algorithm in Chilean safe drinkers resulted in a c-index of 0.781 (95% CI 0.717, 0.846) and Hedge's g of 0.68 (95% CI 0.57, 0.78). The predictAL risk model for development of hazardous consumption in safe drinkers compares favourably with risk algorithms for disorders in other medical settings and can be a useful first step in prevention of alcohol misuse.

  4. Development and validation of a risk model for prediction of hazardous alcohol consumption in general practice attendees: the predictAL study.

    Directory of Open Access Journals (Sweden)

    Michael King

    Full Text Available Little is known about the risk of progression to hazardous alcohol use in people currently drinking at safe limits. We aimed to develop a prediction model (predictAL for the development of hazardous drinking in safe drinkers.A prospective cohort study of adult general practice attendees in six European countries and Chile followed up over 6 months. We recruited 10,045 attendees between April 2003 to February 2005. 6193 European and 2462 Chilean attendees recorded AUDIT scores below 8 in men and 5 in women at recruitment and were used in modelling risk. 38 risk factors were measured to construct a risk model for the development of hazardous drinking using stepwise logistic regression. The model was corrected for over fitting and tested in an external population. The main outcome was hazardous drinking defined by an AUDIT score ≥8 in men and ≥5 in women.69.0% of attendees were recruited, of whom 89.5% participated again after six months. The risk factors in the final predictAL model were sex, age, country, baseline AUDIT score, panic syndrome and lifetime alcohol problem. The predictAL model's average c-index across all six European countries was 0.839 (95% CI 0.805, 0.873. The Hedge's g effect size for the difference in log odds of predicted probability between safe drinkers in Europe who subsequently developed hazardous alcohol use and those who did not was 1.38 (95% CI 1.25, 1.51. External validation of the algorithm in Chilean safe drinkers resulted in a c-index of 0.781 (95% CI 0.717, 0.846 and Hedge's g of 0.68 (95% CI 0.57, 0.78.The predictAL risk model for development of hazardous consumption in safe drinkers compares favourably with risk algorithms for disorders in other medical settings and can be a useful first step in prevention of alcohol misuse.

  5. Prediction Model for Gastric Cancer Incidence in Korean Population.

    Directory of Open Access Journals (Sweden)

    Bang Wool Eom

    Full Text Available Predicting high risk groups for gastric cancer and motivating these groups to receive regular checkups is required for the early detection of gastric cancer. The aim of this study is was to develop a prediction model for gastric cancer incidence based on a large population-based cohort in Korea.Based on the National Health Insurance Corporation data, we analyzed 10 major risk factors for gastric cancer. The Cox proportional hazards model was used to develop gender specific prediction models for gastric cancer development, and the performance of the developed model in terms of discrimination and calibration was also validated using an independent cohort. Discrimination ability was evaluated using Harrell's C-statistics, and the calibration was evaluated using a calibration plot and slope.During a median of 11.4 years of follow-up, 19,465 (1.4% and 5,579 (0.7% newly developed gastric cancer cases were observed among 1,372,424 men and 804,077 women, respectively. The prediction models included age, BMI, family history, meal regularity, salt preference, alcohol consumption, smoking and physical activity for men, and age, BMI, family history, salt preference, alcohol consumption, and smoking for women. This prediction model showed good accuracy and predictability in both the developing and validation cohorts (C-statistics: 0.764 for men, 0.706 for women.In this study, a prediction model for gastric cancer incidence was developed that displayed a good performance.

  6. Predictive modeling of coupled multi-physics systems: I. Theory

    International Nuclear Information System (INIS)

    Cacuci, Dan Gabriel

    2014-01-01

    Highlights: • We developed “predictive modeling of coupled multi-physics systems (PMCMPS)”. • PMCMPS reduces predicted uncertainties in predicted model responses and parameters. • PMCMPS treats efficiently very large coupled systems. - Abstract: This work presents an innovative mathematical methodology for “predictive modeling of coupled multi-physics systems (PMCMPS).” This methodology takes into account fully the coupling terms between the systems but requires only the computational resources that would be needed to perform predictive modeling on each system separately. The PMCMPS methodology uses the maximum entropy principle to construct an optimal approximation of the unknown a priori distribution based on a priori known mean values and uncertainties characterizing the parameters and responses for both multi-physics models. This “maximum entropy”-approximate a priori distribution is combined, using Bayes’ theorem, with the “likelihood” provided by the multi-physics simulation models. Subsequently, the posterior distribution thus obtained is evaluated using the saddle-point method to obtain analytical expressions for the optimally predicted values for the multi-physics models parameters and responses along with corresponding reduced uncertainties. Noteworthy, the predictive modeling methodology for the coupled systems is constructed such that the systems can be considered sequentially rather than simultaneously, while preserving exactly the same results as if the systems were treated simultaneously. Consequently, very large coupled systems, which could perhaps exceed available computational resources if treated simultaneously, can be treated with the PMCMPS methodology presented in this work sequentially and without any loss of generality or information, requiring just the resources that would be needed if the systems were treated sequentially

  7. Comparison of the models of financial distress prediction

    Directory of Open Access Journals (Sweden)

    Jiří Omelka

    2013-01-01

    Full Text Available Prediction of the financial distress is generally supposed as approximation if a business entity is closed on bankruptcy or at least on serious financial problems. Financial distress is defined as such a situation when a company is not able to satisfy its liabilities in any forms, or when its liabilities are higher than its assets. Classification of financial situation of business entities represents a multidisciplinary scientific issue that uses not only the economic theoretical bases but interacts to the statistical, respectively to econometric approaches as well.The first models of financial distress prediction have originated in the sixties of the 20th century. One of the most known is the Altman’s model followed by a range of others which are constructed on more or less conformable bases. In many existing models it is possible to find common elements which could be marked as elementary indicators of potential financial distress of a company. The objective of this article is, based on the comparison of existing models of prediction of financial distress, to define the set of basic indicators of company’s financial distress at conjoined identification of their critical aspects. The sample defined this way will be a background for future research focused on determination of one-dimensional model of financial distress prediction which would subsequently become a basis for construction of multi-dimensional prediction model.

  8. A model for predicting lung cancer response to therapy

    International Nuclear Information System (INIS)

    Seibert, Rebecca M.; Ramsey, Chester R.; Hines, J. Wesley; Kupelian, Patrick A.; Langen, Katja M.; Meeks, Sanford L.; Scaperoth, Daniel D.

    2007-01-01

    Purpose: Volumetric computed tomography (CT) images acquired by image-guided radiation therapy (IGRT) systems can be used to measure tumor response over the course of treatment. Predictive adaptive therapy is a novel treatment technique that uses volumetric IGRT data to actively predict the future tumor response to therapy during the first few weeks of IGRT treatment. The goal of this study was to develop and test a model for predicting lung tumor response during IGRT treatment using serial megavoltage CT (MVCT). Methods and Materials: Tumor responses were measured for 20 lung cancer lesions in 17 patients that were imaged and treated with helical tomotherapy with doses ranging from 2.0 to 2.5 Gy per fraction. Five patients were treated with concurrent chemotherapy, and 1 patient was treated with neoadjuvant chemotherapy. Tumor response to treatment was retrospectively measured by contouring 480 serial MVCT images acquired before treatment. A nonparametric, memory-based locally weight regression (LWR) model was developed for predicting tumor response using the retrospective tumor response data. This model predicts future tumor volumes and the associated confidence intervals based on limited observations during the first 2 weeks of treatment. The predictive accuracy of the model was tested using a leave-one-out cross-validation technique with the measured tumor responses. Results: The predictive algorithm was used to compare predicted verse-measured tumor volume response for all 20 lesions. The average error for the predictions of the final tumor volume was 12%, with the true volumes always bounded by the 95% confidence interval. The greatest model uncertainty occurred near the middle of the course of treatment, in which the tumor response relationships were more complex, the model has less information, and the predictors were more varied. The optimal days for measuring the tumor response on the MVCT images were on elapsed Days 1, 2, 5, 9, 11, 12, 17, and 18 during

  9. Tectonic predictions with mantle convection models

    Science.gov (United States)

    Coltice, Nicolas; Shephard, Grace E.

    2018-04-01

    Over the past 15 yr, numerical models of convection in Earth's mantle have made a leap forward: they can now produce self-consistent plate-like behaviour at the surface together with deep mantle circulation. These digital tools provide a new window into the intimate connections between plate tectonics and mantle dynamics, and can therefore be used for tectonic predictions, in principle. This contribution explores this assumption. First, initial conditions at 30, 20, 10 and 0 Ma are generated by driving a convective flow with imposed plate velocities at the surface. We then compute instantaneous mantle flows in response to the guessed temperature fields without imposing any boundary conditions. Plate boundaries self-consistently emerge at correct locations with respect to reconstructions, except for small plates close to subduction zones. As already observed for other types of instantaneous flow calculations, the structure of the top boundary layer and upper-mantle slab is the dominant character that leads to accurate predictions of surface velocities. Perturbations of the rheological parameters have little impact on the resulting surface velocities. We then compute fully dynamic model evolution from 30 and 10 to 0 Ma, without imposing plate boundaries or plate velocities. Contrary to instantaneous calculations, errors in kinematic predictions are substantial, although the plate layout and kinematics in several areas remain consistent with the expectations for the Earth. For these calculations, varying the rheological parameters makes a difference for plate boundary evolution. Also, identified errors in initial conditions contribute to first-order kinematic errors. This experiment shows that the tectonic predictions of dynamic models over 10 My are highly sensitive to uncertainties of rheological parameters and initial temperature field in comparison to instantaneous flow calculations. Indeed, the initial conditions and the rheological parameters can be good enough

  10. Iowa calibration of MEPDG performance prediction models.

    Science.gov (United States)

    2013-06-01

    This study aims to improve the accuracy of AASHTO Mechanistic-Empirical Pavement Design Guide (MEPDG) pavement : performance predictions for Iowa pavement systems through local calibration of MEPDG prediction models. A total of 130 : representative p...

  11. A predictive model for dimensional errors in fused deposition modeling

    DEFF Research Database (Denmark)

    Stolfi, A.

    2015-01-01

    This work concerns the effect of deposition angle (a) and layer thickness (L) on the dimensional performance of FDM parts using a predictive model based on the geometrical description of the FDM filament profile. An experimental validation over the whole a range from 0° to 177° at 3° steps and two...... values of L (0.254 mm, 0.330 mm) was produced by comparing predicted values with external face-to-face measurements. After removing outliers, the results show that the developed two-parameter model can serve as tool for modeling the FDM dimensional behavior in a wide range of deposition angles....

  12. Comparison of two ordinal prediction models

    DEFF Research Database (Denmark)

    Kattan, Michael W; Gerds, Thomas A

    2015-01-01

    system (i.e. old or new), such as the level of evidence for one or more factors included in the system or the general opinions of expert clinicians. However, given the major objective of estimating prognosis on an ordinal scale, we argue that the rival staging system candidates should be compared...... on their ability to predict outcome. We sought to outline an algorithm that would compare two rival ordinal systems on their predictive ability. RESULTS: We devised an algorithm based largely on the concordance index, which is appropriate for comparing two models in their ability to rank observations. We...... demonstrate our algorithm with a prostate cancer staging system example. CONCLUSION: We have provided an algorithm for selecting the preferred staging system based on prognostic accuracy. It appears to be useful for the purpose of selecting between two ordinal prediction models....

  13. Modeling pitting growth data and predicting degradation trend

    International Nuclear Information System (INIS)

    Viglasky, T.; Awad, R.; Zeng, Z.; Riznic, J.

    2007-01-01

    A non-statistical modeling approach to predict material degradation is presented in this paper. In this approach, the original data series is processed using Accumulated Generating Operation (AGO). With the aid of the AGO which weakens the random fluctuation embedded in the data series, an approximately exponential curve is established. The generated data series described by the exponential curve is then modeled by a differential equation. The coefficients of the differential equation can be deduced by approximate difference formula based on least-squares algorithm. By solving the differential equation and processing an inverse AGO, a predictive model can be obtained. As this approach is not established on the basis of statistics, the prediction can be performed with a limited amount of data. Implementation of this approach is demonstrated by predicting the pitting growth rate in specimens and wear trend in steam generator tubes. The analysis results indicate that this approach provides a powerful tool with reasonable precision to predict material degradation. (author)

  14. Risk Prediction Models for Incident Heart Failure: A Systematic Review of Methodology and Model Performance.

    Science.gov (United States)

    Sahle, Berhe W; Owen, Alice J; Chin, Ken Lee; Reid, Christopher M

    2017-09-01

    Numerous models predicting the risk of incident heart failure (HF) have been developed; however, evidence of their methodological rigor and reporting remains unclear. This study critically appraises the methods underpinning incident HF risk prediction models. EMBASE and PubMed were searched for articles published between 1990 and June 2016 that reported at least 1 multivariable model for prediction of HF. Model development information, including study design, variable coding, missing data, and predictor selection, was extracted. Nineteen studies reporting 40 risk prediction models were included. Existing models have acceptable discriminative ability (C-statistics > 0.70), although only 6 models were externally validated. Candidate variable selection was based on statistical significance from a univariate screening in 11 models, whereas it was unclear in 12 models. Continuous predictors were retained in 16 models, whereas it was unclear how continuous variables were handled in 16 models. Missing values were excluded in 19 of 23 models that reported missing data, and the number of events per variable was models. Only 2 models presented recommended regression equations. There was significant heterogeneity in discriminative ability of models with respect to age (P prediction models that had sufficient discriminative ability, although few are externally validated. Methods not recommended for the conduct and reporting of risk prediction modeling were frequently used, and resulting algorithms should be applied with caution. Copyright © 2017 Elsevier Inc. All rights reserved.

  15. Mathematical model for dissolved oxygen prediction in Cirata ...

    African Journals Online (AJOL)

    This paper presents the implementation and performance of mathematical model to predict theconcentration of dissolved oxygen in Cirata Reservoir, West Java by using Artificial Neural Network (ANN). The simulation program was created using Visual Studio 2012 C# software with ANN model implemented in it. Prediction ...

  16. Risk Prediction Model for Severe Postoperative Complication in Bariatric Surgery.

    Science.gov (United States)

    Stenberg, Erik; Cao, Yang; Szabo, Eva; Näslund, Erik; Näslund, Ingmar; Ottosson, Johan

    2018-01-12

    Factors associated with risk for adverse outcome are important considerations in the preoperative assessment of patients for bariatric surgery. As yet, prediction models based on preoperative risk factors have not been able to predict adverse outcome sufficiently. This study aimed to identify preoperative risk factors and to construct a risk prediction model based on these. Patients who underwent a bariatric surgical procedure in Sweden between 2010 and 2014 were identified from the Scandinavian Obesity Surgery Registry (SOReg). Associations between preoperative potential risk factors and severe postoperative complications were analysed using a logistic regression model. A multivariate model for risk prediction was created and validated in the SOReg for patients who underwent bariatric surgery in Sweden, 2015. Revision surgery (standardized OR 1.19, 95% confidence interval (CI) 1.14-0.24, p prediction model. Despite high specificity, the sensitivity of the model was low. Revision surgery, high age, low BMI, large waist circumference, and dyspepsia/GERD were associated with an increased risk for severe postoperative complication. The prediction model based on these factors, however, had a sensitivity that was too low to predict risk in the individual patient case.

  17. AN EFFICIENT PATIENT INFLOW PREDICTION MODEL FOR HOSPITAL RESOURCE MANAGEMENT

    Directory of Open Access Journals (Sweden)

    Kottalanka Srikanth

    2017-07-01

    Full Text Available There has been increasing demand in improving service provisioning in hospital resources management. Hospital industries work with strict budget constraint at the same time assures quality care. To achieve quality care with budget constraint an efficient prediction model is required. Recently there has been various time series based prediction model has been proposed to manage hospital resources such ambulance monitoring, emergency care and so on. These models are not efficient as they do not consider the nature of scenario such climate condition etc. To address this artificial intelligence is adopted. The issues with existing prediction are that the training suffers from local optima error. This induces overhead and affects the accuracy in prediction. To overcome the local minima error, this work presents a patient inflow prediction model by adopting resilient backpropagation neural network. Experiment are conducted to evaluate the performance of proposed model inter of RMSE and MAPE. The outcome shows the proposed model reduces RMSE and MAPE over existing back propagation based artificial neural network. The overall outcomes show the proposed prediction model improves the accuracy of prediction which aid in improving the quality of health care management.

  18. Compensatory versus noncompensatory models for predicting consumer preferences

    Directory of Open Access Journals (Sweden)

    Anja Dieckmann

    2009-04-01

    Full Text Available Standard preference models in consumer research assume that people weigh and add all attributes of the available options to derive a decision, while there is growing evidence for the use of simplifying heuristics. Recently, a greedoid algorithm has been developed (Yee, Dahan, Hauser and Orlin, 2007; Kohli and Jedidi, 2007 to model lexicographic heuristics from preference data. We compare predictive accuracies of the greedoid approach and standard conjoint analysis in an online study with a rating and a ranking task. The lexicographic model derived from the greedoid algorithm was better at predicting ranking compared to rating data, but overall, it achieved lower predictive accuracy for hold-out data than the compensatory model estimated by conjoint analysis. However, a considerable minority of participants was better predicted by lexicographic strategies. We conclude that the new algorithm will not replace standard tools for analyzing preferences, but can boost the study of situational and individual differences in preferential choice processes.

  19. Prediction models for successful external cephalic version: a systematic review.

    Science.gov (United States)

    Velzel, Joost; de Hundt, Marcella; Mulder, Frederique M; Molkenboer, Jan F M; Van der Post, Joris A M; Mol, Ben W; Kok, Marjolein

    2015-12-01

    To provide an overview of existing prediction models for successful ECV, and to assess their quality, development and performance. We searched MEDLINE, EMBASE and the Cochrane Library to identify all articles reporting on prediction models for successful ECV published from inception to January 2015. We extracted information on study design, sample size, model-building strategies and validation. We evaluated the phases of model development and summarized their performance in terms of discrimination, calibration and clinical usefulness. We collected different predictor variables together with their defined significance, in order to identify important predictor variables for successful ECV. We identified eight articles reporting on seven prediction models. All models were subjected to internal validation. Only one model was also validated in an external cohort. Two prediction models had a low overall risk of bias, of which only one showed promising predictive performance at internal validation. This model also completed the phase of external validation. For none of the models their impact on clinical practice was evaluated. The most important predictor variables for successful ECV described in the selected articles were parity, placental location, breech engagement and the fetal head being palpable. One model was assessed using discrimination and calibration using internal (AUC 0.71) and external validation (AUC 0.64), while two other models were assessed with discrimination and calibration, respectively. We found one prediction model for breech presentation that was validated in an external cohort and had acceptable predictive performance. This model should be used to council women considering ECV. Copyright © 2015. Published by Elsevier Ireland Ltd.

  20. Predictive QSAR Models for the Toxicity of Disinfection Byproducts

    Directory of Open Access Journals (Sweden)

    Litang Qin

    2017-10-01

    Full Text Available Several hundred disinfection byproducts (DBPs in drinking water have been identified, and are known to have potentially adverse health effects. There are toxicological data gaps for most DBPs, and the predictive method may provide an effective way to address this. The development of an in-silico model of toxicology endpoints of DBPs is rarely studied. The main aim of the present study is to develop predictive quantitative structure–activity relationship (QSAR models for the reactive toxicities of 50 DBPs in the five bioassays of X-Microtox, GSH+, GSH−, DNA+ and DNA−. All-subset regression was used to select the optimal descriptors, and multiple linear-regression models were built. The developed QSAR models for five endpoints satisfied the internal and external validation criteria: coefficient of determination (R2 > 0.7, explained variance in leave-one-out prediction (Q2LOO and in leave-many-out prediction (Q2LMO > 0.6, variance explained in external prediction (Q2F1, Q2F2, and Q2F3 > 0.7, and concordance correlation coefficient (CCC > 0.85. The application domains and the meaning of the selective descriptors for the QSAR models were discussed. The obtained QSAR models can be used in predicting the toxicities of the 50 DBPs.

  1. Predictive QSAR Models for the Toxicity of Disinfection Byproducts.

    Science.gov (United States)

    Qin, Litang; Zhang, Xin; Chen, Yuhan; Mo, Lingyun; Zeng, Honghu; Liang, Yanpeng

    2017-10-09

    Several hundred disinfection byproducts (DBPs) in drinking water have been identified, and are known to have potentially adverse health effects. There are toxicological data gaps for most DBPs, and the predictive method may provide an effective way to address this. The development of an in-silico model of toxicology endpoints of DBPs is rarely studied. The main aim of the present study is to develop predictive quantitative structure-activity relationship (QSAR) models for the reactive toxicities of 50 DBPs in the five bioassays of X-Microtox, GSH+, GSH-, DNA+ and DNA-. All-subset regression was used to select the optimal descriptors, and multiple linear-regression models were built. The developed QSAR models for five endpoints satisfied the internal and external validation criteria: coefficient of determination ( R ²) > 0.7, explained variance in leave-one-out prediction ( Q ² LOO ) and in leave-many-out prediction ( Q ² LMO ) > 0.6, variance explained in external prediction ( Q ² F1 , Q ² F2 , and Q ² F3 ) > 0.7, and concordance correlation coefficient ( CCC ) > 0.85. The application domains and the meaning of the selective descriptors for the QSAR models were discussed. The obtained QSAR models can be used in predicting the toxicities of the 50 DBPs.

  2. Predictors of outcome of an Internet-based cognitive-behavioural therapy for post-traumatic stress disorder in older adults.

    Science.gov (United States)

    Böttche, Maria; Kuwert, Philipp; Pietrzak, Robert H; Knaevelsrud, Christine

    2016-03-01

    The aim of this study was to evaluate the role of resource-oriented variables such as self-efficacy, locus of control (LOC) and post-traumatic growth (PTG) in predicting treatment response in older adults with post-traumatic stress. Fifty-eight older adults with subsyndromal or greater severity of war-associated post-traumatic stress disorder (PTSD) symptoms completed a randomized controlled Internet-based cognitive-behavioural therapy (CBT) with immediate and delayed treatment groups. Assessments of PTSD severity and resource-oriented variables of self-efficacy, LOC and PTG were conducted at baseline, post-treatment and at a 6-month follow-up. Results revealed that pre-treatment scores on measures of internal LOC and PTG predicted PTSD symptom severity at post-treatment, even after controlling for initial PTSD. At a 6-month follow-up, internal LOC continued to predict PTSD symptom severity. In addition, repeated-measures analyses of variance revealed that, relative to older adults with low internal LOC and PTG, older adults with high internal LOC and PTG, respectively, did not differ with respect to initial PTSD severity, but they showed a more pronounced response to treatment. These findings suggest that greater locus of control and post-traumatic growth is associated with greater improvement in PTSD symptoms following Internet-based CBT. Assessment of these constructs may be useful in identifying trauma survivors who are most likely to respond to CBT. Greater internal locus of control and post-traumatic growth is associated with greater improvement in PTSD symptoms following Internet-based CBT. Older adults with initial high internal locus of control and post-traumatic growth, respectively, did not differ with respect to initial PTSD severity, but they showed a more pronounced response to treatment. It could be assumed that patients with initial functional appraisals could benefit easier and faster from a trauma-focused cognitive-behavioural therapy compared to

  3. Modelling the predictive performance of credit scoring

    Directory of Open Access Journals (Sweden)

    Shi-Wei Shen

    2013-07-01

    Research purpose: The purpose of this empirical paper was to examine the predictive performance of credit scoring systems in Taiwan. Motivation for the study: Corporate lending remains a major business line for financial institutions. However, in light of the recent global financial crises, it has become extremely important for financial institutions to implement rigorous means of assessing clients seeking access to credit facilities. Research design, approach and method: Using a data sample of 10 349 observations drawn between 1992 and 2010, logistic regression models were utilised to examine the predictive performance of credit scoring systems. Main findings: A test of Goodness of fit demonstrated that credit scoring models that incorporated the Taiwan Corporate Credit Risk Index (TCRI, micro- and also macroeconomic variables possessed greater predictive power. This suggests that macroeconomic variables do have explanatory power for default credit risk. Practical/managerial implications: The originality in the study was that three models were developed to predict corporate firms’ defaults based on different microeconomic and macroeconomic factors such as the TCRI, asset growth rates, stock index and gross domestic product. Contribution/value-add: The study utilises different goodness of fits and receiver operator characteristics during the examination of the robustness of the predictive power of these factors.

  4. Lumbar spondylosis, lumbar spinal stenosis, knee pain, back muscle strength are associated with the locomotive syndrome: Rural population study in Japan.

    Science.gov (United States)

    Chiba, Daisuke; Tsuda, Eiichi; Wada, Kanichiro; Kumagai, Gentaro; Sasaki, Eiji; Nawata, Atsushi; Nakagomi, Sho; Takahashi, Ippei; Nakaji, Shigeyuki; Ishibashi, Yasuyuki

    2016-05-01

    To comprehensively investigate the clinical and physical factors associating with locomotive syndrome (Loc-S); the locomotorium-disability for daily life. 647 volunteers participated (247 males, 400 females, Age: 58.4 ± 11.0, BMI: 22.5 ± 3.3). Three self-assessment questionnaires were administered: 1) "25-question Geriatric Locomotive Function Scale" (GFLS-25) for evaluating Loc-S (GLFS-25 ≥ 16 defined as Loc-S); 2) "diagnostic support tool for LSS" (LSS-DST) for evaluating the prevalence of lumbar spinal stenosis (LSS); 3) Knee injury and Osteoarthritis Outcome Score (KOOS). Plain radiographs of the bilateral knees and lumbar spine were evaluated, and the severity of lumbar spondylosis (LS) and knee osteoarthritis (KOA) defined by Kellgren-Lawrence grade. Bone status was evaluated by using the osteo-sono assessment index (OSI) at the calcaneus. Isometric muscle strength of trunk and leg (Nm/kg, both extension and flexion) were evaluated. Linear regression analysis was performed to elucidate the factors concerned with GFLS-25 including age, sex, and BMI. Thirty-nine subjects (6.0%, 13 males, 26 females) were defined as having Loc-S. Single regression model showed that age, height, BMI, skeletal muscle mass, OSI, LSS, KOOS, the severity of LS and KOA, and trunk- and leg-muscle strength were correlated with the degree of GLFS-25. Stepwise multiple regression model showed that sex, height, LSS, KOOS, the severity of LS, and back muscle strength were significantly correlated with that of GLFS-25. In this cross-sectional study, pain status associated with LSS and knee joint, structural severity for LS, and back muscle strength primarily affected the degree of GFLS-25. For managing Loc-S, we must pay more intensive attention to these factors. Copyright © 2016 The Japanese Orthopaedic Association. Published by Elsevier B.V. All rights reserved.

  5. A predictive pilot model for STOL aircraft landing

    Science.gov (United States)

    Kleinman, D. L.; Killingsworth, W. R.

    1974-01-01

    An optimal control approach has been used to model pilot performance during STOL flare and landing. The model is used to predict pilot landing performance for three STOL configurations, each having a different level of automatic control augmentation. Model predictions are compared with flight simulator data. It is concluded that the model can be effective design tool for studying analytically the effects of display modifications, different stability augmentation systems, and proposed changes in the landing area geometry.

  6. PSO-MISMO modeling strategy for multistep-ahead time series prediction.

    Science.gov (United States)

    Bao, Yukun; Xiong, Tao; Hu, Zhongyi

    2014-05-01

    Multistep-ahead time series prediction is one of the most challenging research topics in the field of time series modeling and prediction, and is continually under research. Recently, the multiple-input several multiple-outputs (MISMO) modeling strategy has been proposed as a promising alternative for multistep-ahead time series prediction, exhibiting advantages compared with the two currently dominating strategies, the iterated and the direct strategies. Built on the established MISMO strategy, this paper proposes a particle swarm optimization (PSO)-based MISMO modeling strategy, which is capable of determining the number of sub-models in a self-adaptive mode, with varying prediction horizons. Rather than deriving crisp divides with equal-size s prediction horizons from the established MISMO, the proposed PSO-MISMO strategy, implemented with neural networks, employs a heuristic to create flexible divides with varying sizes of prediction horizons and to generate corresponding sub-models, providing considerable flexibility in model construction, which has been validated with simulated and real datasets.

  7. Comparison of pause predictions of two sequence-dependent transcription models

    International Nuclear Information System (INIS)

    Bai, Lu; Wang, Michelle D

    2010-01-01

    Two recent theoretical models, Bai et al (2004, 2007) and Tadigotla et al (2006), formulated thermodynamic explanations of sequence-dependent transcription pausing by RNA polymerase (RNAP). The two models differ in some basic assumptions and therefore make different yet overlapping predictions for pause locations, and different predictions on pause kinetics and mechanisms. Here we present a comprehensive comparison of the two models. We show that while they have comparable predictive power of pause locations at low NTP concentrations, the Bai et al model is more accurate than Tadigotla et al at higher NTP concentrations. The pausing kinetics predicted by Bai et al is also consistent with time-course transcription reactions, while Tadigotla et al is unsuited for this type of kinetic prediction. More importantly, the two models in general predict different pausing mechanisms even for the same pausing sites, and the Bai et al model provides an explanation more consistent with recent single molecule observations

  8. Questioning the Faith - Models and Prediction in Stream Restoration (Invited)

    Science.gov (United States)

    Wilcock, P.

    2013-12-01

    River management and restoration demand prediction at and beyond our present ability. Management questions, framed appropriately, can motivate fundamental advances in science, although the connection between research and application is not always easy, useful, or robust. Why is that? This presentation considers the connection between models and management, a connection that requires critical and creative thought on both sides. Essential challenges for managers include clearly defining project objectives and accommodating uncertainty in any model prediction. Essential challenges for the research community include matching the appropriate model to project duration, space, funding, information, and social constraints and clearly presenting answers that are actually useful to managers. Better models do not lead to better management decisions or better designs if the predictions are not relevant to and accepted by managers. In fact, any prediction may be irrelevant if the need for prediction is not recognized. The predictive target must be developed in an active dialog between managers and modelers. This relationship, like any other, can take time to develop. For example, large segments of stream restoration practice have remained resistant to models and prediction because the foundational tenet - that channels built to a certain template will be able to transport the supplied sediment with the available flow - has no essential physical connection between cause and effect. Stream restoration practice can be steered in a predictive direction in which project objectives are defined as predictable attributes and testable hypotheses. If stream restoration design is defined in terms of the desired performance of the channel (static or dynamic, sediment surplus or deficit), then channel properties that provide these attributes can be predicted and a basis exists for testing approximations, models, and predictions.

  9. Qualitative and quantitative guidelines for the comparison of environmental model predictions

    International Nuclear Information System (INIS)

    Scott, M.

    1995-03-01

    The question of how to assess or compare predictions from a number of models is one of concern in the validation of models, in understanding the effects of different models and model parameterizations on model output, and ultimately in assessing model reliability. Comparison of model predictions with observed data is the basic tool of model validation while comparison of predictions amongst different models provides one measure of model credibility. The guidance provided here is intended to provide qualitative and quantitative approaches (including graphical and statistical techniques) to such comparisons for use within the BIOMOVS II project. It is hoped that others may find it useful. It contains little technical information on the actual methods but several references are provided for the interested reader. The guidelines are illustrated on data from the VAMP CB scenario. Unfortunately, these data do not permit all of the possible approaches to be demonstrated since predicted uncertainties were not provided. The questions considered are concerned with a) intercomparison of model predictions and b) comparison of model predictions with the observed data. A series of examples illustrating some of the different types of data structure and some possible analyses have been constructed. A bibliography of references on model validation is provided. It is important to note that the results of the various techniques discussed here, whether qualitative or quantitative, should not be considered in isolation. Overall model performance must also include an evaluation of model structure and formulation, i.e. conceptual model uncertainties, and results for performance measures must be interpreted in this context. Consider a number of models which are used to provide predictions of a number of quantities at a number of time points. In the case of the VAMP CB scenario, the results include predictions of total deposition of Cs-137 and time dependent concentrations in various

  10. Evaluation of wave runup predictions from numerical and parametric models

    Science.gov (United States)

    Stockdon, Hilary F.; Thompson, David M.; Plant, Nathaniel G.; Long, Joseph W.

    2014-01-01

    Wave runup during storms is a primary driver of coastal evolution, including shoreline and dune erosion and barrier island overwash. Runup and its components, setup and swash, can be predicted from a parameterized model that was developed by comparing runup observations to offshore wave height, wave period, and local beach slope. Because observations during extreme storms are often unavailable, a numerical model is used to simulate the storm-driven runup to compare to the parameterized model and then develop an approach to improve the accuracy of the parameterization. Numerically simulated and parameterized runup were compared to observations to evaluate model accuracies. The analysis demonstrated that setup was accurately predicted by both the parameterized model and numerical simulations. Infragravity swash heights were most accurately predicted by the parameterized model. The numerical model suffered from bias and gain errors that depended on whether a one-dimensional or two-dimensional spatial domain was used. Nonetheless, all of the predictions were significantly correlated to the observations, implying that the systematic errors can be corrected. The numerical simulations did not resolve the incident-band swash motions, as expected, and the parameterized model performed best at predicting incident-band swash heights. An assimilated prediction using a weighted average of the parameterized model and the numerical simulations resulted in a reduction in prediction error variance. Finally, the numerical simulations were extended to include storm conditions that have not been previously observed. These results indicated that the parameterized predictions of setup may need modification for extreme conditions; numerical simulations can be used to extend the validity of the parameterized predictions of infragravity swash; and numerical simulations systematically underpredict incident swash, which is relatively unimportant under extreme conditions.

  11. Predictive models for PEM-electrolyzer performance using adaptive neuro-fuzzy inference systems

    Energy Technology Data Exchange (ETDEWEB)

    Becker, Steffen [University of Tasmania, Hobart 7001, Tasmania (Australia); Karri, Vishy [Australian College of Kuwait (Kuwait)

    2010-09-15

    Predictive models were built using neural network based Adaptive Neuro-Fuzzy Inference Systems for hydrogen flow rate, electrolyzer system-efficiency and stack-efficiency respectively. A comprehensive experimental database forms the foundation for the predictive models. It is argued that, due to the high costs associated with the hydrogen measuring equipment; these reliable predictive models can be implemented as virtual sensors. These models can also be used on-line for monitoring and safety of hydrogen equipment. The quantitative accuracy of the predictive models is appraised using statistical techniques. These mathematical models are found to be reliable predictive tools with an excellent accuracy of {+-}3% compared with experimental values. The predictive nature of these models did not show any significant bias to either over prediction or under prediction. These predictive models, built on a sound mathematical and quantitative basis, can be seen as a step towards establishing hydrogen performance prediction models as generic virtual sensors for wider safety and monitoring applications. (author)

  12. State-space prediction model for chaotic time series

    Science.gov (United States)

    Alparslan, A. K.; Sayar, M.; Atilgan, A. R.

    1998-08-01

    A simple method for predicting the continuation of scalar chaotic time series ahead in time is proposed. The false nearest neighbors technique in connection with the time-delayed embedding is employed so as to reconstruct the state space. A local forecasting model based upon the time evolution of the topological neighboring in the reconstructed phase space is suggested. A moving root-mean-square error is utilized in order to monitor the error along the prediction horizon. The model is tested for the convection amplitude of the Lorenz model. The results indicate that for approximately 100 cycles of the training data, the prediction follows the actual continuation very closely about six cycles. The proposed model, like other state-space forecasting models, captures the long-term behavior of the system due to the use of spatial neighbors in the state space.

  13. A new, accurate predictive model for incident hypertension.

    Science.gov (United States)

    Völzke, Henry; Fung, Glenn; Ittermann, Till; Yu, Shipeng; Baumeister, Sebastian E; Dörr, Marcus; Lieb, Wolfgang; Völker, Uwe; Linneberg, Allan; Jørgensen, Torben; Felix, Stephan B; Rettig, Rainer; Rao, Bharat; Kroemer, Heyo K

    2013-11-01

    Data mining represents an alternative approach to identify new predictors of multifactorial diseases. This work aimed at building an accurate predictive model for incident hypertension using data mining procedures. The primary study population consisted of 1605 normotensive individuals aged 20-79 years with 5-year follow-up from the population-based study, that is the Study of Health in Pomerania (SHIP). The initial set was randomly split into a training and a testing set. We used a probabilistic graphical model applying a Bayesian network to create a predictive model for incident hypertension and compared the predictive performance with the established Framingham risk score for hypertension. Finally, the model was validated in 2887 participants from INTER99, a Danish community-based intervention study. In the training set of SHIP data, the Bayesian network used a small subset of relevant baseline features including age, mean arterial pressure, rs16998073, serum glucose and urinary albumin concentrations. Furthermore, we detected relevant interactions between age and serum glucose as well as between rs16998073 and urinary albumin concentrations [area under the receiver operating characteristic (AUC 0.76)]. The model was confirmed in the SHIP validation set (AUC 0.78) and externally replicated in INTER99 (AUC 0.77). Compared to the established Framingham risk score for hypertension, the predictive performance of the new model was similar in the SHIP validation set and moderately better in INTER99. Data mining procedures identified a predictive model for incident hypertension, which included innovative and easy-to-measure variables. The findings promise great applicability in screening settings and clinical practice.

  14. Cure modeling in real-time prediction: How much does it help?

    Science.gov (United States)

    Ying, Gui-Shuang; Zhang, Qiang; Lan, Yu; Li, Yimei; Heitjan, Daniel F

    2017-08-01

    Various parametric and nonparametric modeling approaches exist for real-time prediction in time-to-event clinical trials. Recently, Chen (2016 BMC Biomedical Research Methodology 16) proposed a prediction method based on parametric cure-mixture modeling, intending to cover those situations where it appears that a non-negligible fraction of subjects is cured. In this article we apply a Weibull cure-mixture model to create predictions, demonstrating the approach in RTOG 0129, a randomized trial in head-and-neck cancer. We compare the ultimate realized data in RTOG 0129 to interim predictions from a Weibull cure-mixture model, a standard Weibull model without a cure component, and a nonparametric model based on the Bayesian bootstrap. The standard Weibull model predicted that events would occur earlier than the Weibull cure-mixture model, but the difference was unremarkable until late in the trial when evidence for a cure became clear. Nonparametric predictions often gave undefined predictions or infinite prediction intervals, particularly at early stages of the trial. Simulations suggest that cure modeling can yield better-calibrated prediction intervals when there is a cured component, or the appearance of a cured component, but at a substantial cost in the average width of the intervals. Copyright © 2017 Elsevier Inc. All rights reserved.

  15. Evaluation of burst pressure prediction models for line pipes

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Xian-Kui, E-mail: zhux@battelle.org [Battelle Memorial Institute, 505 King Avenue, Columbus, OH 43201 (United States); Leis, Brian N. [Battelle Memorial Institute, 505 King Avenue, Columbus, OH 43201 (United States)

    2012-01-15

    Accurate prediction of burst pressure plays a central role in engineering design and integrity assessment of oil and gas pipelines. Theoretical and empirical solutions for such prediction are evaluated in this paper relative to a burst pressure database comprising more than 100 tests covering a variety of pipeline steel grades and pipe sizes. Solutions considered include three based on plasticity theory for the end-capped, thin-walled, defect-free line pipe subjected to internal pressure in terms of the Tresca, von Mises, and ZL (or Zhu-Leis) criteria, one based on a cylindrical instability stress (CIS) concept, and a large group of analytical and empirical models previously evaluated by Law and Bowie (International Journal of Pressure Vessels and Piping, 84, 2007: 487-492). It is found that these models can be categorized into either a Tresca-family or a von Mises-family of solutions, except for those due to Margetson and Zhu-Leis models. The viability of predictions is measured via statistical analyses in terms of a mean error and its standard deviation. Consistent with an independent parallel evaluation using another large database, the Zhu-Leis solution is found best for predicting burst pressure, including consideration of strain hardening effects, while the Tresca strength solutions including Barlow, Maximum shear stress, Turner, and the ASME boiler code provide reasonably good predictions for the class of line-pipe steels with intermediate strain hardening response. - Highlights: Black-Right-Pointing-Pointer This paper evaluates different burst pressure prediction models for line pipes. Black-Right-Pointing-Pointer The existing models are categorized into two major groups of Tresca and von Mises solutions. Black-Right-Pointing-Pointer Prediction quality of each model is assessed statistically using a large full-scale burst test database. Black-Right-Pointing-Pointer The Zhu-Leis solution is identified as the best predictive model.

  16. Evaluation of burst pressure prediction models for line pipes

    International Nuclear Information System (INIS)

    Zhu, Xian-Kui; Leis, Brian N.

    2012-01-01

    Accurate prediction of burst pressure plays a central role in engineering design and integrity assessment of oil and gas pipelines. Theoretical and empirical solutions for such prediction are evaluated in this paper relative to a burst pressure database comprising more than 100 tests covering a variety of pipeline steel grades and pipe sizes. Solutions considered include three based on plasticity theory for the end-capped, thin-walled, defect-free line pipe subjected to internal pressure in terms of the Tresca, von Mises, and ZL (or Zhu-Leis) criteria, one based on a cylindrical instability stress (CIS) concept, and a large group of analytical and empirical models previously evaluated by Law and Bowie (International Journal of Pressure Vessels and Piping, 84, 2007: 487–492). It is found that these models can be categorized into either a Tresca-family or a von Mises-family of solutions, except for those due to Margetson and Zhu-Leis models. The viability of predictions is measured via statistical analyses in terms of a mean error and its standard deviation. Consistent with an independent parallel evaluation using another large database, the Zhu-Leis solution is found best for predicting burst pressure, including consideration of strain hardening effects, while the Tresca strength solutions including Barlow, Maximum shear stress, Turner, and the ASME boiler code provide reasonably good predictions for the class of line-pipe steels with intermediate strain hardening response. - Highlights: ► This paper evaluates different burst pressure prediction models for line pipes. ► The existing models are categorized into two major groups of Tresca and von Mises solutions. ► Prediction quality of each model is assessed statistically using a large full-scale burst test database. ► The Zhu-Leis solution is identified as the best predictive model.

  17. Hidden Markov Model for quantitative prediction of snowfall

    Indian Academy of Sciences (India)

    A Hidden Markov Model (HMM) has been developed for prediction of quantitative snowfall in Pir-Panjal and Great Himalayan mountain ranges of Indian Himalaya. The model predicts snowfall for two days in advance using daily recorded nine meteorological variables of past 20 winters from 1992–2012. There are six ...

  18. Predictive Models and Computational Embryology

    Science.gov (United States)

    EPA’s ‘virtual embryo’ project is building an integrative systems biology framework for predictive models of developmental toxicity. One schema involves a knowledge-driven adverse outcome pathway (AOP) framework utilizing information from public databases, standardized ontologies...

  19. Predicting acid dew point with a semi-empirical model

    International Nuclear Information System (INIS)

    Xiang, Baixiang; Tang, Bin; Wu, Yuxin; Yang, Hairui; Zhang, Man; Lu, Junfu

    2016-01-01

    Highlights: • The previous semi-empirical models are systematically studied. • An improved thermodynamic correlation is derived. • A semi-empirical prediction model is proposed. • The proposed semi-empirical model is validated. - Abstract: Decreasing the temperature of exhaust flue gas in boilers is one of the most effective ways to further improve the thermal efficiency, electrostatic precipitator efficiency and to decrease the water consumption of desulfurization tower, while, when this temperature is below the acid dew point, the fouling and corrosion will occur on the heating surfaces in the second pass of boilers. So, the knowledge on accurately predicting the acid dew point is essential. By investigating the previous models on acid dew point prediction, an improved thermodynamic correlation formula between the acid dew point and its influencing factors is derived first. And then, a semi-empirical prediction model is proposed, which is validated with the data both in field test and experiment, and comparing with the previous models.

  20. An updated PREDICT breast cancer prognostication and treatment benefit prediction model with independent validation.

    Science.gov (United States)

    Candido Dos Reis, Francisco J; Wishart, Gordon C; Dicks, Ed M; Greenberg, David; Rashbass, Jem; Schmidt, Marjanka K; van den Broek, Alexandra J; Ellis, Ian O; Green, Andrew; Rakha, Emad; Maishman, Tom; Eccles, Diana M; Pharoah, Paul D P

    2017-05-22

    PREDICT is a breast cancer prognostic and treatment benefit model implemented online. The overall fit of the model has been good in multiple independent case series, but PREDICT has been shown to underestimate breast cancer specific mortality in women diagnosed under the age of 40. Another limitation is the use of discrete categories for tumour size and node status resulting in 'step' changes in risk estimates on moving between categories. We have refitted the PREDICT prognostic model using the original cohort of cases from East Anglia with updated survival time in order to take into account age at diagnosis and to smooth out the survival function for tumour size and node status. Multivariable Cox regression models were used to fit separate models for ER negative and ER positive disease. Continuous variables were fitted using fractional polynomials and a smoothed baseline hazard was obtained by regressing the baseline cumulative hazard for each patients against time using fractional polynomials. The fit of the prognostic models were then tested in three independent data sets that had also been used to validate the original version of PREDICT. In the model fitting data, after adjusting for other prognostic variables, there is an increase in risk of breast cancer specific mortality in younger and older patients with ER positive disease, with a substantial increase in risk for women diagnosed before the age of 35. In ER negative disease the risk increases slightly with age. The association between breast cancer specific mortality and both tumour size and number of positive nodes was non-linear with a more marked increase in risk with increasing size and increasing number of nodes in ER positive disease. The overall calibration and discrimination of the new version of PREDICT (v2) was good and comparable to that of the previous version in both model development and validation data sets. However, the calibration of v2 improved over v1 in patients diagnosed under the age

  1. Comparison of Predictive Modeling Methods of Aircraft Landing Speed

    Science.gov (United States)

    Diallo, Ousmane H.

    2012-01-01

    Expected increases in air traffic demand have stimulated the development of air traffic control tools intended to assist the air traffic controller in accurately and precisely spacing aircraft landing at congested airports. Such tools will require an accurate landing-speed prediction to increase throughput while decreasing necessary controller interventions for avoiding separation violations. There are many practical challenges to developing an accurate landing-speed model that has acceptable prediction errors. This paper discusses the development of a near-term implementation, using readily available information, to estimate/model final approach speed from the top of the descent phase of flight to the landing runway. As a first approach, all variables found to contribute directly to the landing-speed prediction model are used to build a multi-regression technique of the response surface equation (RSE). Data obtained from operations of a major airlines for a passenger transport aircraft type to the Dallas/Fort Worth International Airport are used to predict the landing speed. The approach was promising because it decreased the standard deviation of the landing-speed error prediction by at least 18% from the standard deviation of the baseline error, depending on the gust condition at the airport. However, when the number of variables is reduced to the most likely obtainable at other major airports, the RSE model shows little improvement over the existing methods. Consequently, a neural network that relies on a nonlinear regression technique is utilized as an alternative modeling approach. For the reduced number of variables cases, the standard deviation of the neural network models errors represent over 5% reduction compared to the RSE model errors, and at least 10% reduction over the baseline predicted landing-speed error standard deviation. Overall, the constructed models predict the landing-speed more accurately and precisely than the current state-of-the-art.

  2. Comparison of Linear Prediction Models for Audio Signals

    Directory of Open Access Journals (Sweden)

    2009-03-01

    Full Text Available While linear prediction (LP has become immensely popular in speech modeling, it does not seem to provide a good approach for modeling audio signals. This is somewhat surprising, since a tonal signal consisting of a number of sinusoids can be perfectly predicted based on an (all-pole LP model with a model order that is twice the number of sinusoids. We provide an explanation why this result cannot simply be extrapolated to LP of audio signals. If noise is taken into account in the tonal signal model, a low-order all-pole model appears to be only appropriate when the tonal components are uniformly distributed in the Nyquist interval. Based on this observation, different alternatives to the conventional LP model can be suggested. Either the model should be changed to a pole-zero, a high-order all-pole, or a pitch prediction model, or the conventional LP model should be preceded by an appropriate frequency transform, such as a frequency warping or downsampling. By comparing these alternative LP models to the conventional LP model in terms of frequency estimation accuracy, residual spectral flatness, and perceptual frequency resolution, we obtain several new and promising approaches to LP-based audio modeling.

  3. Auditing predictive models : a case study in crop growth

    NARCIS (Netherlands)

    Metselaar, K.

    1999-01-01

    Methods were developed to assess and quantify the predictive quality of simulation models, with the intent to contribute to evaluation of model studies by non-scientists. In a case study, two models of different complexity, LINTUL and SUCROS87, were used to predict yield of forage maize

  4. Models for predicting compressive strength and water absorption of ...

    African Journals Online (AJOL)

    This work presents a mathematical model for predicting the compressive strength and water absorption of laterite-quarry dust cement block using augmented Scheffe's simplex lattice design. The statistical models developed can predict the mix proportion that will yield the desired property. The models were tested for lack of ...

  5. Numerical weather prediction (NWP) and hybrid ARMA/ANN model to predict global radiation

    International Nuclear Information System (INIS)

    Voyant, Cyril; Muselli, Marc; Paoli, Christophe; Nivet, Marie-Laure

    2012-01-01

    We propose in this paper an original technique to predict global radiation using a hybrid ARMA/ANN model and data issued from a numerical weather prediction model (NWP). We particularly look at the multi-layer perceptron (MLP). After optimizing our architecture with NWP and endogenous data previously made stationary and using an innovative pre-input layer selection method, we combined it to an ARMA model from a rule based on the analysis of hourly data series. This model has been used to forecast the hourly global radiation for five places in Mediterranean area. Our technique outperforms classical models for all the places. The nRMSE for our hybrid model MLP/ARMA is 14.9% compared to 26.2% for the naïve persistence predictor. Note that in the standalone ANN case the nRMSE is 18.4%. Finally, in order to discuss the reliability of the forecaster outputs, a complementary study concerning the confidence interval of each prediction is proposed. -- Highlights: ► Time series forecasting with hybrid method based on the use of ALADIN numerical weather model, ANN and ARMA. ► Innovative pre-input layer selection method. ► Combination of optimized MLP and ARMA model obtained from a rule based on the analysis of hourly data series. ► Stationarity process (method and control) for the global radiation time series.

  6. An intermittency model for predicting roughness induced transition

    Science.gov (United States)

    Ge, Xuan; Durbin, Paul

    2014-11-01

    An extended model for roughness-induced transition is proposed based on an intermittency transport equation for RANS modeling formulated in local variables. To predict roughness effects in the fully turbulent boundary layer, published boundary conditions for k and ω are used, which depend on the equivalent sand grain roughness height, and account for the effective displacement of wall distance origin. Similarly in our approach, wall distance in the transition model for smooth surfaces is modified by an effective origin, which depends on roughness. Flat plate test cases are computed to show that the proposed model is able to predict the transition onset in agreement with a data correlation of transition location versus roughness height, Reynolds number, and inlet turbulence intensity. Experimental data for a turbine cascade are compared with the predicted results to validate the applicability of the proposed model. Supported by NSF Award Number 1228195.

  7. Prediction-error variance in Bayesian model updating: a comparative study

    Science.gov (United States)

    Asadollahi, Parisa; Li, Jian; Huang, Yong

    2017-04-01

    In Bayesian model updating, the likelihood function is commonly formulated by stochastic embedding in which the maximum information entropy probability model of prediction error variances plays an important role and it is Gaussian distribution subject to the first two moments as constraints. The selection of prediction error variances can be formulated as a model class selection problem, which automatically involves a trade-off between the average data-fit of the model class and the information it extracts from the data. Therefore, it is critical for the robustness in the updating of the structural model especially in the presence of modeling errors. To date, three ways of considering prediction error variances have been seem in the literature: 1) setting constant values empirically, 2) estimating them based on the goodness-of-fit of the measured data, and 3) updating them as uncertain parameters by applying Bayes' Theorem at the model class level. In this paper, the effect of different strategies to deal with the prediction error variances on the model updating performance is investigated explicitly. A six-story shear building model with six uncertain stiffness parameters is employed as an illustrative example. Transitional Markov Chain Monte Carlo is used to draw samples of the posterior probability density function of the structure model parameters as well as the uncertain prediction variances. The different levels of modeling uncertainty and complexity are modeled through three FE models, including a true model, a model with more complexity, and a model with modeling error. Bayesian updating is performed for the three FE models considering the three aforementioned treatments of the prediction error variances. The effect of number of measurements on the model updating performance is also examined in the study. The results are compared based on model class assessment and indicate that updating the prediction error variances as uncertain parameters at the model

  8. Modeling of Complex Life Cycle Prediction Based on Cell Division

    Directory of Open Access Journals (Sweden)

    Fucheng Zhang

    2017-01-01

    Full Text Available Effective fault diagnosis and reasonable life expectancy are of great significance and practical engineering value for the safety, reliability, and maintenance cost of equipment and working environment. At present, the life prediction methods of the equipment are equipment life prediction based on condition monitoring, combined forecasting model, and driven data. Most of them need to be based on a large amount of data to achieve the problem. For this issue, we propose learning from the mechanism of cell division in the organism. We have established a moderate complexity of life prediction model across studying the complex multifactor correlation life model. In this paper, we model the life prediction of cell division. Experiments show that our model can effectively simulate the state of cell division. Through the model of reference, we will use it for the equipment of the complex life prediction.

  9. Prediction models and control algorithms for predictive applications of setback temperature in cooling systems

    International Nuclear Information System (INIS)

    Moon, Jin Woo; Yoon, Younju; Jeon, Young-Hoon; Kim, Sooyoung

    2017-01-01

    Highlights: • Initial ANN model was developed for predicting the time to the setback temperature. • Initial model was optimized for producing accurate output. • Optimized model proved its prediction accuracy. • ANN-based algorithms were developed and tested their performance. • ANN-based algorithms presented superior thermal comfort or energy efficiency. - Abstract: In this study, a temperature control algorithm was developed to apply a setback temperature predictively for the cooling system of a residential building during occupied periods by residents. An artificial neural network (ANN) model was developed to determine the required time for increasing the current indoor temperature to the setback temperature. This study involved three phases: development of the initial ANN-based prediction model, optimization and testing of the initial model, and development and testing of three control algorithms. The development and performance testing of the model and algorithm were conducted using TRNSYS and MATLAB. Through the development and optimization process, the final ANN model employed indoor temperature and the temperature difference between the current and target setback temperature as two input neurons. The optimal number of hidden layers, number of neurons, learning rate, and moment were determined to be 4, 9, 0.6, and 0.9, respectively. The tangent–sigmoid and pure-linear transfer function was used in the hidden and output neurons, respectively. The ANN model used 100 training data sets with sliding-window method for data management. Levenberg-Marquart training method was employed for model training. The optimized model had a prediction accuracy of 0.9097 root mean square errors when compared with the simulated results. Employing the ANN model, ANN-based algorithms maintained indoor temperatures better within target ranges. Compared to the conventional algorithm, the ANN-based algorithms reduced the duration of time, in which the indoor temperature

  10. Error analysis in predictive modelling demonstrated on mould data.

    Science.gov (United States)

    Baranyi, József; Csernus, Olívia; Beczner, Judit

    2014-01-17

    The purpose of this paper was to develop a predictive model for the effect of temperature and water activity on the growth rate of Aspergillus niger and to determine the sources of the error when the model is used for prediction. Parallel mould growth curves, derived from the same spore batch, were generated and fitted to determine their growth rate. The variances of replicate ln(growth-rate) estimates were used to quantify the experimental variability, inherent to the method of determining the growth rate. The environmental variability was quantified by the variance of the respective means of replicates. The idea is analogous to the "within group" and "between groups" variability concepts of ANOVA procedures. A (secondary) model, with temperature and water activity as explanatory variables, was fitted to the natural logarithm of the growth rates determined by the primary model. The model error and the experimental and environmental errors were ranked according to their contribution to the total error of prediction. Our method can readily be applied to analysing the error structure of predictive models of bacterial growth models, too. © 2013.

  11. Tilt testing results are influenced by tilt protocol.

    Science.gov (United States)

    Zyśko, Dorota; Fedorowski, Artur; Nilsson, David; Rudnicki, Jerzy; Gajek, Jacek; Melander, Olle; Sutton, Richard

    2016-07-01

    It is unknown how the return to supine position influences duration of loss of consciousness (LOC) and cardioinhibition during tilt test. Retrospective analysis of two datasets containing records of patients who underwent tilt testing for unexplained syncope in two centres was performed. Patients, totalling 1232, were included in the study: 262 in a Swedish centre and 970 patients in a Polish centre. In Sweden, tilt table with tilt-down time (TDT) of 18 s was used (Group II). In Poland, two different tilt tables were used, one of them with TDT of 10 s (Group I, n = 325), and the other with TDT of 47 s (Group III, n = 645). Cardioinhibitory reflex occurred most frequently in Group III, whereas number of pauses >3 s, frequency of very long asystole ≥30 s, and the total duration of pauses >3 s demonstrated a trend to increase from Group I to III. Duration of LOC in Groups II and III was significantly longer compared with Group I (32.0 and 33.7 s vs. 16.4 s). In the multivariate-adjusted regression model, cardioinhibitory reflex was predicted by tilt-table model (odds ratio per model with increasing TDT: 1.40; 95% confidence interval, 1.19-1.64; P < 0.0001), whereas LOC duration was longer with increasing TDT (P < 0.0001) and age (P < 0.0001). Longer TDT during induced vasovagal syncope increases the prevalence of cardioinhibitory reflex and prolongs the duration of LOC. Tilt-down time does not affect asystolic pause duration but delay may lead to occurrence of multiple pauses, higher frequency of very long asystole, and longer total asystole duration. Published on behalf of the European Society of Cardiology. All rights reserved. © The Author 2015. For permissions please email: journals.permissions@oup.com.

  12. Predicting Power Outages Using Multi-Model Ensemble Forecasts

    Science.gov (United States)

    Cerrai, D.; Anagnostou, E. N.; Yang, J.; Astitha, M.

    2017-12-01

    Power outages affect every year millions of people in the United States, affecting the economy and conditioning the everyday life. An Outage Prediction Model (OPM) has been developed at the University of Connecticut for helping utilities to quickly restore outages and to limit their adverse consequences on the population. The OPM, operational since 2015, combines several non-parametric machine learning (ML) models that use historical weather storm simulations and high-resolution weather forecasts, satellite remote sensing data, and infrastructure and land cover data to predict the number and spatial distribution of power outages. A new methodology, developed for improving the outage model performances by combining weather- and soil-related variables using three different weather models (WRF 3.7, WRF 3.8 and RAMS/ICLAMS), will be presented in this study. First, we will present a performance evaluation of each model variable, by comparing historical weather analyses with station data or reanalysis over the entire storm data set. Hence, each variable of the new outage model version is extracted from the best performing weather model for that variable, and sensitivity tests are performed for investigating the most efficient variable combination for outage prediction purposes. Despite that the final variables combination is extracted from different weather models, this ensemble based on multi-weather forcing and multi-statistical model power outage prediction outperforms the currently operational OPM version that is based on a single weather forcing variable (WRF 3.7), because each model component is the closest to the actual atmospheric state.

  13. Acute Myocardial Infarction Readmission Risk Prediction Models: A Systematic Review of Model Performance.

    Science.gov (United States)

    Smith, Lauren N; Makam, Anil N; Darden, Douglas; Mayo, Helen; Das, Sandeep R; Halm, Ethan A; Nguyen, Oanh Kieu

    2018-01-01

    Hospitals are subject to federal financial penalties for excessive 30-day hospital readmissions for acute myocardial infarction (AMI). Prospectively identifying patients hospitalized with AMI at high risk for readmission could help prevent 30-day readmissions by enabling targeted interventions. However, the performance of AMI-specific readmission risk prediction models is unknown. We systematically searched the published literature through March 2017 for studies of risk prediction models for 30-day hospital readmission among adults with AMI. We identified 11 studies of 18 unique risk prediction models across diverse settings primarily in the United States, of which 16 models were specific to AMI. The median overall observed all-cause 30-day readmission rate across studies was 16.3% (range, 10.6%-21.0%). Six models were based on administrative data; 4 on electronic health record data; 3 on clinical hospital data; and 5 on cardiac registry data. Models included 7 to 37 predictors, of which demographics, comorbidities, and utilization metrics were the most frequently included domains. Most models, including the Centers for Medicare and Medicaid Services AMI administrative model, had modest discrimination (median C statistic, 0.65; range, 0.53-0.79). Of the 16 reported AMI-specific models, only 8 models were assessed in a validation cohort, limiting generalizability. Observed risk-stratified readmission rates ranged from 3.0% among the lowest-risk individuals to 43.0% among the highest-risk individuals, suggesting good risk stratification across all models. Current AMI-specific readmission risk prediction models have modest predictive ability and uncertain generalizability given methodological limitations. No existing models provide actionable information in real time to enable early identification and risk-stratification of patients with AMI before hospital discharge, a functionality needed to optimize the potential effectiveness of readmission reduction interventions

  14. A new ensemble model for short term wind power prediction

    DEFF Research Database (Denmark)

    Madsen, Henrik; Albu, Razvan-Daniel; Felea, Ioan

    2012-01-01

    As the objective of this study, a non-linear ensemble system is used to develop a new model for predicting wind speed in short-term time scale. Short-term wind power prediction becomes an extremely important field of research for the energy sector. Regardless of the recent advancements in the re-search...... of prediction models, it was observed that different models have different capabilities and also no single model is suitable under all situations. The idea behind EPS (ensemble prediction systems) is to take advantage of the unique features of each subsystem to detain diverse patterns that exist in the dataset...

  15. A new, accurate predictive model for incident hypertension

    DEFF Research Database (Denmark)

    Völzke, Henry; Fung, Glenn; Ittermann, Till

    2013-01-01

    Data mining represents an alternative approach to identify new predictors of multifactorial diseases. This work aimed at building an accurate predictive model for incident hypertension using data mining procedures.......Data mining represents an alternative approach to identify new predictors of multifactorial diseases. This work aimed at building an accurate predictive model for incident hypertension using data mining procedures....

  16. Domestic appliances energy optimization with model predictive control

    International Nuclear Information System (INIS)

    Rodrigues, E.M.G.; Godina, R.; Pouresmaeil, E.; Ferreira, J.R.; Catalão, J.P.S.

    2017-01-01

    Highlights: • An alternative power management control for home appliances that require thermal regulation is presented. • A Model Predictive Control scheme is assessed and its performance studied and compared to the thermostat. • Problem formulation is explored through tuning weights with the aim of reducing energetic consumption and cost. • A modulation scheme of a two-level Model Predictive Control signal as an interface block is presented. • The implementation costs in home appliances with thermal regulation requirements are reduced. - Abstract: A vital element in making a sustainable world is correctly managing the energy in the domestic sector. Thus, this sector evidently stands as a key one for to be addressed in terms of climate change goals. Increasingly, people are aware of electricity savings by turning off the equipment that is not been used, or connect electrical loads just outside the on-peak hours. However, these few efforts are not enough to reduce the global energy consumption, which is increasing. Much of the reduction was due to technological improvements, however with the advancing of the years new types of control arise. Domestic appliances with the purpose of heating and cooling rely on thermostatic regulation technique. The study in this paper is focused on the subject of an alternative power management control for home appliances that require thermal regulation. In this paper a Model Predictive Control scheme is assessed and its performance studied and compared to the thermostat with the aim of minimizing the cooling energy consumption through the minimization of the energy cost while satisfying the adequate temperature range for the human comfort. In addition, the Model Predictive Control problem formulation is explored through tuning weights with the aim of reducing energetic consumption and cost. For this purpose, the typical consumption of a 24 h period of a summer day was simulated a three-level tariff scheme was used. The new

  17. Predictive, preventive, personalised and participatory periodontology: 'the 5Ps age' has already started.

    Science.gov (United States)

    Cafiero, Carlo; Matarasso, Sergio

    2013-06-14

    An impressive progress in dentistry has been recorded in the last decades. In order to reconsider guidelines in dentistry, it is required to introduce new concepts of personalised patient treatments: the wave of predictive, preventive and personalised medicine is rapidly incoming in dentistry. Worldwide dentists have to make a big cultural effort in changing the actual 'reactive' therapeutic point of view, belonging to the last century, into a futuristic 'predictive' one. The first cause of tooth loss in industrialised world is periodontitis, a Gram-negative anaerobic infection whose pathogenesis is genetically determined and characterised by complex immune reactions. Chairside diagnostic tests based on saliva, gingival crevicular fluid and cell sampling are going to be routinely used by periodontists for a new approach to the diagnosis, monitoring, prognosis and management of periodontal patients. The futuristic '5Ps' (predictive, preventive, personalised and participatory periodontology) focuses on early integrated diagnosis (genetic, microbiology, host-derived biomarker detection) and on the active role of the patient in which networked patients will shift from being mere passengers to responsible drivers of their health. In this paper, we intend to propose five diagnostic levels (high-tech diagnostic tools, genetic susceptibility, bacterial infection, host response factors and tissue breakdown-derived products) to be evaluated with the intention to obtain a clear picture of the vulnerability of a single individual to periodontitis in order to organise patient stratification in different categories of risk. Lab-on-a-chip (LOC) technology may soon become an important part of efforts to improve worldwide periodontal health in developed nations as well as in the underserved communities, resource-poor areas and poor countries. The use of LOC devices for periodontal inspection will allow patients to be screened for periodontal diseases in settings other than the

  18. A state-based probabilistic model for tumor respiratory motion prediction

    International Nuclear Information System (INIS)

    Kalet, Alan; Sandison, George; Schmitz, Ruth; Wu Huanmei

    2010-01-01

    This work proposes a new probabilistic mathematical model for predicting tumor motion and position based on a finite state representation using the natural breathing states of exhale, inhale and end of exhale. Tumor motion was broken down into linear breathing states and sequences of states. Breathing state sequences and the observables representing those sequences were analyzed using a hidden Markov model (HMM) to predict the future sequences and new observables. Velocities and other parameters were clustered using a k-means clustering algorithm to associate each state with a set of observables such that a prediction of state also enables a prediction of tumor velocity. A time average model with predictions based on average past state lengths was also computed. State sequences which are known a priori to fit the data were fed into the HMM algorithm to set a theoretical limit of the predictive power of the model. The effectiveness of the presented probabilistic model has been evaluated for gated radiation therapy based on previously tracked tumor motion in four lung cancer patients. Positional prediction accuracy is compared with actual position in terms of the overall RMS errors. Various system delays, ranging from 33 to 1000 ms, were tested. Previous studies have shown duty cycles for latencies of 33 and 200 ms at around 90% and 80%, respectively, for linear, no prediction, Kalman filter and ANN methods as averaged over multiple patients. At 1000 ms, the previously reported duty cycles range from approximately 62% (ANN) down to 34% (no prediction). Average duty cycle for the HMM method was found to be 100% and 91 ± 3% for 33 and 200 ms latency and around 40% for 1000 ms latency in three out of four breathing motion traces. RMS errors were found to be lower than linear and no prediction methods at latencies of 1000 ms. The results show that for system latencies longer than 400 ms, the time average HMM prediction outperforms linear, no prediction, and the more

  19. SHMF: Interest Prediction Model with Social Hub Matrix Factorization

    Directory of Open Access Journals (Sweden)

    Chaoyuan Cui

    2017-01-01

    Full Text Available With the development of social networks, microblog has become the major social communication tool. There is a lot of valuable information such as personal preference, public opinion, and marketing in microblog. Consequently, research on user interest prediction in microblog has a positive practical significance. In fact, how to extract information associated with user interest orientation from the constantly updated blog posts is not so easy. Existing prediction approaches based on probabilistic factor analysis use blog posts published by user to predict user interest. However, these methods are not very effective for the users who post less but browse more. In this paper, we propose a new prediction model, which is called SHMF, using social hub matrix factorization. SHMF constructs the interest prediction model by combining the information of blogs posts published by both user and direct neighbors in user’s social hub. Our proposed model predicts user interest by integrating user’s historical behavior and temporal factor as well as user’s friendships, thus achieving accurate forecasts of user’s future interests. The experimental results on Sina Weibo show the efficiency and effectiveness of our proposed model.

  20. Development of Interpretable Predictive Models for BPH and Prostate Cancer.

    Science.gov (United States)

    Bermejo, Pablo; Vivo, Alicia; Tárraga, Pedro J; Rodríguez-Montes, J A

    2015-01-01

    Traditional methods for deciding whether to recommend a patient for a prostate biopsy are based on cut-off levels of stand-alone markers such as prostate-specific antigen (PSA) or any of its derivatives. However, in the last decade we have seen the increasing use of predictive models that combine, in a non-linear manner, several predictives that are better able to predict prostate cancer (PC), but these fail to help the clinician to distinguish between PC and benign prostate hyperplasia (BPH) patients. We construct two new models that are capable of predicting both PC and BPH. An observational study was performed on 150 patients with PSA ≥3 ng/mL and age >50 years. We built a decision tree and a logistic regression model, validated with the leave-one-out methodology, in order to predict PC or BPH, or reject both. Statistical dependence with PC and BPH was found for prostate volume (P-value BPH prediction. PSA and volume together help to build predictive models that accurately distinguish among PC, BPH, and patients without any of these pathologies. Our decision tree and logistic regression models outperform the AUC obtained in the compared studies. Using these models as decision support, the number of unnecessary biopsies might be significantly reduced.

  1. Modeling a multivariable reactor and on-line model predictive control.

    Science.gov (United States)

    Yu, D W; Yu, D L

    2005-10-01

    A nonlinear first principle model is developed for a laboratory-scaled multivariable chemical reactor rig in this paper and the on-line model predictive control (MPC) is implemented to the rig. The reactor has three variables-temperature, pH, and dissolved oxygen with nonlinear dynamics-and is therefore used as a pilot system for the biochemical industry. A nonlinear discrete-time model is derived for each of the three output variables and their model parameters are estimated from the real data using an adaptive optimization method. The developed model is used in a nonlinear MPC scheme. An accurate multistep-ahead prediction is obtained for MPC, where the extended Kalman filter is used to estimate system unknown states. The on-line control is implemented and a satisfactory tracking performance is achieved. The MPC is compared with three decentralized PID controllers and the advantage of the nonlinear MPC over the PID is clearly shown.

  2. Plant water potential improves prediction of empirical stomatal models.

    Directory of Open Access Journals (Sweden)

    William R L Anderegg

    Full Text Available Climate change is expected to lead to increases in drought frequency and severity, with deleterious effects on many ecosystems. Stomatal responses to changing environmental conditions form the backbone of all ecosystem models, but are based on empirical relationships and are not well-tested during drought conditions. Here, we use a dataset of 34 woody plant species spanning global forest biomes to examine the effect of leaf water potential on stomatal conductance and test the predictive accuracy of three major stomatal models and a recently proposed model. We find that current leaf-level empirical models have consistent biases of over-prediction of stomatal conductance during dry conditions, particularly at low soil water potentials. Furthermore, the recently proposed stomatal conductance model yields increases in predictive capability compared to current models, and with particular improvement during drought conditions. Our results reveal that including stomatal sensitivity to declining water potential and consequent impairment of plant water transport will improve predictions during drought conditions and show that many biomes contain a diversity of plant stomatal strategies that range from risky to conservative stomatal regulation during water stress. Such improvements in stomatal simulation are greatly needed to help unravel and predict the response of ecosystems to future climate extremes.

  3. eTOXlab, an open source modeling framework for implementing predictive models in production environments.

    Science.gov (United States)

    Carrió, Pau; López, Oriol; Sanz, Ferran; Pastor, Manuel

    2015-01-01

    Computational models based in Quantitative-Structure Activity Relationship (QSAR) methodologies are widely used tools for predicting the biological properties of new compounds. In many instances, such models are used as a routine in the industry (e.g. food, cosmetic or pharmaceutical industry) for the early assessment of the biological properties of new compounds. However, most of the tools currently available for developing QSAR models are not well suited for supporting the whole QSAR model life cycle in production environments. We have developed eTOXlab; an open source modeling framework designed to be used at the core of a self-contained virtual machine that can be easily deployed in production environments, providing predictions as web services. eTOXlab consists on a collection of object-oriented Python modules with methods mapping common tasks of standard modeling workflows. This framework allows building and validating QSAR models as well as predicting the properties of new compounds using either a command line interface or a graphic user interface (GUI). Simple models can be easily generated by setting a few parameters, while more complex models can be implemented by overriding pieces of the original source code. eTOXlab benefits from the object-oriented capabilities of Python for providing high flexibility: any model implemented using eTOXlab inherits the features implemented in the parent model, like common tools and services or the automatic exposure of the models as prediction web services. The particular eTOXlab architecture as a self-contained, portable prediction engine allows building models with confidential information within corporate facilities, which can be safely exported and used for prediction without disclosing the structures of the training series. The software presented here provides full support to the specific needs of users that want to develop, use and maintain predictive models in corporate environments. The technologies used by e

  4. Real estate value prediction using multivariate regression models

    Science.gov (United States)

    Manjula, R.; Jain, Shubham; Srivastava, Sharad; Rajiv Kher, Pranav

    2017-11-01

    The real estate market is one of the most competitive in terms of pricing and the same tends to vary significantly based on a lot of factors, hence it becomes one of the prime fields to apply the concepts of machine learning to optimize and predict the prices with high accuracy. Therefore in this paper, we present various important features to use while predicting housing prices with good accuracy. We have described regression models, using various features to have lower Residual Sum of Squares error. While using features in a regression model some feature engineering is required for better prediction. Often a set of features (multiple regressions) or polynomial regression (applying a various set of powers in the features) is used for making better model fit. For these models are expected to be susceptible towards over fitting ridge regression is used to reduce it. This paper thus directs to the best application of regression models in addition to other techniques to optimize the result.

  5. A COMPARISON BETWEEN THREE PREDICTIVE MODELS OF COMPUTATIONAL INTELLIGENCE

    Directory of Open Access Journals (Sweden)

    DUMITRU CIOBANU

    2013-12-01

    Full Text Available Time series prediction is an open problem and many researchers are trying to find new predictive methods and improvements for the existing ones. Lately methods based on neural networks are used extensively for time series prediction. Also, support vector machines have solved some of the problems faced by neural networks and they began to be widely used for time series prediction. The main drawback of those two methods is that they are global models and in the case of a chaotic time series it is unlikely to find such model. In this paper it is presented a comparison between three predictive from computational intelligence field one based on neural networks one based on support vector machine and another based on chaos theory. We show that the model based on chaos theory is an alternative to the other two methods.

  6. New tips for structure prediction by comparative modeling

    Science.gov (United States)

    Rayan, Anwar

    2009-01-01

    Comparative modelling is utilized to predict the 3-dimensional conformation of a given protein (target) based on its sequence alignment to experimentally determined protein structure (template). The use of such technique is already rewarding and increasingly widespread in biological research and drug development. The accuracy of the predictions as commonly accepted depends on the score of sequence identity of the target protein to the template. To assess the relationship between sequence identity and model quality, we carried out an analysis of a set of 4753 sequence and structure alignments. Throughout this research, the model accuracy was measured by root mean square deviations of Cα atoms of the target-template structures. Surprisingly, the results show that sequence identity of the target protein to the template is not a good descriptor to predict the accuracy of the 3-D structure model. However, in a large number of cases, comparative modelling with lower sequence identity of target to template proteins led to more accurate 3-D structure model. As a consequence of this study, we suggest new tips for improving the quality of omparative models, particularly for models whose target-template sequence identity is below 50%. PMID:19255646

  7. Complex versus simple models: ion-channel cardiac toxicity prediction.

    Science.gov (United States)

    Mistry, Hitesh B

    2018-01-01

    There is growing interest in applying detailed mathematical models of the heart for ion-channel related cardiac toxicity prediction. However, a debate as to whether such complex models are required exists. Here an assessment in the predictive performance between two established large-scale biophysical cardiac models and a simple linear model B net was conducted. Three ion-channel data-sets were extracted from literature. Each compound was designated a cardiac risk category using two different classification schemes based on information within CredibleMeds. The predictive performance of each model within each data-set for each classification scheme was assessed via a leave-one-out cross validation. Overall the B net model performed equally as well as the leading cardiac models in two of the data-sets and outperformed both cardiac models on the latest. These results highlight the importance of benchmarking complex versus simple models but also encourage the development of simple models.

  8. Complex versus simple models: ion-channel cardiac toxicity prediction

    Directory of Open Access Journals (Sweden)

    Hitesh B. Mistry

    2018-02-01

    Full Text Available There is growing interest in applying detailed mathematical models of the heart for ion-channel related cardiac toxicity prediction. However, a debate as to whether such complex models are required exists. Here an assessment in the predictive performance between two established large-scale biophysical cardiac models and a simple linear model Bnet was conducted. Three ion-channel data-sets were extracted from literature. Each compound was designated a cardiac risk category using two different classification schemes based on information within CredibleMeds. The predictive performance of each model within each data-set for each classification scheme was assessed via a leave-one-out cross validation. Overall the Bnet model performed equally as well as the leading cardiac models in two of the data-sets and outperformed both cardiac models on the latest. These results highlight the importance of benchmarking complex versus simple models but also encourage the development of simple models.

  9. Tuning SISO offset-free Model Predictive Control based on ARX models

    DEFF Research Database (Denmark)

    Huusom, Jakob Kjøbsted; Poulsen, Niels Kjølstad; Jørgensen, Sten Bay

    2012-01-01

    , the proposed controller is simple to tune as it has only one free tuning parameter. These two features are advantageous in predictive process control as they simplify industrial commissioning of MPC. Disturbance rejection and offset-free control is important in industrial process control. To achieve offset......In this paper, we present a tuning methodology for a simple offset-free SISO Model Predictive Controller (MPC) based on autoregressive models with exogenous inputs (ARX models). ARX models simplify system identification as they can be identified from data using convex optimization. Furthermore......-free control in face of unknown disturbances or model-plant mismatch, integrators must be introduced in either the estimator or the regulator. Traditionally, offset-free control is achieved using Brownian disturbance models in the estimator. In this paper we achieve offset-free control by extending the noise...

  10. Copula based prediction models: an application to an aortic regurgitation study

    Directory of Open Access Journals (Sweden)

    Shoukri Mohamed M

    2007-06-01

    Full Text Available Abstract Background: An important issue in prediction modeling of multivariate data is the measure of dependence structure. The use of Pearson's correlation as a dependence measure has several pitfalls and hence application of regression prediction models based on this correlation may not be an appropriate methodology. As an alternative, a copula based methodology for prediction modeling and an algorithm to simulate data are proposed. Methods: The method consists of introducing copulas as an alternative to the correlation coefficient commonly used as a measure of dependence. An algorithm based on the marginal distributions of random variables is applied to construct the Archimedean copulas. Monte Carlo simulations are carried out to replicate datasets, estimate prediction model parameters and validate them using Lin's concordance measure. Results: We have carried out a correlation-based regression analysis on data from 20 patients aged 17–82 years on pre-operative and post-operative ejection fractions after surgery and estimated the prediction model: Post-operative ejection fraction = - 0.0658 + 0.8403 (Pre-operative ejection fraction; p = 0.0008; 95% confidence interval of the slope coefficient (0.3998, 1.2808. From the exploratory data analysis, it is noted that both the pre-operative and post-operative ejection fractions measurements have slight departures from symmetry and are skewed to the left. It is also noted that the measurements tend to be widely spread and have shorter tails compared to normal distribution. Therefore predictions made from the correlation-based model corresponding to the pre-operative ejection fraction measurements in the lower range may not be accurate. Further it is found that the best approximated marginal distributions of pre-operative and post-operative ejection fractions (using q-q plots are gamma distributions. The copula based prediction model is estimated as: Post -operative ejection fraction = - 0.0933 + 0

  11. Chemical structure-based predictive model for methanogenic anaerobic biodegradation potential.

    Science.gov (United States)

    Meylan, William; Boethling, Robert; Aronson, Dallas; Howard, Philip; Tunkel, Jay

    2007-09-01

    Many screening-level models exist for predicting aerobic biodegradation potential from chemical structure, but anaerobic biodegradation generally has been ignored by modelers. We used a fragment contribution approach to develop a model for predicting biodegradation potential under methanogenic anaerobic conditions. The new model has 37 fragments (substructures) and classifies a substance as either fast or slow, relative to the potential to be biodegraded in the "serum bottle" anaerobic biodegradation screening test (Organization for Economic Cooperation and Development Guideline 311). The model correctly classified 90, 77, and 91% of the chemicals in the training set (n = 169) and two independent validation sets (n = 35 and 23), respectively. Accuracy of predictions of fast and slow degradation was equal for training-set chemicals, but fast-degradation predictions were less accurate than slow-degradation predictions for the validation sets. Analysis of the signs of the fragment coefficients for this and the other (aerobic) Biowin models suggests that in the context of simple group contribution models, the majority of positive and negative structural influences on ultimate degradation are the same for aerobic and methanogenic anaerobic biodegradation.

  12. Short-term wind power prediction based on LSSVM–GSA model

    International Nuclear Information System (INIS)

    Yuan, Xiaohui; Chen, Chen; Yuan, Yanbin; Huang, Yuehua; Tan, Qingxiong

    2015-01-01

    Highlights: • A hybrid model is developed for short-term wind power prediction. • The model is based on LSSVM and gravitational search algorithm. • Gravitational search algorithm is used to optimize parameters of LSSVM. • Effect of different kernel function of LSSVM on wind power prediction is discussed. • Comparative studies show that prediction accuracy of wind power is improved. - Abstract: Wind power forecasting can improve the economical and technical integration of wind energy into the existing electricity grid. Due to its intermittency and randomness, it is hard to forecast wind power accurately. For the purpose of utilizing wind power to the utmost extent, it is very important to make an accurate prediction of the output power of a wind farm under the premise of guaranteeing the security and the stability of the operation of the power system. In this paper, a hybrid model (LSSVM–GSA) based on the least squares support vector machine (LSSVM) and gravitational search algorithm (GSA) is proposed to forecast the short-term wind power. As the kernel function and the related parameters of the LSSVM have a great influence on the performance of the prediction model, the paper establishes LSSVM model based on different kernel functions for short-term wind power prediction. And then an optimal kernel function is determined and the parameters of the LSSVM model are optimized by using GSA. Compared with the Back Propagation (BP) neural network and support vector machine (SVM) model, the simulation results show that the hybrid LSSVM–GSA model based on exponential radial basis kernel function and GSA has higher accuracy for short-term wind power prediction. Therefore, the proposed LSSVM–GSA is a better model for short-term wind power prediction

  13. Calibration of PMIS pavement performance prediction models.

    Science.gov (United States)

    2012-02-01

    Improve the accuracy of TxDOTs existing pavement performance prediction models through calibrating these models using actual field data obtained from the Pavement Management Information System (PMIS). : Ensure logical performance superiority patte...

  14. Testing process predictions of models of risky choice: a quantitative model comparison approach

    Science.gov (United States)

    Pachur, Thorsten; Hertwig, Ralph; Gigerenzer, Gerd; Brandstätter, Eduard

    2013-01-01

    This article presents a quantitative model comparison contrasting the process predictions of two prominent views on risky choice. One view assumes a trade-off between probabilities and outcomes (or non-linear functions thereof) and the separate evaluation of risky options (expectation models). Another view assumes that risky choice is based on comparative evaluation, limited search, aspiration levels, and the forgoing of trade-offs (heuristic models). We derived quantitative process predictions for a generic expectation model and for a specific heuristic model, namely the priority heuristic (Brandstätter et al., 2006), and tested them in two experiments. The focus was on two key features of the cognitive process: acquisition frequencies (i.e., how frequently individual reasons are looked up) and direction of search (i.e., gamble-wise vs. reason-wise). In Experiment 1, the priority heuristic predicted direction of search better than the expectation model (although neither model predicted the acquisition process perfectly); acquisition frequencies, however, were inconsistent with both models. Additional analyses revealed that these frequencies were primarily a function of what Rubinstein (1988) called “similarity.” In Experiment 2, the quantitative model comparison approach showed that people seemed to rely more on the priority heuristic in difficult problems, but to make more trade-offs in easy problems. This finding suggests that risky choice may be based on a mental toolbox of strategies. PMID:24151472

  15. Testing Process Predictions of Models of Risky Choice: A Quantitative Model Comparison Approach

    Directory of Open Access Journals (Sweden)

    Thorsten ePachur

    2013-09-01

    Full Text Available This article presents a quantitative model comparison contrasting the process predictions of two prominent views on risky choice. One view assumes a trade-off between probabilities and outcomes (or nonlinear functions thereof and the separate evaluation of risky options (expectation models. Another view assumes that risky choice is based on comparative evaluation, limited search, aspiration levels, and the forgoing of trade-offs (heuristic models. We derived quantitative process predictions for a generic expectation model and for a specific heuristic model, namely the priority heuristic (Brandstätter, Gigerenzer, & Hertwig, 2006, and tested them in two experiments. The focus was on two key features of the cognitive process: acquisition frequencies (i.e., how frequently individual reasons are looked up and direction of search (i.e., gamble-wise vs. reason-wise. In Experiment 1, the priority heuristic predicted direction of search better than the expectation model (although neither model predicted the acquisition process perfectly; acquisition frequencies, however, were inconsistent with both models. Additional analyses revealed that these frequencies were primarily a function of what Rubinstein (1988 called similarity. In Experiment 2, the quantitative model comparison approach showed that people seemed to rely more on the priority heuristic in difficult problems, but to make more trade-offs in easy problems. This finding suggests that risky choice may be based on a mental toolbox of strategies.

  16. Individualized prediction of perineural invasion in colorectal cancer: development and validation of a radiomics prediction model.

    Science.gov (United States)

    Huang, Yanqi; He, Lan; Dong, Di; Yang, Caiyun; Liang, Cuishan; Chen, Xin; Ma, Zelan; Huang, Xiaomei; Yao, Su; Liang, Changhong; Tian, Jie; Liu, Zaiyi

    2018-02-01

    To develop and validate a radiomics prediction model for individualized prediction of perineural invasion (PNI) in colorectal cancer (CRC). After computed tomography (CT) radiomics features extraction, a radiomics signature was constructed in derivation cohort (346 CRC patients). A prediction model was developed to integrate the radiomics signature and clinical candidate predictors [age, sex, tumor location, and carcinoembryonic antigen (CEA) level]. Apparent prediction performance was assessed. After internal validation, independent temporal validation (separate from the cohort used to build the model) was then conducted in 217 CRC patients. The final model was converted to an easy-to-use nomogram. The developed radiomics nomogram that integrated the radiomics signature and CEA level showed good calibration and discrimination performance [Harrell's concordance index (c-index): 0.817; 95% confidence interval (95% CI): 0.811-0.823]. Application of the nomogram in validation cohort gave a comparable calibration and discrimination (c-index: 0.803; 95% CI: 0.794-0.812). Integrating the radiomics signature and CEA level into a radiomics prediction model enables easy and effective risk assessment of PNI in CRC. This stratification of patients according to their PNI status may provide a basis for individualized auxiliary treatment.

  17. Approximating prediction uncertainty for random forest regression models

    Science.gov (United States)

    John W. Coulston; Christine E. Blinn; Valerie A. Thomas; Randolph H. Wynne

    2016-01-01

    Machine learning approaches such as random forest have increased for the spatial modeling and mapping of continuous variables. Random forest is a non-parametric ensemble approach, and unlike traditional regression approaches there is no direct quantification of prediction error. Understanding prediction uncertainty is important when using model-based continuous maps as...

  18. Deep Flare Net (DeFN) Model for Solar Flare Prediction

    Science.gov (United States)

    Nishizuka, N.; Sugiura, K.; Kubo, Y.; Den, M.; Ishii, M.

    2018-05-01

    We developed a solar flare prediction model using a deep neural network (DNN) named Deep Flare Net (DeFN). This model can calculate the probability of flares occurring in the following 24 hr in each active region, which is used to determine the most likely maximum classes of flares via a binary classification (e.g., ≥M class versus statistically predict flares, the DeFN model was trained to optimize the skill score, i.e., the true skill statistic (TSS). As a result, we succeeded in predicting flares with TSS = 0.80 for ≥M-class flares and TSS = 0.63 for ≥C-class flares. Note that in usual DNN models, the prediction process is a black box. However, in the DeFN model, the features are manually selected, and it is possible to analyze which features are effective for prediction after evaluation.

  19. Hidden markov model for the prediction of transmembrane proteins using MATLAB.

    Science.gov (United States)

    Chaturvedi, Navaneet; Shanker, Sudhanshu; Singh, Vinay Kumar; Sinha, Dhiraj; Pandey, Paras Nath

    2011-01-01

    Since membranous proteins play a key role in drug targeting therefore transmembrane proteins prediction is active and challenging area of biological sciences. Location based prediction of transmembrane proteins are significant for functional annotation of protein sequences. Hidden markov model based method was widely applied for transmembrane topology prediction. Here we have presented a revised and a better understanding model than an existing one for transmembrane protein prediction. Scripting on MATLAB was built and compiled for parameter estimation of model and applied this model on amino acid sequence to know the transmembrane and its adjacent locations. Estimated model of transmembrane topology was based on TMHMM model architecture. Only 7 super states are defined in the given dataset, which were converted to 96 states on the basis of their length in sequence. Accuracy of the prediction of model was observed about 74 %, is a good enough in the area of transmembrane topology prediction. Therefore we have concluded the hidden markov model plays crucial role in transmembrane helices prediction on MATLAB platform and it could also be useful for drug discovery strategy. The database is available for free at bioinfonavneet@gmail.comvinaysingh@bhu.ac.in.

  20. Bayesian Age-Period-Cohort Modeling and Prediction - BAMP

    Directory of Open Access Journals (Sweden)

    Volker J. Schmid

    2007-10-01

    Full Text Available The software package BAMP provides a method of analyzing incidence or mortality data on the Lexis diagram, using a Bayesian version of an age-period-cohort model. A hierarchical model is assumed with a binomial model in the first-stage. As smoothing priors for the age, period and cohort parameters random walks of first and second order, with and without an additional unstructured component are available. Unstructured heterogeneity can also be included in the model. In order to evaluate the model fit, posterior deviance, DIC and predictive deviances are computed. By projecting the random walk prior into the future, future death rates can be predicted.

  1. USP38, FREM3, SDC1, DDC, and LOC727982 Gene Polymorphisms and Differential Susceptibility to Severe Malaria in Tanzania.

    Science.gov (United States)

    Manjurano, Alphaxard; Sepúlveda, Nuno; Nadjm, Behzad; Mtove, George; Wangai, Hannah; Maxwell, Caroline; Olomi, Raimos; Reyburn, Hugh; Drakeley, Christopher J; Riley, Eleanor M; Clark, Taane G

    2015-10-01

    Populations exposed to Plasmodium falciparum infection develop genetic mechanisms of protection against severe malarial disease. Despite decades of genetic epidemiological research, the sickle cell trait (HbAS) sickle cell polymorphism, ABO blood group, and other hemoglobinopathies remain the few major determinants in severe malaria to be replicated across different African populations and study designs. Within a case-control study in a region of high transmission in Tanzania (n = 983), we investigated the role of 40 new loci identified in recent genome-wide studies. In 32 loci passing quality control procedures, we found polymorphisms in USP38, FREM3, SDC1, DDC, and LOC727982 genes to be putatively associated with differential susceptibility to severe malaria. Established candidates explained 7.4% of variation in severe malaria risk (HbAS polymorphism, 6.3%; α-thalassemia, 0.3%; ABO group, 0.3%; and glucose-6-phosphate dehydrogenase deficiency, 0.5%) and the new polymorphisms, another 4.3%. The regions encompassing the loci identified are promising targets for the design of future treatment and control interventions. © The Author 2015. Published by Oxford University Press on behalf of the Infectious Diseases Society of America.

  2. Model predictive control of a wind turbine modelled in Simpack

    International Nuclear Information System (INIS)

    Jassmann, U; Matzke, D; Reiter, M; Abel, D; Berroth, J; Schelenz, R; Jacobs, G

    2014-01-01

    Wind turbines (WT) are steadily growing in size to increase their power production, which also causes increasing loads acting on the turbine's components. At the same time large structures, such as the blades and the tower get more flexible. To minimize this impact, the classical control loops for keeping the power production in an optimum state are more and more extended by load alleviation strategies. These additional control loops can be unified by a multiple-input multiple-output (MIMO) controller to achieve better balancing of tuning parameters. An example for MIMO control, which has been paid more attention to recently by wind industry, is Model Predictive Control (MPC). In a MPC framework a simplified model of the WT is used to predict its controlled outputs. Based on a user-defined cost function an online optimization calculates the optimal control sequence. Thereby MPC can intrinsically incorporate constraints e.g. of actuators. Turbine models used for calculation within the MPC are typically simplified. For testing and verification usually multi body simulations, such as FAST, BLADED or FLEX5 are used to model system dynamics, but they are still limited in the number of degrees of freedom (DOF). Detailed information about load distribution (e.g. inside the gearbox) cannot be provided by such models. In this paper a Model Predictive Controller is presented and tested in a co-simulation with SlMPACK, a multi body system (MBS) simulation framework used for detailed load analysis. The analysis are performed on the basis of the IME6.0 MBS WT model, described in this paper. It is based on the rotor of the NREL 5MW WT and consists of a detailed representation of the drive train. This takes into account a flexible main shaft and its main bearings with a planetary gearbox, where all components are modelled flexible, as well as a supporting flexible main frame. The wind loads are simulated using the NREL AERODYN v13 code which has been implemented as a routine

  3. Model predictive control of a wind turbine modelled in Simpack

    Science.gov (United States)

    Jassmann, U.; Berroth, J.; Matzke, D.; Schelenz, R.; Reiter, M.; Jacobs, G.; Abel, D.

    2014-06-01

    Wind turbines (WT) are steadily growing in size to increase their power production, which also causes increasing loads acting on the turbine's components. At the same time large structures, such as the blades and the tower get more flexible. To minimize this impact, the classical control loops for keeping the power production in an optimum state are more and more extended by load alleviation strategies. These additional control loops can be unified by a multiple-input multiple-output (MIMO) controller to achieve better balancing of tuning parameters. An example for MIMO control, which has been paid more attention to recently by wind industry, is Model Predictive Control (MPC). In a MPC framework a simplified model of the WT is used to predict its controlled outputs. Based on a user-defined cost function an online optimization calculates the optimal control sequence. Thereby MPC can intrinsically incorporate constraints e.g. of actuators. Turbine models used for calculation within the MPC are typically simplified. For testing and verification usually multi body simulations, such as FAST, BLADED or FLEX5 are used to model system dynamics, but they are still limited in the number of degrees of freedom (DOF). Detailed information about load distribution (e.g. inside the gearbox) cannot be provided by such models. In this paper a Model Predictive Controller is presented and tested in a co-simulation with SlMPACK, a multi body system (MBS) simulation framework used for detailed load analysis. The analysis are performed on the basis of the IME6.0 MBS WT model, described in this paper. It is based on the rotor of the NREL 5MW WT and consists of a detailed representation of the drive train. This takes into account a flexible main shaft and its main bearings with a planetary gearbox, where all components are modelled flexible, as well as a supporting flexible main frame. The wind loads are simulated using the NREL AERODYN v13 code which has been implemented as a routine to

  4. The North American Multi-Model Ensemble (NMME): Phase-1 Seasonal to Interannual Prediction, Phase-2 Toward Developing Intra-Seasonal Prediction

    Science.gov (United States)

    Kirtman, Ben P.; Min, Dughong; Infanti, Johnna M.; Kinter, James L., III; Paolino, Daniel A.; Zhang, Qin; vandenDool, Huug; Saha, Suranjana; Mendez, Malaquias Pena; Becker, Emily; hide

    2013-01-01

    The recent US National Academies report "Assessment of Intraseasonal to Interannual Climate Prediction and Predictability" was unequivocal in recommending the need for the development of a North American Multi-Model Ensemble (NMME) operational predictive capability. Indeed, this effort is required to meet the specific tailored regional prediction and decision support needs of a large community of climate information users. The multi-model ensemble approach has proven extremely effective at quantifying prediction uncertainty due to uncertainty in model formulation, and has proven to produce better prediction quality (on average) then any single model ensemble. This multi-model approach is the basis for several international collaborative prediction research efforts, an operational European system and there are numerous examples of how this multi-model ensemble approach yields superior forecasts compared to any single model. Based on two NOAA Climate Test Bed (CTB) NMME workshops (February 18, and April 8, 2011) a collaborative and coordinated implementation strategy for a NMME prediction system has been developed and is currently delivering real-time seasonal-to-interannual predictions on the NOAA Climate Prediction Center (CPC) operational schedule. The hindcast and real-time prediction data is readily available (e.g., http://iridl.ldeo.columbia.edu/SOURCES/.Models/.NMME/) and in graphical format from CPC (http://origin.cpc.ncep.noaa.gov/products/people/wd51yf/NMME/index.html). Moreover, the NMME forecast are already currently being used as guidance for operational forecasters. This paper describes the new NMME effort, presents an overview of the multi-model forecast quality, and the complementary skill associated with individual models.

  5. Multi-Model Ensemble Wake Vortex Prediction

    Science.gov (United States)

    Koerner, Stephan; Holzaepfel, Frank; Ahmad, Nash'at N.

    2015-01-01

    Several multi-model ensemble methods are investigated for predicting wake vortex transport and decay. This study is a joint effort between National Aeronautics and Space Administration and Deutsches Zentrum fuer Luft- und Raumfahrt to develop a multi-model ensemble capability using their wake models. An overview of different multi-model ensemble methods and their feasibility for wake applications is presented. The methods include Reliability Ensemble Averaging, Bayesian Model Averaging, and Monte Carlo Simulations. The methodologies are evaluated using data from wake vortex field experiments.

  6. In Silico Modeling of Gastrointestinal Drug Absorption: Predictive Performance of Three Physiologically Based Absorption Models.

    Science.gov (United States)

    Sjögren, Erik; Thörn, Helena; Tannergren, Christer

    2016-06-06

    Gastrointestinal (GI) drug absorption is a complex process determined by formulation, physicochemical and biopharmaceutical factors, and GI physiology. Physiologically based in silico absorption models have emerged as a widely used and promising supplement to traditional in vitro assays and preclinical in vivo studies. However, there remains a lack of comparative studies between different models. The aim of this study was to explore the strengths and limitations of the in silico absorption models Simcyp 13.1, GastroPlus 8.0, and GI-Sim 4.1, with respect to their performance in predicting human intestinal drug absorption. This was achieved by adopting an a priori modeling approach and using well-defined input data for 12 drugs associated with incomplete GI absorption and related challenges in predicting the extent of absorption. This approach better mimics the real situation during formulation development where predictive in silico models would be beneficial. Plasma concentration-time profiles for 44 oral drug administrations were calculated by convolution of model-predicted absorption-time profiles and reported pharmacokinetic parameters. Model performance was evaluated by comparing the predicted plasma concentration-time profiles, Cmax, tmax, and exposure (AUC) with observations from clinical studies. The overall prediction accuracies for AUC, given as the absolute average fold error (AAFE) values, were 2.2, 1.6, and 1.3 for Simcyp, GastroPlus, and GI-Sim, respectively. The corresponding AAFE values for Cmax were 2.2, 1.6, and 1.3, respectively, and those for tmax were 1.7, 1.5, and 1.4, respectively. Simcyp was associated with underprediction of AUC and Cmax; the accuracy decreased with decreasing predicted fabs. A tendency for underprediction was also observed for GastroPlus, but there was no correlation with predicted fabs. There were no obvious trends for over- or underprediction for GI-Sim. The models performed similarly in capturing dependencies on dose and

  7. Embryo quality predictive models based on cumulus cells gene expression

    Directory of Open Access Journals (Sweden)

    Devjak R

    2016-06-01

    Full Text Available Since the introduction of in vitro fertilization (IVF in clinical practice of infertility treatment, the indicators for high quality embryos were investigated. Cumulus cells (CC have a specific gene expression profile according to the developmental potential of the oocyte they are surrounding, and therefore, specific gene expression could be used as a biomarker. The aim of our study was to combine more than one biomarker to observe improvement in prediction value of embryo development. In this study, 58 CC samples from 17 IVF patients were analyzed. This study was approved by the Republic of Slovenia National Medical Ethics Committee. Gene expression analysis [quantitative real time polymerase chain reaction (qPCR] for five genes, analyzed according to embryo quality level, was performed. Two prediction models were tested for embryo quality prediction: a binary logistic and a decision tree model. As the main outcome, gene expression levels for five genes were taken and the area under the curve (AUC for two prediction models were calculated. Among tested genes, AMHR2 and LIF showed significant expression difference between high quality and low quality embryos. These two genes were used for the construction of two prediction models: the binary logistic model yielded an AUC of 0.72 ± 0.08 and the decision tree model yielded an AUC of 0.73 ± 0.03. Two different prediction models yielded similar predictive power to differentiate high and low quality embryos. In terms of eventual clinical decision making, the decision tree model resulted in easy-to-interpret rules that are highly applicable in clinical practice.

  8. Model Predictive Control of a Wave Energy Converter

    DEFF Research Database (Denmark)

    Andersen, Palle; Pedersen, Tom Søndergård; Nielsen, Kirsten Mølgaard

    2015-01-01

    In this paper reactive control and Model Predictive Control (MPC) for a Wave Energy Converter (WEC) are compared. The analysis is based on a WEC from Wave Star A/S designed as a point absorber. The model predictive controller uses wave models based on the dominating sea states combined with a model...... connecting undisturbed wave sequences to sequences of torque. Losses in the conversion from mechanical to electrical power are taken into account in two ways. Conventional reactive controllers are tuned for each sea state with the assumption that the converter has the same efficiency back and forth. MPC...

  9. Three-model ensemble wind prediction in southern Italy

    Science.gov (United States)

    Torcasio, Rosa Claudia; Federico, Stefano; Calidonna, Claudia Roberta; Avolio, Elenio; Drofa, Oxana; Landi, Tony Christian; Malguzzi, Piero; Buzzi, Andrea; Bonasoni, Paolo

    2016-03-01

    Quality of wind prediction is of great importance since a good wind forecast allows the prediction of available wind power, improving the penetration of renewable energies into the energy market. Here, a 1-year (1 December 2012 to 30 November 2013) three-model ensemble (TME) experiment for wind prediction is considered. The models employed, run operationally at National Research Council - Institute of Atmospheric Sciences and Climate (CNR-ISAC), are RAMS (Regional Atmospheric Modelling System), BOLAM (BOlogna Limited Area Model), and MOLOCH (MOdello LOCale in H coordinates). The area considered for the study is southern Italy and the measurements used for the forecast verification are those of the GTS (Global Telecommunication System). Comparison with observations is made every 3 h up to 48 h of forecast lead time. Results show that the three-model ensemble outperforms the forecast of each individual model. The RMSE improvement compared to the best model is between 22 and 30 %, depending on the season. It is also shown that the three-model ensemble outperforms the IFS (Integrated Forecasting System) of the ECMWF (European Centre for Medium-Range Weather Forecast) for the surface wind forecasts. Notably, the three-model ensemble forecast performs better than each unbiased model, showing the added value of the ensemble technique. Finally, the sensitivity of the three-model ensemble RMSE to the length of the training period is analysed.

  10. QSAR Modeling and Prediction of Drug-Drug Interactions.

    Science.gov (United States)

    Zakharov, Alexey V; Varlamova, Ekaterina V; Lagunin, Alexey A; Dmitriev, Alexander V; Muratov, Eugene N; Fourches, Denis; Kuz'min, Victor E; Poroikov, Vladimir V; Tropsha, Alexander; Nicklaus, Marc C

    2016-02-01

    Severe adverse drug reactions (ADRs) are the fourth leading cause of fatality in the U.S. with more than 100,000 deaths per year. As up to 30% of all ADRs are believed to be caused by drug-drug interactions (DDIs), typically mediated by cytochrome P450s, possibilities to predict DDIs from existing knowledge are important. We collected data from public sources on 1485, 2628, 4371, and 27,966 possible DDIs mediated by four cytochrome P450 isoforms 1A2, 2C9, 2D6, and 3A4 for 55, 73, 94, and 237 drugs, respectively. For each of these data sets, we developed and validated QSAR models for the prediction of DDIs. As a unique feature of our approach, the interacting drug pairs were represented as binary chemical mixtures in a 1:1 ratio. We used two types of chemical descriptors: quantitative neighborhoods of atoms (QNA) and simplex descriptors. Radial basis functions with self-consistent regression (RBF-SCR) and random forest (RF) were utilized to build QSAR models predicting the likelihood of DDIs for any pair of drug molecules. Our models showed balanced accuracy of 72-79% for the external test sets with a coverage of 81.36-100% when a conservative threshold for the model's applicability domain was applied. We generated virtually all possible binary combinations of marketed drugs and employed our models to identify drug pairs predicted to be instances of DDI. More than 4500 of these predicted DDIs that were not found in our training sets were confirmed by data from the DrugBank database.

  11. Predicting Market Impact Costs Using Nonparametric Machine Learning Models.

    Science.gov (United States)

    Park, Saerom; Lee, Jaewook; Son, Youngdoo

    2016-01-01

    Market impact cost is the most significant portion of implicit transaction costs that can reduce the overall transaction cost, although it cannot be measured directly. In this paper, we employed the state-of-the-art nonparametric machine learning models: neural networks, Bayesian neural network, Gaussian process, and support vector regression, to predict market impact cost accurately and to provide the predictive model that is versatile in the number of variables. We collected a large amount of real single transaction data of US stock market from Bloomberg Terminal and generated three independent input variables. As a result, most nonparametric machine learning models outperformed a-state-of-the-art benchmark parametric model such as I-star model in four error measures. Although these models encounter certain difficulties in separating the permanent and temporary cost directly, nonparametric machine learning models can be good alternatives in reducing transaction costs by considerably improving in prediction performance.

  12. The effects of model and data complexity on predictions from species distributions models

    DEFF Research Database (Denmark)

    García-Callejas, David; Bastos, Miguel

    2016-01-01

    How complex does a model need to be to provide useful predictions is a matter of continuous debate across environmental sciences. In the species distributions modelling literature, studies have demonstrated that more complex models tend to provide better fits. However, studies have also shown...... that predictive performance does not always increase with complexity. Testing of species distributions models is challenging because independent data for testing are often lacking, but a more general problem is that model complexity has never been formally described in such studies. Here, we systematically...

  13. Predictive modelling using neuroimaging data in the presence of confounds.

    Science.gov (United States)

    Rao, Anil; Monteiro, Joao M; Mourao-Miranda, Janaina

    2017-04-15

    When training predictive models from neuroimaging data, we typically have available non-imaging variables such as age and gender that affect the imaging data but which we may be uninterested in from a clinical perspective. Such variables are commonly referred to as 'confounds'. In this work, we firstly give a working definition for confound in the context of training predictive models from samples of neuroimaging data. We define a confound as a variable which affects the imaging data and has an association with the target variable in the sample that differs from that in the population-of-interest, i.e., the population over which we intend to apply the estimated predictive model. The focus of this paper is the scenario in which the confound and target variable are independent in the population-of-interest, but the training sample is biased due to a sample association between the target and confound. We then discuss standard approaches for dealing with confounds in predictive modelling such as image adjustment and including the confound as a predictor, before deriving and motivating an Instance Weighting scheme that attempts to account for confounds by focusing model training so that it is optimal for the population-of-interest. We evaluate the standard approaches and Instance Weighting in two regression problems with neuroimaging data in which we train models in the presence of confounding, and predict samples that are representative of the population-of-interest. For comparison, these models are also evaluated when there is no confounding present. In the first experiment we predict the MMSE score using structural MRI from the ADNI database with gender as the confound, while in the second we predict age using structural MRI from the IXI database with acquisition site as the confound. Considered over both datasets we find that none of the methods for dealing with confounding gives more accurate predictions than a baseline model which ignores confounding, although

  14. A deep auto-encoder model for gene expression prediction.

    Science.gov (United States)

    Xie, Rui; Wen, Jia; Quitadamo, Andrew; Cheng, Jianlin; Shi, Xinghua

    2017-11-17

    Gene expression is a key intermediate level that genotypes lead to a particular trait. Gene expression is affected by various factors including genotypes of genetic variants. With an aim of delineating the genetic impact on gene expression, we build a deep auto-encoder model to assess how good genetic variants will contribute to gene expression changes. This new deep learning model is a regression-based predictive model based on the MultiLayer Perceptron and Stacked Denoising Auto-encoder (MLP-SAE). The model is trained using a stacked denoising auto-encoder for feature selection and a multilayer perceptron framework for backpropagation. We further improve the model by introducing dropout to prevent overfitting and improve performance. To demonstrate the usage of this model, we apply MLP-SAE to a real genomic datasets with genotypes and gene expression profiles measured in yeast. Our results show that the MLP-SAE model with dropout outperforms other models including Lasso, Random Forests and the MLP-SAE model without dropout. Using the MLP-SAE model with dropout, we show that gene expression quantifications predicted by the model solely based on genotypes, align well with true gene expression patterns. We provide a deep auto-encoder model for predicting gene expression from SNP genotypes. This study demonstrates that deep learning is appropriate for tackling another genomic problem, i.e., building predictive models to understand genotypes' contribution to gene expression. With the emerging availability of richer genomic data, we anticipate that deep learning models play a bigger role in modeling and interpreting genomics.

  15. Cultural Resource Predictive Modeling

    Science.gov (United States)

    2017-10-01

    CR cultural resource CRM cultural resource management CRPM Cultural Resource Predictive Modeling DoD Department of Defense ESTCP Environmental...resource management ( CRM ) legal obligations under NEPA and the NHPA, military installations need to demonstrate that CRM decisions are based on objective...maxim “one size does not fit all,” and demonstrate that DoD installations have many different CRM needs that can and should be met through a variety

  16. Gamma-Ray Pulsars Models and Predictions

    CERN Document Server

    Harding, A K

    2001-01-01

    Pulsed emission from gamma-ray pulsars originates inside the magnetosphere, from radiation by charged particles accelerated near the magnetic poles or in the outer gaps. In polar cap models, the high energy spectrum is cut off by magnetic pair production above an energy that is dependent on the local magnetic field strength. While most young pulsars with surface fields in the range B = 10^{12} - 10^{13} G are expected to have high energy cutoffs around several GeV, the gamma-ray spectra of old pulsars having lower surface fields may extend to 50 GeV. Although the gamma-ray emission of older pulsars is weaker, detecting pulsed emission at high energies from nearby sources would be an important confirmation of polar cap models. Outer gap models predict more gradual high-energy turnovers at around 10 GeV, but also predict an inverse Compton component extending to TeV energies. Detection of pulsed TeV emission, which would not survive attenuation at the polar caps, is thus an important test of outer gap models. N...

  17. A statistical model for predicting muscle performance

    Science.gov (United States)

    Byerly, Diane Leslie De Caix

    The objective of these studies was to develop a capability for predicting muscle performance and fatigue to be utilized for both space- and ground-based applications. To develop this predictive model, healthy test subjects performed a defined, repetitive dynamic exercise to failure using a Lordex spinal machine. Throughout the exercise, surface electromyography (SEMG) data were collected from the erector spinae using a Mega Electronics ME3000 muscle tester and surface electrodes placed on both sides of the back muscle. These data were analyzed using a 5th order Autoregressive (AR) model and statistical regression analysis. It was determined that an AR derived parameter, the mean average magnitude of AR poles, significantly correlated with the maximum number of repetitions (designated Rmax) that a test subject was able to perform. Using the mean average magnitude of AR poles, a test subject's performance to failure could be predicted as early as the sixth repetition of the exercise. This predictive model has the potential to provide a basis for improving post-space flight recovery, monitoring muscle atrophy in astronauts and assessing the effectiveness of countermeasures, monitoring astronaut performance and fatigue during Extravehicular Activity (EVA) operations, providing pre-flight assessment of the ability of an EVA crewmember to perform a given task, improving the design of training protocols and simulations for strenuous International Space Station assembly EVA, and enabling EVA work task sequences to be planned enhancing astronaut performance and safety. Potential ground-based, medical applications of the predictive model include monitoring muscle deterioration and performance resulting from illness, establishing safety guidelines in the industry for repetitive tasks, monitoring the stages of rehabilitation for muscle-related injuries sustained in sports and accidents, and enhancing athletic performance through improved training protocols while reducing

  18. Longitudinal modeling to predict vital capacity in amyotrophic lateral sclerosis.

    Science.gov (United States)

    Jahandideh, Samad; Taylor, Albert A; Beaulieu, Danielle; Keymer, Mike; Meng, Lisa; Bian, Amy; Atassi, Nazem; Andrews, Jinsy; Ennist, David L

    2018-05-01

    Death in amyotrophic lateral sclerosis (ALS) patients is related to respiratory failure, which is assessed in clinical settings by measuring vital capacity. We developed ALS-VC, a modeling tool for longitudinal prediction of vital capacity in ALS patients. A gradient boosting machine (GBM) model was trained using the PRO-ACT (Pooled Resource Open-access ALS Clinical Trials) database of over 10,000 ALS patient records. We hypothesized that a reliable vital capacity predictive model could be developed using PRO-ACT. The model was used to compare FVC predictions with a 30-day run-in period to predictions made from just baseline. The internal root mean square deviations (RMSD) of the run-in and baseline models were 0.534 and 0.539, respectively, across the 7L FVC range captured in PRO-ACT. The RMSDs of the run-in and baseline models using an unrelated, contemporary external validation dataset (0.553 and 0.538, respectively) were comparable to the internal validation. The model was shown to have similar accuracy for predicting SVC (RMSD = 0.562). The most important features for both run-in and baseline models were "Baseline forced vital capacity" and "Days since baseline." We developed ALS-VC, a GBM model trained with the PRO-ACT ALS dataset that provides vital capacity predictions generalizable to external datasets. The ALS-VC model could be helpful in advising and counseling patients, and, in clinical trials, it could be used to generate virtual control arms against which observed outcomes could be compared, or used to stratify patients into slowly, average, and rapidly progressing subgroups.

  19. Preoperative prediction model of outcome after cholecystectomy for symptomatic gallstones

    DEFF Research Database (Denmark)

    Borly, L; Anderson, I B; Bardram, L

    1999-01-01

    and sonography evaluated gallbladder motility, gallstones, and gallbladder volume. Preoperative variables in patients with or without postcholecystectomy pain were compared statistically, and significant variables were combined in a logistic regression model to predict the postoperative outcome. RESULTS: Eighty...... and by the absence of 'agonizing' pain and of symptoms coinciding with pain (P model 15 of 18 predicted patients had postoperative pain (PVpos = 0.83). Of 62 patients predicted as having no pain postoperatively, 56 were pain-free (PVneg = 0.90). Overall accuracy...... was 89%. CONCLUSION: From this prospective study a model based on preoperative symptoms was developed to predict postcholecystectomy pain. Since intrastudy reclassification may give too optimistic results, the model should be validated in future studies....

  20. Model Predictive Control based on Finite Impulse Response Models

    DEFF Research Database (Denmark)

    Prasath, Guru; Jørgensen, John Bagterp

    2008-01-01

    We develop a regularized l2 finite impulse response (FIR) predictive controller with input and input-rate constraints. Feedback is based on a simple constant output disturbance filter. The performance of the predictive controller in the face of plant-model mismatch is investigated by simulations...... and related to the uncertainty of the impulse response coefficients. The simulations can be used to benchmark l2 MPC against FIR based robust MPC as well as to estimate the maximum performance improvements by robust MPC....

  1. Including model uncertainty in the model predictive control with output feedback

    Directory of Open Access Journals (Sweden)

    Rodrigues M.A.

    2002-01-01

    Full Text Available This paper addresses the development of an efficient numerical output feedback robust model predictive controller for open-loop stable systems. Stability of the closed loop is guaranteed by using an infinite horizon predictive controller and a stable state observer. The performance and the computational burden of this approach are compared to a robust predictive controller from the literature. The case used for this study is based on an industrial gasoline debutanizer column.

  2. Global vegetation change predicted by the modified Budyko model

    Energy Technology Data Exchange (ETDEWEB)

    Monserud, R.A.; Tchebakova, N.M.; Leemans, R. (US Department of Agriculture, Moscow, ID (United States). Intermountain Research Station, Forest Service)

    1993-09-01

    A modified Budyko global vegetation model is used to predict changes in global vegetation patterns resulting from climate change (CO[sub 2] doubling). Vegetation patterns are predicted using a model based on a dryness index and potential evaporation determined by solving radiation balance equations. Climate change scenarios are derived from predictions from four General Circulation Models (GCM's) of the atmosphere (GFDL, GISS, OSU, and UKMO). All four GCM scenarios show similar trends in vegetation shifts and in areas that remain stable, although the UKMO scenario predicts greater warming than the others. Climate change maps produced by all four GCM scenarios show good agreement with the current climate vegetation map for the globe as a whole, although over half of the vegetation classes show only poor to fair agreement. The most stable areas are Desert and Ice/Polar Desert. Because most of the predicted warming is concentrated in the Boreal and Temperate zones, vegetation there is predicted to undergo the greatest change. Most vegetation classes in the Subtropics and Tropics are predicted to expand. Any shift in the Tropics favouring either Forest over Savanna, or vice versa, will be determined by the magnitude of the increased precipitation accompanying global warming. Although the model predicts equilibrium conditions to which many plant species cannot adjust (through migration or microevolution) in the 50-100 y needed for CO[sub 2] doubling, it is not clear if projected global warming will result in drastic or benign vegetation change. 72 refs., 3 figs., 3 tabs.

  3. A model to predict the power output from wind farms

    Energy Technology Data Exchange (ETDEWEB)

    Landberg, L. [Riso National Lab., Roskilde (Denmark)

    1997-12-31

    This paper will describe a model that can predict the power output from wind farms. To give examples of input the model is applied to a wind farm in Texas. The predictions are generated from forecasts from the NGM model of NCEP. These predictions are made valid at individual sites (wind farms) by applying a matrix calculated by the sub-models of WASP (Wind Atlas Application and Analysis Program). The actual wind farm production is calculated using the Riso PARK model. Because of the preliminary nature of the results, they will not be given. However, similar results from Europe will be given.

  4. Predicting birth weight with conditionally linear transformation models.

    Science.gov (United States)

    Möst, Lisa; Schmid, Matthias; Faschingbauer, Florian; Hothorn, Torsten

    2016-12-01

    Low and high birth weight (BW) are important risk factors for neonatal morbidity and mortality. Gynecologists must therefore accurately predict BW before delivery. Most prediction formulas for BW are based on prenatal ultrasound measurements carried out within one week prior to birth. Although successfully used in clinical practice, these formulas focus on point predictions of BW but do not systematically quantify uncertainty of the predictions, i.e. they result in estimates of the conditional mean of BW but do not deliver prediction intervals. To overcome this problem, we introduce conditionally linear transformation models (CLTMs) to predict BW. Instead of focusing only on the conditional mean, CLTMs model the whole conditional distribution function of BW given prenatal ultrasound parameters. Consequently, the CLTM approach delivers both point predictions of BW and fetus-specific prediction intervals. Prediction intervals constitute an easy-to-interpret measure of prediction accuracy and allow identification of fetuses subject to high prediction uncertainty. Using a data set of 8712 deliveries at the Perinatal Centre at the University Clinic Erlangen (Germany), we analyzed variants of CLTMs and compared them to standard linear regression estimation techniques used in the past and to quantile regression approaches. The best-performing CLTM variant was competitive with quantile regression and linear regression approaches in terms of conditional coverage and average length of the prediction intervals. We propose that CLTMs be used because they are able to account for possible heteroscedasticity, kurtosis, and skewness of the distribution of BWs. © The Author(s) 2014.

  5. Hierarchical Neural Regression Models for Customer Churn Prediction

    Directory of Open Access Journals (Sweden)

    Golshan Mohammadi

    2013-01-01

    Full Text Available As customers are the main assets of each industry, customer churn prediction is becoming a major task for companies to remain in competition with competitors. In the literature, the better applicability and efficiency of hierarchical data mining techniques has been reported. This paper considers three hierarchical models by combining four different data mining techniques for churn prediction, which are backpropagation artificial neural networks (ANN, self-organizing maps (SOM, alpha-cut fuzzy c-means (α-FCM, and Cox proportional hazards regression model. The hierarchical models are ANN + ANN + Cox, SOM + ANN + Cox, and α-FCM + ANN + Cox. In particular, the first component of the models aims to cluster data in two churner and nonchurner groups and also filter out unrepresentative data or outliers. Then, the clustered data as the outputs are used to assign customers to churner and nonchurner groups by the second technique. Finally, the correctly classified data are used to create Cox proportional hazards model. To evaluate the performance of the hierarchical models, an Iranian mobile dataset is considered. The experimental results show that the hierarchical models outperform the single Cox regression baseline model in terms of prediction accuracy, Types I and II errors, RMSE, and MAD metrics. In addition, the α-FCM + ANN + Cox model significantly performs better than the two other hierarchical models.

  6. Discrete fracture modelling for the Stripa tracer validation experiment predictions

    International Nuclear Information System (INIS)

    Dershowitz, W.; Wallmann, P.

    1992-02-01

    Groundwater flow and transport through three-dimensional networks of discrete fractures was modeled to predict the recovery of tracer from tracer injection experiments conducted during phase 3 of the Stripa site characterization and validation protect. Predictions were made on the basis of an updated version of the site scale discrete fracture conceptual model used for flow predictions and preliminary transport modelling. In this model, individual fractures were treated as stochastic features described by probability distributions of geometric and hydrologic properties. Fractures were divided into three populations: Fractures in fracture zones near the drift, non-fracture zone fractures within 31 m of the drift, and fractures in fracture zones over 31 meters from the drift axis. Fractures outside fracture zones are not modelled beyond 31 meters from the drift axis. Transport predictions were produced using the FracMan discrete fracture modelling package for each of five tracer experiments. Output was produced in the seven formats specified by the Stripa task force on fracture flow modelling. (au)

  7. Multivariate statistical models for disruption prediction at ASDEX Upgrade

    International Nuclear Information System (INIS)

    Aledda, R.; Cannas, B.; Fanni, A.; Sias, G.; Pautasso, G.

    2013-01-01

    In this paper, a disruption prediction system for ASDEX Upgrade has been proposed that does not require disruption terminated experiments to be implemented. The system consists of a data-based model, which is built using only few input signals coming from successfully terminated pulses. A fault detection and isolation approach has been used, where the prediction is based on the analysis of the residuals of an auto regressive exogenous input model. The prediction performance of the proposed system is encouraging when it is applied to the same set of campaigns used to implement the model. However, the false alarms significantly increase when we tested the system on discharges coming from experimental campaigns temporally far from those used to train the model. This is due to the well know aging effect inherent in the data-based models. The main advantage of the proposed method, with respect to other data-based approaches in literature, is that it does not need data on experiments terminated with a disruption, as it uses a normal operating conditions model. This is a big advantage in the prospective of a prediction system for ITER, where a limited number of disruptions can be allowed

  8. Modelling Chemical Reasoning to Predict and Invent Reactions.

    Science.gov (United States)

    Segler, Marwin H S; Waller, Mark P

    2017-05-02

    The ability to reason beyond established knowledge allows organic chemists to solve synthetic problems and invent novel transformations. Herein, we propose a model that mimics chemical reasoning, and formalises reaction prediction as finding missing links in a knowledge graph. We have constructed a knowledge graph containing 14.4 million molecules and 8.2 million binary reactions, which represents the bulk of all chemical reactions ever published in the scientific literature. Our model outperforms a rule-based expert system in the reaction prediction task for 180 000 randomly selected binary reactions. The data-driven model generalises even beyond known reaction types, and is thus capable of effectively (re-)discovering novel transformations (even including transition metal-catalysed reactions). Our model enables computers to infer hypotheses about reactivity and reactions by only considering the intrinsic local structure of the graph and because each single reaction prediction is typically achieved in a sub-second time frame, the model can be used as a high-throughput generator of reaction hypotheses for reaction discovery. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  9. Models for predicting fuel consumption in sagebrush-dominated ecosystems

    Science.gov (United States)

    Clinton S. Wright

    2013-01-01

    Fuel consumption predictions are necessary to accurately estimate or model fire effects, including pollutant emissions during wildland fires. Fuel and environmental measurements on a series of operational prescribed fires were used to develop empirical models for predicting fuel consumption in big sagebrush (Artemisia tridentate Nutt.) ecosystems....

  10. Verification of some numerical models for operationally predicting mesoscale winds aloft

    International Nuclear Information System (INIS)

    Cornett, J.S.; Randerson, D.

    1977-01-01

    Four numerical models are described for predicting mesoscale winds aloft for a 6 h period. These models are all tested statistically against persistence as the control forecast and against predictions made by operational forecasters. Mesoscale winds aloft data were used to initialize the models and to verify the predictions on an hourly basis. The model yielding the smallest root-mean-square vector errors (RMSVE's) was the one based on the most physics which included advection, ageostrophic acceleration, vertical mixing and friction. Horizontal advection was found to be the most important term in reducing the RMSVE's followed by ageostrophic acceleration, vertical advection, surface friction and vertical mixing. From a comparison of the mean absolute errors based on up to 72 independent wind-profile predictions made by operational forecasters, by the most complete model, and by persistence, we conclude that the model is the best wind predictor in the free air. In the boundary layer, the results tend to favor the forecaster for direction predictions. The speed predictions showed no overall superiority in any of these three models

  11. Modeling and prediction of Turkey's electricity consumption using Support Vector Regression

    International Nuclear Information System (INIS)

    Kavaklioglu, Kadir

    2011-01-01

    Support Vector Regression (SVR) methodology is used to model and predict Turkey's electricity consumption. Among various SVR formalisms, ε-SVR method was used since the training pattern set was relatively small. Electricity consumption is modeled as a function of socio-economic indicators such as population, Gross National Product, imports and exports. In order to facilitate future predictions of electricity consumption, a separate SVR model was created for each of the input variables using their current and past values; and these models were combined to yield consumption prediction values. A grid search for the model parameters was performed to find the best ε-SVR model for each variable based on Root Mean Square Error. Electricity consumption of Turkey is predicted until 2026 using data from 1975 to 2006. The results show that electricity consumption can be modeled using Support Vector Regression and the models can be used to predict future electricity consumption. (author)

  12. Optimizing Prediction Using Bayesian Model Averaging: Examples Using Large-Scale Educational Assessments.

    Science.gov (United States)

    Kaplan, David; Lee, Chansoon

    2018-01-01

    This article provides a review of Bayesian model averaging as a means of optimizing the predictive performance of common statistical models applied to large-scale educational assessments. The Bayesian framework recognizes that in addition to parameter uncertainty, there is uncertainty in the choice of models themselves. A Bayesian approach to addressing the problem of model uncertainty is the method of Bayesian model averaging. Bayesian model averaging searches the space of possible models for a set of submodels that satisfy certain scientific principles and then averages the coefficients across these submodels weighted by each model's posterior model probability (PMP). Using the weighted coefficients for prediction has been shown to yield optimal predictive performance according to certain scoring rules. We demonstrate the utility of Bayesian model averaging for prediction in education research with three examples: Bayesian regression analysis, Bayesian logistic regression, and a recently developed approach for Bayesian structural equation modeling. In each case, the model-averaged estimates are shown to yield better prediction of the outcome of interest than any submodel based on predictive coverage and the log-score rule. Implications for the design of large-scale assessments when the goal is optimal prediction in a policy context are discussed.

  13. Quantifying the predictive consequences of model error with linear subspace analysis

    Science.gov (United States)

    White, Jeremy T.; Doherty, John E.; Hughes, Joseph D.

    2014-01-01

    All computer models are simplified and imperfect simulators of complex natural systems. The discrepancy arising from simplification induces bias in model predictions, which may be amplified by the process of model calibration. This paper presents a new method to identify and quantify the predictive consequences of calibrating a simplified computer model. The method is based on linear theory, and it scales efficiently to the large numbers of parameters and observations characteristic of groundwater and petroleum reservoir models. The method is applied to a range of predictions made with a synthetic integrated surface-water/groundwater model with thousands of parameters. Several different observation processing strategies and parameterization/regularization approaches are examined in detail, including use of the Karhunen-Loève parameter transformation. Predictive bias arising from model error is shown to be prediction specific and often invisible to the modeler. The amount of calibration-induced bias is influenced by several factors, including how expert knowledge is applied in the design of parameterization schemes, the number of parameters adjusted during calibration, how observations and model-generated counterparts are processed, and the level of fit with observations achieved through calibration. Failure to properly implement any of these factors in a prediction-specific manner may increase the potential for predictive bias in ways that are not visible to the calibration and uncertainty analysis process.

  14. Predicting Market Impact Costs Using Nonparametric Machine Learning Models.

    Directory of Open Access Journals (Sweden)

    Saerom Park

    Full Text Available Market impact cost is the most significant portion of implicit transaction costs that can reduce the overall transaction cost, although it cannot be measured directly. In this paper, we employed the state-of-the-art nonparametric machine learning models: neural networks, Bayesian neural network, Gaussian process, and support vector regression, to predict market impact cost accurately and to provide the predictive model that is versatile in the number of variables. We collected a large amount of real single transaction data of US stock market from Bloomberg Terminal and generated three independent input variables. As a result, most nonparametric machine learning models outperformed a-state-of-the-art benchmark parametric model such as I-star model in four error measures. Although these models encounter certain difficulties in separating the permanent and temporary cost directly, nonparametric machine learning models can be good alternatives in reducing transaction costs by considerably improving in prediction performance.

  15. Ground Motion Prediction Model Using Artificial Neural Network

    Science.gov (United States)

    Dhanya, J.; Raghukanth, S. T. G.

    2018-03-01

    This article focuses on developing a ground motion prediction equation based on artificial neural network (ANN) technique for shallow crustal earthquakes. A hybrid technique combining genetic algorithm and Levenberg-Marquardt technique is used for training the model. The present model is developed to predict peak ground velocity, and 5% damped spectral acceleration. The input parameters for the prediction are moment magnitude ( M w), closest distance to rupture plane ( R rup), shear wave velocity in the region ( V s30) and focal mechanism ( F). A total of 13,552 ground motion records from 288 earthquakes provided by the updated NGA-West2 database released by Pacific Engineering Research Center are utilized to develop the model. The ANN architecture considered for the model consists of 192 unknowns including weights and biases of all the interconnected nodes. The performance of the model is observed to be within the prescribed error limits. In addition, the results from the study are found to be comparable with the existing relations in the global database. The developed model is further demonstrated by estimating site-specific response spectra for Shimla city located in Himalayan region.

  16. A novel Bayesian hierarchical model for road safety hotspot prediction.

    Science.gov (United States)

    Fawcett, Lee; Thorpe, Neil; Matthews, Joseph; Kremer, Karsten

    2017-02-01

    In this paper, we propose a Bayesian hierarchical model for predicting accident counts in future years at sites within a pool of potential road safety hotspots. The aim is to inform road safety practitioners of the location of likely future hotspots to enable a proactive, rather than reactive, approach to road safety scheme implementation. A feature of our model is the ability to rank sites according to their potential to exceed, in some future time period, a threshold accident count which may be used as a criterion for scheme implementation. Our model specification enables the classical empirical Bayes formulation - commonly used in before-and-after studies, wherein accident counts from a single before period are used to estimate counterfactual counts in the after period - to be extended to incorporate counts from multiple time periods. This allows site-specific variations in historical accident counts (e.g. locally-observed trends) to offset estimates of safety generated by a global accident prediction model (APM), which itself is used to help account for the effects of global trend and regression-to-mean (RTM). The Bayesian posterior predictive distribution is exploited to formulate predictions and to properly quantify our uncertainty in these predictions. The main contributions of our model include (i) the ability to allow accident counts from multiple time-points to inform predictions, with counts in more recent years lending more weight to predictions than counts from time-points further in the past; (ii) where appropriate, the ability to offset global estimates of trend by variations in accident counts observed locally, at a site-specific level; and (iii) the ability to account for unknown/unobserved site-specific factors which may affect accident counts. We illustrate our model with an application to accident counts at 734 potential hotspots in the German city of Halle; we also propose some simple diagnostics to validate the predictive capability of our

  17. Oslo model, hyperuniformity, and the quenched Edwards-Wilkinson model

    Science.gov (United States)

    Grassberger, Peter; Dhar, Deepak; Mohanty, P. K.

    2016-10-01

    We present simulations of the one-dimensional Oslo rice pile model in which the critical height at each site is randomly reset after each toppling. We use the fact that the stationary state of this sand-pile model is hyperuniform to reach system of sizes >107 . Most previous simulations were seriously flawed by important finite-size corrections. We find that all critical exponents have values consistent with simple rationals: ν =4/3 for the correlation length exponent, D =9/4 for the fractal dimension of avalanche clusters, and z =10/7 for the dynamical exponent. In addition, we relate the hyperuniformity exponent to the correlation length exponent ν . Finally, we discuss the relationship with the quenched Edwards-Wilkinson model, where we find in particular that the local roughness exponent is αloc=1 .

  18. A neighborhood statistics model for predicting stream pathogen indicator levels.

    Science.gov (United States)

    Pandey, Pramod K; Pasternack, Gregory B; Majumder, Mahbubul; Soupir, Michelle L; Kaiser, Mark S

    2015-03-01

    Because elevated levels of water-borne Escherichia coli in streams are a leading cause of water quality impairments in the U.S., water-quality managers need tools for predicting aqueous E. coli levels. Presently, E. coli levels may be predicted using complex mechanistic models that have a high degree of unchecked uncertainty or simpler statistical models. To assess spatio-temporal patterns of instream E. coli levels, herein we measured E. coli, a pathogen indicator, at 16 sites (at four different times) within the Squaw Creek watershed, Iowa, and subsequently, the Markov Random Field model was exploited to develop a neighborhood statistics model for predicting instream E. coli levels. Two observed covariates, local water temperature (degrees Celsius) and mean cross-sectional depth (meters), were used as inputs to the model. Predictions of E. coli levels in the water column were compared with independent observational data collected from 16 in-stream locations. The results revealed that spatio-temporal averages of predicted and observed E. coli levels were extremely close. Approximately 66 % of individual predicted E. coli concentrations were within a factor of 2 of the observed values. In only one event, the difference between prediction and observation was beyond one order of magnitude. The mean of all predicted values at 16 locations was approximately 1 % higher than the mean of the observed values. The approach presented here will be useful while assessing instream contaminations such as pathogen/pathogen indicator levels at the watershed scale.

  19. Predicting recycling behaviour: Comparison of a linear regression model and a fuzzy logic model.

    Science.gov (United States)

    Vesely, Stepan; Klöckner, Christian A; Dohnal, Mirko

    2016-03-01

    In this paper we demonstrate that fuzzy logic can provide a better tool for predicting recycling behaviour than the customarily used linear regression. To show this, we take a set of empirical data on recycling behaviour (N=664), which we randomly divide into two halves. The first half is used to estimate a linear regression model of recycling behaviour, and to develop a fuzzy logic model of recycling behaviour. As the first comparison, the fit of both models to the data included in estimation of the models (N=332) is evaluated. As the second comparison, predictive accuracy of both models for "new" cases (hold-out data not included in building the models, N=332) is assessed. In both cases, the fuzzy logic model significantly outperforms the regression model in terms of fit. To conclude, when accurate predictions of recycling and possibly other environmental behaviours are needed, fuzzy logic modelling seems to be a promising technique. Copyright © 2015 Elsevier Ltd. All rights reserved.

  20. Outcome Prediction in Mathematical Models of Immune Response to Infection.

    Directory of Open Access Journals (Sweden)

    Manuel Mai

    Full Text Available Clinicians need to predict patient outcomes with high accuracy as early as possible after disease inception. In this manuscript, we show that patient-to-patient variability sets a fundamental limit on outcome prediction accuracy for a general class of mathematical models for the immune response to infection. However, accuracy can be increased at the expense of delayed prognosis. We investigate several systems of ordinary differential equations (ODEs that model the host immune response to a pathogen load. Advantages of systems of ODEs for investigating the immune response to infection include the ability to collect data on large numbers of 'virtual patients', each with a given set of model parameters, and obtain many time points during the course of the infection. We implement patient-to-patient variability v in the ODE models by randomly selecting the model parameters from distributions with coefficients of variation v that are centered on physiological values. We use logistic regression with one-versus-all classification to predict the discrete steady-state outcomes of the system. We find that the prediction algorithm achieves near 100% accuracy for v = 0, and the accuracy decreases with increasing v for all ODE models studied. The fact that multiple steady-state outcomes can be obtained for a given initial condition, i.e. the basins of attraction overlap in the space of initial conditions, limits the prediction accuracy for v > 0. Increasing the elapsed time of the variables used to train and test the classifier, increases the prediction accuracy, while adding explicit external noise to the ODE models decreases the prediction accuracy. Our results quantify the competition between early prognosis and high prediction accuracy that is frequently encountered by clinicians.

  1. Fuzzy model predictive control algorithm applied in nuclear power plant

    International Nuclear Information System (INIS)

    Zuheir, Ahmad

    2006-01-01

    The aim of this paper is to design a predictive controller based on a fuzzy model. The Takagi-Sugeno fuzzy model with an Adaptive B-splines neuro-fuzzy implementation is used and incorporated as a predictor in a predictive controller. An optimization approach with a simplified gradient technique is used to calculate predictions of the future control actions. In this approach, adaptation of the fuzzy model using dynamic process information is carried out to build the predictive controller. The easy description of the fuzzy model and the easy computation of the gradient sector during the optimization procedure are the main advantages of the computation algorithm. The algorithm is applied to the control of a U-tube steam generation unit (UTSG) used for electricity generation. (author)

  2. Probability-based collaborative filtering model for predicting gene-disease associations.

    Science.gov (United States)

    Zeng, Xiangxiang; Ding, Ningxiang; Rodríguez-Patón, Alfonso; Zou, Quan

    2017-12-28

    Accurately predicting pathogenic human genes has been challenging in recent research. Considering extensive gene-disease data verified by biological experiments, we can apply computational methods to perform accurate predictions with reduced time and expenses. We propose a probability-based collaborative filtering model (PCFM) to predict pathogenic human genes. Several kinds of data sets, containing data of humans and data of other nonhuman species, are integrated in our model. Firstly, on the basis of a typical latent factorization model, we propose model I with an average heterogeneous regularization. Secondly, we develop modified model II with personal heterogeneous regularization to enhance the accuracy of aforementioned models. In this model, vector space similarity or Pearson correlation coefficient metrics and data on related species are also used. We compared the results of PCFM with the results of four state-of-arts approaches. The results show that PCFM performs better than other advanced approaches. PCFM model can be leveraged for predictions of disease genes, especially for new human genes or diseases with no known relationships.

  3. Computationally efficient model predictive control algorithms a neural network approach

    CERN Document Server

    Ławryńczuk, Maciej

    2014-01-01

    This book thoroughly discusses computationally efficient (suboptimal) Model Predictive Control (MPC) techniques based on neural models. The subjects treated include: ·         A few types of suboptimal MPC algorithms in which a linear approximation of the model or of the predicted trajectory is successively calculated on-line and used for prediction. ·         Implementation details of the MPC algorithms for feedforward perceptron neural models, neural Hammerstein models, neural Wiener models and state-space neural models. ·         The MPC algorithms based on neural multi-models (inspired by the idea of predictive control). ·         The MPC algorithms with neural approximation with no on-line linearization. ·         The MPC algorithms with guaranteed stability and robustness. ·         Cooperation between the MPC algorithms and set-point optimization. Thanks to linearization (or neural approximation), the presented suboptimal algorithms do not require d...

  4. Catalytic cracking models developed for predictive control purposes

    Directory of Open Access Journals (Sweden)

    Dag Ljungqvist

    1993-04-01

    Full Text Available The paper deals with state-space modeling issues in the context of model-predictive control, with application to catalytic cracking. Emphasis is placed on model establishment, verification and online adjustment. Both the Fluid Catalytic Cracking (FCC and the Residual Catalytic Cracking (RCC units are discussed. Catalytic cracking units involve complex interactive processes which are difficult to operate and control in an economically optimal way. The strong nonlinearities of the FCC process mean that the control calculation should be based on a nonlinear model with the relevant constraints included. However, the model can be simple compared to the complexity of the catalytic cracking plant. Model validity is ensured by a robust online model adjustment strategy. Model-predictive control schemes based on linear convolution models have been successfully applied to the supervisory dynamic control of catalytic cracking units, and the control can be further improved by the SSPC scheme.

  5. Nothing Else Matters: Model-Agnostic Explanations By Identifying Prediction Invariance

    OpenAIRE

    Ribeiro, Marco Tulio; Singh, Sameer; Guestrin, Carlos

    2016-01-01

    At the core of interpretable machine learning is the question of whether humans are able to make accurate predictions about a model's behavior. Assumed in this question are three properties of the interpretable output: coverage, precision, and effort. Coverage refers to how often humans think they can predict the model's behavior, precision to how accurate humans are in those predictions, and effort is either the up-front effort required in interpreting the model, or the effort required to ma...

  6. Factors Influencing the Predictive Power of Models for Predicting Mortality and/or Heart Failure Hospitalization in Patients With Heart Failure

    NARCIS (Netherlands)

    Ouwerkerk, Wouter; Voors, Adriaan A.; Zwinderman, Aeilko H.

    2014-01-01

    The present paper systematically reviews and compares existing prediction models in order to establish the strongest variables, models, and model characteristics in patients with heart failure predicting outcome. To improve decision making accurately predicting mortality and heart-failure

  7. Cross-Validation of Aerobic Capacity Prediction Models in Adolescents.

    Science.gov (United States)

    Burns, Ryan Donald; Hannon, James C; Brusseau, Timothy A; Eisenman, Patricia A; Saint-Maurice, Pedro F; Welk, Greg J; Mahar, Matthew T

    2015-08-01

    Cardiorespiratory endurance is a component of health-related fitness. FITNESSGRAM recommends the Progressive Aerobic Cardiovascular Endurance Run (PACER) or One mile Run/Walk (1MRW) to assess cardiorespiratory endurance by estimating VO2 Peak. No research has cross-validated prediction models from both PACER and 1MRW, including the New PACER Model and PACER-Mile Equivalent (PACER-MEQ) using current standards. The purpose of this study was to cross-validate prediction models from PACER and 1MRW against measured VO2 Peak in adolescents. Cardiorespiratory endurance data were collected on 90 adolescents aged 13-16 years (Mean = 14.7 ± 1.3 years; 32 girls, 52 boys) who completed the PACER and 1MRW in addition to a laboratory maximal treadmill test to measure VO2 Peak. Multiple correlations among various models with measured VO2 Peak were considered moderately strong (R = .74-0.78), and prediction error (RMSE) ranged from 5.95 ml·kg⁻¹,min⁻¹ to 8.27 ml·kg⁻¹.min⁻¹. Criterion-referenced agreement into FITNESSGRAM's Healthy Fitness Zones was considered fair-to-good among models (Kappa = 0.31-0.62; Agreement = 75.5-89.9%; F = 0.08-0.65). In conclusion, prediction models demonstrated moderately strong linear relationships with measured VO2 Peak, fair prediction error, and fair-to-good criterion referenced agreement with measured VO2 Peak into FITNESSGRAM's Healthy Fitness Zones.

  8. The prediction of epidemics through mathematical modeling.

    Science.gov (United States)

    Schaus, Catherine

    2014-01-01

    Mathematical models may be resorted to in an endeavor to predict the development of epidemics. The SIR model is one of the applications. Still too approximate, the use of statistics awaits more data in order to come closer to reality.

  9. Model-free prediction and regression a transformation-based approach to inference

    CERN Document Server

    Politis, Dimitris N

    2015-01-01

    The Model-Free Prediction Principle expounded upon in this monograph is based on the simple notion of transforming a complex dataset to one that is easier to work with, e.g., i.i.d. or Gaussian. As such, it restores the emphasis on observable quantities, i.e., current and future data, as opposed to unobservable model parameters and estimates thereof, and yields optimal predictors in diverse settings such as regression and time series. Furthermore, the Model-Free Bootstrap takes us beyond point prediction in order to construct frequentist prediction intervals without resort to unrealistic assumptions such as normality. Prediction has been traditionally approached via a model-based paradigm, i.e., (a) fit a model to the data at hand, and (b) use the fitted model to extrapolate/predict future data. Due to both mathematical and computational constraints, 20th century statistical practice focused mostly on parametric models. Fortunately, with the advent of widely accessible powerful computing in the late 1970s, co...

  10. A prediction model for assessing residential radon concentration in Switzerland

    International Nuclear Information System (INIS)

    Hauri, Dimitri D.; Huss, Anke; Zimmermann, Frank; Kuehni, Claudia E.; Röösli, Martin

    2012-01-01

    Indoor radon is regularly measured in Switzerland. However, a nationwide model to predict residential radon levels has not been developed. The aim of this study was to develop a prediction model to assess indoor radon concentrations in Switzerland. The model was based on 44,631 measurements from the nationwide Swiss radon database collected between 1994 and 2004. Of these, 80% randomly selected measurements were used for model development and the remaining 20% for an independent model validation. A multivariable log-linear regression model was fitted and relevant predictors selected according to evidence from the literature, the adjusted R², the Akaike's information criterion (AIC), and the Bayesian information criterion (BIC). The prediction model was evaluated by calculating Spearman rank correlation between measured and predicted values. Additionally, the predicted values were categorised into three categories (50th, 50th–90th and 90th percentile) and compared with measured categories using a weighted Kappa statistic. The most relevant predictors for indoor radon levels were tectonic units and year of construction of the building, followed by soil texture, degree of urbanisation, floor of the building where the measurement was taken and housing type (P-values <0.001 for all). Mean predicted radon values (geometric mean) were 66 Bq/m³ (interquartile range 40–111 Bq/m³) in the lowest exposure category, 126 Bq/m³ (69–215 Bq/m³) in the medium category, and 219 Bq/m³ (108–427 Bq/m³) in the highest category. Spearman correlation between predictions and measurements was 0.45 (95%-CI: 0.44; 0.46) for the development dataset and 0.44 (95%-CI: 0.42; 0.46) for the validation dataset. Kappa coefficients were 0.31 for the development and 0.30 for the validation dataset, respectively. The model explained 20% overall variability (adjusted R²). In conclusion, this residential radon prediction model, based on a large number of measurements, was demonstrated to be

  11. Optimizing Blasting’s Air Overpressure Prediction Model using Swarm Intelligence

    Science.gov (United States)

    Nur Asmawisham Alel, Mohd; Ruben Anak Upom, Mark; Asnida Abdullah, Rini; Hazreek Zainal Abidin, Mohd

    2018-04-01

    Air overpressure (AOp) resulting from blasting can cause damage and nuisance to nearby civilians. Thus, it is important to be able to predict AOp accurately. In this study, 8 different Artificial Neural Network (ANN) were developed for the purpose of prediction of AOp. The ANN models were trained using different variants of Particle Swarm Optimization (PSO) algorithm. AOp predictions were also made using an empirical equation, as suggested by United States Bureau of Mines (USBM), to serve as a benchmark. In order to develop the models, 76 blasting operations in Hulu Langat were investigated. All the ANN models were found to outperform the USBM equation in three performance metrics; root mean square error (RMSE), mean absolute percentage error (MAPE) and coefficient of determination (R2). Using a performance ranking method, MSO-Rand-Mut was determined to be the best prediction model for AOp with a performance metric of RMSE=2.18, MAPE=1.73% and R2=0.97. The result shows that ANN models trained using PSO are capable of predicting AOp with great accuracy.

  12. Predicting carcinogenicity of diverse chemicals using probabilistic neural network modeling approaches

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Kunwar P., E-mail: kpsingh_52@yahoo.com [Academy of Scientific and Innovative Research, Council of Scientific and Industrial Research, New Delhi (India); Environmental Chemistry Division, CSIR-Indian Institute of Toxicology Research, Post Box 80, Mahatma Gandhi Marg, Lucknow 226 001 (India); Gupta, Shikha; Rai, Premanjali [Academy of Scientific and Innovative Research, Council of Scientific and Industrial Research, New Delhi (India); Environmental Chemistry Division, CSIR-Indian Institute of Toxicology Research, Post Box 80, Mahatma Gandhi Marg, Lucknow 226 001 (India)

    2013-10-15

    Robust global models capable of discriminating positive and non-positive carcinogens; and predicting carcinogenic potency of chemicals in rodents were developed. The dataset of 834 structurally diverse chemicals extracted from Carcinogenic Potency Database (CPDB) was used which contained 466 positive and 368 non-positive carcinogens. Twelve non-quantum mechanical molecular descriptors were derived. Structural diversity of the chemicals and nonlinearity in the data were evaluated using Tanimoto similarity index and Brock–Dechert–Scheinkman statistics. Probabilistic neural network (PNN) and generalized regression neural network (GRNN) models were constructed for classification and function optimization problems using the carcinogenicity end point in rat. Validation of the models was performed using the internal and external procedures employing a wide series of statistical checks. PNN constructed using five descriptors rendered classification accuracy of 92.09% in complete rat data. The PNN model rendered classification accuracies of 91.77%, 80.70% and 92.08% in mouse, hamster and pesticide data, respectively. The GRNN constructed with nine descriptors yielded correlation coefficient of 0.896 between the measured and predicted carcinogenic potency with mean squared error (MSE) of 0.44 in complete rat data. The rat carcinogenicity model (GRNN) applied to the mouse and hamster data yielded correlation coefficient and MSE of 0.758, 0.71 and 0.760, 0.46, respectively. The results suggest for wide applicability of the inter-species models in predicting carcinogenic potency of chemicals. Both the PNN and GRNN (inter-species) models constructed here can be useful tools in predicting the carcinogenicity of new chemicals for regulatory purposes. - Graphical abstract: Figure (a) shows classification accuracies (positive and non-positive carcinogens) in rat, mouse, hamster, and pesticide data yielded by optimal PNN model. Figure (b) shows generalization and predictive

  13. Aero-acoustic noise of wind turbines. Noise prediction models

    Energy Technology Data Exchange (ETDEWEB)

    Maribo Pedersen, B. [ed.

    1997-12-31

    Semi-empirical and CAA (Computational AeroAcoustics) noise prediction techniques are the subject of this expert meeting. The meeting presents and discusses models and methods. The meeting may provide answers to the following questions: What Noise sources are the most important? How are the sources best modeled? What needs to be done to do better predictions? Does it boil down to correct prediction of the unsteady aerodynamics around the rotor? Or is the difficult part to convert the aerodynamics into acoustics? (LN)

  14. Predictive assessment of models for dynamic functional connectivity

    DEFF Research Database (Denmark)

    Nielsen, Søren Føns Vind; Schmidt, Mikkel Nørgaard; Madsen, Kristoffer Hougaard

    2018-01-01

    represent functional brain networks as a meta-stable process with a discrete number of states; however, there is a lack of consensus on how to perform model selection and learn the number of states, as well as a lack of understanding of how different modeling assumptions influence the estimated state......In neuroimaging, it has become evident that models of dynamic functional connectivity (dFC), which characterize how intrinsic brain organization changes over time, can provide a more detailed representation of brain function than traditional static analyses. Many dFC models in the literature...... dynamics. To address these issues, we consider a predictive likelihood approach to model assessment, where models are evaluated based on their predictive performance on held-out test data. Examining several prominent models of dFC (in their probabilistic formulations) we demonstrate our framework...

  15. Predicting turns in proteins with a unified model.

    Directory of Open Access Journals (Sweden)

    Qi Song

    Full Text Available MOTIVATION: Turns are a critical element of the structure of a protein; turns play a crucial role in loops, folds, and interactions. Current prediction methods are well developed for the prediction of individual turn types, including α-turn, β-turn, and γ-turn, etc. However, for further protein structure and function prediction it is necessary to develop a uniform model that can accurately predict all types of turns simultaneously. RESULTS: In this study, we present a novel approach, TurnP, which offers the ability to investigate all the turns in a protein based on a unified model. The main characteristics of TurnP are: (i using newly exploited features of structural evolution information (secondary structure and shape string of protein based on structure homologies, (ii considering all types of turns in a unified model, and (iii practical capability of accurate prediction of all turns simultaneously for a query. TurnP utilizes predicted secondary structures and predicted shape strings, both of which have greater accuracy, based on innovative technologies which were both developed by our group. Then, sequence and structural evolution features, which are profile of sequence, profile of secondary structures and profile of shape strings are generated by sequence and structure alignment. When TurnP was validated on a non-redundant dataset (4,107 entries by five-fold cross-validation, we achieved an accuracy of 88.8% and a sensitivity of 71.8%, which exceeded the most state-of-the-art predictors of certain type of turn. Newly determined sequences, the EVA and CASP9 datasets were used as independent tests and the results we achieved were outstanding for turn predictions and confirmed the good performance of TurnP for practical applications.

  16. Modeling Seizure Self-Prediction: An E-Diary Study

    Science.gov (United States)

    Haut, Sheryl R.; Hall, Charles B.; Borkowski, Thomas; Tennen, Howard; Lipton, Richard B.

    2013-01-01

    Purpose A subset of patients with epilepsy successfully self-predicted seizures in a paper diary study. We conducted an e-diary study to ensure that prediction precedes seizures, and to characterize the prodromal features and time windows that underlie self-prediction. Methods Subjects 18 or older with LRE and ≥3 seizures/month maintained an e-diary, reporting AM/PM data daily, including mood, premonitory symptoms, and all seizures. Self-prediction was rated by, “How likely are you to experience a seizure [time frame]”? Five choices ranged from almost certain (>95% chance) to very unlikely. Relative odds of seizure (OR) within time frames was examined using Poisson models with log normal random effects to adjust for multiple observations. Key Findings Nineteen subjects reported 244 eligible seizures. OR for prediction choices within 6hrs was as high as 9.31 (1.92,45.23) for “almost certain”. Prediction was most robust within 6hrs of diary entry, and remained significant up to 12hrs. For 9 best predictors, average sensitivity was 50%. Older age contributed to successful self-prediction, and self-prediction appeared to be driven by mood and premonitory symptoms. In multivariate modeling of seizure occurrence, self-prediction (2.84; 1.68,4.81), favorable change in mood (0.82; 0.67,0.99) and number of premonitory symptoms (1,11; 1.00,1.24) were significant. Significance Some persons with epilepsy can self-predict seizures. In these individuals, the odds of a seizure following a positive prediction are high. Predictions were robust, not attributable to recall bias, and were related to self awareness of mood and premonitory features. The 6-hour prediction window is suitable for the development of pre-emptive therapy. PMID:24111898

  17. A disaggregate model to predict the intercity travel demand

    Energy Technology Data Exchange (ETDEWEB)

    Damodaran, S.

    1988-01-01

    This study was directed towards developing disaggregate models to predict the intercity travel demand in Canada. A conceptual framework for the intercity travel behavior was proposed; under this framework, a nested multinomial model structure that combined mode choice and trip generation was developed. The CTS (Canadian Travel Survey) data base was used for testing the structure and to determine the viability of using this data base for intercity travel-demand prediction. Mode-choice and trip-generation models were calibrated for four modes (auto, bus, rail and air) for both business and non-business trips. The models were linked through the inclusive value variable, also referred to as the long sum of the denominator in the literature. Results of the study indicated that the structure used in this study could be applied for intercity travel-demand modeling. However, some limitations of the data base were identified. It is believed that, with some modifications, the CTS data could be used for predicting intercity travel demand. Future research can identify the factors affecting intercity travel behavior, which will facilitate collection of useful data for intercity travel prediction and policy analysis.

  18. Integrated predictive modelling simulations of burning plasma experiment designs

    International Nuclear Information System (INIS)

    Bateman, Glenn; Onjun, Thawatchai; Kritz, Arnold H

    2003-01-01

    Models for the height of the pedestal at the edge of H-mode plasmas (Onjun T et al 2002 Phys. Plasmas 9 5018) are used together with the Multi-Mode core transport model (Bateman G et al 1998 Phys. Plasmas 5 1793) in the BALDUR integrated predictive modelling code to predict the performance of the ITER (Aymar A et al 2002 Plasma Phys. Control. Fusion 44 519), FIRE (Meade D M et al 2001 Fusion Technol. 39 336), and IGNITOR (Coppi B et al 2001 Nucl. Fusion 41 1253) fusion reactor designs. The simulation protocol used in this paper is tested by comparing predicted temperature and density profiles against experimental data from 33 H-mode discharges in the JET (Rebut P H et al 1985 Nucl. Fusion 25 1011) and DIII-D (Luxon J L et al 1985 Fusion Technol. 8 441) tokamaks. The sensitivities of the predictions are evaluated for the burning plasma experimental designs by using variations of the pedestal temperature model that are one standard deviation above and below the standard model. Simulations of the fusion reactor designs are carried out for scans in which the plasma density and auxiliary heating power are varied

  19. Scalable Joint Models for Reliable Uncertainty-Aware Event Prediction.

    Science.gov (United States)

    Soleimani, Hossein; Hensman, James; Saria, Suchi

    2017-08-21

    Missing data and noisy observations pose significant challenges for reliably predicting events from irregularly sampled multivariate time series (longitudinal) data. Imputation methods, which are typically used for completing the data prior to event prediction, lack a principled mechanism to account for the uncertainty due to missingness. Alternatively, state-of-the-art joint modeling techniques can be used for jointly modeling the longitudinal and event data and compute event probabilities conditioned on the longitudinal observations. These approaches, however, make strong parametric assumptions and do not easily scale to multivariate signals with many observations. Our proposed approach consists of several key innovations. First, we develop a flexible and scalable joint model based upon sparse multiple-output Gaussian processes. Unlike state-of-the-art joint models, the proposed model can explain highly challenging structure including non-Gaussian noise while scaling to large data. Second, we derive an optimal policy for predicting events using the distribution of the event occurrence estimated by the joint model. The derived policy trades-off the cost of a delayed detection versus incorrect assessments and abstains from making decisions when the estimated event probability does not satisfy the derived confidence criteria. Experiments on a large dataset show that the proposed framework significantly outperforms state-of-the-art techniques in event prediction.

  20. Coupled Model of Artificial Neural Network and Grey Model for Tendency Prediction of Labor Turnover

    Directory of Open Access Journals (Sweden)

    Yueru Ma

    2014-01-01

    Full Text Available The tendency of labor turnover in the Chinese enterprise shows the characteristics of seasonal fluctuations and irregular distribution of various factors, especially the Chinese traditional social and cultural characteristics. In this paper, we present a coupled model for the tendency prediction of labor turnover. In the model, a time series of tendency prediction of labor turnover was expressed as trend item and its random item. Trend item of tendency prediction of labor turnover is predicted using Grey theory. Random item of trend item is calculated by artificial neural network model (ANN. A case study is presented by the data of 24 months in a Chinese matured enterprise. The model uses the advantages of “accumulative generation” of a Grey prediction method, which weakens the original sequence of random disturbance factors and increases the regularity of data. It also takes full advantage of the ANN model approximation performance, which has a capacity to solve economic problems rapidly, describes the nonlinear relationship easily, and avoids the defects of Grey theory.

  1. Validation of a predictive model for smart control of electrical energy storage

    NARCIS (Netherlands)

    Homan, Bart; van Leeuwen, Richard Pieter; Smit, Gerardus Johannes Maria; Zhu, Lei; de Wit, Jan B.

    2016-01-01

    The purpose of this paper is to investigate the applicability of a relatively simple model which is based on energy conservation for model predictions as part of smart control of thermal and electric storage. The paper reviews commonly used predictive models. Model predictions of charging and

  2. Standardizing the performance evaluation of short-term wind prediction models

    DEFF Research Database (Denmark)

    Madsen, Henrik; Pinson, Pierre; Kariniotakis, G.

    2005-01-01

    Short-term wind power prediction is a primary requirement for efficient large-scale integration of wind generation in power systems and electricity markets. The choice of an appropriate prediction model among the numerous available models is not trivial, and has to be based on an objective...... evaluation of model performance. This paper proposes a standardized protocol for the evaluation of short-term wind-poser preciction systems. A number of reference prediction models are also described, and their use for performance comparison is analysed. The use of the protocol is demonstrated using results...... from both on-shore and off-shore wind forms. The work was developed in the frame of the Anemos project (EU R&D project) where the protocol has been used to evaluate more than 10 prediction systems....

  3. Evaluating predictive models of software quality

    International Nuclear Information System (INIS)

    Ciaschini, V; Canaparo, M; Ronchieri, E; Salomoni, D

    2014-01-01

    Applications from High Energy Physics scientific community are constantly growing and implemented by a large number of developers. This implies a strong churn on the code and an associated risk of faults, which is unavoidable as long as the software undergoes active evolution. However, the necessities of production systems run counter to this. Stability and predictability are of paramount importance; in addition, a short turn-around time for the defect discovery-correction-deployment cycle is required. A way to reconcile these opposite foci is to use a software quality model to obtain an approximation of the risk before releasing a program to only deliver software with a risk lower than an agreed threshold. In this article we evaluated two quality predictive models to identify the operational risk and the quality of some software products. We applied these models to the development history of several EMI packages with intent to discover the risk factor of each product and compare it with its real history. We attempted to determine if the models reasonably maps reality for the applications under evaluation, and finally we concluded suggesting directions for further studies.

  4. Evaluating Predictive Models of Software Quality

    Science.gov (United States)

    Ciaschini, V.; Canaparo, M.; Ronchieri, E.; Salomoni, D.

    2014-06-01

    Applications from High Energy Physics scientific community are constantly growing and implemented by a large number of developers. This implies a strong churn on the code and an associated risk of faults, which is unavoidable as long as the software undergoes active evolution. However, the necessities of production systems run counter to this. Stability and predictability are of paramount importance; in addition, a short turn-around time for the defect discovery-correction-deployment cycle is required. A way to reconcile these opposite foci is to use a software quality model to obtain an approximation of the risk before releasing a program to only deliver software with a risk lower than an agreed threshold. In this article we evaluated two quality predictive models to identify the operational risk and the quality of some software products. We applied these models to the development history of several EMI packages with intent to discover the risk factor of each product and compare it with its real history. We attempted to determine if the models reasonably maps reality for the applications under evaluation, and finally we concluded suggesting directions for further studies.

  5. Driver's mental workload prediction model based on physiological indices.

    Science.gov (United States)

    Yan, Shengyuan; Tran, Cong Chi; Wei, Yingying; Habiyaremye, Jean Luc

    2017-09-15

    Developing an early warning model to predict the driver's mental workload (MWL) is critical and helpful, especially for new or less experienced drivers. The present study aims to investigate the correlation between new drivers' MWL and their work performance, regarding the number of errors. Additionally, the group method of data handling is used to establish the driver's MWL predictive model based on subjective rating (NASA task load index [NASA-TLX]) and six physiological indices. The results indicate that the NASA-TLX and the number of errors are positively correlated, and the predictive model shows the validity of the proposed model with an R 2 value of 0.745. The proposed model is expected to provide a reference value for the new drivers of their MWL by providing the physiological indices, and the driving lesson plans can be proposed to sustain an appropriate MWL as well as improve the driver's work performance.

  6. Protein (Viridiplantae): 786990 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 79506 Solanum tuberosum MEETSTSSNNAKAKARVRVCITRKKTLKDKRAKLYIIRRCLYMLLCWKERAEFCNVGNRESTA ...3993 4070:3993 ... 424551:3993 ... 424574:3993 ... 4107:3993 ... 4113:2476 ... PREDICTED: uncharacterized protein LOC1025

  7. Bayesian Genomic Prediction with Genotype × Environment Interaction Kernel Models

    Science.gov (United States)

    Cuevas, Jaime; Crossa, José; Montesinos-López, Osval A.; Burgueño, Juan; Pérez-Rodríguez, Paulino; de los Campos, Gustavo

    2016-01-01

    The phenomenon of genotype × environment (G × E) interaction in plant breeding decreases selection accuracy, thereby negatively affecting genetic gains. Several genomic prediction models incorporating G × E have been recently developed and used in genomic selection of plant breeding programs. Genomic prediction models for assessing multi-environment G × E interaction are extensions of a single-environment model, and have advantages and limitations. In this study, we propose two multi-environment Bayesian genomic models: the first model considers genetic effects (u) that can be assessed by the Kronecker product of variance–covariance matrices of genetic correlations between environments and genomic kernels through markers under two linear kernel methods, linear (genomic best linear unbiased predictors, GBLUP) and Gaussian (Gaussian kernel, GK). The other model has the same genetic component as the first model (u) plus an extra component, f, that captures random effects between environments that were not captured by the random effects u. We used five CIMMYT data sets (one maize and four wheat) that were previously used in different studies. Results show that models with G × E always have superior prediction ability than single-environment models, and the higher prediction ability of multi-environment models with u and f over the multi-environment model with only u occurred 85% of the time with GBLUP and 45% of the time with GK across the five data sets. The latter result indicated that including the random effect f is still beneficial for increasing prediction ability after adjusting by the random effect u. PMID:27793970

  8. Bayesian Genomic Prediction with Genotype × Environment Interaction Kernel Models

    Directory of Open Access Journals (Sweden)

    Jaime Cuevas

    2017-01-01

    Full Text Available The phenomenon of genotype × environment (G × E interaction in plant breeding decreases selection accuracy, thereby negatively affecting genetic gains. Several genomic prediction models incorporating G × E have been recently developed and used in genomic selection of plant breeding programs. Genomic prediction models for assessing multi-environment G × E interaction are extensions of a single-environment model, and have advantages and limitations. In this study, we propose two multi-environment Bayesian genomic models: the first model considers genetic effects ( u that can be assessed by the Kronecker product of variance–covariance matrices of genetic correlations between environments and genomic kernels through markers under two linear kernel methods, linear (genomic best linear unbiased predictors, GBLUP and Gaussian (Gaussian kernel, GK. The other model has the same genetic component as the first model ( u plus an extra component, f, that captures random effects between environments that were not captured by the random effects u . We used five CIMMYT data sets (one maize and four wheat that were previously used in different studies. Results show that models with G × E always have superior prediction ability than single-environment models, and the higher prediction ability of multi-environment models with u   and   f over the multi-environment model with only u occurred 85% of the time with GBLUP and 45% of the time with GK across the five data sets. The latter result indicated that including the random effect f is still beneficial for increasing prediction ability after adjusting by the random effect u .

  9. Statistical models for expert judgement and wear prediction

    International Nuclear Information System (INIS)

    Pulkkinen, U.

    1994-01-01

    This thesis studies the statistical analysis of expert judgements and prediction of wear. The point of view adopted is the one of information theory and Bayesian statistics. A general Bayesian framework for analyzing both the expert judgements and wear prediction is presented. Information theoretic interpretations are given for some averaging techniques used in the determination of consensus distributions. Further, information theoretic models are compared with a Bayesian model. The general Bayesian framework is then applied in analyzing expert judgements based on ordinal comparisons. In this context, the value of information lost in the ordinal comparison process is analyzed by applying decision theoretic concepts. As a generalization of the Bayesian framework, stochastic filtering models for wear prediction are formulated. These models utilize the information from condition monitoring measurements in updating the residual life distribution of mechanical components. Finally, the application of stochastic control models in optimizing operational strategies for inspected components are studied. Monte-Carlo simulation methods, such as the Gibbs sampler and the stochastic quasi-gradient method, are applied in the determination of posterior distributions and in the solution of stochastic optimization problems. (orig.) (57 refs., 7 figs., 1 tab.)

  10. Extensions of the Rosner-Colditz breast cancer prediction model to include older women and type-specific predicted risk.

    Science.gov (United States)

    Glynn, Robert J; Colditz, Graham A; Tamimi, Rulla M; Chen, Wendy Y; Hankinson, Susan E; Willett, Walter W; Rosner, Bernard

    2017-08-01

    A breast cancer risk prediction rule previously developed by Rosner and Colditz has reasonable predictive ability. We developed a re-fitted version of this model, based on more than twice as many cases now including women up to age 85, and further extended it to a model that distinguished risk factor prediction of tumors with different estrogen/progesterone receptor status. We compared the calibration and discriminatory ability of the original, the re-fitted, and the type-specific models. Evaluation used data from the Nurses' Health Study during the period 1980-2008, when 4384 incident invasive breast cancers occurred over 1.5 million person-years. Model development used two-thirds of study subjects and validation used one-third. Predicted risks in the validation sample from the original and re-fitted models were highly correlated (ρ = 0.93), but several parameters, notably those related to use of menopausal hormone therapy and age, had different estimates. The re-fitted model was well-calibrated and had an overall C-statistic of 0.65. The extended, type-specific model identified several risk factors with varying associations with occurrence of tumors of different receptor status. However, this extended model relative to the prediction of any breast cancer did not meaningfully reclassify women who developed breast cancer to higher risk categories, nor women remaining cancer free to lower risk categories. The re-fitted Rosner-Colditz model has applicability to risk prediction in women up to age 85, and its discrimination is not improved by consideration of varying associations across tumor subtypes.

  11. Improved Modeling and Prediction of Surface Wave Amplitudes

    Science.gov (United States)

    2017-05-31

    AFRL-RV-PS- AFRL-RV-PS- TR-2017-0162 TR-2017-0162 IMPROVED MODELING AND PREDICTION OF SURFACE WAVE AMPLITUDES Jeffry L. Stevens, et al. Leidos...data does not license the holder or any other person or corporation; or convey any rights or permission to manufacture, use, or sell any patented...SUBTITLE Improved Modeling and Prediction of Surface Wave Amplitudes 5a. CONTRACT NUMBER FA9453-14-C-0225 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER

  12. Rate-Based Model Predictive Control of Turbofan Engine Clearance

    Science.gov (United States)

    DeCastro, Jonathan A.

    2006-01-01

    An innovative model predictive control strategy is developed for control of nonlinear aircraft propulsion systems and sub-systems. At the heart of the controller is a rate-based linear parameter-varying model that propagates the state derivatives across the prediction horizon, extending prediction fidelity to transient regimes where conventional models begin to lose validity. The new control law is applied to a demanding active clearance control application, where the objectives are to tightly regulate blade tip clearances and also anticipate and avoid detrimental blade-shroud rub occurrences by optimally maintaining a predefined minimum clearance. Simulation results verify that the rate-based controller is capable of satisfying the objectives during realistic flight scenarios where both a conventional Jacobian-based model predictive control law and an unconstrained linear-quadratic optimal controller are incapable of doing so. The controller is evaluated using a variety of different actuators, illustrating the efficacy and versatility of the control approach. It is concluded that the new strategy has promise for this and other nonlinear aerospace applications that place high importance on the attainment of control objectives during transient regimes.

  13. Seismic attenuation relationship with homogeneous and heterogeneous prediction-error variance models

    Science.gov (United States)

    Mu, He-Qing; Xu, Rong-Rong; Yuen, Ka-Veng

    2014-03-01

    Peak ground acceleration (PGA) estimation is an important task in earthquake engineering practice. One of the most well-known models is the Boore-Joyner-Fumal formula, which estimates the PGA using the moment magnitude, the site-to-fault distance and the site foundation properties. In the present study, the complexity for this formula and the homogeneity assumption for the prediction-error variance are investigated and an efficiency-robustness balanced formula is proposed. For this purpose, a reduced-order Monte Carlo simulation algorithm for Bayesian model class selection is presented to obtain the most suitable predictive formula and prediction-error model for the seismic attenuation relationship. In this approach, each model class (a predictive formula with a prediction-error model) is evaluated according to its plausibility given the data. The one with the highest plausibility is robust since it possesses the optimal balance between the data fitting capability and the sensitivity to noise. A database of strong ground motion records in the Tangshan region of China is obtained from the China Earthquake Data Center for the analysis. The optimal predictive formula is proposed based on this database. It is shown that the proposed formula with heterogeneous prediction-error variance is much simpler than the attenuation model suggested by Boore, Joyner and Fumal (1993).

  14. Improving Saliency Models by Predicting Human Fixation Patches

    KAUST Repository

    Dubey, Rachit

    2015-04-16

    There is growing interest in studying the Human Visual System (HVS) to supplement and improve the performance of computer vision tasks. A major challenge for current visual saliency models is predicting saliency in cluttered scenes (i.e. high false positive rate). In this paper, we propose a fixation patch detector that predicts image patches that contain human fixations with high probability. Our proposed model detects sparse fixation patches with an accuracy of 84 % and eliminates non-fixation patches with an accuracy of 84 % demonstrating that low-level image features can indeed be used to short-list and identify human fixation patches. We then show how these detected fixation patches can be used as saliency priors for popular saliency models, thus, reducing false positives while maintaining true positives. Extensive experimental results show that our proposed approach allows state-of-the-art saliency methods to achieve better prediction performance on benchmark datasets.

  15. Improving Saliency Models by Predicting Human Fixation Patches

    KAUST Repository

    Dubey, Rachit; Dave, Akshat; Ghanem, Bernard

    2015-01-01

    There is growing interest in studying the Human Visual System (HVS) to supplement and improve the performance of computer vision tasks. A major challenge for current visual saliency models is predicting saliency in cluttered scenes (i.e. high false positive rate). In this paper, we propose a fixation patch detector that predicts image patches that contain human fixations with high probability. Our proposed model detects sparse fixation patches with an accuracy of 84 % and eliminates non-fixation patches with an accuracy of 84 % demonstrating that low-level image features can indeed be used to short-list and identify human fixation patches. We then show how these detected fixation patches can be used as saliency priors for popular saliency models, thus, reducing false positives while maintaining true positives. Extensive experimental results show that our proposed approach allows state-of-the-art saliency methods to achieve better prediction performance on benchmark datasets.

  16. An Intelligent Model for Stock Market Prediction

    Directory of Open Access Journals (Sweden)

    IbrahimM. Hamed

    2012-08-01

    Full Text Available This paper presents an intelligent model for stock market signal prediction using Multi-Layer Perceptron (MLP Artificial Neural Networks (ANN. Blind source separation technique, from signal processing, is integrated with the learning phase of the constructed baseline MLP ANN to overcome the problems of prediction accuracy and lack of generalization. Kullback Leibler Divergence (KLD is used, as a learning algorithm, because it converges fast and provides generalization in the learning mechanism. Both accuracy and efficiency of the proposed model were confirmed through the Microsoft stock, from wall-street market, and various data sets, from different sectors of the Egyptian stock market. In addition, sensitivity analysis was conducted on the various parameters of the model to ensure the coverage of the generalization issue. Finally, statistical significance was examined using ANOVA test.

  17. Mixing-model Sensitivity to Initial Conditions in Hydrodynamic Predictions

    Science.gov (United States)

    Bigelow, Josiah; Silva, Humberto; Truman, C. Randall; Vorobieff, Peter

    2017-11-01

    Amagat and Dalton mixing-models were studied to compare their thermodynamic prediction of shock states. Numerical simulations with the Sandia National Laboratories shock hydrodynamic code CTH modeled University of New Mexico (UNM) shock tube laboratory experiments shocking a 1:1 molar mixture of helium (He) and sulfur hexafluoride (SF6) . Five input parameters were varied for sensitivity analysis: driver section pressure, driver section density, test section pressure, test section density, and mixture ratio (mole fraction). We show via incremental Latin hypercube sampling (LHS) analysis that significant differences exist between Amagat and Dalton mixing-model predictions. The differences observed in predicted shock speeds, temperatures, and pressures grow more pronounced with higher shock speeds. Supported by NNSA Grant DE-0002913.

  18. Prediction Model for Relativistic Electrons at Geostationary Orbit

    Science.gov (United States)

    Khazanov, George V.; Lyatsky, Wladislaw

    2008-01-01

    We developed a new prediction model for forecasting relativistic (greater than 2MeV) electrons, which provides a VERY HIGH correlation between predicted and actually measured electron fluxes at geostationary orbit. This model implies the multi-step particle acceleration and is based on numerical integrating two linked continuity equations for primarily accelerated particles and relativistic electrons. The model includes a source and losses, and used solar wind data as only input parameters. We used the coupling function which is a best-fit combination of solar wind/interplanetary magnetic field parameters, responsible for the generation of geomagnetic activity, as a source. The loss function was derived from experimental data. We tested the model for four year period 2004-2007. The correlation coefficient between predicted and actual values of the electron fluxes for whole four year period as well as for each of these years is stable and incredibly high (about 0.9). The high and stable correlation between the computed and actual electron fluxes shows that the reliable forecasting these electrons at geostationary orbit is possible.

  19. Model Predictive Control of Sewer Networks

    DEFF Research Database (Denmark)

    Pedersen, Einar B.; Herbertsson, Hannes R.; Niemann, Henrik

    2016-01-01

    The developments in solutions for management of urban drainage are of vital importance, as the amount of sewer water from urban areas continues to increase due to the increase of the world’s population and the change in the climate conditions. How a sewer network is structured, monitored and cont...... benchmark model. Due to the inherent constraints the applied approach is based on Model Predictive Control....

  20. Development of estrogen receptor beta binding prediction model using large sets of chemicals.

    Science.gov (United States)

    Sakkiah, Sugunadevi; Selvaraj, Chandrabose; Gong, Ping; Zhang, Chaoyang; Tong, Weida; Hong, Huixiao

    2017-11-03

    We developed an ER β binding prediction model to facilitate identification of chemicals specifically bind ER β or ER α together with our previously developed ER α binding model. Decision Forest was used to train ER β binding prediction model based on a large set of compounds obtained from EADB. Model performance was estimated through 1000 iterations of 5-fold cross validations. Prediction confidence was analyzed using predictions from the cross validations. Informative chemical features for ER β binding were identified through analysis of the frequency data of chemical descriptors used in the models in the 5-fold cross validations. 1000 permutations were conducted to assess the chance correlation. The average accuracy of 5-fold cross validations was 93.14% with a standard deviation of 0.64%. Prediction confidence analysis indicated that the higher the prediction confidence the more accurate the predictions. Permutation testing results revealed that the prediction model is unlikely generated by chance. Eighteen informative descriptors were identified to be important to ER β binding prediction. Application of the prediction model to the data from ToxCast project yielded very high sensitivity of 90-92%. Our results demonstrated ER β binding of chemicals could be accurately predicted using the developed model. Coupling with our previously developed ER α prediction model, this model could be expected to facilitate drug development through identification of chemicals that specifically bind ER β or ER α .

  1. Robust Model Predictive Control of a Wind Turbine

    DEFF Research Database (Denmark)

    Mirzaei, Mahmood; Poulsen, Niels Kjølstad; Niemann, Hans Henrik

    2012-01-01

    In this work the problem of robust model predictive control (robust MPC) of a wind turbine in the full load region is considered. A minimax robust MPC approach is used to tackle the problem. Nonlinear dynamics of the wind turbine are derived by combining blade element momentum (BEM) theory...... of the uncertain system is employed and a norm-bounded uncertainty model is used to formulate a minimax model predictive control. The resulting optimization problem is simplified by semidefinite relaxation and the controller obtained is applied on a full complexity, high fidelity wind turbine model. Finally...... and first principle modeling of the turbine flexible structure. Thereafter the nonlinear model is linearized using Taylor series expansion around system operating points. Operating points are determined by effective wind speed and an extended Kalman filter (EKF) is employed to estimate this. In addition...

  2. Optimal model-free prediction from multivariate time series

    Science.gov (United States)

    Runge, Jakob; Donner, Reik V.; Kurths, Jürgen

    2015-05-01

    Forecasting a time series from multivariate predictors constitutes a challenging problem, especially using model-free approaches. Most techniques, such as nearest-neighbor prediction, quickly suffer from the curse of dimensionality and overfitting for more than a few predictors which has limited their application mostly to the univariate case. Therefore, selection strategies are needed that harness the available information as efficiently as possible. Since often the right combination of predictors matters, ideally all subsets of possible predictors should be tested for their predictive power, but the exponentially growing number of combinations makes such an approach computationally prohibitive. Here a prediction scheme that overcomes this strong limitation is introduced utilizing a causal preselection step which drastically reduces the number of possible predictors to the most predictive set of causal drivers making a globally optimal search scheme tractable. The information-theoretic optimality is derived and practical selection criteria are discussed. As demonstrated for multivariate nonlinear stochastic delay processes, the optimal scheme can even be less computationally expensive than commonly used suboptimal schemes like forward selection. The method suggests a general framework to apply the optimal model-free approach to select variables and subsequently fit a model to further improve a prediction or learn statistical dependencies. The performance of this framework is illustrated on a climatological index of El Niño Southern Oscillation.

  3. The prediction of surface temperature in the new seasonal prediction system based on the MPI-ESM coupled climate model

    Science.gov (United States)

    Baehr, J.; Fröhlich, K.; Botzet, M.; Domeisen, D. I. V.; Kornblueh, L.; Notz, D.; Piontek, R.; Pohlmann, H.; Tietsche, S.; Müller, W. A.

    2015-05-01

    A seasonal forecast system is presented, based on the global coupled climate model MPI-ESM as used for CMIP5 simulations. We describe the initialisation of the system and analyse its predictive skill for surface temperature. The presented system is initialised in the atmospheric, oceanic, and sea ice component of the model from reanalysis/observations with full field nudging in all three components. For the initialisation of the ensemble, bred vectors with a vertically varying norm are implemented in the ocean component to generate initial perturbations. In a set of ensemble hindcast simulations, starting each May and November between 1982 and 2010, we analyse the predictive skill. Bias-corrected ensemble forecasts for each start date reproduce the observed surface temperature anomalies at 2-4 months lead time, particularly in the tropics. Niño3.4 sea surface temperature anomalies show a small root-mean-square error and predictive skill up to 6 months. Away from the tropics, predictive skill is mostly limited to the ocean, and to regions which are strongly influenced by ENSO teleconnections. In summary, the presented seasonal prediction system based on a coupled climate model shows predictive skill for surface temperature at seasonal time scales comparable to other seasonal prediction systems using different underlying models and initialisation strategies. As the same model underlying our seasonal prediction system—with a different initialisation—is presently also used for decadal predictions, this is an important step towards seamless seasonal-to-decadal climate predictions.

  4. FINITE ELEMENT MODEL FOR PREDICTING RESIDUAL ...

    African Journals Online (AJOL)

    FINITE ELEMENT MODEL FOR PREDICTING RESIDUAL STRESSES IN ... the transverse residual stress in the x-direction (σx) had a maximum value of 375MPa ... the finite element method are in fair agreement with the experimental results.

  5. A stepwise model to predict monthly streamflow

    Science.gov (United States)

    Mahmood Al-Juboori, Anas; Guven, Aytac

    2016-12-01

    In this study, a stepwise model empowered with genetic programming is developed to predict the monthly flows of Hurman River in Turkey and Diyalah and Lesser Zab Rivers in Iraq. The model divides the monthly flow data to twelve intervals representing the number of months in a year. The flow of a month, t is considered as a function of the antecedent month's flow (t - 1) and it is predicted by multiplying the antecedent monthly flow by a constant value called K. The optimum value of K is obtained by a stepwise procedure which employs Gene Expression Programming (GEP) and Nonlinear Generalized Reduced Gradient Optimization (NGRGO) as alternative to traditional nonlinear regression technique. The degree of determination and root mean squared error are used to evaluate the performance of the proposed models. The results of the proposed model are compared with the conventional Markovian and Auto Regressive Integrated Moving Average (ARIMA) models based on observed monthly flow data. The comparison results based on five different statistic measures show that the proposed stepwise model performed better than Markovian model and ARIMA model. The R2 values of the proposed model range between 0.81 and 0.92 for the three rivers in this study.

  6. Updated climatological model predictions of ionospheric and HF propagation parameters

    International Nuclear Information System (INIS)

    Reilly, M.H.; Rhoads, F.J.; Goodman, J.M.; Singh, M.

    1991-01-01

    The prediction performances of several climatological models, including the ionospheric conductivity and electron density model, RADAR C, and Ionospheric Communications Analysis and Predictions Program, are evaluated for different regions and sunspot number inputs. Particular attention is given to the near-real-time (NRT) predictions associated with single-station updates. It is shown that a dramatic improvement can be obtained by using single-station ionospheric data to update the driving parameters for an ionospheric model for NRT predictions of f(0)F2 and other ionospheric and HF circuit parameters. For middle latitudes, the improvement extends out thousands of kilometers from the update point to points of comparable corrected geomagnetic latitude. 10 refs

  7. Spectral Neugebauer-based color halftone prediction model accounting for paper fluorescence.

    Science.gov (United States)

    Hersch, Roger David

    2014-08-20

    We present a spectral model for predicting the fluorescent emission and the total reflectance of color halftones printed on optically brightened paper. By relying on extended Neugebauer models, the proposed model accounts for the attenuation by the ink halftones of both the incident exciting light in the UV wavelength range and the emerging fluorescent emission in the visible wavelength range. The total reflectance is predicted by adding the predicted fluorescent emission relative to the incident light and the pure reflectance predicted with an ink-spreading enhanced Yule-Nielsen modified Neugebauer reflectance prediction model. The predicted fluorescent emission spectrum as a function of the amounts of cyan, magenta, and yellow inks is very accurate. It can be useful to paper and ink manufacturers who would like to study in detail the contribution of the fluorescent brighteners and the attenuation of the fluorescent emission by ink halftones.

  8. Key Questions in Building Defect Prediction Models in Practice

    Science.gov (United States)

    Ramler, Rudolf; Wolfmaier, Klaus; Stauder, Erwin; Kossak, Felix; Natschläger, Thomas

    The information about which modules of a future version of a software system are defect-prone is a valuable planning aid for quality managers and testers. Defect prediction promises to indicate these defect-prone modules. However, constructing effective defect prediction models in an industrial setting involves a number of key questions. In this paper we discuss ten key questions identified in context of establishing defect prediction in a large software development project. Seven consecutive versions of the software system have been used to construct and validate defect prediction models for system test planning. Furthermore, the paper presents initial empirical results from the studied project and, by this means, contributes answers to the identified questions.

  9. Comprehensive fluence model for absolute portal dose image prediction

    International Nuclear Information System (INIS)

    Chytyk, K.; McCurdy, B. M. C.

    2009-01-01

    Amorphous silicon (a-Si) electronic portal imaging devices (EPIDs) continue to be investigated as treatment verification tools, with a particular focus on intensity modulated radiation therapy (IMRT). This verification could be accomplished through a comparison of measured portal images to predicted portal dose images. A general fluence determination tailored to portal dose image prediction would be a great asset in order to model the complex modulation of IMRT. A proposed physics-based parameter fluence model was commissioned by matching predicted EPID images to corresponding measured EPID images of multileaf collimator (MLC) defined fields. The two-source fluence model was composed of a focal Gaussian and an extrafocal Gaussian-like source. Specific aspects of the MLC and secondary collimators were also modeled (e.g., jaw and MLC transmission factors, MLC rounded leaf tips, tongue and groove effect, interleaf leakage, and leaf offsets). Several unique aspects of the model were developed based on the results of detailed Monte Carlo simulations of the linear accelerator including (1) use of a non-Gaussian extrafocal fluence source function, (2) separate energy spectra used for focal and extrafocal fluence, and (3) different off-axis energy spectra softening used for focal and extrafocal fluences. The predicted energy fluence was then convolved with Monte Carlo generated, EPID-specific dose kernels to convert incident fluence to dose delivered to the EPID. Measured EPID data were obtained with an a-Si EPID for various MLC-defined fields (from 1x1 to 20x20 cm 2 ) over a range of source-to-detector distances. These measured profiles were used to determine the fluence model parameters in a process analogous to the commissioning of a treatment planning system. The resulting model was tested on 20 clinical IMRT plans, including ten prostate and ten oropharyngeal cases. The model predicted the open-field profiles within 2%, 2 mm, while a mean of 96.6% of pixels over all

  10. Predictive model for survival in patients with gastric cancer.

    Science.gov (United States)

    Goshayeshi, Ladan; Hoseini, Benyamin; Yousefli, Zahra; Khooie, Alireza; Etminani, Kobra; Esmaeilzadeh, Abbas; Golabpour, Amin

    2017-12-01

    Gastric cancer is one of the most prevalent cancers in the world. Characterized by poor prognosis, it is a frequent cause of cancer in Iran. The aim of the study was to design a predictive model of survival time for patients suffering from gastric cancer. This was a historical cohort conducted between 2011 and 2016. Study population were 277 patients suffering from gastric cancer. Data were gathered from the Iranian Cancer Registry and the laboratory of Emam Reza Hospital in Mashhad, Iran. Patients or their relatives underwent interviews where it was needed. Missing values were imputed by data mining techniques. Fifteen factors were analyzed. Survival was addressed as a dependent variable. Then, the predictive model was designed by combining both genetic algorithm and logistic regression. Matlab 2014 software was used to combine them. Of the 277 patients, only survival of 80 patients was available whose data were used for designing the predictive model. Mean ?SD of missing values for each patient was 4.43?.41 combined predictive model achieved 72.57% accuracy. Sex, birth year, age at diagnosis time, age at diagnosis time of patients' family, family history of gastric cancer, and family history of other gastrointestinal cancers were six parameters associated with patient survival. The study revealed that imputing missing values by data mining techniques have a good accuracy. And it also revealed six parameters extracted by genetic algorithm effect on the survival of patients with gastric cancer. Our combined predictive model, with a good accuracy, is appropriate to forecast the survival of patients suffering from Gastric cancer. So, we suggest policy makers and specialists to apply it for prediction of patients' survival.

  11. Radionuclides in fruit systems: Model prediction-experimental data intercomparison study

    International Nuclear Information System (INIS)

    Ould-Dada, Z.; Carini, F.; Eged, K.; Kis, Z.; Linkov, I.; Mitchell, N.G.; Mourlon, C.; Robles, B.; Sweeck, L.; Venter, A.

    2006-01-01

    This paper presents results from an international exercise undertaken to test model predictions against an independent data set for the transfer of radioactivity to fruit. Six models with various structures and complexity participated in this exercise. Predictions from these models were compared against independent experimental measurements on the transfer of 134 Cs and 85 Sr via leaf-to-fruit and soil-to-fruit in strawberry plants after an acute release. Foliar contamination was carried out through wet deposition on the plant at two different growing stages, anthesis and ripening, while soil contamination was effected at anthesis only. In the case of foliar contamination, predicted values are within the same order of magnitude as the measured values for both radionuclides, while in the case of soil contamination models tend to under-predict by up to three orders of magnitude for 134 Cs, while differences for 85 Sr are lower. Performance of models against experimental data is discussed together with the lessons learned from this exercise

  12. Prediction models in in vitro fertilization; where are we? A mini review

    Directory of Open Access Journals (Sweden)

    Laura van Loendersloot

    2014-05-01

    Full Text Available Since the introduction of in vitro fertilization (IVF in 1978, over five million babies have been born worldwide using IVF. Contrary to the perception of many, IVF does not guarantee success. Almost 50% of couples that start IVF will remain childless, even if they undergo multiple IVF cycles. The decision to start or pursue with IVF is challenging due to the high cost, the burden of the treatment, and the uncertain outcome. In optimal counseling on chances of a pregnancy with IVF, prediction models may play a role, since doctors are not able to correctly predict pregnancy chances. There are three phases of prediction model development: model derivation, model validation, and impact analysis. This review provides an overview on predictive factors in IVF, the available prediction models in IVF and provides key principles that can be used to critically appraise the literature on prediction models in IVF. We will address these points by the three phases of model development.

  13. Using a Prediction Model to Manage Cyber Security Threats

    Directory of Open Access Journals (Sweden)

    Venkatesh Jaganathan

    2015-01-01

    Full Text Available Cyber-attacks are an important issue faced by all organizations. Securing information systems is critical. Organizations should be able to understand the ecosystem and predict attacks. Predicting attacks quantitatively should be part of risk management. The cost impact due to worms, viruses, or other malicious software is significant. This paper proposes a mathematical model to predict the impact of an attack based on significant factors that influence cyber security. This model also considers the environmental information required. It is generalized and can be customized to the needs of the individual organization.

  14. Using a Prediction Model to Manage Cyber Security Threats.

    Science.gov (United States)

    Jaganathan, Venkatesh; Cherurveettil, Priyesh; Muthu Sivashanmugam, Premapriya

    2015-01-01

    Cyber-attacks are an important issue faced by all organizations. Securing information systems is critical. Organizations should be able to understand the ecosystem and predict attacks. Predicting attacks quantitatively should be part of risk management. The cost impact due to worms, viruses, or other malicious software is significant. This paper proposes a mathematical model to predict the impact of an attack based on significant factors that influence cyber security. This model also considers the environmental information required. It is generalized and can be customized to the needs of the individual organization.

  15. Predictions for mt and MW in minimal supersymmetric models

    International Nuclear Information System (INIS)

    Buchmueller, O.; Ellis, J.R.; Flaecher, H.; Isidori, G.

    2009-12-01

    Using a frequentist analysis of experimental constraints within two versions of the minimal supersymmetric extension of the Standard Model, we derive the predictions for the top quark mass, m t , and the W boson mass, m W . We find that the supersymmetric predictions for both m t and m W , obtained by incorporating all the relevant experimental information and state-of-the-art theoretical predictions, are highly compatible with the experimental values with small remaining uncertainties, yielding an improvement compared to the case of the Standard Model. (orig.)

  16. Using a Prediction Model to Manage Cyber Security Threats

    Science.gov (United States)

    Muthu Sivashanmugam, Premapriya

    2015-01-01

    Cyber-attacks are an important issue faced by all organizations. Securing information systems is critical. Organizations should be able to understand the ecosystem and predict attacks. Predicting attacks quantitatively should be part of risk management. The cost impact due to worms, viruses, or other malicious software is significant. This paper proposes a mathematical model to predict the impact of an attack based on significant factors that influence cyber security. This model also considers the environmental information required. It is generalized and can be customized to the needs of the individual organization. PMID:26065024

  17. A new crack growth model for life prediction under random loading

    International Nuclear Information System (INIS)

    Lee, Ouk Sub; Chen, Zhi Wei

    1999-01-01

    The load interaction effect in variable amplitude fatigue test is a very important issue for correctly predicting fatigue life. Some prediction methods for retardation are reviewed and the problems discussed. The so-called 'under-load' effect is also of importance for a prediction model to work properly under random load spectrum. A new model that is simple in form but combines overload plastic zone and residual stress considerations together with Elber's closure concept is proposed to fully take account of the load-interaction effects including both over-load and under-load effects. Applying this new model to complex load sequence is explored here. Simulations of tests show the improvement of the new model over other models. The best prediction (mostly closely resembling test curve) is given by the newly proposed Chen-Lee model

  18. Statistical model based gender prediction for targeted NGS clinical panels

    Directory of Open Access Journals (Sweden)

    Palani Kannan Kandavel

    2017-12-01

    The reference test dataset are being used to test the model. The sensitivity on predicting the gender has been increased from the current “genotype composition in ChrX” based approach. In addition, the prediction score given by the model can be used to evaluate the quality of clinical dataset. The higher prediction score towards its respective gender indicates the higher quality of sequenced data.

  19. Predictive modeling of coral disease distribution within a reef system.

    Directory of Open Access Journals (Sweden)

    Gareth J Williams

    2010-02-01

    Full Text Available Diseases often display complex and distinct associations with their environment due to differences in etiology, modes of transmission between hosts, and the shifting balance between pathogen virulence and host resistance. Statistical modeling has been underutilized in coral disease research to explore the spatial patterns that result from this triad of interactions. We tested the hypotheses that: 1 coral diseases show distinct associations with multiple environmental factors, 2 incorporating interactions (synergistic collinearities among environmental variables is important when predicting coral disease spatial patterns, and 3 modeling overall coral disease prevalence (the prevalence of multiple diseases as a single proportion value will increase predictive error relative to modeling the same diseases independently. Four coral diseases: Porites growth anomalies (PorGA, Porites tissue loss (PorTL, Porites trematodiasis (PorTrem, and Montipora white syndrome (MWS, and their interactions with 17 predictor variables were modeled using boosted regression trees (BRT within a reef system in Hawaii. Each disease showed distinct associations with the predictors. Environmental predictors showing the strongest overall associations with the coral diseases were both biotic and abiotic. PorGA was optimally predicted by a negative association with turbidity, PorTL and MWS by declines in butterflyfish and juvenile parrotfish abundance respectively, and PorTrem by a modal relationship with Porites host cover. Incorporating interactions among predictor variables contributed to the predictive power of our models, particularly for PorTrem. Combining diseases (using overall disease prevalence as the model response, led to an average six-fold increase in cross-validation predictive deviance over modeling the diseases individually. We therefore recommend coral diseases to be modeled separately, unless known to have etiologies that respond in a similar manner to

  20. Time series analysis as input for clinical predictive modeling: modeling cardiac arrest in a pediatric ICU.

    Science.gov (United States)

    Kennedy, Curtis E; Turley, James P

    2011-10-24

    Thousands of children experience cardiac arrest events every year in pediatric intensive care units. Most of these children die. Cardiac arrest prediction tools are used as part of medical emergency team evaluations to identify patients in standard hospital beds that are at high risk for cardiac arrest. There are no models to predict cardiac arrest in pediatric intensive care units though, where the risk of an arrest is 10 times higher than for standard hospital beds. Current tools are based on a multivariable approach that does not characterize deterioration, which often precedes cardiac arrests. Characterizing deterioration requires a time series approach. The purpose of this study is to propose a method that will allow for time series data to be used in clinical prediction models. Successful implementation of these methods has the potential to bring arrest prediction to the pediatric intensive care environment, possibly allowing for interventions that can save lives and prevent disabilities. We reviewed prediction models from nonclinical domains that employ time series data, and identified the steps that are necessary for building predictive models using time series clinical data. We illustrate the method by applying it to the specific case of building a predictive model for cardiac arrest in a pediatric intensive care unit. Time course analysis studies from genomic analysis provided a modeling template that was compatible with the steps required to develop a model from clinical time series data. The steps include: 1) selecting candidate variables; 2) specifying measurement parameters; 3) defining data format; 4) defining time window duration and resolution; 5) calculating latent variables for candidate variables not directly measured; 6) calculating time series features as latent variables; 7) creating data subsets to measure model performance effects attributable to various classes of candidate variables; 8) reducing the number of candidate features; 9

  1. Protein (Viridiplantae): 128879 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 5:248 3803:248 ... 3814:248 ... 163722:3689 ... 3826:3689 ... 3827:3689 ... PREDICTED: uncharacterized protein LOC101515541 Cicer arietinum MNSSTI...CSLFLGLILISQSANAKGHGGGLVVTICKGATDRAACENILGSNSEISHAKSFSQL

  2. Predictive modeling of mosquito abundance and dengue transmission in Kenya

    Science.gov (United States)

    Caldwell, J.; Krystosik, A.; Mutuku, F.; Ndenga, B.; LaBeaud, D.; Mordecai, E.

    2017-12-01

    Approximately 390 million people are exposed to dengue virus every year, and with no widely available treatments or vaccines, predictive models of disease risk are valuable tools for vector control and disease prevention. The aim of this study was to modify and improve climate-driven predictive models of dengue vector abundance (Aedes spp. mosquitoes) and viral transmission to people in Kenya. We simulated disease transmission using a temperature-driven mechanistic model and compared model predictions with vector trap data for larvae, pupae, and adult mosquitoes collected between 2014 and 2017 at four sites across urban and rural villages in Kenya. We tested predictive capacity of our models using four temperature measurements (minimum, maximum, range, and anomalies) across daily, weekly, and monthly time scales. Our results indicate seasonal temperature variation is a key driving factor of Aedes mosquito abundance and disease transmission. These models can help vector control programs target specific locations and times when vectors are likely to be present, and can be modified for other Aedes-transmitted diseases and arboviral endemic regions around the world.

  3. Techniques for discrimination-free predictive models (Chapter 12)

    NARCIS (Netherlands)

    Kamiran, F.; Calders, T.G.K.; Pechenizkiy, M.; Custers, B.H.M.; Calders, T.G.K.; Schermer, B.W.; Zarsky, T.Z.

    2013-01-01

    In this chapter, we give an overview of the techniques developed ourselves for constructing discrimination-free classifiers. In discrimination-free classification the goal is to learn a predictive model that classifies future data objects as accurately as possible, yet the predicted labels should be

  4. Genomic prediction in a nuclear population of layers using single-step models.

    Science.gov (United States)

    Yan, Yiyuan; Wu, Guiqin; Liu, Aiqiao; Sun, Congjiao; Han, Wenpeng; Li, Guangqi; Yang, Ning

    2018-02-01

    Single-step genomic prediction method has been proposed to improve the accuracy of genomic prediction by incorporating information of both genotyped and ungenotyped animals. The objective of this study is to compare the prediction performance of single-step model with a 2-step models and the pedigree-based models in a nuclear population of layers. A total of 1,344 chickens across 4 generations were genotyped by a 600 K SNP chip. Four traits were analyzed, i.e., body weight at 28 wk (BW28), egg weight at 28 wk (EW28), laying rate at 38 wk (LR38), and Haugh unit at 36 wk (HU36). In predicting offsprings, individuals from generation 1 to 3 were used as training data and females from generation 4 were used as validation set. The accuracies of predicted breeding values by pedigree BLUP (PBLUP), genomic BLUP (GBLUP), SSGBLUP and single-step blending (SSBlending) were compared for both genotyped and ungenotyped individuals. For genotyped females, GBLUP performed no better than PBLUP because of the small size of training data, while the 2 single-step models predicted more accurately than the PBLUP model. The average predictive ability of SSGBLUP and SSBlending were 16.0% and 10.8% higher than the PBLUP model across traits, respectively. Furthermore, the predictive abilities for ungenotyped individuals were also enhanced. The average improvements of prediction abilities were 5.9% and 1.5% for SSGBLUP and SSBlending model, respectively. It was concluded that single-step models, especially the SSGBLUP model, can yield more accurate prediction of genetic merits and are preferable for practical implementation of genomic selection in layers. © 2017 Poultry Science Association Inc.

  5. Hybrid Prediction Model of the Temperature Field of a Motorized Spindle

    Directory of Open Access Journals (Sweden)

    Lixiu Zhang

    2017-10-01

    Full Text Available The thermal characteristics of a motorized spindle are the main determinants of its performance, and influence the machining accuracy of computer numerical control machine tools. It is important to accurately predict the thermal field of a motorized spindle during its operation to improve its thermal characteristics. This paper proposes a model to predict the temperature field of a high-speed and high-precision motorized spindle under different working conditions using a finite element model and test data. The finite element model considers the influence of the parameters of the cooling system and the lubrication system, and that of environmental conditions on the coefficient of heat transfer based on test data for the surface temperature of the motorized spindle. A genetic algorithm is used to optimize the coefficient of heat transfer of the spindle, and its temperature field is predicted using a three-dimensional model that employs this optimal coefficient. A prediction model of the 170MD30 temperature field of the motorized spindle is created and simulation data for the temperature field are compared with the test data. The results show that when the speed of the spindle is 10,000 rpm, the relative mean prediction error is 1.5%, and when its speed is 15,000 rpm, the prediction error is 3.6%. Therefore, the proposed prediction model can predict the temperature field of the motorized spindle with high accuracy.

  6. Model predictive control based on reduced order models applied to belt conveyor system.

    Science.gov (United States)

    Chen, Wei; Li, Xin

    2016-11-01

    In the paper, a model predictive controller based on reduced order model is proposed to control belt conveyor system, which is an electro-mechanics complex system with long visco-elastic body. Firstly, in order to design low-degree controller, the balanced truncation method is used for belt conveyor model reduction. Secondly, MPC algorithm based on reduced order model for belt conveyor system is presented. Because of the error bound between the full-order model and reduced order model, two Kalman state estimators are applied in the control scheme to achieve better system performance. Finally, the simulation experiments are shown that balanced truncation method can significantly reduce the model order with high-accuracy and model predictive control based on reduced-model performs well in controlling the belt conveyor system. Copyright © 2016 ISA. Published by Elsevier Ltd. All rights reserved.

  7. Bayesian Genomic Prediction with Genotype × Environment Interaction Kernel Models.

    Science.gov (United States)

    Cuevas, Jaime; Crossa, José; Montesinos-López, Osval A; Burgueño, Juan; Pérez-Rodríguez, Paulino; de Los Campos, Gustavo

    2017-01-05

    The phenomenon of genotype × environment (G × E) interaction in plant breeding decreases selection accuracy, thereby negatively affecting genetic gains. Several genomic prediction models incorporating G × E have been recently developed and used in genomic selection of plant breeding programs. Genomic prediction models for assessing multi-environment G × E interaction are extensions of a single-environment model, and have advantages and limitations. In this study, we propose two multi-environment Bayesian genomic models: the first model considers genetic effects [Formula: see text] that can be assessed by the Kronecker product of variance-covariance matrices of genetic correlations between environments and genomic kernels through markers under two linear kernel methods, linear (genomic best linear unbiased predictors, GBLUP) and Gaussian (Gaussian kernel, GK). The other model has the same genetic component as the first model [Formula: see text] plus an extra component, F: , that captures random effects between environments that were not captured by the random effects [Formula: see text] We used five CIMMYT data sets (one maize and four wheat) that were previously used in different studies. Results show that models with G × E always have superior prediction ability than single-environment models, and the higher prediction ability of multi-environment models with [Formula: see text] over the multi-environment model with only u occurred 85% of the time with GBLUP and 45% of the time with GK across the five data sets. The latter result indicated that including the random effect f is still beneficial for increasing prediction ability after adjusting by the random effect [Formula: see text]. Copyright © 2017 Cuevas et al.

  8. Data Quality Enhanced Prediction Model for Massive Plant Data

    International Nuclear Information System (INIS)

    Park, Moon-Ghu; Kang, Seong-Ki; Shin, Hajin

    2016-01-01

    This paper introduces an integrated signal preconditioning and model prediction mainly by kernel functions. The performance and benefits of the methods are demonstrated by a case study with measurement data from a power plant and its components transient data. The developed methods will be applied as a part of monitoring massive or big data platform where human experts cannot detect the fault behaviors due to too large size of the measurements. Recent extensive efforts for on-line monitoring implementation insists that a big surprise in the modeling for predicting process variables was the extent of data quality problems in measurement data especially for data-driven modeling. Bad data for training will be learned as normal and can make significant degrade in prediction performance. For this reason, the quantity and quality of measurement data in modeling phase need special care. Bad quality data must be removed from training sets to the bad data considered as normal system behavior. This paper presented an integrated structure of supervisory system for monitoring the plants or sensors performance. The quality of the data-driven model is improved with a bilateral kernel filter for preprocessing of the noisy data. The prediction module is also based on kernel regression having the same basis with noise filter. The model structure is optimized by a grouping process with nonlinear Hoeffding correlation function

  9. Data Quality Enhanced Prediction Model for Massive Plant Data

    Energy Technology Data Exchange (ETDEWEB)

    Park, Moon-Ghu [Nuclear Engr. Sejong Univ., Seoul (Korea, Republic of); Kang, Seong-Ki [Monitoring and Diagnosis, Suwon (Korea, Republic of); Shin, Hajin [Saint Paul Preparatory Seoul, Seoul (Korea, Republic of)

    2016-10-15

    This paper introduces an integrated signal preconditioning and model prediction mainly by kernel functions. The performance and benefits of the methods are demonstrated by a case study with measurement data from a power plant and its components transient data. The developed methods will be applied as a part of monitoring massive or big data platform where human experts cannot detect the fault behaviors due to too large size of the measurements. Recent extensive efforts for on-line monitoring implementation insists that a big surprise in the modeling for predicting process variables was the extent of data quality problems in measurement data especially for data-driven modeling. Bad data for training will be learned as normal and can make significant degrade in prediction performance. For this reason, the quantity and quality of measurement data in modeling phase need special care. Bad quality data must be removed from training sets to the bad data considered as normal system behavior. This paper presented an integrated structure of supervisory system for monitoring the plants or sensors performance. The quality of the data-driven model is improved with a bilateral kernel filter for preprocessing of the noisy data. The prediction module is also based on kernel regression having the same basis with noise filter. The model structure is optimized by a grouping process with nonlinear Hoeffding correlation function.

  10. Frequency weighted model predictive control of wind turbine

    DEFF Research Database (Denmark)

    Klauco, Martin; Poulsen, Niels Kjølstad; Mirzaei, Mahmood

    2013-01-01

    This work is focused on applying frequency weighted model predictive control (FMPC) on three blade horizontal axis wind turbine (HAWT). A wind turbine is a very complex, non-linear system influenced by a stochastic wind speed variation. The reduced dynamics considered in this work are the rotatio...... predictive controller are presented. Statistical comparison between frequency weighted MPC, standard MPC and baseline PI controller is shown as well.......This work is focused on applying frequency weighted model predictive control (FMPC) on three blade horizontal axis wind turbine (HAWT). A wind turbine is a very complex, non-linear system influenced by a stochastic wind speed variation. The reduced dynamics considered in this work...... are the rotational degree of freedom of the rotor and the tower for-aft movement. The MPC design is based on a receding horizon policy and a linearised model of the wind turbine. Due to the change of dynamics according to wind speed, several linearisation points must be considered and the control design adjusted...

  11. Enhancing pavement performance prediction models for the Illinois Tollway System

    Directory of Open Access Journals (Sweden)

    Laxmikanth Premkumar

    2016-01-01

    Full Text Available Accurate pavement performance prediction represents an important role in prioritizing future maintenance and rehabilitation needs, and predicting future pavement condition in a pavement management system. The Illinois State Toll Highway Authority (Tollway with over 2000 lane miles of pavement utilizes the condition rating survey (CRS methodology to rate pavement performance. Pavement performance models developed in the past for the Illinois Department of Transportation (IDOT are used by the Tollway to predict the future condition of its network. The model projects future CRS ratings based on pavement type, thickness, traffic, pavement age and current CRS rating. However, with time and inclusion of newer pavement types there was a need to calibrate the existing pavement performance models, as well as, develop models for newer pavement types.This study presents the results of calibrating the existing models, and developing new models for the various pavement types in the Illinois Tollway network. The predicted future condition of the pavements is used in estimating its remaining service life to failure, which is of immediate use in recommending future maintenance and rehabilitation requirements for the network. Keywords: Pavement performance models, Remaining life, Pavement management

  12. Estimating the magnitude of prediction uncertainties for field-scale P loss models

    Science.gov (United States)

    Models are often used to predict phosphorus (P) loss from agricultural fields. While it is commonly recognized that model predictions are inherently uncertain, few studies have addressed prediction uncertainties using P loss models. In this study, an uncertainty analysis for the Annual P Loss Estima...

  13. Development of a prognostic model for predicting spontaneous singleton preterm birth.

    Science.gov (United States)

    Schaaf, Jelle M; Ravelli, Anita C J; Mol, Ben Willem J; Abu-Hanna, Ameen

    2012-10-01

    To develop and validate a prognostic model for prediction of spontaneous preterm birth. Prospective cohort study using data of the nationwide perinatal registry in The Netherlands. We studied 1,524,058 singleton pregnancies between 1999 and 2007. We developed a multiple logistic regression model to estimate the risk of spontaneous preterm birth based on maternal and pregnancy characteristics. We used bootstrapping techniques to internally validate our model. Discrimination (AUC), accuracy (Brier score) and calibration (calibration graphs and Hosmer-Lemeshow C-statistic) were used to assess the model's predictive performance. Our primary outcome measure was spontaneous preterm birth at model included 13 variables for predicting preterm birth. The predicted probabilities ranged from 0.01 to 0.71 (IQR 0.02-0.04). The model had an area under the receiver operator characteristic curve (AUC) of 0.63 (95% CI 0.63-0.63), the Brier score was 0.04 (95% CI 0.04-0.04) and the Hosmer Lemeshow C-statistic was significant (pvalues of predicted probability. The positive predictive value was 26% (95% CI 20-33%) for the 0.4 probability cut-off point. The model's discrimination was fair and it had modest calibration. Previous preterm birth, drug abuse and vaginal bleeding in the first half of pregnancy were the most important predictors for spontaneous preterm birth. Although not applicable in clinical practice yet, this model is a next step towards early prediction of spontaneous preterm birth that enables caregivers to start preventive therapy in women at higher risk. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  14. Aqua/Aura Updated Inclination Adjust Maneuver Performance Prediction Model

    Science.gov (United States)

    Boone, Spencer

    2017-01-01

    This presentation will discuss the updated Inclination Adjust Maneuver (IAM) performance prediction model that was developed for Aqua and Aura following the 2017 IAM series. This updated model uses statistical regression methods to identify potential long-term trends in maneuver parameters, yielding improved predictions when re-planning past maneuvers. The presentation has been reviewed and approved by Eric Moyer, ESMO Deputy Project Manager.

  15. Risk prediction model for knee pain in the Nottingham community: a Bayesian modelling approach.

    Science.gov (United States)

    Fernandes, G S; Bhattacharya, A; McWilliams, D F; Ingham, S L; Doherty, M; Zhang, W

    2017-03-20

    Twenty-five percent of the British population over the age of 50 years experiences knee pain. Knee pain can limit physical ability and cause distress and bears significant socioeconomic costs. The objectives of this study were to develop and validate the first risk prediction model for incident knee pain in the Nottingham community and validate this internally within the Nottingham cohort and externally within the Osteoarthritis Initiative (OAI) cohort. A total of 1822 participants from the Nottingham community who were at risk for knee pain were followed for 12 years. Of this cohort, two-thirds (n = 1203) were used to develop the risk prediction model, and one-third (n = 619) were used to validate the model. Incident knee pain was defined as pain on most days for at least 1 month in the past 12 months. Predictors were age, sex, body mass index, pain elsewhere, prior knee injury and knee alignment. A Bayesian logistic regression model was used to determine the probability of an OR >1. The Hosmer-Lemeshow χ 2 statistic (HLS) was used for calibration, and ROC curve analysis was used for discrimination. The OAI cohort from the United States was also used to examine the performance of the model. A risk prediction model for knee pain incidence was developed using a Bayesian approach. The model had good calibration, with an HLS of 7.17 (p = 0.52) and moderate discriminative ability (ROC 0.70) in the community. Individual scenarios are given using the model. However, the model had poor calibration (HLS 5866.28, p prediction model for knee pain, regardless of underlying structural changes of knee osteoarthritis, in the community using a Bayesian modelling approach. The model appears to work well in a community-based population but not in individuals with a higher risk for knee osteoarthritis, and it may provide a convenient tool for use in primary care to predict the risk of knee pain in the general population.

  16. A Comparative Study of Spectral Auroral Intensity Predictions From Multiple Electron Transport Models

    Science.gov (United States)

    Grubbs, Guy; Michell, Robert; Samara, Marilia; Hampton, Donald; Hecht, James; Solomon, Stanley; Jahn, Jorg-Micha

    2018-01-01

    It is important to routinely examine and update models used to predict auroral emissions resulting from precipitating electrons in Earth's magnetotail. These models are commonly used to invert spectral auroral ground-based images to infer characteristics about incident electron populations when in situ measurements are unavailable. In this work, we examine and compare auroral emission intensities predicted by three commonly used electron transport models using varying electron population characteristics. We then compare model predictions to same-volume in situ electron measurements and ground-based imaging to qualitatively examine modeling prediction error. Initial comparisons showed differences in predictions by the GLobal airglOW (GLOW) model and the other transport models examined. Chemical reaction rates and radiative rates in GLOW were updated using recent publications, and predictions showed better agreement with the other models and the same-volume data, stressing that these rates are important to consider when modeling auroral processes. Predictions by each model exhibit similar behavior for varying atmospheric constants, energies, and energy fluxes. Same-volume electron data and images are highly correlated with predictions by each model, showing that these models can be used to accurately derive electron characteristics and ionospheric parameters based solely on multispectral optical imaging data.

  17. The Comparison Study of Short-Term Prediction Methods to Enhance the Model Predictive Controller Applied to Microgrid Energy Management

    Directory of Open Access Journals (Sweden)

    César Hernández-Hernández

    2017-06-01

    Full Text Available Electricity load forecasting, optimal power system operation and energy management play key roles that can bring significant operational advantages to microgrids. This paper studies how methods based on time series and neural networks can be used to predict energy demand and production, allowing them to be combined with model predictive control. Comparisons of different prediction methods and different optimum energy distribution scenarios are provided, permitting us to determine when short-term energy prediction models should be used. The proposed prediction models in addition to the model predictive control strategy appear as a promising solution to energy management in microgrids. The controller has the task of performing the management of electricity purchase and sale to the power grid, maximizing the use of renewable energy sources and managing the use of the energy storage system. Simulations were performed with different weather conditions of solar irradiation. The obtained results are encouraging for future practical implementation.

  18. Usability Prediction & Ranking of SDLC Models Using Fuzzy Hierarchical Usability Model

    Science.gov (United States)

    Gupta, Deepak; Ahlawat, Anil K.; Sagar, Kalpna

    2017-06-01

    Evaluation of software quality is an important aspect for controlling and managing the software. By such evaluation, improvements in software process can be made. The software quality is significantly dependent on software usability. Many researchers have proposed numbers of usability models. Each model considers a set of usability factors but do not cover all the usability aspects. Practical implementation of these models is still missing, as there is a lack of precise definition of usability. Also, it is very difficult to integrate these models into current software engineering practices. In order to overcome these challenges, this paper aims to define the term `usability' using the proposed hierarchical usability model with its detailed taxonomy. The taxonomy considers generic evaluation criteria for identifying the quality components, which brings together factors, attributes and characteristics defined in various HCI and software models. For the first time, the usability model is also implemented to predict more accurate usability values. The proposed system is named as fuzzy hierarchical usability model that can be easily integrated into the current software engineering practices. In order to validate the work, a dataset of six software development life cycle models is created and employed. These models are ranked according to their predicted usability values. This research also focuses on the detailed comparison of proposed model with the existing usability models.

  19. A predictive coding account of bistable perception - a model-based fMRI study.

    Science.gov (United States)

    Weilnhammer, Veith; Stuke, Heiner; Hesselmann, Guido; Sterzer, Philipp; Schmack, Katharina

    2017-05-01

    In bistable vision, subjective perception wavers between two interpretations of a constant ambiguous stimulus. This dissociation between conscious perception and sensory stimulation has motivated various empirical studies on the neural correlates of bistable perception, but the neurocomputational mechanism behind endogenous perceptual transitions has remained elusive. Here, we recurred to a generic Bayesian framework of predictive coding and devised a model that casts endogenous perceptual transitions as a consequence of prediction errors emerging from residual evidence for the suppressed percept. Data simulations revealed close similarities between the model's predictions and key temporal characteristics of perceptual bistability, indicating that the model was able to reproduce bistable perception. Fitting the predictive coding model to behavioural data from an fMRI-experiment on bistable perception, we found a correlation across participants between the model parameter encoding perceptual stabilization and the behaviourally measured frequency of perceptual transitions, corroborating that the model successfully accounted for participants' perception. Formal model comparison with established models of bistable perception based on mutual inhibition and adaptation, noise or a combination of adaptation and noise was used for the validation of the predictive coding model against the established models. Most importantly, model-based analyses of the fMRI data revealed that prediction error time-courses derived from the predictive coding model correlated with neural signal time-courses in bilateral inferior frontal gyri and anterior insulae. Voxel-wise model selection indicated a superiority of the predictive coding model over conventional analysis approaches in explaining neural activity in these frontal areas, suggesting that frontal cortex encodes prediction errors that mediate endogenous perceptual transitions in bistable perception. Taken together, our current work

  20. A predictive coding account of bistable perception - a model-based fMRI study.

    Directory of Open Access Journals (Sweden)

    Veith Weilnhammer

    2017-05-01

    Full Text Available In bistable vision, subjective perception wavers between two interpretations of a constant ambiguous stimulus. This dissociation between conscious perception and sensory stimulation has motivated various empirical studies on the neural correlates of bistable perception, but the neurocomputational mechanism behind endogenous perceptual transitions has remained elusive. Here, we recurred to a generic Bayesian framework of predictive coding and devised a model that casts endogenous perceptual transitions as a consequence of prediction errors emerging from residual evidence for the suppressed percept. Data simulations revealed close similarities between the model's predictions and key temporal characteristics of perceptual bistability, indicating that the model was able to reproduce bistable perception. Fitting the predictive coding model to behavioural data from an fMRI-experiment on bistable perception, we found a correlation across participants between the model parameter encoding perceptual stabilization and the behaviourally measured frequency of perceptual transitions, corroborating that the model successfully accounted for participants' perception. Formal model comparison with established models of bistable perception based on mutual inhibition and adaptation, noise or a combination of adaptation and noise was used for the validation of the predictive coding model against the established models. Most importantly, model-based analyses of the fMRI data revealed that prediction error time-courses derived from the predictive coding model correlated with neural signal time-courses in bilateral inferior frontal gyri and anterior insulae. Voxel-wise model selection indicated a superiority of the predictive coding model over conventional analysis approaches in explaining neural activity in these frontal areas, suggesting that frontal cortex encodes prediction errors that mediate endogenous perceptual transitions in bistable perception. Taken together

  1. Study on prediction model of irradiation embrittlement for reactor pressure vessel steel

    International Nuclear Information System (INIS)

    Wang Rongshan; Xu Chaoliang; Huang Ping; Liu Xiangbing; Ren Ai; Chen Jun; Li Chengliang

    2014-01-01

    The study on prediction model of irradiation embrittlement for reactor pres- sure vessel (RPV) steel is an important method for long term operation. According to the deep analysis of the previous prediction models developed worldwide, the drawbacks of these models were given and a new irradiation embrittlement prediction model PMIE-2012 was developed. A corresponding reliability assessment was carried out by irradiation surveillance data. The assessment results show that the PMIE-2012 have a high reliability and accuracy on irradiation embrittlement prediction. (authors)

  2. Comparative Evaluation of Some Crop Yield Prediction Models ...

    African Journals Online (AJOL)

    A computer program was adopted from the work of Hill et al. (1982) to calibrate and test three of the existing yield prediction models using tropical cowpea yieldÐweather data. The models tested were Hanks Model (first and second versions). Stewart Model (first and second versions) and HallÐButcher Model. Three sets of ...

  3. TH-A-9A-01: Active Optical Flow Model: Predicting Voxel-Level Dose Prediction in Spine SBRT

    Energy Technology Data Exchange (ETDEWEB)

    Liu, J; Wu, Q.J.; Yin, F; Kirkpatrick, J; Cabrera, A [Duke University Medical Center, Durham, NC (United States); Ge, Y [University of North Carolina at Charlotte, Charlotte, NC (United States)

    2014-06-15

    Purpose: To predict voxel-level dose distribution and enable effective evaluation of cord dose sparing in spine SBRT. Methods: We present an active optical flow model (AOFM) to statistically describe cord dose variations and train a predictive model to represent correlations between AOFM and PTV contours. Thirty clinically accepted spine SBRT plans are evenly divided into training and testing datasets. The development of predictive model consists of 1) collecting a sequence of dose maps including PTV and OAR (spinal cord) as well as a set of associated PTV contours adjacent to OAR from the training dataset, 2) classifying data into five groups based on PTV's locations relative to OAR, two “Top”s, “Left”, “Right”, and “Bottom”, 3) randomly selecting a dose map as the reference in each group and applying rigid registration and optical flow deformation to match all other maps to the reference, 4) building AOFM by importing optical flow vectors and dose values into the principal component analysis (PCA), 5) applying another PCA to features of PTV and OAR contours to generate an active shape model (ASM), and 6) computing a linear regression model of correlations between AOFM and ASM.When predicting dose distribution of a new case in the testing dataset, the PTV is first assigned to a group based on its contour characteristics. Contour features are then transformed into ASM's principal coordinates of the selected group. Finally, voxel-level dose distribution is determined by mapping from the ASM space to the AOFM space using the predictive model. Results: The DVHs predicted by the AOFM-based model and those in clinical plans are comparable in training and testing datasets. At 2% volume the dose difference between predicted and clinical plans is 4.2±4.4% and 3.3±3.5% in the training and testing datasets, respectively. Conclusion: The AOFM is effective in predicting voxel-level dose distribution for spine SBRT. Partially supported by NIH

  4. TH-A-9A-01: Active Optical Flow Model: Predicting Voxel-Level Dose Prediction in Spine SBRT

    International Nuclear Information System (INIS)

    Liu, J; Wu, Q.J.; Yin, F; Kirkpatrick, J; Cabrera, A; Ge, Y

    2014-01-01

    Purpose: To predict voxel-level dose distribution and enable effective evaluation of cord dose sparing in spine SBRT. Methods: We present an active optical flow model (AOFM) to statistically describe cord dose variations and train a predictive model to represent correlations between AOFM and PTV contours. Thirty clinically accepted spine SBRT plans are evenly divided into training and testing datasets. The development of predictive model consists of 1) collecting a sequence of dose maps including PTV and OAR (spinal cord) as well as a set of associated PTV contours adjacent to OAR from the training dataset, 2) classifying data into five groups based on PTV's locations relative to OAR, two “Top”s, “Left”, “Right”, and “Bottom”, 3) randomly selecting a dose map as the reference in each group and applying rigid registration and optical flow deformation to match all other maps to the reference, 4) building AOFM by importing optical flow vectors and dose values into the principal component analysis (PCA), 5) applying another PCA to features of PTV and OAR contours to generate an active shape model (ASM), and 6) computing a linear regression model of correlations between AOFM and ASM.When predicting dose distribution of a new case in the testing dataset, the PTV is first assigned to a group based on its contour characteristics. Contour features are then transformed into ASM's principal coordinates of the selected group. Finally, voxel-level dose distribution is determined by mapping from the ASM space to the AOFM space using the predictive model. Results: The DVHs predicted by the AOFM-based model and those in clinical plans are comparable in training and testing datasets. At 2% volume the dose difference between predicted and clinical plans is 4.2±4.4% and 3.3±3.5% in the training and testing datasets, respectively. Conclusion: The AOFM is effective in predicting voxel-level dose distribution for spine SBRT. Partially supported by NIH

  5. The Complexity of Developmental Predictions from Dual Process Models

    Science.gov (United States)

    Stanovich, Keith E.; West, Richard F.; Toplak, Maggie E.

    2011-01-01

    Drawing developmental predictions from dual-process theories is more complex than is commonly realized. Overly simplified predictions drawn from such models may lead to premature rejection of the dual process approach as one of many tools for understanding cognitive development. Misleading predictions can be avoided by paying attention to several…

  6. A polynomial based model for cell fate prediction in human diseases.

    Science.gov (United States)

    Ma, Lichun; Zheng, Jie

    2017-12-21

    Cell fate regulation directly affects tissue homeostasis and human health. Research on cell fate decision sheds light on key regulators, facilitates understanding the mechanisms, and suggests novel strategies to treat human diseases that are related to abnormal cell development. In this study, we proposed a polynomial based model to predict cell fate. This model was derived from Taylor series. As a case study, gene expression data of pancreatic cells were adopted to test and verify the model. As numerous features (genes) are available, we employed two kinds of feature selection methods, i.e. correlation based and apoptosis pathway based. Then polynomials of different degrees were used to refine the cell fate prediction function. 10-fold cross-validation was carried out to evaluate the performance of our model. In addition, we analyzed the stability of the resultant cell fate prediction model by evaluating the ranges of the parameters, as well as assessing the variances of the predicted values at randomly selected points. Results show that, within both the two considered gene selection methods, the prediction accuracies of polynomials of different degrees show little differences. Interestingly, the linear polynomial (degree 1 polynomial) is more stable than others. When comparing the linear polynomials based on the two gene selection methods, it shows that although the accuracy of the linear polynomial that uses correlation analysis outcomes is a little higher (achieves 86.62%), the one within genes of the apoptosis pathway is much more stable. Considering both the prediction accuracy and the stability of polynomial models of different degrees, the linear model is a preferred choice for cell fate prediction with gene expression data of pancreatic cells. The presented cell fate prediction model can be extended to other cells, which may be important for basic research as well as clinical study of cell development related diseases.

  7. Test of 1-D transport models, and their predictions for ITER

    International Nuclear Information System (INIS)

    Mikkelsen, D.; Bateman, G.; Boucher, D.

    2001-01-01

    A number of proposed tokamak thermal transport models are tested by comparing their predictions with measurements from several tokamaks. The necessary data have been provided for a total of 75 discharges from C-mod, DIII-D, JET, JT-60U, T10, and TFTR. A standard prediction methodology has been developed, and three codes have been benchmarked; these 'standard' codes have been relied on for testing most of the transport models. While a wide range of physical transport processes has been tested, no single model has emerged as clearly superior to all competitors for simulating H-mode discharges. In order to winnow the field, further tests of the effect of sheared flows and of the 'stiffness' of transport are planned. Several of the models have been used to predict ITER performance, with widely varying results. With some transport models ITER's predicted fusion power depends strongly on the 'pedestal' temperature, but ∼ 1GW (Q=10) is predicted for most models if the pedestal temperature is at least 4 keV. (author)

  8. Tests of 1-D transport models, and their predictions for ITER

    International Nuclear Information System (INIS)

    Mikkelsen, D.R.; Bateman, G.; Boucher, D.

    1999-01-01

    A number of proposed tokamak thermal transport models are tested by comparing their predictions with measurements from several tokamaks. The necessary data have been provided for a total of 75 discharges from C-mod, DIII-D, JET, JT-60U, T10, and TFTR. A standard prediction methodology has been developed, and three codes have been benchmarked; these 'standard' codes have been relied on for testing most of the transport models. While a wide range of physical transport processes has been tested, no single model has emerged as clearly superior to all competitors for simulating H-mode discharges. In order to winnow the field, further tests of the effect of sheared flows and of the 'stiffness' of transport are planned. Several of the models have been used to predict ITER performance, with widely varying results. With some transport models ITER's predicted fusion power depends strongly on the 'pedestal' temperature, but ∼ 1GW (Q=10) is predicted for most models if the pedestal temperature is at least 4 keV. (author)

  9. Model predictive control for a thermostatic controlled system

    DEFF Research Database (Denmark)

    Shafiei, Seyed Ehsan; Rasmussen, Henrik; Stoustrup, Jakob

    2013-01-01

    This paper proposes a model predictive control scheme to provide temperature set-points to thermostatic controlled cooling units in refrigeration systems. The control problem is formulated as a convex programming problem to minimize the overall operating cost of the system. The foodstuff temperat......This paper proposes a model predictive control scheme to provide temperature set-points to thermostatic controlled cooling units in refrigeration systems. The control problem is formulated as a convex programming problem to minimize the overall operating cost of the system. The foodstuff...

  10. Explicit Modeling of Ancestry Improves Polygenic Risk Scores and BLUP Prediction.

    Science.gov (United States)

    Chen, Chia-Yen; Han, Jiali; Hunter, David J; Kraft, Peter; Price, Alkes L

    2015-09-01

    Polygenic prediction using genome-wide SNPs can provide high prediction accuracy for complex traits. Here, we investigate the question of how to account for genetic ancestry when conducting polygenic prediction. We show that the accuracy of polygenic prediction in structured populations may be partly due to genetic ancestry. However, we hypothesized that explicitly modeling ancestry could improve polygenic prediction accuracy. We analyzed three GWAS of hair color (HC), tanning ability (TA), and basal cell carcinoma (BCC) in European Americans (sample size from 7,440 to 9,822) and considered two widely used polygenic prediction approaches: polygenic risk scores (PRSs) and best linear unbiased prediction (BLUP). We compared polygenic prediction without correction for ancestry to polygenic prediction with ancestry as a separate component in the model. In 10-fold cross-validation using the PRS approach, the R(2) for HC increased by 66% (0.0456-0.0755; P ancestry, which prevents ancestry effects from entering into each SNP effect and being overweighted. Surprisingly, explicitly modeling ancestry produces a similar improvement when using the BLUP approach, which fits all SNPs simultaneously in a single variance component and causes ancestry to be underweighted. We validate our findings via simulations, which show that the differences in prediction accuracy will increase in magnitude as sample sizes increase. In summary, our results show that explicitly modeling ancestry can be important in both PRS and BLUP prediction. © 2015 WILEY PERIODICALS, INC.

  11. Atterberg Limits Prediction Comparing SVM with ANFIS Model

    Directory of Open Access Journals (Sweden)

    Mohammad Murtaza Sherzoy

    2017-03-01

    Full Text Available Support Vector Machine (SVM and Adaptive Neuro-Fuzzy inference Systems (ANFIS both analytical methods are used to predict the values of Atterberg limits, such as the liquid limit, plastic limit and plasticity index. The main objective of this study is to make a comparison between both forecasts (SVM & ANFIS methods. All data of 54 soil samples are used and taken from the area of Peninsular Malaysian and tested for different parameters containing liquid limit, plastic limit, plasticity index and grain size distribution and were. The input parameter used in for this case are the fraction of grain size distribution which are the percentage of silt, clay and sand. The actual and predicted values of Atterberg limit which obtained from the SVM and ANFIS models are compared by using the correlation coefficient R2 and root mean squared error (RMSE value.  The outcome of the study show that the ANFIS model shows higher accuracy than SVM model for the liquid limit (R2 = 0.987, plastic limit (R2 = 0.949 and plastic index (R2 = 0966. RMSE value that obtained for both methods have shown that the ANFIS model has represent the best performance than SVM model to predict the Atterberg Limits as a whole.

  12. Estimating Predictive Variance for Statistical Gas Distribution Modelling

    International Nuclear Information System (INIS)

    Lilienthal, Achim J.; Asadi, Sahar; Reggente, Matteo

    2009-01-01

    Recent publications in statistical gas distribution modelling have proposed algorithms that model mean and variance of a distribution. This paper argues that estimating the predictive concentration variance entails not only a gradual improvement but is rather a significant step to advance the field. This is, first, since the models much better fit the particular structure of gas distributions, which exhibit strong fluctuations with considerable spatial variations as a result of the intermittent character of gas dispersal. Second, because estimating the predictive variance allows to evaluate the model quality in terms of the data likelihood. This offers a solution to the problem of ground truth evaluation, which has always been a critical issue for gas distribution modelling. It also enables solid comparisons of different modelling approaches, and provides the means to learn meta parameters of the model, to determine when the model should be updated or re-initialised, or to suggest new measurement locations based on the current model. We also point out directions of related ongoing or potential future research work.

  13. Predictive power of theoretical modelling of the nuclear mean field: examples of improving predictive capacities

    Science.gov (United States)

    Dedes, I.; Dudek, J.

    2018-03-01

    We examine the effects of the parametric correlations on the predictive capacities of the theoretical modelling keeping in mind the nuclear structure applications. The main purpose of this work is to illustrate the method of establishing the presence and determining the form of parametric correlations within a model as well as an algorithm of elimination by substitution (see text) of parametric correlations. We examine the effects of the elimination of the parametric correlations on the stabilisation of the model predictions further and further away from the fitting zone. It follows that the choice of the physics case and the selection of the associated model are of secondary importance in this case. Under these circumstances we give priority to the relative simplicity of the underlying mathematical algorithm, provided the model is realistic. Following such criteria, we focus specifically on an important but relatively simple case of doubly magic spherical nuclei. To profit from the algorithmic simplicity we chose working with the phenomenological spherically symmetric Woods–Saxon mean-field. We employ two variants of the underlying Hamiltonian, the traditional one involving both the central and the spin orbit potential in the Woods–Saxon form and the more advanced version with the self-consistent density-dependent spin–orbit interaction. We compare the effects of eliminating of various types of correlations and discuss the improvement of the quality of predictions (‘predictive power’) under realistic parameter adjustment conditions.

  14. The Prediction of Drought-Related Tree Mortality in Vegetation Models

    Science.gov (United States)

    Schwinning, S.; Jensen, J.; Lomas, M. R.; Schwartz, B.; Woodward, F. I.

    2013-12-01

    Drought-related tree die-off events at regional scales have been reported from all wooded continents and it has been suggested that their frequency may be increasing. The prediction of these drought-related die-off events from regional to global scales has been recognized as a critical need for the conservation of forest resources and improving the prediction of climate-vegetation interactions. However, there is no conceptual consensus on how to best approach the quantitative prediction of tree mortality. Current models use a variety of mechanisms to represent demographic events. Mortality is modeled to represent a number of different processes, including death by fire, wind throw, extreme temperatures, and self-thinning, and each vegetation model differs in the emphasis they place on specific mechanisms. Dynamic global vegetation models generally operate on the assumption of incremental vegetation shift due to changes in the carbon economy of plant functional types and proportional effects on recruitment, growth, competition and mortality, but this may not capture sudden and sweeping tree death caused by extreme weather conditions. We tested several different approaches to predicting tree mortality within the framework of the Sheffield Dynamic Global Vegetation Model. We applied the model to the state of Texas, USA, which in 2011 experienced extreme drought conditions, causing the death of an estimated 300 million trees statewide. We then compared predicted to actual mortality to determine which algorithms most accurately predicted geographical variation in tree mortality. We discuss implications regarding the ongoing debate on the causes of tree death.

  15. Corporate prediction models, ratios or regression analysis?

    NARCIS (Netherlands)

    Bijnen, E.J.; Wijn, M.F.C.M.

    1994-01-01

    The models developed in the literature with respect to the prediction of a company s failure are based on ratios. It has been shown before that these models should be rejected on theoretical grounds. Our study of industrial companies in the Netherlands shows that the ratios which are used in

  16. Effect of heteroscedasticity treatment in residual error models on model calibration and prediction uncertainty estimation

    Science.gov (United States)

    Sun, Ruochen; Yuan, Huiling; Liu, Xiaoli

    2017-11-01

    The heteroscedasticity treatment in residual error models directly impacts the model calibration and prediction uncertainty estimation. This study compares three methods to deal with the heteroscedasticity, including the explicit linear modeling (LM) method and nonlinear modeling (NL) method using hyperbolic tangent function, as well as the implicit Box-Cox transformation (BC). Then a combined approach (CA) combining the advantages of both LM and BC methods has been proposed. In conjunction with the first order autoregressive model and the skew exponential power (SEP) distribution, four residual error models are generated, namely LM-SEP, NL-SEP, BC-SEP and CA-SEP, and their corresponding likelihood functions are applied to the Variable Infiltration Capacity (VIC) hydrologic model over the Huaihe River basin, China. Results show that the LM-SEP yields the poorest streamflow predictions with the widest uncertainty band and unrealistic negative flows. The NL and BC methods can better deal with the heteroscedasticity and hence their corresponding predictive performances are improved, yet the negative flows cannot be avoided. The CA-SEP produces the most accurate predictions with the highest reliability and effectively avoids the negative flows, because the CA approach is capable of addressing the complicated heteroscedasticity over the study basin.

  17. Modelling and Predicting Backstroke Start Performance Using Non-Linear and Linear Models.

    Science.gov (United States)

    de Jesus, Karla; Ayala, Helon V H; de Jesus, Kelly; Coelho, Leandro Dos S; Medeiros, Alexandre I A; Abraldes, José A; Vaz, Mário A P; Fernandes, Ricardo J; Vilas-Boas, João Paulo

    2018-03-01

    Our aim was to compare non-linear and linear mathematical model responses for backstroke start performance prediction. Ten swimmers randomly completed eight 15 m backstroke starts with feet over the wedge, four with hands on the highest horizontal and four on the vertical handgrip. Swimmers were videotaped using a dual media camera set-up, with the starts being performed over an instrumented block with four force plates. Artificial neural networks were applied to predict 5 m start time using kinematic and kinetic variables and to determine the accuracy of the mean absolute percentage error. Artificial neural networks predicted start time more robustly than the linear model with respect to changing training to the validation dataset for the vertical handgrip (3.95 ± 1.67 vs. 5.92 ± 3.27%). Artificial neural networks obtained a smaller mean absolute percentage error than the linear model in the horizontal (0.43 ± 0.19 vs. 0.98 ± 0.19%) and vertical handgrip (0.45 ± 0.19 vs. 1.38 ± 0.30%) using all input data. The best artificial neural network validation revealed a smaller mean absolute error than the linear model for the horizontal (0.007 vs. 0.04 s) and vertical handgrip (0.01 vs. 0.03 s). Artificial neural networks should be used for backstroke 5 m start time prediction due to the quite small differences among the elite level performances.

  18. Optimization of maintenance for power system equipment using a predictive health model

    NARCIS (Netherlands)

    Bajracharya, G.; Koltunowicz, T.; Negenborn, R.R.; Papp, Z.; Djairam, D.; Schutter, B.D. de; Smit, J.J.

    2009-01-01

    In this paper, a model-predictive control based framework is proposed for modeling and optimization of the health state of power system equipment. In the framework, a predictive health model is proposed that predicts the health state of the equipment based on its usage and maintenance actions. Based

  19. Baryogenesis model predicting antimatter in the Universe

    International Nuclear Information System (INIS)

    Kirilova, D.

    2003-01-01

    Cosmic ray and gamma-ray data do not rule out antimatter domains in the Universe, separated at distances bigger than 10 Mpc from us. Hence, it is interesting to analyze the possible generation of vast antimatter structures during the early Universe evolution. We discuss a SUSY-condensate baryogenesis model, predicting large separated regions of matter and antimatter. The model provides generation of the small locally observed baryon asymmetry for a natural initial conditions, it predicts vast antimatter domains, separated from the matter ones by baryonically empty voids. The characteristic scale of antimatter regions and their distance from the matter ones is in accordance with observational constraints from cosmic ray, gamma-ray and cosmic microwave background anisotropy data

  20. Load-based approaches for modelling visual clarity in streams at regional scale.

    Science.gov (United States)

    Elliott, A H; Davies-Colley, R J; Parshotam, A; Ballantine, D

    2013-01-01

    Reduction of visual clarity in streams by diffuse sources of fine sediment is a cause of water quality impairment in New Zealand and internationally. In this paper we introduce the concept of a load of optical cross section (LOCS), which can be used for load-based management of light-attenuating substances and for water quality models that are based on mass accounting. In this approach, the beam attenuation coefficient (units of m(-1)) is estimated from the inverse of the visual clarity (units of m) measured with a black disc. This beam attenuation coefficient can also be considered as an optical cross section (OCS) per volume of water, analogous to a concentration. The instantaneous 'flux' of cross section is obtained from the attenuation coefficient multiplied by the water discharge, and this can be accumulated over time to give an accumulated 'load' of cross section (LOCS). Moreover, OCS is a conservative quantity, in the sense that the OCS of two combined water volumes is the sum of the OCS of the individual water volumes (barring effects such as coagulation, settling, or sorption). The LOCS can be calculated for a water quality station using rating curve methods applied to measured time series of visual clarity and flow. This approach was applied to the sites in New Zealand's National Rivers Water Quality Network (NRWQN). Although the attenuation coefficient follows roughly a power relation with flow at some sites, more flexible loess rating curves are required at other sites. The hybrid mechanistic-statistical catchment model SPARROW (SPAtially Referenced Regressions On Watershed attributes), which is based on a mass balance for mean annual load, was then applied to the NRWQN dataset. Preliminary results from this model are presented, highlighting the importance of factors related to erosion, such as rainfall, slope, hardness of catchment rock types, and the influence of pastoral development on the load of optical cross section.

  1. Prediction models for successful external cephalic version: a systematic review

    NARCIS (Netherlands)

    Velzel, Joost; de Hundt, Marcella; Mulder, Frederique M.; Molkenboer, Jan F. M.; van der Post, Joris A. M.; Mol, Ben W.; Kok, Marjolein

    2015-01-01

    To provide an overview of existing prediction models for successful ECV, and to assess their quality, development and performance. We searched MEDLINE, EMBASE and the Cochrane Library to identify all articles reporting on prediction models for successful ECV published from inception to January 2015.

  2. Refining the Committee Approach and Uncertainty Prediction in Hydrological Modelling

    NARCIS (Netherlands)

    Kayastha, N.

    2014-01-01

    Due to the complexity of hydrological systems a single model may be unable to capture the full range of a catchment response and accurately predict the streamflows. The multi modelling approach opens up possibilities for handling such difficulties and allows improve the predictive capability of

  3. Comparative analysis of modified PMV models and SET models to predict human thermal sensation in naturally ventilated buildings

    DEFF Research Database (Denmark)

    Gao, Jie; Wang, Yi; Wargocki, Pawel

    2015-01-01

    In this paper, a comparative analysis was performed on the human thermal sensation estimated by modified predicted mean vote (PMV) models and modified standard effective temperature (SET) models in naturally ventilated buildings; the data were collected in field study. These prediction models were....../s, the expectancy factors for the extended PMV model and the extended SET model were from 0.770 to 0.974 and from 1.330 to 1.363, and the adaptive coefficients for the adaptive PMV model and the adaptive SET model were from 0.029 to 0.167 and from-0.213 to-0.195. In addition, the difference in thermal sensation...... between the measured and predicted values using the modified PMV models exceeded 25%, while the difference between the measured thermal sensation and the predicted thermal sensation using modified SET models was approximately less than 25%. It is concluded that the modified SET models can predict human...

  4. Ultra-Short-Term Wind Power Prediction Using a Hybrid Model

    Science.gov (United States)

    Mohammed, E.; Wang, S.; Yu, J.

    2017-05-01

    This paper aims to develop and apply a hybrid model of two data analytical methods, multiple linear regressions and least square (MLR&LS), for ultra-short-term wind power prediction (WPP), for example taking, Northeast China electricity demand. The data was obtained from the historical records of wind power from an offshore region, and from a wind farm of the wind power plant in the areas. The WPP achieved in two stages: first, the ratios of wind power were forecasted using the proposed hybrid method, and then the transformation of these ratios of wind power to obtain forecasted values. The hybrid model combines the persistence methods, MLR and LS. The proposed method included two prediction types, multi-point prediction and single-point prediction. WPP is tested by applying different models such as autoregressive moving average (ARMA), autoregressive integrated moving average (ARIMA) and artificial neural network (ANN). By comparing results of the above models, the validity of the proposed hybrid model is confirmed in terms of error and correlation coefficient. Comparison of results confirmed that the proposed method works effectively. Additional, forecasting errors were also computed and compared, to improve understanding of how to depict highly variable WPP and the correlations between actual and predicted wind power.

  5. Formability prediction for AHSS materials using damage models

    Science.gov (United States)

    Amaral, R.; Santos, Abel D.; José, César de Sá; Miranda, Sara

    2017-05-01

    Advanced high strength steels (AHSS) are seeing an increased use, mostly due to lightweight design in automobile industry and strict regulations on safety and greenhouse gases emissions. However, the use of these materials, characterized by a high strength to weight ratio, stiffness and high work hardening at early stages of plastic deformation, have imposed many challenges in sheet metal industry, mainly their low formability and different behaviour, when compared to traditional steels, which may represent a defying task, both to obtain a successful component and also when using numerical simulation to predict material behaviour and its fracture limits. Although numerical prediction of critical strains in sheet metal forming processes is still very often based on the classic forming limit diagrams, alternative approaches can use damage models, which are based on stress states to predict failure during the forming process and they can be classified as empirical, physics based and phenomenological models. In the present paper a comparative analysis of different ductile damage models is carried out, in order numerically evaluate two isotropic coupled damage models proposed by Johnson-Cook and Gurson-Tvergaard-Needleman (GTN), each of them corresponding to the first two previous group classification. Finite element analysis is used considering these damage mechanics approaches and the obtained results are compared with experimental Nakajima tests, thus being possible to evaluate and validate the ability to predict damage and formability limits for previous defined approaches.

  6. Formability prediction for AHSS materials using damage models

    International Nuclear Information System (INIS)

    Amaral, R.; Miranda, Sara; Santos, Abel D.; José, César de Sá

    2017-01-01

    Advanced high strength steels (AHSS) are seeing an increased use, mostly due to lightweight design in automobile industry and strict regulations on safety and greenhouse gases emissions. However, the use of these materials, characterized by a high strength to weight ratio, stiffness and high work hardening at early stages of plastic deformation, have imposed many challenges in sheet metal industry, mainly their low formability and different behaviour, when compared to traditional steels, which may represent a defying task, both to obtain a successful component and also when using numerical simulation to predict material behaviour and its fracture limits. Although numerical prediction of critical strains in sheet metal forming processes is still very often based on the classic forming limit diagrams, alternative approaches can use damage models, which are based on stress states to predict failure during the forming process and they can be classified as empirical, physics based and phenomenological models. In the present paper a comparative analysis of different ductile damage models is carried out, in order numerically evaluate two isotropic coupled damage models proposed by Johnson-Cook and Gurson-Tvergaard-Needleman (GTN), each of them corresponding to the first two previous group classification. Finite element analysis is used considering these damage mechanics approaches and the obtained results are compared with experimental Nakajima tests, thus being possible to evaluate and validate the ability to predict damage and formability limits for previous defined approaches. (paper)

  7. A joint calibration model for combining predictive distributions

    Directory of Open Access Journals (Sweden)

    Patrizia Agati

    2013-05-01

    Full Text Available In many research fields, as for example in probabilistic weather forecasting, valuable predictive information about a future random phenomenon may come from several, possibly heterogeneous, sources. Forecast combining methods have been developed over the years in order to deal with ensembles of sources: the aim is to combine several predictions in such a way to improve forecast accuracy and reduce risk of bad forecasts.In this context, we propose the use of a Bayesian approach to information combining, which consists in treating the predictive probability density functions (pdfs from the individual ensemble members as data in a Bayesian updating problem. The likelihood function is shown to be proportional to the product of the pdfs, adjusted by a joint “calibration function” describing the predicting skill of the sources (Morris, 1977. In this paper, after rephrasing Morris’ algorithm in a predictive context, we propose to model the calibration function in terms of bias, scale and correlation and to estimate its parameters according to the least squares criterion. The performance of our method is investigated and compared with that of Bayesian Model Averaging (Raftery, 2005 on simulated data.

  8. Modeling, Prediction, and Control of Heating Temperature for Tube Billet

    Directory of Open Access Journals (Sweden)

    Yachun Mao

    2015-01-01

    Full Text Available Annular furnaces have multivariate, nonlinear, large time lag, and cross coupling characteristics. The prediction and control of the exit temperature of a tube billet are important but difficult. We establish a prediction model for the final temperature of a tube billet through OS-ELM-DRPLS method. We address the complex production characteristics, integrate the advantages of PLS and ELM algorithms in establishing linear and nonlinear models, and consider model update and data lag. Based on the proposed model, we design a prediction control algorithm for tube billet temperature. The algorithm is validated using the practical production data of Baosteel Co., Ltd. Results show that the model achieves the precision required in industrial applications. The temperature of the tube billet can be controlled within the required temperature range through compensation control method.

  9. Vulnerability and adaptation to severe weather events in the American southwest

    OpenAIRE

    Boero, Riccardo; Bianchini, Laura; Pasqualini, Donatella

    2015-01-01

    Climate change can induce changes in the frequency of severe weather events representing a threat to socio-economic development. It is thus of uttermost importance to understand how the vulnerability to the weather of local communities is determined and how adaptation public policies can be effectively put in place. We focused our empirical analysis on the American Southwest. Results show that, consistently with the predictions of an investment model, economic characteristics signaling loc...

  10. An Operational Model for the Prediction of Jet Blast

    Science.gov (United States)

    2012-01-09

    This paper presents an operational model for the prediction of jet blast. The model was : developed based upon three modules including a jet exhaust model, jet centerline decay : model and aircraft motion model. The final analysis was compared with d...

  11. Wind turbine control and model predictive control for uncertain systems

    DEFF Research Database (Denmark)

    Thomsen, Sven Creutz

    as disturbance models for controller design. The theoretical study deals with Model Predictive Control (MPC). MPC is an optimal control method which is characterized by the use of a receding prediction horizon. MPC has risen in popularity due to its inherent ability to systematically account for time...

  12. FPGA implementation of predictive degradation model for engine oil lifetime

    Science.gov (United States)

    Idros, M. F. M.; Razak, A. H. A.; Junid, S. A. M. Al; Suliman, S. I.; Halim, A. K.

    2018-03-01

    This paper presents the implementation of linear regression model for degradation prediction on Register Transfer Logic (RTL) using QuartusII. A stationary model had been identified in the degradation trend for the engine oil in a vehicle in time series method. As for RTL implementation, the degradation model is written in Verilog HDL and the data input are taken at a certain time. Clock divider had been designed to support the timing sequence of input data. At every five data, a regression analysis is adapted for slope variation determination and prediction calculation. Here, only the negative value are taken as the consideration for the prediction purposes for less number of logic gate. Least Square Method is adapted to get the best linear model based on the mean values of time series data. The coded algorithm has been implemented on FPGA for validation purposes. The result shows the prediction time to change the engine oil.

  13. Predicting typhoon-induced storm surge tide with a two-dimensional hydrodynamic model and artificial neural network model

    Science.gov (United States)

    Chen, W.-B.; Liu, W.-C.; Hsu, M.-H.

    2012-12-01

    Precise predictions of storm surges during typhoon events have the necessity for disaster prevention in coastal seas. This paper explores an artificial neural network (ANN) model, including the back propagation neural network (BPNN) and adaptive neuro-fuzzy inference system (ANFIS) algorithms used to correct poor calculations with a two-dimensional hydrodynamic model in predicting storm surge height during typhoon events. The two-dimensional model has a fine horizontal resolution and considers the interaction between storm surges and astronomical tides, which can be applied for describing the complicated physical properties of storm surges along the east coast of Taiwan. The model is driven by the tidal elevation at the open boundaries using a global ocean tidal model and is forced by the meteorological conditions using a cyclone model. The simulated results of the hydrodynamic model indicate that this model fails to predict storm surge height during the model calibration and verification phases as typhoons approached the east coast of Taiwan. The BPNN model can reproduce the astronomical tide level but fails to modify the prediction of the storm surge tide level. The ANFIS model satisfactorily predicts both the astronomical tide level and the storm surge height during the training and verification phases and exhibits the lowest values of mean absolute error and root-mean-square error compared to the simulated results at the different stations using the hydrodynamic model and the BPNN model. Comparison results showed that the ANFIS techniques could be successfully applied in predicting water levels along the east coastal of Taiwan during typhoon events.

  14. Detailed physical properties prediction of pure methyl esters for biodiesel combustion modeling

    International Nuclear Information System (INIS)

    An, H.; Yang, W.M.; Maghbouli, A.; Chou, S.K.; Chua, K.J.

    2013-01-01

    Highlights: ► Group contribution methods from molecular level have been used for the prediction. ► Complete prediction of the physical properties for 5 methyl esters has been done. ► The predicted results can be very useful for biodiesel combustion modeling. ► Various models have been compared and the best model has been identified. ► Predicted properties are over large temperature ranges with excellent accuracies. -- Abstract: In order to accurately simulate the fuel spray, atomization, combustion and emission formation processes of a diesel engine fueled with biodiesel, adequate knowledge of biodiesel’s physical properties is desired. The objective of this work is to do a detailed physical properties prediction for the five major methyl esters of biodiesel for combustion modeling. The physical properties considered in this study are: normal boiling point, critical properties, vapor pressure, and latent heat of vaporization, liquid density, liquid viscosity, liquid thermal conductivity, gas diffusion coefficients and surface tension. For each physical property, the best prediction model has been identified, and very good agreements have been obtained between the predicted results and the published data where available. The calculated results can be used as key references for biodiesel combustion modeling.

  15. Our calibrated model has poor predictive value: An example from the petroleum industry

    Energy Technology Data Exchange (ETDEWEB)

    Carter, J.N. [Department of Earth Science and Engineering, Imperial College, London (United Kingdom)]. E-mail: j.n.carter@ic.ac.uk; Ballester, P.J. [Department of Earth Science and Engineering, Imperial College, London (United Kingdom); Tavassoli, Z. [Department of Earth Science and Engineering, Imperial College, London (United Kingdom); King, P.R. [Department of Earth Science and Engineering, Imperial College, London (United Kingdom)

    2006-10-15

    It is often assumed that once a model has been calibrated to measurements then it will have some level of predictive capability, although this may be limited. If the model does not have predictive capability then the assumption is that the model needs to be improved in some way. Using an example from the petroleum industry, we show that cases can exit where calibrated models have limited predictive capability. This occurs even when there is no modelling error present. It is also shown that the introduction of a small modelling error can make it impossible to obtain any models with useful predictive capability. We have been unable to find ways of identifying which calibrated models will have some predictive capacity and those which will not.

  16. Our calibrated model has poor predictive value: An example from the petroleum industry

    International Nuclear Information System (INIS)

    Carter, J.N.; Ballester, P.J.; Tavassoli, Z.; King, P.R.

    2006-01-01

    It is often assumed that once a model has been calibrated to measurements then it will have some level of predictive capability, although this may be limited. If the model does not have predictive capability then the assumption is that the model needs to be improved in some way. Using an example from the petroleum industry, we show that cases can exit where calibrated models have limited predictive capability. This occurs even when there is no modelling error present. It is also shown that the introduction of a small modelling error can make it impossible to obtain any models with useful predictive capability. We have been unable to find ways of identifying which calibrated models will have some predictive capacity and those which will not

  17. Prediction of selected Indian stock using a partitioning–interpolation based ARIMA–GARCH model

    Directory of Open Access Journals (Sweden)

    C. Narendra Babu

    2015-07-01

    Full Text Available Accurate long-term prediction of time series data (TSD is a very useful research challenge in diversified fields. As financial TSD are highly volatile, multi-step prediction of financial TSD is a major research problem in TSD mining. The two challenges encountered are, maintaining high prediction accuracy and preserving the data trend across the forecast horizon. The linear traditional models such as autoregressive integrated moving average (ARIMA and generalized autoregressive conditional heteroscedastic (GARCH preserve data trend to some extent, at the cost of prediction accuracy. Non-linear models like ANN maintain prediction accuracy by sacrificing data trend. In this paper, a linear hybrid model, which maintains prediction accuracy while preserving data trend, is proposed. A quantitative reasoning analysis justifying the accuracy of proposed model is also presented. A moving-average (MA filter based pre-processing, partitioning and interpolation (PI technique are incorporated by the proposed model. Some existing models and the proposed model are applied on selected NSE India stock market data. Performance results show that for multi-step ahead prediction, the proposed model outperforms the others in terms of both prediction accuracy and preserving data trend.

  18. A real-time prediction model for post-irradiation malignant cervical lymph nodes.

    Science.gov (United States)

    Lo, W-C; Cheng, P-W; Shueng, P-W; Hsieh, C-H; Chang, Y-L; Liao, L-J

    2018-04-01

    To establish a real-time predictive scoring model based on sonographic characteristics for identifying malignant cervical lymph nodes (LNs) in cancer patients after neck irradiation. One-hundred forty-four irradiation-treated patients underwent ultrasonography and ultrasound-guided fine-needle aspirations (USgFNAs), and the resultant data were used to construct a real-time and computerised predictive scoring model. This scoring system was further compared with our previously proposed prediction model. A predictive scoring model, 1.35 × (L axis) + 2.03 × (S axis) + 2.27 × (margin) + 1.48 × (echogenic hilum) + 3.7, was generated by stepwise multivariate logistic regression analysis. Neck LNs were considered to be malignant when the score was ≥ 7, corresponding to a sensitivity of 85.5%, specificity of 79.4%, positive predictive value (PPV) of 82.3%, negative predictive value (NPV) of 83.1%, and overall accuracy of 82.6%. When this new model and the original model were compared, the areas under the receiver operating characteristic curve (c-statistic) were 0.89 and 0.81, respectively (P real-time sonographic predictive scoring model was constructed to provide prompt and reliable guidance for USgFNA biopsies to manage cervical LNs after neck irradiation. © 2017 John Wiley & Sons Ltd.

  19. Housing price prediction: parametric versus semi-parametric spatial hedonic models

    Science.gov (United States)

    Montero, José-María; Mínguez, Román; Fernández-Avilés, Gema

    2018-01-01

    House price prediction is a hot topic in the economic literature. House price prediction has traditionally been approached using a-spatial linear (or intrinsically linear) hedonic models. It has been shown, however, that spatial effects are inherent in house pricing. This article considers parametric and semi-parametric spatial hedonic model variants that account for spatial autocorrelation, spatial heterogeneity and (smooth and nonparametrically specified) nonlinearities using penalized splines methodology. The models are represented as a mixed model that allow for the estimation of the smoothing parameters along with the other parameters of the model. To assess the out-of-sample performance of the models, the paper uses a database containing the price and characteristics of 10,512 homes in Madrid, Spain (Q1 2010). The results obtained suggest that the nonlinear models accounting for spatial heterogeneity and flexible nonlinear relationships between some of the individual or areal characteristics of the houses and their prices are the best strategies for house price prediction.

  20. A two-parameter model to predict fracture in the transition

    International Nuclear Information System (INIS)

    DeAquino, C.T.; Landes, J.D.; McCabe, D.E.

    1995-01-01

    A model is proposed that uses a numerical characterization of the crack tip stress field modified by the J - Q constraint theory and a weak link assumption to predict fracture behavior in the transition for reactor vessel steels. This model predicts the toughness scatter band for a component model from a toughness scatter band measured on a test specimen geometry. The model has been applied previously to two-dimensional through cracks. Many applications to actual components structures involve three-dimensional surface flaws. These cases require a more difficult level of analysis and need additional information. In this paper, both the current model for two-dimensional cracks and an approach needed to extend the model for the prediction of transition fracture behavior in three-dimensional surface flaws are discussed. Examples are presented to show how the model can be applied and in some cases to compare with other test results. (author). 13 refs., 7 figs

  1. An efficient numerical target strength prediction model: Validation against analysis solutions

    NARCIS (Netherlands)

    Fillinger, L.; Nijhof, M.J.J.; Jong, C.A.F. de

    2014-01-01

    A decade ago, TNO developed RASP (Rapid Acoustic Signature Prediction), a numerical model for the prediction of the target strength of immersed underwater objects. The model is based on Kirchhoff diffraction theory. It is currently being improved to model refraction, angle dependent reflection and

  2. Confronting species distribution model predictions with species functional traits.

    Science.gov (United States)

    Wittmann, Marion E; Barnes, Matthew A; Jerde, Christopher L; Jones, Lisa A; Lodge, David M

    2016-02-01

    Species distribution models are valuable tools in studies of biogeography, ecology, and climate change and have been used to inform conservation and ecosystem management. However, species distribution models typically incorporate only climatic variables and species presence data. Model development or validation rarely considers functional components of species traits or other types of biological data. We implemented a species distribution model (Maxent) to predict global climate habitat suitability for Grass Carp (Ctenopharyngodon idella). We then tested the relationship between the degree of climate habitat suitability predicted by Maxent and the individual growth rates of both wild (N = 17) and stocked (N = 51) Grass Carp populations using correlation analysis. The Grass Carp Maxent model accurately reflected the global occurrence data (AUC = 0.904). Observations of Grass Carp growth rate covered six continents and ranged from 0.19 to 20.1 g day(-1). Species distribution model predictions were correlated (r = 0.5, 95% CI (0.03, 0.79)) with observed growth rates for wild Grass Carp populations but were not correlated (r = -0.26, 95% CI (-0.5, 0.012)) with stocked populations. Further, a review of the literature indicates that the few studies for other species that have previously assessed the relationship between the degree of predicted climate habitat suitability and species functional traits have also discovered significant relationships. Thus, species distribution models may provide inferences beyond just where a species may occur, providing a useful tool to understand the linkage between species distributions and underlying biological mechanisms.

  3. Predictive Models, How good are they?

    DEFF Research Database (Denmark)

    Kasch, Helge

    The WAD grading system has been used for more than 20 years by now. It has shown long-term viability, but with strengths and limitations. New bio-psychosocial assessment of the acute whiplash injured subject may provide better prediction of long-term disability and pain. Furthermore, the emerging......-up. It is important to obtain prospective identification of the relevant risk underreported disability could, if we were able to expose these hidden “risk-factors” during our consultations, provide us with better predictive models. New data from large clinical studies will present exciting new genetic risk markers...

  4. Application of a predictive Bayesian model to environmental accounting.

    Science.gov (United States)

    Anex, R P; Englehardt, J D

    2001-03-30

    Environmental accounting techniques are intended to capture important environmental costs and benefits that are often overlooked in standard accounting practices. Environmental accounting methods themselves often ignore or inadequately represent large but highly uncertain environmental costs and costs conditioned by specific prior events. Use of a predictive Bayesian model is demonstrated for the assessment of such highly uncertain environmental and contingent costs. The predictive Bayesian approach presented generates probability distributions for the quantity of interest (rather than parameters thereof). A spreadsheet implementation of a previously proposed predictive Bayesian model, extended to represent contingent costs, is described and used to evaluate whether a firm should undertake an accelerated phase-out of its PCB containing transformers. Variability and uncertainty (due to lack of information) in transformer accident frequency and severity are assessed simultaneously using a combination of historical accident data, engineering model-based cost estimates, and subjective judgement. Model results are compared using several different risk measures. Use of the model for incorporation of environmental risk management into a company's overall risk management strategy is discussed.

  5. Model predictive controller design of hydrocracker reactors

    OpenAIRE

    GÖKÇE, Dila

    2011-01-01

    This study summarizes the design of a Model Predictive Controller (MPC) in Tüpraş, İzmit Refinery Hydrocracker Unit Reactors. Hydrocracking process, in which heavy vacuum gasoil is converted into lighter and valuable products at high temperature and pressure is described briefly. Controller design description, identification and modeling studies are examined and the model variables are presented. WABT (Weighted Average Bed Temperature) equalization and conversion increase are simulate...

  6. Wind farm production prediction - The Zephyr model

    Energy Technology Data Exchange (ETDEWEB)

    Landberg, L. [Risoe National Lab., Wind Energy Dept., Roskilde (Denmark); Giebel, G. [Risoe National Lab., Wind Energy Dept., Roskilde (Denmark); Madsen, H. [IMM (DTU), Kgs. Lyngby (Denmark); Nielsen, T.S. [IMM (DTU), Kgs. Lyngby (Denmark); Joergensen, J.U. [Danish Meteorologisk Inst., Copenhagen (Denmark); Lauersen, L. [Danish Meteorologisk Inst., Copenhagen (Denmark); Toefting, J. [Elsam, Fredericia (DK); Christensen, H.S. [Eltra, Fredericia (Denmark); Bjerge, C. [SEAS, Haslev (Denmark)

    2002-06-01

    This report describes a project - funded by the Danish Ministry of Energy and the Environment - which developed a next generation prediction system called Zephyr. The Zephyr system is a merging between two state-of-the-art prediction systems: Prediktor of Risoe National Laboratory and WPPT of IMM at the Danish Technical University. The numerical weather predictions were generated by DMI's HIRLAM model. Due to technical difficulties programming the system, only the computational core and a very simple version of the originally very complex system were developed. The project partners were: Risoe, DMU, DMI, Elsam, Eltra, Elkraft System, SEAS and E2. (au)

  7. Predictive modeling and reducing cyclic variability in autoignition engines

    Science.gov (United States)

    Hellstrom, Erik; Stefanopoulou, Anna; Jiang, Li; Larimore, Jacob

    2016-08-30

    Methods and systems are provided for controlling a vehicle engine to reduce cycle-to-cycle combustion variation. A predictive model is applied to predict cycle-to-cycle combustion behavior of an engine based on observed engine performance variables. Conditions are identified, based on the predicted cycle-to-cycle combustion behavior, that indicate high cycle-to-cycle combustion variation. Corrective measures are then applied to prevent the predicted high cycle-to-cycle combustion variation.

  8. A Novel Modelling Approach for Predicting Forest Growth and Yield under Climate Change.

    Directory of Open Access Journals (Sweden)

    M Irfan Ashraf

    Full Text Available Global climate is changing due to increasing anthropogenic emissions of greenhouse gases. Forest managers need growth and yield models that can be used to predict future forest dynamics during the transition period of present-day forests under a changing climatic regime. In this study, we developed a forest growth and yield model that can be used to predict individual-tree growth under current and projected future climatic conditions. The model was constructed by integrating historical tree growth records with predictions from an ecological process-based model using neural networks. The new model predicts basal area (BA and volume growth for individual trees in pure or mixed species forests. For model development, tree-growth data under current climatic conditions were obtained using over 3000 permanent sample plots from the Province of Nova Scotia, Canada. Data to reflect tree growth under a changing climatic regime were projected with JABOWA-3 (an ecological process-based model. Model validation with designated data produced model efficiencies of 0.82 and 0.89 in predicting individual-tree BA and volume growth. Model efficiency is a relative index of model performance, where 1 indicates an ideal fit, while values lower than zero means the predictions are no better than the average of the observations. Overall mean prediction error (BIAS of basal area and volume growth predictions was nominal (i.e., for BA: -0.0177 cm(2 5-year(-1 and volume: 0.0008 m(3 5-year(-1. Model variability described by root mean squared error (RMSE in basal area prediction was 40.53 cm(2 5-year(-1 and 0.0393 m(3 5-year(-1 in volume prediction. The new modelling approach has potential to reduce uncertainties in growth and yield predictions under different climate change scenarios. This novel approach provides an avenue for forest managers to generate required information for the management of forests in transitional periods of climate change. Artificial intelligence

  9. Conceptual Software Reliability Prediction Models for Nuclear Power Plant Safety Systems

    International Nuclear Information System (INIS)

    Johnson, G.; Lawrence, D.; Yu, H.

    2000-01-01

    The objective of this project is to develop a method to predict the potential reliability of software to be used in a digital system instrumentation and control system. The reliability prediction is to make use of existing measures of software reliability such as those described in IEEE Std 982 and 982.2. This prediction must be of sufficient accuracy to provide a value for uncertainty that could be used in a nuclear power plant probabilistic risk assessment (PRA). For the purposes of the project, reliability was defined to be the probability that the digital system will successfully perform its intended safety function (for the distribution of conditions under which it is expected to respond) upon demand with no unintended functions that might affect system safety. The ultimate objective is to use the identified measures to develop a method for predicting the potential quantitative reliability of a digital system. The reliability prediction models proposed in this report are conceptual in nature. That is, possible prediction techniques are proposed and trial models are built, but in order to become a useful tool for predicting reliability, the models must be tested, modified according to the results, and validated. Using methods outlined by this project, models could be constructed to develop reliability estimates for elements of software systems. This would require careful review and refinement of the models, development of model parameters from actual experience data or expert elicitation, and careful validation. By combining these reliability estimates (generated from the validated models for the constituent parts) in structural software models, the reliability of the software system could then be predicted. Modeling digital system reliability will also require that methods be developed for combining reliability estimates for hardware and software. System structural models must also be developed in order to predict system reliability based upon the reliability

  10. Research on a Novel Kernel Based Grey Prediction Model and Its Applications

    Directory of Open Access Journals (Sweden)

    Xin Ma

    2016-01-01

    Full Text Available The discrete grey prediction models have attracted considerable interest of research due to its effectiveness to improve the modelling accuracy of the traditional grey prediction models. The autoregressive GM(1,1 model, abbreviated as ARGM(1,1, is a novel discrete grey model which is easy to use and accurate in prediction of approximate nonhomogeneous exponential time series. However, the ARGM(1,1 is essentially a linear model; thus, its applicability is still limited. In this paper a novel kernel based ARGM(1,1 model is proposed, abbreviated as KARGM(1,1. The KARGM(1,1 has a nonlinear function which can be expressed by a kernel function using the kernel method, and its modelling procedures are presented in details. Two case studies of predicting the monthly gas well production are carried out with the real world production data. The results of KARGM(1,1 model are compared to the existing discrete univariate grey prediction models, including ARGM(1,1, NDGM(1,1,k, DGM(1,1, and NGBMOP, and it is shown that the KARGM(1,1 outperforms the other four models.

  11. Stochastic models for predicting pitting corrosion damage of HLRW containers

    International Nuclear Information System (INIS)

    Henshall, G.A.

    1991-10-01

    Stochastic models for predicting aqueous pitting corrosion damage of high-level radioactive-waste containers are described. These models could be used to predict the time required for the first pit to penetrate a conta