WorldWideScience

Sample records for lll ddd sss

  1. A verified LLL algorithm

    NARCIS (Netherlands)

    Divasón, Jose; Joosten, Sebastiaan; Thiemann, René; Yamada, Akihisa

    2018-01-01

    The Lenstra-Lenstra-Lovász basis reduction algorithm, also known as LLL algorithm, is an algorithm to find a basis with short, nearly orthogonal vectors of an integer lattice. Thereby, it can also be seen as an approximation to solve the shortest vector problem (SVP), which is an NP-hard problem,

  2. Geodesic continued fractions and LLL

    NARCIS (Netherlands)

    Beukers, F

    2014-01-01

    We discuss a proposal for a continued fraction-like algorithm to determine simultaneous rational approximations to dd real numbers α1,…,αdα1,…,αd. It combines an algorithm of Hermite and Lagarias with ideas from LLL-reduction. We dynamically LLL-reduce a quadratic form with parameter tt as t↓0t↓0.

  3. LLL hydrodiagnostics upgrade program

    International Nuclear Information System (INIS)

    Carpluk, G.T.; Innes, T.G.; Trost, S.R.

    1978-01-01

    The continued success of the nuclear weapon design and test programs is a direct result of the effective hydrodynamic programs developed at Livermore. Hydrodynamic studies provide the weapon designer with experimental verification and analysis of weapon designs through the use of explosively driven, nonfissile materials. Hydrodiagnostic techniques include (1) flash radiography; (2) high-speed photography; (3) electrical-pin diagnostics; and (4) interferometry. The focus of all hydrodynamic testing at LLL is the Site 300 Explosive Test Area located 18 miles east of Livermore. This remote, 10-mi 2 facility consists of: (1) areas for machining and assembling explosives; (2) environmental test facilities; (3) administrative and support facilities; and (4) five underground, reinforced-concrete bunkers equipped with high-speed cameras, electrical data-acquisition systems, and electron accelerators for flash radiography. The report summarizes the improvements made in radiography, optics, electronics, and interferometry, and indicates the projects that remain to be completed

  4. SSS* = AB+TT

    NARCIS (Netherlands)

    A. Plaat (Aske); J. Schaeffer; W.H.L.M. Pijls (Wim); A. de Bruin (Arie)

    1995-01-01

    textabstractIn 1979 Stockman introduced the SSS* minimax search algorithm that dominates alpha-beta in the number of leaf nodes expanded. Further investigation of the algorithm showed that it had three serious drawbacks, which prevented its use by practitioners: it is difficult to understand, it has

  5. Laser fusion experiments at LLL

    Energy Technology Data Exchange (ETDEWEB)

    Ahlstrom, H.G.

    1980-06-16

    These notes present the experimental basis and status for laser fusion as developed at LLL. Two other chapters, one authored by K.A. Brueckner and the other by C. Max, present the theoretical implosion physics and laser plasma interaction physics. The notes consist of six sections. The first is an introductory section which provides some of the history of inertial fusion and a simple explanation of the concepts involved. The second section presents an extensive discussion of diagnostic instrumentation used in the LLL Laser Fusion Program. The third section is a presentation of laser facilities and capabilities at LLL. The purpose here is to define capability, not to derive how it was obtained. The fourth and fifth sections present the experimental data on laser-plasma interaction and implosion physics. The last chapter is a short projection of the future.

  6. Laser fusion experiments at LLL

    International Nuclear Information System (INIS)

    Ahlstrom, H.G.

    1980-01-01

    These notes present the experimental basis and status for laser fusion as developed at LLL. Two other chapters, one authored by K.A. Brueckner and the other by C. Max, present the theoretical implosion physics and laser plasma interaction physics. The notes consist of six sections. The first is an introductory section which provides some of the history of inertial fusion and a simple explanation of the concepts involved. The second section presents an extensive discussion of diagnostic instrumentation used in the LLL Laser Fusion Program. The third section is a presentation of laser facilities and capabilities at LLL. The purpose here is to define capability, not to derive how it was obtained. The fourth and fifth sections present the experimental data on laser-plasma interaction and implosion physics. The last chapter is a short projection of the future

  7. Achievements and developments at LLL

    International Nuclear Information System (INIS)

    Anon.

    1977-01-01

    In discussing Laboratory trends, the Director cited numerous examples of progress recorded during the past year. This summary highlights some of the programmatic and research milestones that marked 1976 and that represent the diversity of efforts carried out at LLL. 6 figures

  8. LPTR irradiation of LLL vanadium tensile specimens and LLL Nb--1Zr tensile specimens

    International Nuclear Information System (INIS)

    MacLean, S.C.; Rowe, C.L.

    1977-01-01

    The LPTR irradiation of 14 LLL vanadium tensile specimens and 14 LLL Nb-1Zr tensile specimens is described. Sample packaging, the irradiation schedule and neutron fluences for three energy ranges are given

  9. The LLL algorithm survey and applications

    CERN Document Server

    Nguyen, Phong Q

    2010-01-01

    The first book to offer a comprehensive view of the LLL algorithm, this text surveys computational aspects of Euclidean lattices and their main applications. It includes many detailed motivations, explanations and examples.

  10. The history of the LLL-algorithm

    NARCIS (Netherlands)

    Smeets, I.; Lenstra, A.; Lenstra, H.; Lovász, L.; van Emde Boas, P.

    2010-01-01

    The 25th birthday of the LLL-algorithm was celebrated in Caen from 29th June to 1st July 2007. The three day conference kicked off with a historical session of four talks about the origins of the algorithm. The speakers were the three L’s and close bystander Peter van Emde Boas. These were the

  11. Segment LLL Reduction of Lattice Bases Using Modular Arithmetic

    Directory of Open Access Journals (Sweden)

    Sanjay Mehrotra

    2010-07-01

    Full Text Available The algorithm of Lenstra, Lenstra, and Lovász (LLL transforms a given integer lattice basis into a reduced basis. Storjohann improved the worst case complexity of LLL algorithms by a factor of O(n using modular arithmetic. Koy and Schnorr developed a segment-LLL basis reduction algorithm that generates lattice basis satisfying a weaker condition than the LLL reduced basis with O(n improvement than the LLL algorithm. In this paper we combine Storjohann’s modular arithmetic approach with the segment-LLL approach to further improve the worst case complexity of the segment-LLL algorithms by a factor of n0.5.

  12. N-Dimensional LLL Reduction Algorithm with Pivoted Reflection

    Directory of Open Access Journals (Sweden)

    Zhongliang Deng

    2018-01-01

    Full Text Available The Lenstra-Lenstra-Lovász (LLL lattice reduction algorithm and many of its variants have been widely used by cryptography, multiple-input-multiple-output (MIMO communication systems and carrier phase positioning in global navigation satellite system (GNSS to solve the integer least squares (ILS problem. In this paper, we propose an n-dimensional LLL reduction algorithm (n-LLL, expanding the Lovász condition in LLL algorithm to n-dimensional space in order to obtain a further reduced basis. We also introduce pivoted Householder reflection into the algorithm to optimize the reduction time. For an m-order positive definite matrix, analysis shows that the n-LLL reduction algorithm will converge within finite steps and always produce better results than the original LLL reduction algorithm with n > 2. The simulations clearly prove that n-LLL is better than the original LLL in reducing the condition number of an ill-conditioned input matrix with 39% improvement on average for typical cases, which can significantly reduce the searching space for solving ILS problem. The simulation results also show that the pivoted reflection has significantly declined the number of swaps in the algorithm by 57%, making n-LLL a more practical reduction algorithm.

  13. [Validation of the IBS-SSS].

    Science.gov (United States)

    Betz, C; Mannsdörfer, K; Bischoff, S C

    2013-10-01

    Irritable bowel syndrome (IBS) is a functional gastrointestinal disorder characterised by abdominal pain, associated with stool abnormalities and changes in stool consistency. Diagnosis of IBS is based on characteristic symptoms and exclusion of other gastrointestinal diseases. A number of questionnaires exist to assist diagnosis and assessment of severity of the disease. One of these is the irritable bowel syndrome - severity scoring system (IBS-SSS). The IBS-SSS was validated 1997 in its English version. In the present study, the IBS-SSS has been validated in German language. To do this, a cohort of 60 patients with IBS according to the Rome III criteria, was compared with a control group of healthy individuals (n = 38). We studied sensitivity and reproducibility of the score, as well as the sensitivity to detect changes of symptom severity. The results of the German validation largely reflect the results of the English validation. The German version of the IBS-SSS is also a valid, meaningful and reproducible questionnaire with a high sensitivity to assess changes in symptom severity, especially in IBS patients with moderate symptoms. It is unclear if the IBS-SSS is also a valid questionnaire in IBS patients with severe symptoms because this group of patients was not studied. © Georg Thieme Verlag KG Stuttgart · New York.

  14. Computerized mass spectrometer data system at LLL

    International Nuclear Information System (INIS)

    Friesen, R.D.; Dupzyk, R.J.

    1976-01-01

    The data systems on the three mass spectrometers at LLL are computer-controlled, pulse-counting systems synchronized to a repeatedly swept magnetic field. The data are accumulated in the memory of the computer or in a Nuclear Data ND 180 in a multi-scaler mode of operation. This mode of data acquisition allows a continuous check of the background stability and makes tune-up easier. But the main benefit is a reduction in the required ion emission rate stability. By the use of standards to set the system dead time, we have been able to utilize the sensitivity of a pulse counting system without the expense of exotic equipment

  15. Mass spectrometer data system at LLL

    International Nuclear Information System (INIS)

    Friesen, R.D.

    1975-01-01

    The data systems on the three mass spectrometers at LLL are computer-controlled, pulse-counting systems synchronized to a repeatedly-swept magnetic field. The data are accumulated in the memory of the computer or in a Nuclear Data ND 180 in a multi-scaler mode of operation. This mode of sweeping allows a continuous check of the background stability and makes tune-up easier. But the main benefit is a reduction in the required ion emission rate stability. By the use of standards to set the system dead time, we have been able to utilize the sensitivity of a pulse counting system without the expense of exotic equipment

  16. Another view on the SSS* algorithm

    NARCIS (Netherlands)

    W.H.L.M. Pijls (Wim); A. de Bruin (Arie)

    1990-01-01

    textabstractA new version of the SSS* algorithm for searching game trees is presented. This algorithm is built around two recursive procedures. It finds the minimax value of a game tree by first establishing an upper bound to this value and then successively trying in a top down fashion to tighten

  17. DT fusion neutron irradiation of LLL Nb3Sn and LLL superconductor wires at 4.20K

    International Nuclear Information System (INIS)

    MacLean, S.C.

    1977-01-01

    The DT fusion neutron irradiation of one LLL superconductor wire and one LLL Nb 3 Sn foil at 4.2 0 K is described. The sample position, beam-on time, and neutron dose record are given. The results from two ''profile'' dosimetry foils measuring the lateral variation in neutron flux are included

  18. LLL magnetic fusion energy program: an overview

    International Nuclear Information System (INIS)

    Anon.

    1976-01-01

    Over the last 12 months, significant progress has been made in the LLL magnetic fusion energy program. In the 2XIIB experiment, a tenfold improvement was achieved in the plasma confinement factor (the product of plasma density and confinement time), pushed plasma temperature and pressure to values never before reached in a magnetic fusion experiment, and demonstrated--for the first time--plasma startup by neutral beam injection. A new laser-pellet startup technique for Baseball IIT has been successfully tested and is now being incorporated in the experiment. Technological improvements have been realized, such as a breakthrough in fabricating niobium-tin conductors for superconducting magnets. These successes, together with complementary progress in theory and reactor design, have led to a proposal to build the MX facility, which could be on the threshold of a mirror fusion reactor

  19. Segmental stiff skin syndrome (SSS): A distinct clinical entity.

    Science.gov (United States)

    Myers, Kathryn L; Mir, Adnan; Schaffer, Julie V; Meehan, Shane A; Orlow, Seth J; Brinster, Nooshin K

    2016-07-01

    Stiff skin syndrome (SSS) is a noninflammatory, fibrosing condition of the skin, often affecting the limb girdles. We present 4 new patients with SSS with largely unilateral, segmental distribution. To date, reported cases of SSS have been grouped based on generally accepted clinical and histopathologic findings. The purpose of this study was to analyze differences in clinical and histopathologic findings between previously reported SSS cases. This is a retrospective review of 4 new cases and 48 previously published cases of SSS obtained from PubMed search. Of 52 total cases, 18 (35%) were segmentally distributed and 34 (65%) were widespread. The average age of onset was 4.1 years versus 1.6 years for segmental versus widespread SSS, respectively. Limitation in joint mobility affected 44% of patients with segmental SSS and 97% of patients with widespread SSS. Histopathologic findings were common between the 2 groups. This was a retrospective study of previously published cases limited by the completeness and accuracy of the reviewed cases. We propose a distinct clinical entity, segmental SSS, characterized by a segmental distribution, later age of onset, and less severe functional limitation. Both segmental SSS and widespread SSS share common diagnostic histopathologic features. Copyright © 2016 American Academy of Dermatology, Inc. All rights reserved.

  20. 40 CFR 129.101 - DDT, DDD and DDE.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false DDT, DDD and DDE. 129.101 Section 129... POLLUTANT EFFLUENT STANDARDS Toxic Pollutant Effluent Standards and Prohibitions § 129.101 DDT, DDD and DDE. (a) Specialized definitions. (1) DDT Manufacturer means a manufacturer, excluding any source which is...

  1. The SSS classical nova V5116 Sgr

    Science.gov (United States)

    Sala, G.; Ness, J.; Greiner, J.; Hernanz, M.

    2017-10-01

    XMM-Newton observed the nova V5116 Sgr during its supersoft phase (SSS). V5116 Sgr showed a decrease of the flux by a factor around 8 during 2/3 of the orbital period. The broad band EPIC spectra remain unchanged during the different flux phases, suggesting an occultation of the central source in a high inclination system. While the global SED does not change significantly, the RGS spectrum is changing between the high and the low flux phases. The non-occultation phase shows a typical white dwarf atmosphere spectrum, dominated by absorption lines. During the low flux periods an extra component of emission lines is superimposed to the soft X-ray continuum. This supports the picture of V5116 Sgr as the clearest example of a system switching between the SSa class of SSS novae, with spectra dominated by absorption lines, and the SSe class, showing an emission lines component. In addition, the simultaneous OM images allow us to find a phase solution for the X-ray light-curve. A thick rim of the accretion disk as the one developed for the SSSs CAL 87, RX J0019.8, and RX J0513.9 could provide a plausible model both for the optical and the X-ray light curve of V5116 Sgr.

  2. Hydrogeochemical and stream-sediment reconnaissance program at LLL

    International Nuclear Information System (INIS)

    Tinney, J.F.

    1977-03-01

    The Lawrence Livermore Laboratory (LLL) is conducting a Hydrogeochemical and Stream-Sediment Reconnaissance (HSSR) survey in support of ERDA's National Uranium Resource Evaluation (NURE) program. Included in the LLL portion of this survey are seven western states (Arizona, California, Idaho, Nevada, Oregon, Utah, and Washington). Similar surveys are being carried out in the rest of the continental United States, including Alaska, as part of a systematic nationwide study of the distribution of uranium in surface water, groundwater, and stream sediment. The overall objective is to identify favorable areas for uranium exploration. This paper describes the program being conducted by LLL to complete our portion of the survey by 1981. The topics discussed are geology and sample acquisition, sample preparation and analysis, and data-base management

  3. LLL DBASE glossary and parameter definitions, Part 1

    International Nuclear Information System (INIS)

    Rohrer, R.F.

    1975-01-01

    This report lists, defines, and updates parameters in DBASE, an LLL test effects data bank in which data is stored from experiments performed at NTS and other test sites. Parameters are listed by subject and by number. Part 2 of this report presents the same information for classified parameters

  4. Second order statistical behavior of LLL and BKZ

    NARCIS (Netherlands)

    Y. Yu (Yang); L. Ducas (Léo)

    2017-01-01

    textabstractThe LLL algorithm (from Lenstra, Lenstra and Lovász) and its generalization BKZ (from Schnorr and Euchner) are widely used in cryptanalysis, especially for lattice-based cryptography. Precisely understanding their behavior is crucial for deriving appropriate key-size for cryptographic

  5. AESTHESIA IN SOUTH AFRICA * lllSTORY OF

    African Journals Online (AJOL)

    family general practitioner who i always in the picture. lllSTORY ... gradually increased up to 125 minim daiJy of laudanum.3. This give .... about eighteen minutes, most nobly, scarcely uttering a word or ..... uld recall \\ a that of a onfu ed unea y.

  6. SOS switch system (SSS) in the radiation treatment room

    International Nuclear Information System (INIS)

    Komiyama, Takafumi; Motoyama, Tsuyoshi; Nakamura, Koji; Onishi, Hiroshi; Araya, Masayuki; Sano, Naoki

    2009-01-01

    We applied patient's self-breath hold irradiation system to a device to declare the patient's intentions (SOS switch system: SSS) in the radiation room and examined a utility for problem recognition and improvement of risk management during radiation therapy by induction of SSS. Between May 2005 and October 2006, we used SSS with 65 patients. The study involved 32 men and 33 women with a median age of 65 (range, 26-88) years. The reason for using SSS was as a shell in 57, a history of laryngectomy in 2, a cough in 6, convulsions in 1, and anxiety in 3. The treatment with SSS was performed 1,120 times. The hand switch was pushed 11 times. The reasons the switch was pushed were for nausea, aspiration, pain, and cough one time each. For the others, the reasons were unclear, and it was thought due to the clouding of consciousness from brain metastases. No problems were observed with the use of SSS. SSS was a useful device for improvement of risk management during the radiation therapy. (author)

  7. U.S. Geoid Heights, Scientific Model (G96SSS)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This 2' geoid height grid for the conterminous United States is the G96SSS model. The computation used about 1.8 million terrestrial and marine gravity data held in...

  8. Improved anchoring of SSS with vacuum barrier to avoid displacement

    CERN Document Server

    Capatina, O; Foreste, A; Parma, V; Renaglia, T; Quesnel, J

    2009-01-01

    As presented in the previous speech, the incident in sector 3-4 of the LHC caused a high pressure build-up inside the cryostat insulation vacuum resulting in high longitudinal forces acting on the insulation vacuum barriers. This resulted in braking floor and floor fixations of the SSS with vacuum barrier. The strategy of improving anchoring of SSS with vacuum barrier to avoid displacement is presented and discussed.

  9. Laser damage testing at LLL: an overview and an update

    International Nuclear Information System (INIS)

    Milam, D.; Lowdermilk, W.H.; Wirtenson, G.R.

    1978-01-01

    Damage thresholds for single layers of common coating materials such as MgF 2 , SiO 2 , ThF 4 , Al 2 O 3 , ZrO 2 , and TiO 2 are given. Laser-induced damage of coated and uncoated optically polished surfaces has been studied at LLL for laser pulsewidths between 0.17 ns and 3 ns. Two 1064 nm Nd lasers generated this range of pulsewidths. This report contains a review of the results

  10. Why 1.02? The root Hermite factor of LLL and stochastic sandpile models

    OpenAIRE

    Ding, Jintai; Kim, Seungki; Takagi, Tsuyoshi; Wang, Yuntao

    2018-01-01

    In lattice-based cryptography, a disturbing and puzzling fact is that there exists such a conspicuous gap between the actual performance of LLL and what could be said of it theoretically. By now, no plausible mathematical explanation is yet proposed. In this paper, we provide compelling evidence that LLL behaves essentially identically to a certain stochastic variant of the sandpile model that we introduce. This allows us to explain many observations on the LLL algorithm that have so far been...

  11. Einstein SSS+MPC observations of Seyfert type galaxies

    Science.gov (United States)

    Holt, S. S.; Turner, T. J.; Mushotzky, R. F.; Weaver, K.

    1989-01-01

    The X-ray spectra of 27 Seyfert galaxies measured with the Solid State Spectrometer (SSS) onboard the Einstein Observatory is investigated. This new investigation features the utilization of simultaneous data from the Monitor Proportional Counter (MPC) and automatic correction for systematic effects in the SSS. The new results are that the best-fit single power law indices agree with those previously reported, but that soft excesses are inferred for at least 20 percent of the measured spectra. The soft excesses are consistent with either an approximately 0.25 keV black body or Fe-L line emission.

  12. What Have We Learnt about Mobile LifeLong Learning (mLLL)?

    Science.gov (United States)

    Seta, Luciano; Kukulska-Hulme, Agnes; Arrigo, Marco

    2014-01-01

    Mobile technologies are becoming ubiquitous in education, yet the wider implications of this phenomenon are not well understood. The paper discusses how mobile lifelong learning (mLLL) may be defined, and the challenges of forging a suitable definition in an ever-shifting technological and socio-economic landscape. mLLL appears as a ubiquitous…

  13. Status of the LBL/LLL development program

    International Nuclear Information System (INIS)

    Berkner, K.H.; Cooper, W.S.; Ehlers, K.W.; Pyle, R.V.; Hooper, E.B. Jr.

    1977-11-01

    The status and near-term goals of the LBL/LLL neutral-beam-development program are described. The emphasis is on the technology of systems based on the acceleration and neutralization of positive ions; this approach will be used in the near term, probably through 1985 at least. For more efficient injection, part of the plan is to develop a negative-ion approach suitable for 200- to 400-kV injectors on confinement experiments in the 1985 to 1990 period. However, the negative-ion based program is still very much in the research phase, and it is difficult to project how it will phase into fusion reactor fueling experiments

  14. Status of the LBL/LLL development program

    International Nuclear Information System (INIS)

    Berkner, K.H.; Cooper, W.S.; Ehlers, K.W.; Pyle, R.V.; Hooper, E.B. Jr.

    1978-01-01

    The status and near-term goals of the LBL/LLL neutral-beam-development program are described. The emphasis in this paper is on the technology of systems based on the acceleration and neutralization of positive ions; this approach will be used in the near term, probably through 1985 at least. For more efficient injection, part of our plan is to develop a negative-ion approach suitable for 200- to 400-kV injectors on confinement experiments in the 1985 to 1990 period. However, the negative-ion based program is still very much in the research phase, and it is difficult to project how it will phase into fusion reactor fueling experiments

  15. MR PROSTATE SEGMENTATION VIA DISTRIBUTED DISCRIMINATIVE DICTIONARY (DDD) LEARNING.

    Science.gov (United States)

    Guo, Yanrong; Zhan, Yiqiang; Gao, Yaozong; Jiang, Jianguo; Shen, Dinggang

    2013-01-01

    Segmenting prostate from MR images is important yet challenging. Due to non-Gaussian distribution of prostate appearances in MR images, the popular active appearance model (AAM) has its limited performance. Although the newly developed sparse dictionary learning method[1, 2] can model the image appearance in a non-parametric fashion, the learned dictionaries still lack the discriminative power between prostate and non-prostate tissues, which is critical for accurate prostate segmentation. In this paper, we propose to integrate deformable model with a novel learning scheme, namely the Distributed Discriminative Dictionary ( DDD ) learning, which can capture image appearance in a non-parametric and discriminative fashion. In particular, three strategies are designed to boost the tissue discriminative power of DDD. First , minimum Redundancy Maximum Relevance (mRMR) feature selection is performed to constrain the dictionary learning in a discriminative feature space. Second , linear discriminant analysis (LDA) is employed to assemble residuals from different dictionaries for optimal separation between prostate and non-prostate tissues. Third , instead of learning the global dictionaries, we learn a set of local dictionaries for the local regions (each with small appearance variations) along prostate boundary, thus achieving better tissue differentiation locally. In the application stage, DDDs will provide the appearance cues to robustly drive the deformable model onto the prostate boundary. Experiments on 50 MR prostate images show that our method can yield a Dice Ratio of 88% compared to the manual segmentations, and have 7% improvement over the conventional AAM.

  16. MASTER prediscovery observations of SSS130101:122222-311525

    Science.gov (United States)

    Levato, H.; Saffe, C.; Mallamaci, C.; Lopez, C.; Podest, F.; Denisenko, D.; Lipunov, V.; Gorbovskoy, E.; Balanutsa, P.; Yecheistov, V.; Tiurina, N.; Kornilov, V.; Belinski, A.; Shatskiy, N.; Chazov, V.; Kuznetsov, A.; Zimnukhov, D.; Krushinsky, V.; Zalozhnih, I.; Popov, A.; Bourdanov, A.; Punanova, A.; Ivanov, K.; Yazev, S.; Budnev, N.; Konstantinov, E.; Chuvalaev, O.; Poleshchuk, V.; Gress, O.; Parkhomenko, A.; Tlatov, A.; Dormidontov, D.; Senik, V.; Yurkov, V.; Sergienko, Y.; Varda, D.; Sinyakov, E.; Shumkov, V.; Shurpakov, S.; Podvorotny, P.

    2013-01-01

    Following the announcement of a bright transient SSS130101:122222-311525 detected by CRTS (Drake et al., ATel #4699) we have checked the archival observations of this field by MASTER-ICATE very wide field camera (72-mm f/1.2 lens + 11 Mpx CCD, FOV=24x16 sq. deg.) located at OAFA near San Juan, Argentina. The object is present on two combined images obtained on 2012 Dec. 16.357 UT (total exposure time 122 sec) and 2012 Dec.

  17. On the theoretical link between LLL-reduction and Lambda-decorrelation

    Science.gov (United States)

    Lannes, A.

    2013-04-01

    The LLL algorithm, introduced by Lenstra et al. (Math Ann 261:515-534, 1982), plays a key role in many fields of applied mathematics. In particular, it is used as an effective numerical tool for preconditioning the integer least-squares problems arising in high-precision geodetic positioning and Global Navigation Satellite Systems (GNSS). In 1992, Teunissen developed a method for solving these nearest-lattice point (NLP) problems. This method is referred to as Lambda (for Least-squares AMBiguity Decorrelation Adjustment). The preconditioning stage of Lambda corresponds to its decorrelation algorithm. From an epistemological point of view, the latter was devised through an innovative statistical approach completely independent of the LLL algorithm. Recent papers pointed out some similarities between the LLL algorithm and the Lambda-decorrelation algorithm. We try to clarify this point in the paper. We first introduce a parameter measuring the orthogonality defect of the integer basis in which the NLP problem is solved, the LLL-reduced basis of the LLL algorithm, or the Λ -basis of the Lambda method. With regard to this problem, the potential qualities of these bases can then be compared. The Λ -basis is built by working at the level of the variance-covariance matrix of the float solution, while the LLL-reduced basis is built by working at the level of its inverse. As a general rule, the orthogonality defect of the Λ -basis is greater than that of the corresponding LLL-reduced basis; these bases are however very close to one another. To specify this tight relationship, we present a method that provides the dual LLL-reduced basis of a given Λ -basis. As a consequence of this basic link, all the recent developments made on the LLL algorithm can be applied to the Lambda-decorrelation algorithm. This point is illustrated in a concrete manner: we present a parallel Λ -type decorrelation algorithm derived from the parallel LLL algorithm of Luo and Qiao (Proceedings of

  18. [Measurement of antimicrobial consumption using DDD per 100 bed-days versus DDD per 100 discharges after the implementation of an antimicrobial stewardship program].

    Science.gov (United States)

    Collado, Roberto; Losa, Juan Emilio; Álvaro, Elena Alba; Toro, Piedad; Moreno, Leonor; Pérez, Montserrat

    2015-12-01

    Monitoring antimicrobial consumption in hospitals is a necessary measure. The indicators commonly employed do not clearly reflect the antibiotic selection pressure. The objective of this study is to evaluate two different methods that analyze antimicrobial consumption based on DDD, per stay and per discharge, before and after the implementation an antimicrobial stewardship program. Comparative pre-post study of antimicrobial consumption with the implementation of an antimicrobial stewardship program using DDD per 100 bed-days and DDD per 100 discharges as indicators. Hospital bed days remained stable and discharges increased slightly along the period of study Antibiotic consumption in DDD per 100 bed-days decreased by 2.5% versus 3.8% when expressed as DDD per 100 discharges. Antifungal consumption decreased by more than 50%. When average hospital stay decreases, reductions in the consumption of antimicrobials with an antimicrobial stewardship program system occur at the expense of reducing the number of patients receiving treatment, while increases occur due to longer durations of treatment.

  19. A New Block Processing Algorithm of LLL for Fast High-dimension Ambiguity Resolution

    Directory of Open Access Journals (Sweden)

    LIU Wanke

    2016-02-01

    Full Text Available Due to high dimension and precision for the ambiguity vector under GNSS observations of multi-frequency and multi-system, a major problem to limit computational efficiency of ambiguity resolution is the longer reduction time when using conventional LLL algorithm. To address this problem, it is proposed a new block processing algorithm of LLL by analyzing the relationship between the reduction time and the dimensions and precision of ambiguity. The new algorithm reduces the reduction time to improve computational efficiency of ambiguity resolution, which is based on block processing ambiguity variance-covariance matrix that decreased the dimensions of single reduction matrix. It is validated that the new algorithm with two groups of measured data. The results show that the computing efficiency of the new algorithm increased by 65.2% and 60.2% respectively compared with that of LLL algorithm when choosing a reasonable number of blocks.

  20. A Confirmatory Factor Analysis of an Abbreviated Social Support Instrument: The MOS-SSS

    Science.gov (United States)

    Gjesfjeld, Christopher D.; Greeno, Catherine G.; Kim, Kevin H.

    2008-01-01

    Objective: Confirm the factor structure of the original 18-item Medical Outcome Study Social Support Survey (MOS-SSS) as well as two abbreviated versions in a sample of mothers with a child in mental health treatment. Method: The factor structure, internal consistency, and concurrent validity of the MOS-SSS were assessed using a convenience sample…

  1. Biologic activity of the novel small molecule STAT3 inhibitor LLL12 against canine osteosarcoma cell lines

    Directory of Open Access Journals (Sweden)

    Couto Jason I

    2012-12-01

    Full Text Available Abstract Background STAT3 [1] has been shown to be dysregulated in nearly every major cancer, including osteosarcoma (OS. Constitutive activation of STAT3, via aberrant phosphorylation, leads to proliferation, cell survival and resistance to apoptosis. The present study sought to characterize the biologic activity of a novel allosteric STAT3 inhibitor, LLL12, in canine OS cell lines. Results We evaluated the effects of LLL12 treatment on 4 canine OS cell lines and found that LLL12 inhibited proliferation, induced apoptosis, reduced STAT3 phosphorylation, and decreased the expression of several transcriptional targets of STAT3 in these cells. Lastly, LLL12 exhibited synergistic anti-proliferative activity with the chemotherapeutic doxorubicin in the OS lines. Conclusion LLL12 exhibits biologic activity against canine OS cell lines through inhibition of STAT3 related cellular functions supporting its potential use as a novel therapy for OS.

  2. Spatial δ18Osw-SSS relationship across the western tropical Pacific Ocean

    Science.gov (United States)

    Thompson, D. M.; Conroy, J. L.; Wyman, A.; Read, D.

    2017-12-01

    Dynamic hydroclimate processes across the western tropical Pacific lead to strong spatial and temporal variability in δ18Osw and sea-surface salinity (SSS) across the western Pacific. Corals in this region have therefore provided key information about past SSS variability, as δ18Osw contributes strongly to coral δ18O across this region. However, uncertainties in the δ18Osw-SSS relationship across space and time often limit quantitative SSS reconstructions from such coral records. Recent work demonstrates considerable variability in the δ18Osw-SSS relationship across the Pacific, which may lead to over- or under-estimation of the contribution of SSS to coral δ18O, particularly across the western tropical Pacific (Conroy et al. 2017). Here we assess the spatial δ18Osw-SSS relationship across the dynamic western tropical Pacific, capitalizing on a transit between Subic Bay, Philippines and Townsville, Australia aboard the International Ocean Discovery program's JOIDES Resolution. Water samples and weather conditions were collected 3 times daily (6:00, 12:00, 18:00) en route, resulting in a network of 47 samples spaced at semi-regular 130-260 km intervals across the western Pacific from 14°N to 18°S. The route also crossed near long-term δ18Osw monitoring sites at Papua New Guinea and Palau (Conroy et al. 2017), allowing us to compare the spatial and temporal δ18Osw-SSS relationships at these sites and test the space-for-time assumption. We present the δ18Osw-SSS relationship across this region, compare the relationship across space and time, and discuss the implications of our results for SSS reconstructions from coral δ18O.

  3. An AAA-DDD triply hydrogen-bonded complex easily accessible for supramolecular polymers.

    Science.gov (United States)

    Han, Yi-Fei; Chen, Wen-Qiang; Wang, Hong-Bo; Yuan, Ying-Xue; Wu, Na-Na; Song, Xiang-Zhi; Yang, Lan

    2014-12-15

    For a complementary hydrogen-bonded complex, when every hydrogen-bond acceptor is on one side and every hydrogen-bond donor is on the other, all secondary interactions are attractive and the complex is highly stable. AAA-DDD (A=acceptor, D=donor) is considered to be the most stable among triply hydrogen-bonded sequences. The easily synthesized and further derivatized AAA-DDD system is very desirable for hydrogen-bonded functional materials. In this case, AAA and DDD, starting from 4-methoxybenzaldehyde, were synthesized with the Hantzsch pyridine synthesis and Friedländer annulation reaction. The association constant determined by fluorescence titration in chloroform at room temperature is 2.09×10(7)  M(-1) . The AAA and DDD components are not coplanar, but form a V shape in the solid state. Supramolecular polymers based on AAA-DDD triply hydrogen bonded have also been developed. This work may make AAA-DDD triply hydrogen-bonded sequences easily accessible for stimuli-responsive materials. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  4. LLL K Division nuclear test effects and geologic data base: glossary and parameter definitions (U)

    International Nuclear Information System (INIS)

    Howard, N.W.

    1979-01-01

    The report lists, defines, and updates Parameters in DBASE, an LLL test effects data bank in which data is stored from experiments performed at NTS and other test sites. Parameters are listed by subject and by number. Part 2 of this report presents the same information for parameters for which some of the data may be classified

  5. SSS: A code for computing one dimensional shock and detonation wave propagation

    International Nuclear Information System (INIS)

    Sun Chengwei

    1986-01-01

    The one-dimensional hydrodynamic code SSS for shock and detonation wave propagation in inert and reactive media is described. The elastic-plastic-hydrodynamic model and four burn techniques (the Arrhenius law, C-J volume, sharp shock and Forest Fire) are used. There are HOM and JWL options for the state equation of detonation products. Comparing with the SIN code published by LANL, the SSS code has several new options: laser effects, blast waves, diverging and instantaneous detonation waves with arbitrary initiation positions. Two examples are given to compare the SSS and SIN calculations with the experimental data

  6. Drosophila QVR/SSS modulates the activation and C-type inactivation kinetics of Shaker K+ channels

    Science.gov (United States)

    Dean, Terry; Xu, Rong; Joiner, William; Sehgal, Amita; Hoshi, Toshinori

    2011-01-01

    The quiver/sleepless (qvr/sss) gene encodes a small, glycosylphosphatidylinositol-anchored protein that plays a critical role in the regulation of sleep in Drosophila. Loss-of-function mutations in qvr/sss severely suppress sleep and effect multiple changes in in situ Shaker K+ currents, including decreased magnitude, slower time-to-peak, and cumulative inactivation. Recently, we demonstrated that SLEEPLESS (SSS) protein modulates Shaker channel activity, possibly through a direct interaction at the plasma membrane. We show here that SSS accelerates the activation of heterologously expressed Shaker channels with no effect on deactivation or fast N-type inactivation. Furthermore, this SSS-induced acceleration is sensitive to the pharmacological disruption of lipid rafts and sufficiently accounts for the slower time-to-peak of in situ Shaker currents seen in qvr/sss mutants. We also find that SSS decreases the rate of C-type inactivation of heterologously expressed Shaker channels, providing a potential mechanism for the cumulative inactivation phenotype induced by qvr/sss loss of function mutations. Kinetic modeling based on the in vitro results suggests that the SSS-dependent regulation of channel kinetics accounts for nearly 40% of the decrease in Shaker current magnitude in flies lacking SSS. Sleep duration in qvr/sss null mutants is restored to normal by a qvr/sss transgene that fully rescues the Shaker kinetic phenotypes but only partially rescues the decrease in current magnitude. Together, these results suggest that the role of SSS in the regulation of sleep in Drosophila correlates more strongly with the effects of SSS on Shaker kinetics than current magnitude. PMID:21813698

  7. Drosophila QVR/SSS modulates the activation and C-type inactivation kinetics of Shaker K(+) channels.

    Science.gov (United States)

    Dean, Terry; Xu, Rong; Joiner, William; Sehgal, Amita; Hoshi, Toshinori

    2011-08-03

    The quiver/sleepless (qvr/sss) gene encodes a small, glycosylphosphatidylinositol-anchored protein that plays a critical role in the regulation of sleep in Drosophila. Loss-of-function mutations in qvr/sss severely suppress sleep and effect multiple changes in in situ Shaker K(+) currents, including decreased magnitude, slower time-to-peak, and cumulative inactivation. Recently, we demonstrated that SLEEPLESS (SSS) protein modulates Shaker channel activity, possibly through a direct interaction at the plasma membrane. We show here that SSS accelerates the activation of heterologously expressed Shaker channels with no effect on deactivation or fast N-type inactivation. Furthermore, this SSS-induced acceleration is sensitive to the pharmacological disruption of lipid rafts and sufficiently accounts for the slower time-to-peak of in situ Shaker currents seen in qvr/sss mutants. We also find that SSS decreases the rate of C-type inactivation of heterologously expressed Shaker channels, providing a potential mechanism for the cumulative inactivation phenotype induced by qvr/sss loss-of-function mutations. Kinetic modeling based on the in vitro results suggests that the SSS-dependent regulation of channel kinetics accounts for nearly 40% of the decrease in Shaker current magnitude in flies lacking SSS. Sleep duration in qvr/sss-null mutants is restored to normal by a qvr/sss transgene that fully rescues the Shaker kinetic phenotypes but only partially rescues the decrease in current magnitude. Together, these results suggest that the role of SSS in the regulation of sleep in Drosophila correlates more strongly with the effects of SSS on Shaker kinetics than current magnitude.

  8. Secondary School Students' LLL Competencies, and Their Relation with Classroom Structure and Achievement.

    Science.gov (United States)

    Klug, Julia; Lüftenegger, Marko; Bergsmann, Evelyn; Spiel, Christiane; Schober, Barbara

    2016-01-01

    There is a strong urge to foster lifelong learning (LLL) competencies with its key components - motivation and self-regulated learning - from early on in the education system. School in general is presently not considered to be successful in systematically imparting motivation and self-regulated learning strategies. There is strong evidence that decisive motivational determinants decrease the longer students stay in school. At present, the central sources of information about the situation in Austria are international monitoring studies, which only examine selected aspects of specific target groups, and their interpretability concerning mean values is constricted due to cultural differences. Thus, it is important to conduct additional and more differentiated national surveys of the actual state. This is why this study aimed at answering the following questions: (1) how well are Austrian students equipped for the future, in terms of their lifelong learning competencies, (2) can perceived classroom structure predict students' LLL, and (3) is there a correlation of students' LLL with their achievement in the school subjects math and German language. 5366 students (52.1% female) from 36 Austrian schools took part in the online-questionnaire (mean age 15.35 years, SD = 2.45), which measured their perceived LLL competencies in the subjects math and German language, their perceived classroom structure and their achievement. Results showed that the great majority of Austrian students - independent from domain and sex - know and are able to apply cognitive as well as metacognitive learning strategies. With regard to motivation the picture is less satisfactory: whilst students' self-efficacy is not the problem, there is a lack of interest in the school subjects and they often report to follow performance approach goals. Classroom structure positively predicted students' goals, interest, self-efficacy and learning strategies. Self-efficacy, performance approach goals, meta

  9. Secondary school students' LLL competencies, and their relation with classroom structure and achievement

    Directory of Open Access Journals (Sweden)

    Julia eKlug

    2016-05-01

    Full Text Available There is a strong urge to foster lifelong learning (LLL competencies with its key components - motivation and self-regulated learning - from early on in the education system. School in general is presently not considered to be successful in systematically imparting motivation and self-regulated learning strategies. There is strong evidence that decisive motivational determinants decrease the longer students stay in school. At present, the central sources of information about the situation in Austria are international monitoring studies, which only examine selected aspects of specific target groups, and their interpretability concerning mean values is constricted due to cultural differences. Thus, it is important to conduct additional and more differentiated national surveys of the actual state. This is why this study aimed at answering the following questions: (1 how well are Austrian students equipped for the future, in terms of their lifelong learning competencies, (2 can perceived classroom structure predict students’ LLL, and (3 is there a correlation of students’ LLL with their achievement in the school subjects math and German language. 5366 students (52.1% female from Thirty-six Austrian schools took part in the online-questionnaire (mean age 15.35 years, SD=2.45, which measured their perceived LLL competencies in the subjects math and German language, their perceived classroom structure and their achievement. Results showed that the great majority of Austrian students – independent from domain and sex - know and are able to apply cognitive as well as metacognitive learning strategies. With regard to motivation the picture is less satisfactory: whilst students’ self-efficacy is not the problem, there is a lack of interest in the school subjects and they often report to follow performance approach goals. Classroom structure positively predicted students’ goals, interest, self-efficacy and learning strategies. Self

  10. Role of computers in quality assurance in the LLL Criticality Safety Program

    International Nuclear Information System (INIS)

    Koponen, B.L.

    1978-01-01

    Some of the aspects of computational criticality safety quality assurance that have been emphasized in recent years at LLL are summarized. In particular, computer code changes that have been made that help the criticality analyst reduce the number of errors that he makes and to locate those that he does make; and how a computerized ''benchmark'' data base aids him in the validation of his computational methods are discussed

  11. Secondary School Students’ LLL Competencies, and Their Relation with Classroom Structure and Achievement

    Science.gov (United States)

    Klug, Julia; Lüftenegger, Marko; Bergsmann, Evelyn; Spiel, Christiane; Schober, Barbara

    2016-01-01

    There is a strong urge to foster lifelong learning (LLL) competencies with its key components – motivation and self-regulated learning – from early on in the education system. School in general is presently not considered to be successful in systematically imparting motivation and self-regulated learning strategies. There is strong evidence that decisive motivational determinants decrease the longer students stay in school. At present, the central sources of information about the situation in Austria are international monitoring studies, which only examine selected aspects of specific target groups, and their interpretability concerning mean values is constricted due to cultural differences. Thus, it is important to conduct additional and more differentiated national surveys of the actual state. This is why this study aimed at answering the following questions: (1) how well are Austrian students equipped for the future, in terms of their lifelong learning competencies, (2) can perceived classroom structure predict students’ LLL, and (3) is there a correlation of students’ LLL with their achievement in the school subjects math and German language. 5366 students (52.1% female) from 36 Austrian schools took part in the online-questionnaire (mean age 15.35 years, SD = 2.45), which measured their perceived LLL competencies in the subjects math and German language, their perceived classroom structure and their achievement. Results showed that the great majority of Austrian students – independent from domain and sex – know and are able to apply cognitive as well as metacognitive learning strategies. With regard to motivation the picture is less satisfactory: whilst students’ self-efficacy is not the problem, there is a lack of interest in the school subjects and they often report to follow performance approach goals. Classroom structure positively predicted students’ goals, interest, self-efficacy and learning strategies. Self-efficacy, performance

  12. effect of o,p'-DDD on the in vivo incorporation of 3H-thymidine into DNA

    International Nuclear Information System (INIS)

    Lund, B.-O.; Brandt, I.; Busk, L.; Hellmann, B.

    1990-01-01

    The effects of o,p'-DDD on the DNA synthesis in the C57Bl mouse lung and liver were studied. As determined by 3 H-thymidine incorporation into DNA, a selective increase in the lung DNA synthesis (+59%) was observed 2 day after a single intraperiotoneal injection of 100 mg/kg o,p'-DDD. Microautoradiography showed that incorporated 3 H-thymidine was confined to a restricted number of heavily labelled cells, presumably proliferating type II cells. At the most, a 9 times higher rate of cell proliferation was observed in the lung 4 days after an intraperitoneal injection of 500 mg/kg o,p'-DDD. Using mouse lung or liver S-9 as activating system, no mutagenic activity of o,p'-DDD was detected in the Ames test. The induced cell proliferation may indicate a tissue-selective promotor activity of o,p'-DDD in the mouse lung. (author)

  13. The small molecule, LLL12, inhibits STAT3 phosphorylation and induces apoptosis in medulloblastoma and glioblastoma cells.

    Directory of Open Access Journals (Sweden)

    Sarah Ball

    Full Text Available Tumors of the central nervous system represent a major source of cancer-related deaths, with medulloblastoma and glioblastoma being the most common malignant brain tumors in children and adults respectively. While significant advances in treatment have been made, with the 5-year survival rate for medulloblastoma at 70-80%, treating patients under 3 years of age still poses a problem due to the deleterious effects of radiation on the developing brain, and the median survival for patients with glioblastoma is only 15 months. The transcription factor, STAT3, has been found constitutively activated in a wide variety of cancers and in recent years it has become an attractive therapeutic target. We designed a non-peptide small molecule STAT3 inhibitor, LLL12, using structure-based design. LLL12 was able to inhibit STAT3 phosphorylation, decrease cell viability and induce apoptosis in medulloblastoma and glioblastoma cell lines with elevated levels of p-STAT3 (Y705. IC(50 values for LLL12 were found to be between 1.07 µM and 5.98 µM in the five cell lines expressing phosphorylated STAT3. STAT3 target genes were found to be downregulated and a decrease in STAT3 DNA binding was observed following LLL12 treatment, indicating that LLL12 is an effective STAT3 inhibitor. LLL12 was also able to inhibit colony formation, wound healing and decreased IL-6 and LIF secretion. Our results suggest that LLL12 is a potent STAT3 inhibitor and that it may be a potential therapeutic treatment for medulloblastoma and glioblastoma.

  14. US NRC/LLL liaison with the Federal Republic of Germany for the GKSS-PSS steam condensation tests. Progress report No. 1

    International Nuclear Information System (INIS)

    McCauley, E.W.

    1979-01-01

    This progress report for the USNRC/LLL Liaison program with the Federal Republic of Germany regarding boiling water reactor containment multivent steam condensation tests being conducted by GKSS (Gesellschaft fuer Kernenergieverwertung in Schiffbau und Schiffahrt) address program activity during the period of May-June 1979. During this period the program scope was defined, initial contacts between LLL and GKSS were established, and the first trip by an LLL representative to the GKSS test facility was taken

  15. Guided Iterative Substructure Search (GI-SSS) - A New Trick for an Old Dog.

    Science.gov (United States)

    Weskamp, Nils

    2016-07-01

    Substructure search (SSS) is a fundamental technique supported by various chemical information systems. Many users apply it in an iterative manner: they modify their queries to shape the composition of the retrieved hit sets according to their needs. We propose and evaluate two heuristic extensions of SSS aimed at simplifying these iterative query modifications by collecting additional information during query processing and visualizing this information in an intuitive way. This gives the user a convenient feedback on how certain changes to the query would affect the retrieved hit set and reduces the number of trial-and-error cycles needed to generate an optimal search result. The proposed heuristics are simple, yet surprisingly effective and can be easily added to existing SSS implementations. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. The somatic symptom scale-8 (SSS-8): a brief measure of somatic symptom burden.

    Science.gov (United States)

    Gierk, Benjamin; Kohlmann, Sebastian; Kroenke, Kurt; Spangenberg, Lena; Zenger, Markus; Brähler, Elmar; Löwe, Bernd

    2014-03-01

    Somatic symptoms are the core features of many medical diseases, and they are used to evaluate the severity and course of illness. The 8-item Somatic Symptom Scale (SSS-8) was recently developed as a brief, patient-reported outcome measure of somatic symptom burden, but its reliability, validity, and usefulness have not yet been tested. To investigate the reliability, validity, and severity categories as well as the reference scores of the SSS-8. A national, representative general-population survey was performed between June 15, 2012, and July 15, 2012, in Germany, including 2510 individuals older than 13 years. The SSS-8 mean (SD), item-total correlations, Cronbach α, factor structure, associations with measures of construct validity (Patient Health Questionnaire-2 depression scale, Generalized Anxiety Disorder-2 scale, visual analog scale for general health status, 12-month health care use), severity categories, and percentile rank reference scores. The SSS-8 had excellent item characteristics and good reliability (Cronbach α = 0.81). The factor structure reflects gastrointestinal, pain, fatigue, and cardiopulmonary aspects of the general somatic symptom burden. Somatic symptom burden as measured by the SSS-8 was significantly associated with depression (r = 0.57 [95% CI, 0.54 to 0.60]), anxiety (r = 0.55 [95% CI, 0.52 to 0.58]), general health status (r = -0.24 [95% CI, -0.28 to -0.20]), and health care use (incidence rate ratio, 1.12 [95% CI, 1.10 to 1.14]). The SSS-8 severity categories were calculated in accordance with percentile ranks: no to minimal (0-3 points), low (4-7 points), medium (8-11 points), high (12-15 points), and very high (16-32 points) somatic symptom burden. For every SSS-8 severity category increase, there was a 53% (95% CI, 44% to 63%) increase in health care visits. The SSS-8 is a reliable and valid self-report measure of somatic symptom burden. Cutoff scores identify individuals with low, medium, high, and very high somatic

  17. Biochemical, Kinetic, and Spectroscopic Characterization of Ruegeria pomeroyi DddW--A Mononuclear Iron-Dependent DMSP Lyase.

    Directory of Open Access Journals (Sweden)

    Adam E Brummett

    Full Text Available The osmolyte dimethylsulfoniopropionate (DMSP is a key nutrient in marine environments and its catabolism by bacteria through enzymes known as DMSP lyases generates dimethylsulfide (DMS, a gas of importance in climate regulation, the sulfur cycle, and signaling to higher organisms. Despite the environmental significance of DMSP lyases, little is known about how they function at the mechanistic level. In this study we biochemically characterize DddW, a DMSP lyase from the model roseobacter Ruegeria pomeroyi DSS-3. DddW is a 16.9 kDa enzyme that contains a C-terminal cupin domain and liberates acrylate, a proton, and DMS from the DMSP substrate. Our studies show that as-purified DddW is a metalloenzyme, like the DddQ and DddP DMSP lyases, but contains an iron cofactor. The metal cofactor is essential for DddW DMSP lyase activity since addition of the metal chelator EDTA abolishes its enzymatic activity, as do substitution mutations of key metal-binding residues in the cupin motif (His81, His83, Glu87, and His121. Measurements of metal binding affinity and catalytic activity indicate that Fe(II is most likely the preferred catalytic metal ion with a nanomolar binding affinity. Stoichiometry studies suggest DddW requires one Fe(II per monomer. Electronic absorption and electron paramagnetic resonance (EPR studies show an interaction between NO and Fe(II-DddW, with NO binding to the EPR silent Fe(II site giving rise to an EPR active species (g = 4.29, 3.95, 2.00. The change in the rhombicity of the EPR signal is observed in the presence of DMSP, indicating that substrate binds to the iron site without displacing bound NO. This work provides insight into the mechanism of DMSP cleavage catalyzed by DddW.

  18. Approaches for increasing the cooperation between Member States and IAEA under SSS

    International Nuclear Information System (INIS)

    Rheem, Karp-Soon; Park, Wan-Sou; Kim, Byung-Koo

    1997-01-01

    With introduction of the Strengthened Safeguards System (SSS), both the IAEA and Member States are concerned about the limited resources to carry out the SSS activity and the potential increase of additional cost and burdens. Even though the IAEA has recently prepared a procedure of the generalized New Partnership Approach (NPA), its wider application to the general Member States is difficult at the present time. For the generalized NPA necessitates that SSACs of the Member States have sufficient technical capability in safeguards to carry out the necessary activities. Unfortunately a few Member States seem to be qualified to have the sufficient technical capability that the IAEA desires. In this topic, a new approach to increase the cooperation between Member States and IAEA under SSS is proposed such that effective supports can be provided to all of its Member States that are not technically competent in terms of safeguards experience. This is realized by so called 'tunneling effort', meaning that desired goals are accomplished by efforts from both Member States and the IAEA. The Member States having high technical competence in safeguards provide technical assistance to the Member States that are not competent until they attain to a certain level in technical capability, while the IAEA provides the guidelines, and coordinates the process. The formal introduction of the Quality Control concept to the safeguards management is proposed as well so as to efficiently reduce burdens from the implementation of the SSS. (author)

  19. Indocyanine green videoangiography (ICGV)-guided surgery of parasagittal meningiomas occluding the superior sagittal sinus (SSS).

    Science.gov (United States)

    d'Avella, Elena; Volpin, Francesco; Manara, Renzo; Scienza, Renato; Della Puppa, Alessandro

    2013-03-01

    Maximal safe resection is the goal of correct surgical treatment of parasagittal meningiomas, and it is intimately related to the venous anatomy both near and directly involved by the tumor. Indocyanine green videoangiography (ICGV) has already been advocated as an intra-operative resourceful technique in brain tumor surgery for the identification of vessels. The aim of this study was to investigate the role of ICGV in surgery of parasagittal meningiomas occluding the superior sagittal sinus (SSS). In this study, we prospectively analyzed clinical, radiological and intra-operative findings of patients affected by parasagittal meningioma occluding the SSS, who underwent ICGV assisted-surgery. Radiological diagnosis of complete SSS occlusion was pre-operatively established in all cases. ICGV was performed before dural opening, before and during tumor resection, at the end of the procedure. Five patients were included in our study. In all cases, ICGV guided dural opening, tumor resection, and venous management. The venous collateral pathway was easily identified and preserved in all cases. Radical resection was achieved in four cases. Surgery was uneventful in all cases. Despite the small number of patients, our study shows that ICG videoangiography could play a crucial role in guiding surgery of parasagittal meningioma occluding the SSS. Further studies are needed to define the role of this technique on functional and oncological outcome of these patients.

  20. Sodium concentration in home made salt – sugar – solution (sss ...

    African Journals Online (AJOL)

    In a cohort of 210 young mothers, selected through cluster sampling technique from Ogida health district of Egor Local Government Area of Edo State, the electrolyte concentration of prepared salt-sugar-solutions (SSS) were evaluated. This was predicated on the need to determine the effects of introduction of various ...

  1. Increasing synthetic serum substitute (SSS) concentrations in P1 glucose/phosphate-free medium improves implantation rate: a comparative study.

    Science.gov (United States)

    Ben-Yosef, D; Yovel, I; Schwartz, T; Azem, F; Lessing, J B; Amit, A

    2001-11-01

    To assess the comparative efficacy of IVF medium (MediCult, with 5.2 mM glucose) and a glucose/phosphate-free medium, P1 (Irvine Scientific), and to investigate the influence of increasing the serum supplementation (synthetic serum substitute; SSS; Irvine Scientific) to P1 on embryo development and implantation. Patients were randomly assigned to IVF medium (Group 1, cycles n = 172) or P1 supplemented with 10% SSS (Group 2, cycles n = 229) according to the medium scheduled for use on the day of oocyte retrieval. Another 555 IVF consequent cycles (Group 3) were performed using increased SSS concentrations (20%) in P1 medium. In this large series of IVF cycles, we herein demonstrate that significantly higher pregnancy and implantation rates were found when embryos were cultured in glucose/phosphate-free medium P1 supplemented with 20% SSS compared to supplementation with the lower SSS concentration and with IVF medium.

  2. Agent-based Decision Support System for the Third Generation Distributed Dynamic Decision-making (DDD-III) Simulator

    National Research Council Canada - National Science Library

    Meirina, Candra; Ruan, Sui; Yu, Feili; Zhu, Liang; Pattipati, Krishna R; Kleinman, David L

    2004-01-01

    ...) based on the third-generation distributed dynamic decision-making (DDD-III) simulator and contingency theory to increase the organizational cognitive capacity and to facilitate the processes of adaptation...

  3. Ionization, charge exchange, and secondary electron emission in the extractor of an LBL/LLL neutral beam source

    International Nuclear Information System (INIS)

    Fink, J.H.; McDowell, C.E.

    1975-01-01

    Using a computer code, bombardment of the electrodes resulting from ionization, charge-exchange, and back-ion emission from the neutralizer cell is studied in the positive-ion extractor region of a Lawrence Berkeley Laboratory/Lawrence Livermore Laboratory (LBL/LLL) neutral beam source. Ion and electron trajectories are presented, grid dissipations estimated, and proposals made for future designs

  4. Towards a New LLL Paradigm? EU Policy on Key Competences and Reskilling: Facets and Trends

    Directory of Open Access Journals (Sweden)

    N. Papadakis

    2009-06-01

    Full Text Available Policy initiatives such as the European Year of Creativity and Innovation (2009 and the EU Framework on “Key Competences” (2006 and onwards aim at contributing on the ongoing reconceptualisation of skills (gradually correlated to Reskilling, Employability, Sustainability and Competitiveness and operate within the context of a changing balance between technocracy, pedagogy and politics. I.e. according to the EU cluster on Key Competences “major themes are applied throughout the Framework: creativity, critical thinking, initiative taking, play a major role in all eight key competences”. This explicit changing role of Creativity gains in political visibility and requires a contextually embedded and multidisciplinary approach. On such a perspective the present paper analyzes the political context and interest politics’ impact on the transformations on LLL and reskilling within the EU policy agenda and raises methodological and epistemological issues on the interface between educational and policy analysis.

  5. The Assembly of the LHC Short Straight Sections (SSS) at CERN Project Status and Lessons Learned

    CERN Document Server

    Parma, Vittorio; Dos Santos de Campos, Paulo M; Feitor, Rogerio C; Gandel, Makcim; López, R; Schmidlkofer, Martin; Slits, Ivo

    2005-01-01

    The series production of the LHC SSS has started in the beginning of 2004 and is foreseen to last until end 2006. The production consists in the assembly of 474 cold masses housing superconducting quadrupoles and corrector magnets within their cryostats. 87 cold mass variants, resulting from various combinations of main quadrupole and corrector magnets, have to be assembled in 55 cryostat types, depending on the specific cryogenic and electrical powering schemes required by the collider topology. The assembly activity features the execution of more than 5 km of leak-tight welding of stainless steel and aluminium cryogenic lines, designed for 20-bar pressure, according to high qualification standards and undergoing severe QA inspections. Some 2500 leak detection tests, using He mass spectrometry, are required to check the tightness of the cryogenic circuits. Extensive electrical control work, to check the integrity of the magnet instrumentation and electrical circuits throughout the assembly of the SSS, is als...

  6. Einstein SSS and MPC observations of Aql X-1 and 4U1820-30

    Science.gov (United States)

    Kelley, R. L.; Christian, D. J.; Schoelkopf, R. J.; Swank, J. H.

    1989-01-01

    The results of timing and spectral analyses of the X-ray sources Aql X-1 (X1908+005) and 4U1820-30 (NGC6624) are reported using data obtained with the Einstein SSS (Solid State Spectrometer) and MPC (Monitor Proportional Counter) instruments. A classic type I burst was observed from Aql X-1 in both detectors and a coherent modulation with a period of 131.66 + or - 0.02 ms and a pulsed fraction of 10 percent was detected in the SSS data. There is no evidence for a loss of coherance during the approximately 80 sec when the burst is observable. The 2 sigma upper limit on the rate of change of the pulse period is 0.00005s/s. It is argued that an asymmetrical burst occurring on a neutron star rotating at 7.6 Hz offers a plausible explanation for the oscillation. The data from 4U1820-30 show that the amplitude of the 685 sec modulation, identified as the orbital period, is independent of energy down to 0.6 keV. The SSS data show that the light curve in the 0.6 to 4.5 keV band is smoother than at higher energies.

  7. Unita di consumo dei farmaci e valutazioni farmacoeconomiche: uso e misuso di DDD e PDD

    Directory of Open Access Journals (Sweden)

    Mario Eandi

    2002-12-01

    Full Text Available In pharmacoeconomical evaluations the quantification of drug utilization has to be done on the basis of measurement units that allow comparisons among series of longitudinal and transversal data. The most common techniques used for the analysis and the comparison of drug utilization patterns are based either on the Defined Daily Dose (DDD, a unit system proposed by WHO’s Drug Utilization Research Group, or on the Prescribed Daily Dose (PDD, a statistical parameter obtained from the analysis of drug prescriptions. This article illustrates the meaning of the main indicators of drug consumption that can be build with these techniques, underlining their utility and limitations. The DDD is the conventionally established theoretical mean daily dose of a drug, referred to a way of administration and to its main indication. It is, therefore, a mere technical measurement unit that cannot be interpreted as mean prescribed or consumed dose, and even less as recommended dose. The PDD, on the contrary, is not a measurement unit but a statistical mean value, that expresses the central tendency of the prescription variability in a defined setting. Starting from Italian data on the consumption of wide-spread antibiotics, the use and interpretation of various indicators based on the DDDs and PDDs are discussed. The parameters derived with the DDD technique are suitable for monitoring drug utilization and pharmaceutical expenditure. The PDD method is more direct, indicates the mean quantities actually prescribed and permits the estimation of the total dose consumed per therapeutic cycle and of other clinically relevant parameters, but requires the acquisition of more data than the other technique does. It is also important to remark the fact that both methods can’t be directly used for economical evaluations trying to assess the efficiency of resource allocation, as they are not correlated to the clinical outcomes of the therapy.

  8. Modelling Coastal Cliff Recession Based on the GIM-DDD Method

    Science.gov (United States)

    Gong, Bin; Wang, Shanyong; Sloan, Scott William; Sheng, Daichao; Tang, Chun'an

    2018-04-01

    The unpredictable and instantaneous collapse behaviour of coastal rocky cliffs may cause damage that extends significantly beyond the area of failure. Gravitational movements that occur during coastal cliff recession involve two major stages: the small deformation stage and the large displacement stage. In this paper, a method of simulating the entire progressive failure process of coastal rocky cliffs is developed based on the gravity increase method (GIM), the rock failure process analysis method and the discontinuous deformation analysis method, and it is referred to as the GIM-DDD method. The small deformation stage, which includes crack initiation, propagation and coalescence processes, and the large displacement stage, which includes block translation and rotation processes during the rocky cliff collapse, are modelled using the GIM-DDD method. In addition, acoustic emissions, stress field variations, crack propagation and failure mode characteristics are further analysed to provide insights that can be used to predict, prevent and minimize potential economic losses and casualties. The calculation and analytical results are consistent with previous studies, which indicate that the developed method provides an effective and reliable approach for performing rocky cliff stability evaluations and coastal cliff recession analyses and has considerable potential for improving the safety and protection of seaside cliff areas.

  9. Lepton flavor violating decays τ→lll and μ→eγ in the Higgs triplet model

    International Nuclear Information System (INIS)

    Akeroyd, A. G.; Aoki, Mayumi; Sugiyama, Hiroaki

    2009-01-01

    Singly and doubly charged Higgs bosons in the Higgs triplet model mediate the lepton flavor violating (LFV) decays τ→lll and μ→eγ. The lepton flavor violating decay rates are proportional to products of two triplet Yukawa couplings (h ij ) which can be expressed in terms of the parameters of the neutrino mass matrix and an unknown triplet vacuum expectation value. We determine the parameter space of the neutrino mass matrix in which a signal for τ→lll and/or μ→eγ is possible at ongoing and planned experiments. The conditions for respecting the stringent upper limit for μ→eee are studied in detail, with emphasis given to the possibility of |h ee |≅0, which can only be realized if Majorana phases are present.

  10. Positive ion portion of the LBL/LLL Neutral Beam Program

    International Nuclear Information System (INIS)

    Pyle, R.V.; Baker, W.R.; Anderson, O.A.

    1978-06-01

    The positive ion portion of the Neutral Beam Development Program at the Lawrence Berkeley (LBL) and Livermore (LLL) Laboratories has two purposes: (a) to carry out general research and development in a timely way to assure that users' needs can be met in principle, and (b) to carry out specific development for users. To meet the first requirement, we have programs to develop sources capable of producing beams with high (85%) atomic fractions, long pulse lengths (10 sec to DC), and at beam energies up to 150 keV. We are also pursuing the development of on-line computer diagnostics and controls, the sophisticated high-power electronics required by neutral beam systems, and energy recovery. To meet the second requirement, we are developing prototype source modules to meet the requirements of the TMX and MFTF experiments at Lawrence Livermore Laboratory, the TFTR experiment at the Princeton Plasma Physics Laboratory, and the Doublet III experiment at General Atomic Co. The Lawrence Laboratories are also constructing and will demonstrate at LBL a complete prototype neutral injection system for TFTR, and are designing a similar system for Doublet III

  11. Supporting documents for LLL area 27 (410 area) safety analysis reports, Nevada Test Site

    Energy Technology Data Exchange (ETDEWEB)

    Odell, B. N. [comp.

    1977-02-01

    The following appendices are common to the LLL Safety Analysis Reports Nevada Test Site and are included here as supporting documents to those reports: Environmental Monitoring Report for the Nevada Test Site and Other Test Areas Used for Underground Nuclear Detonations, U. S. Environmental Protection Agency, Las Vegas, Rept. EMSL-LV-539-4 (1976); Selected Census Information Around the Nevada Test Site, U. S. Environmental Protection Agency, Las Vegas, Rept. NERC-LV-539-8 (1973); W. J. Hannon and H. L. McKague, An Examination of the Geology and Seismology Associated with Area 410 at the Nevada Test Site, Lawrence Livermore Laboratory, Livermore, Rept. UCRL-51830 (1975); K. R. Peterson, Diffusion Climatology for Hypothetical Accidents in Area 410 of the Nevada Test Site, Lawrence Livermore Laboratory, Livermore, Rept. UCRL-52074 (1976); J. R. McDonald, J. E. Minor, and K. C. Mehta, Development of a Design Basis Tornado and Structural Design Criteria for the Nevada Test Site, Nevada, Lawrence Livermore Laboratory, Livermore, Rept. UCRL-13668 (1975); A. E. Stevenson, Impact Tests of Wind-Borne Wooden Missiles, Sandia Laboratories, Tonopah, Rept. SAND 76-0407 (1976); and Hydrology of the 410 Area (Area 27) at the Nevada Test Site.

  12. 188Re-SSS lipiodol: radiolabelling and biodistribution following injection into the hepatic artery of rats bearing hepatoma.

    Science.gov (United States)

    Garin, Etienne; Denizot, Benoit; Noiret, Nicolas; Lepareur, Nicolas; Roux, Jerome; Moreau, Myriam; Herry, Jean-Yves; Bourguet, Patrick; Benoit, Jean-Pierre; Lejeune, Jean-Jacques

    2004-10-01

    Although intra-arterial radiation therapy with 131I-lipiodol is a useful therapeutic approach to the treatment of hepatocellular carcinoma, various disadvantages limit its use. To describe the development of a method for the labelling of lipiodol with 188Re-SSS (188Re (S2CPh)(S3CPh)2 complex) and to investigate its biodistribution after injection into the hepatic artery of rats with hepatoma. 188Re-SSS lipiodol was obtained after dissolving a chelating agent, previously labelled with 188Re, in cold lipiodol. The radiochemical purity (RCP) of labelling was checked immediately. The 188Re-SSS lipiodol was injected into the hepatic artery of nine rats with a Novikoff hepatoma. They were sacrificed 1, 24 and 48 h after injection, and used for ex vivo counting. Labelling of 188Re-SSS lipiodol was achieved with a yield of 97.3+/-2.1%. The immediate RCP was 94.1+/-1.7%. Ex vivo counting confirmed a predominantly hepatic uptake, with a good tumoral retention of 188Re-SSS lipiodol, a weak pulmonary uptake and a very faint digestive uptake. The 'tumour/non-tumoral liver' ratio was high at 1, 24 and 48 h after injection (2.9+/-1.5, 4.1+/-/4.1 and 4.1+/-0.7, respectively). Using the method described here, 188Re-SSS lipiodol can be obtained with a very high yield and a satisfactory RCP. The biodistribution in rats with hepatoma indicates a good tumoral retention of 188Re-SSS lipiodol associated with a predominant hepatic uptake, a weak pulmonary uptake and a very faint digestive uptake. This product should be considered for intra-arterial radiation therapy in human hepatoma.

  13. Psychometric testing of the Chinese version of the medical outcomes study social support survey (MOS-SSS-C).

    Science.gov (United States)

    Yu, Doris S F; Lee, Diana T F; Woo, Jean

    2004-04-01

    The purpose of this study was to assess the psychometric properties of the Chinese version of the Medical Outcomes Study Social Support Survey (MOS-SSS-C) in a sample of 110 patients. Criterion-related and construct validities of the MOS-SSS-C were evaluated by correlations with the Chinese version of the Multidimensional Perceived Social Support Survey (r =.82) and the Hospital Anxiety and Depression Scale (r = -.58). Confirmatory factor analysis affirmed the four-factor structure of the MOS-SSS-C in measuring the functional aspects of perceived social support. Cronbach's alphas for the subscales ranged from.93 to.96, whereas the alpha for the overall scale was.98. The 2-week test-retest reliability of the MOS-SSS-C as measured by the intraclass correlation coefficient was.84. The MOS-SSS-C is a psychometrically sound multidimensional measure for the evaluation of functional aspects of perceived social support by Chinese patients with chronic disease. Copyright 2004 Wiley Periodicals, Inc.

  14. Sensory-specific satiety for a food is unaffected by the ad libitum intake of other foods during a meal. Is SSS subject to dishabituation?

    Science.gov (United States)

    Meillon, S; Thomas, A; Havermans, R; Pénicaud, L; Brondel, L

    2013-04-01

    Sensory-specific satiety (SSS) is defined as a decrease in the pleasantness of a specific food that has just been eaten to satiation, while other non-eaten foods remain pleasant. The objectives of this study were the following: (1) to investigate whether SSS for a food is affected by the ad libitum intake of other foods presented sequentially during a meal, (2) to compare the development of SSS when foods are presented simultaneously or sequentially during a meal, and (3) to examine whether SSS is modified when foods are presented in an unusual order within a meal. Twelve participants participated in three tasting sessions. In session A, SSS for protein-, fat- and carbohydrate-rich sandwiches was measured after the ad libitum consumption of single type of each of these foods. In session B, SSS was measured for the same three foods consumed ad libitum but presented simultaneously. Session C was identical to session A, except that the presentation order of the three foods was reversed. The results indicate that once SSS for a given food is reached, the ad libitum consumption of other foods with different sensory characteristics does not decrease SSS, regardless of the order in which the foods are presented. Once reached, SSS is thus not subject to dishabituation during a meal. Copyright © 2012 Elsevier Ltd. All rights reserved.

  15. Evaluation of Polymerase Chain Reaction (PCR with Slit Skin Smear Examination (SSS to Confirm Clinical Diagnosis of Leprosy in Eastern Nepal.

    Directory of Open Access Journals (Sweden)

    Shraddha Siwakoti

    2016-12-01

    Full Text Available Detection of Mycobacterium leprae in slit skin smear (SSS is a gold standard technique for the leprosy diagnosis. Over recent years, molecular diagnosis by using PCR has been increasingly used as an alternative for its diagnosis due to its higher sensitivity. This study was carried out for comparative evaluation of PCR and SSS microscopy in a cohort of new leprosy cases diagnosed in B. P. Koirala Institute of health Sciences, Dharan, Nepal.In this prospective crossectional study, 50 new clinically diagnosed cases of leprosy were included. DNA was extracted from SSS and PCR was carried out to amplify 129 bp sequence of M. leprae repetitive element. Sensitivity of SSS and PCR was 18% and 72% respectively. Improvement of 54% case detection by PCR clearly showed its advantage over SSS. Furthermore, PCR could confirm the leprosy diagnosis in 66% of AFB negative cases indicating its superiority over SSS. In the paucibacillary (PB patients, whose BI was zero; sensitivity of PCR was 44%, whereas it was 78% in the multibacillary patients.Our study showed PCR to be more sensitive than SSS microscopy in diagnosing leprosy. Moreover, it explored the characteristic feature of PCR which detected higher level of early stage(PB cases tested negative by SSS. Being an expensive technique, PCR may not be feasible in all the cases, however, it would be useful in diagnosis of early cases of leprosy as opposed to SSS.

  16. Evaluation of Polymerase Chain Reaction (PCR) with Slit Skin Smear Examination (SSS) to Confirm Clinical Diagnosis of Leprosy in Eastern Nepal.

    Science.gov (United States)

    Siwakoti, Shraddha; Rai, Keshav; Bhattarai, Narayan Raj; Agarwal, Sudha; Khanal, Basudha

    2016-12-01

    Detection of Mycobacterium leprae in slit skin smear (SSS) is a gold standard technique for the leprosy diagnosis. Over recent years, molecular diagnosis by using PCR has been increasingly used as an alternative for its diagnosis due to its higher sensitivity. This study was carried out for comparative evaluation of PCR and SSS microscopy in a cohort of new leprosy cases diagnosed in B. P. Koirala Institute of health Sciences, Dharan, Nepal. In this prospective crossectional study, 50 new clinically diagnosed cases of leprosy were included. DNA was extracted from SSS and PCR was carried out to amplify 129 bp sequence of M. leprae repetitive element. Sensitivity of SSS and PCR was 18% and 72% respectively. Improvement of 54% case detection by PCR clearly showed its advantage over SSS. Furthermore, PCR could confirm the leprosy diagnosis in 66% of AFB negative cases indicating its superiority over SSS. In the paucibacillary (PB) patients, whose BI was zero; sensitivity of PCR was 44%, whereas it was 78% in the multibacillary patients. Our study showed PCR to be more sensitive than SSS microscopy in diagnosing leprosy. Moreover, it explored the characteristic feature of PCR which detected higher level of early stage(PB) cases tested negative by SSS. Being an expensive technique, PCR may not be feasible in all the cases, however, it would be useful in diagnosis of early cases of leprosy as opposed to SSS.

  17. The role of SSAC in the implementation of SSS Part 2

    International Nuclear Information System (INIS)

    Min, K. S.; Lee, B. D.; Soh, D. S.

    1998-01-01

    Conventional role of SSAC is known to the support of the Agency's inspection and the implementation of national inspection according to the law. The change of international safeguards system requires the change of the role of SSAC. This paper illustrated the role of SSAC in the conventional safeguards system and analyzed the role of SSAC in the new system of safeguards. State has an obligation to reserve nuclear material existing in its territory according to the safeguards agreement and thus the systematic SSAC should be maintained for the purpose of the reservation of the nuclear material. Additional role of the SSAC due to the implementation of the SSS can be divided into two; Firstly the aid of the researcher for the expanded declaration and secondly reduction of the amount of IAEA inspection through the cooperation and confidence building measures

  18. The time for atomic and molecular data bases is now. An overview of data management research at LLL

    International Nuclear Information System (INIS)

    Hampel, V.E.; Henry, E.A.

    1977-01-01

    We have created two numerical data bases of atomic and molecular (A+M) data required for laser induced fusion studies. One file contains primarily atomic energy levels and atomic transition data released by Charlotte E. Moore in NBS publications. The second file is based on the spectroscopic constants for more than 1000 molecular levels of approximately 160 heteronuclear diatomic molecules prepared by S. N. Suchard. Additional data bases are contemplated in support of the accelerating research activities in these fields. The present paucity of authenticated, computer-readable A+M data is not unlike that observed two decades ago in nuclear fission research. At that time, emphasis was also given to the accurate measurement of physical parameters and to reaction rates which eventually led to the ENDF/B series of evaluated neutron cross sections. Today, powerful computers have a more dominant role in modeling and predicting the results of promising experiments. Their effective use, however, depends more than ever before upon the availability of comprehensive and accurate files of A+M data. At the Lawrence Livermore Laboratory (LLL), these requirements are accentuated by the heavy reliance on computers. Also, trends are presently becoming apparent among users of the national computer network for Magnetic Fusion Energy (MFE), with its center at LLL, to coalesce organization-dependent data files into central data bases containing bibliographic information and numerical data as a common resource. The Data Management Research Project (LLL/DMRP) is collaborating with the National Bureau of Standards (NBS/NSRDS) to be able to respond to the emerging requirements. This should contribute to a ''Public Well'' of atomic and molecular data, unencumbered by legal or monetary constraints. (author)

  19. The results of electromagnetic studies of the Bragin-Loev ledge and the Chernihiv block of the DDD

    OpenAIRE

    Kushnir, A. N.; Burakhovich, T. R.

    2017-01-01

    The distribution of geomagnetic variations and the electric field on the Earth’s surface was obtained as a result of the modern experimental observations conducted in 2013 (10 points) in the northwestern part of the Dnieper-Donets depression (DDD) by the methods of magnetotelluric sounding (MTS) and magnetovariation profiling (MVP). It is possible to estimate the value of the electric conductivity and vertical and horizontal geoelectric structure. The processing of these data is done using th...

  20. [Cultural adaptation and validation of the Medical Outcomes Study Social Support Survey questionnaire (MOS-SSS)].

    Science.gov (United States)

    Alonso Fachado, A; Montes Martinez, A; Menendez Villalva, C; Pereira, M Graça

    2007-01-01

    The aim of this study was the assesment of psychometric properties of the Portuguese version of the instrument "Medical Outcomes Study - Social Support Survey (MOSSSS)". This questionnaire has been translated and adapted in a Portuguese sample of 101 patients with chronic illness of a rural health centre in Portugal. The average age of patients was 63.4 years, 56.4% female. 29% were illiterate and 2% had completed high school. 78% had arterial hypertension and the 56.4% had diabetes mellitus type 2. The internal consistency was evaluated using Cronbach's alpha. Exploratory and Confirmatory factor analysis were performed in order to confirm reliability and validity of the scale and its multidimensional characteristics. The 2-week test-retest reliability was estimated using weighted kappa for the ordinals variables and intraclass coefficient correlation for the quantitative variables. Cronbach's alphas for the subscales ranged from 0.873 to 0.967 at test, and 0.862 to 0.972 at retest. Exploratory factor analysis revealed the existence of four factors (emotional, tangible, positive interaction and affection support) that explain the 72.71% of the variance. Confirmatory factor analysis supported the existence of four factors that allowed the application of the scale with original items. The goodness-of-fit measures corroborate the initial structure, with chi2/ df=2.01, GFI=0.998, CFI=0.999, AGFI=0.998, TLI=0.999, NFI=0.998, SRMR=0.332, RMSEA=0.76. The 2-weeks test-retest reliability of the Portuguese MOS-SSS as measured by the intraclass correlation coefficient was ranged from 0.941 to 0.966 for the four dimensions and the overall support index. The weighted kappa was ranged from 0.67 to 0.87 for all the items. The MOS-SSS Portuguese version demonstrates good psychometric properties and seems to be useful to measure multidimensional aspects of social support in the Portuguese population.

  1. The Dichotic Digits difference Test (DDdT): Development, Normative Data, and Test-Retest Reliability Studies Part 1.

    Science.gov (United States)

    Cameron, Sharon; Glyde, Helen; Dillon, Harvey; Whitfield, Jessica; Seymour, John

    2016-06-01

    The dichotic digits test is one of the most widely used assessment tools for central auditory processing disorder. However, questions remain concerning the impact of cognitive factors on test results. To develop the Dichotic Digits difference Test (DDdT), an assessment tool that could differentiate children with cognitive deficits from children with genuine dichotic deficits based on differential test results. The DDdT consists of four subtests: dichotic free recall (FR), dichotic directed left ear (DLE), dichotic directed right ear (DRE), and diotic. Scores for six conditions are calculated (FR left ear [LE], FR right ear [RE], and FR total, as well as DLE, DRE, and diotic). Scores for four difference measures are also calculated: dichotic advantage, right-ear advantage (REA) FR, REA directed, and attention advantage. Experiment 1 involved development of the DDdT, including error rate analysis. Experiment 2 involved collection of normative and test-retest reliability data. Twenty adults (aged 25 yr 10 mo to 50 yr 7 mo, mean 36 yr 4 mo) took part in the development study; 62 normal-hearing, typically developing, primary-school children (aged 7 yr 1 mo to 11 yr 11 mo, mean 9 yr 4 mo) and 10 adults (aged 25 yr 0 mo to 51 yr 6 mo, mean 34 yr 10 mo) took part in the normative and test-retest reliability study. In Experiment 1, error rate analysis was conducted on the 36 digit-pair combinations of the DDdT. Normative data collected in Experiment 2 were arcsine transformed to achieve a distribution that was closer to a normal distribution and z-scores calculated. Pearson product-moment correlations were used to determine the strength of relationships between DDdT conditions. The development study revealed no significant differences in the adult population between test and retest on any DDdT condition. Error rates on 36 digit pairs ranged from 1.5% to 16.7%. The most and the least error-prone digits were removed before commencement of the normative data study, leaving 25

  2. Superhumps linked to X-ray emission. The superoutbursts of SSS J122221.7-311525 and GW Lib

    Science.gov (United States)

    Neustroev, V. V.; Page, K. L.; Kuulkers, E.; Osborne, J. P.; Beardmore, A. P.; Knigge, C.; Marsh, T.; Suleimanov, V. F.; Zharikov, S. V.

    2018-03-01

    Context. We present more than 4 years of Swift X-ray observations of the 2013 superoutburst, subsequent decline and quiescence of the WZ Sge-type dwarf nova SSS J122221.7-311525 (SSS J122222) from 6 days after discovery. Aims: Only a handful of WZ Sge-type dwarf novae have been observed in X-rays, and until recently GW Lib was the only binary of this type with complete coverage of an X-ray light curve throughout a superoutburst. We collected extensive X-ray data of a second such system to understand the extent to which the unexpected properties of GW Lib are common to the WZ Sge class. Methods: We collected 60 Swift-XRT observations of SSS J122222 between 2013 January 6 and 2013 July 1. Four follow-up observations were performed in 2014, 2015, 2016 and 2017. The total exposure time of our observations is 86.6 ks. We analysed the X-ray light curve and compared it with the behaviour of superhumps which were detected in the optical light curve. We also performed spectral analysis of the data. The results were compared with the properties of GW Lib, for which new X-ray observations were also obtained. Results: SSS J122222 was variable and around five times brighter in 0.3-10 keV X-rays during the superoutburst than in quiescence, mainly because of a significant strengthening of a high-energy component of the X-ray spectrum. The post-outburst decline of the X-ray flux lasted at least 500 d. The data show no evidence of the expected optically thick boundary layer in the system during the outburst. SSS J122222 also exhibited a sudden X-ray flux change in the middle of the superoutburst, which occurred exactly at the time of the superhump stage transition. A similar X-ray behaviour was also detected in GW Lib. Conclusions: We show that the X-ray flux exhibits changes at the times of changes in the superhump behaviour of both SSS J122222 and GW Lib. This result demonstrates a relationship between the outer disc and the white dwarf boundary layer for the first time, and

  3. Comparison of SSS and SRS calculated from normal databases provided by QPS and 4D-MSPECT manufacturers and from identical institutional normals.

    Science.gov (United States)

    Knollmann, Daniela; Knebel, Ingrid; Koch, Karl-Christian; Gebhard, Michael; Krohn, Thomas; Buell, Ulrich; Schaefer, Wolfgang M

    2008-02-01

    There is proven evidence for the importance of myocardial perfusion-single-photon emission computed tomography (SPECT) with computerised determination of summed stress and rest scores (SSS/SRS) for the diagnosis of coronary artery disease (CAD). SSS and SRS can thereby be calculated semi-quantitatively using a 20-segment model by comparing tracer-uptake with values from normal databases (NDB). Four severity-degrees for SSS and SRS are normally used: or =14. Manufacturers' NDBs (M-NDBs) often do not fit the institutional (I) settings. Therefore, this study compared SSS and SRS obtained with the algorithms Quantitative Perfusion SPECT (QPS) and 4D-MSPECT using M-NDB and I-NDB. I-NDBs were obtained using QPS and 4D-MSPECT from exercise stress data (450 MBq (99m)Tc-tetrofosmin, triple-head-camera, 30 s/view, 20 views/head) from 36 men with a low post-stress test CAD probability and visually normal SPECT findings. Patient group was 60 men showing the entire CAD-spectrum referred for routine perfusion-SPECT. Stress/rest results of automatic quantification of the 60 patients were compared to M-NDB and I-NDB. After reclassifying SSS/SRS into the four severity degrees, kappa values were calculated to objectify agreement. Mean values (vs M-NDB) were 9.4 +/- 10.3 (SSS) and 5.8 +/- 9.7 (SRS) for QPS and 8.2 +/- 8.7 (SSS) and 6.2 +/- 7.8 (SRS) for 4D-MSPECT. Thirty seven of sixty SSS classifications (kappa = 0.462) and 40/60 SRS classifications (kappa = 0.457) agreed. Compared to I-NDB, mean values were 10.2 +/- 11.6 (SSS) and 6.5 +/- 10.4 (SRS) for QPS and 9.2 +/- 9.3 (SSS) and 7.2 +/- 8.6 (SRS) for 4D-MSPECT. Forty four of sixty patients agreed in SSS and SRS (kappa = 0.621 resp. 0.58). Considerable differences between SSS/SRS obtained with QPS and 4D-MSPECT were found when using M-NDB. Even using identical patients and identical I-NDB, the algorithms still gave substantial different results.

  4. Time for atomic and molecular data bases is now (an overview of data management research at LLL)

    International Nuclear Information System (INIS)

    Hampel, V.E.; Henry, E.A.

    1977-01-01

    Two numerical data bases of atomic and molecular (A and M) data required for laser-induced fusion studies were created. One file contains primarily atomic energy levels and atomic transition data released by Charlotte E. Moore in NBS publications. The second file is based on the spectroscopic constants for more than 1000 molecular levels of approximately 160 heteronuclear diatomic molecules prepared by S. N. Suchard. Additional data bases are contemplated in support of the accelerating research activities in these fields. The present paucity of authenticated, computer-readable A and M data is not unlike that observed two decades ago in nuclear fission research. At that time, emphasis was also given to the accurate measurement of physical parameters and to reaction rates which eventually led to the ENDF/B series of evaluated neutron cross sections. Today, powerful computers have a more dominant role in modeling and predicting the results of promising experiments. Their effective use, however, depends more than ever before upon the availability of comprehensive and accurate files of A and M data. At the Lawrence Livermore Laboratory (LLL), these requirements are accentuated by the heavy reliance on computers. Also, trends are presently becoming apparent among users of the national computer network for Magnetic Fusion Energy, with its center at LLL, to coalesce organization-dependent data files into central data bases containing bibliographic information and numerical data as a common resource. The Data Management Research Project is collaborating with the National Bureau of Standards (NBS/NSRDS) to be able to respond to the emerging requirements. This should contribute to a ''Public Well'' of atomic and molecular data, unencumbered by legal or monetary constraints. 14 figures

  5. Lung Cancer Signature Biomarkers: tissue specific semantic similarity based clustering of Digital Differential Display (DDD data

    Directory of Open Access Journals (Sweden)

    Srivastava Mousami

    2012-11-01

    Full Text Available Abstract Background The tissue-specific Unigene Sets derived from more than one million expressed sequence tags (ESTs in the NCBI, GenBank database offers a platform for identifying significantly and differentially expressed tissue-specific genes by in-silico methods. Digital differential display (DDD rapidly creates transcription profiles based on EST comparisons and numerically calculates, as a fraction of the pool of ESTs, the relative sequence abundance of known and novel genes. However, the process of identifying the most likely tissue for a specific disease in which to search for candidate genes from the pool of differentially expressed genes remains difficult. Therefore, we have used ‘Gene Ontology semantic similarity score’ to measure the GO similarity between gene products of lung tissue-specific candidate genes from control (normal and disease (cancer sets. This semantic similarity score matrix based on hierarchical clustering represents in the form of a dendrogram. The dendrogram cluster stability was assessed by multiple bootstrapping. Multiple bootstrapping also computes a p-value for each cluster and corrects the bias of the bootstrap probability. Results Subsequent hierarchical clustering by the multiple bootstrapping method (α = 0.95 identified seven clusters. The comparative, as well as subtractive, approach revealed a set of 38 biomarkers comprising four distinct lung cancer signature biomarker clusters (panel 1–4. Further gene enrichment analysis of the four panels revealed that each panel represents a set of lung cancer linked metastasis diagnostic biomarkers (panel 1, chemotherapy/drug resistance biomarkers (panel 2, hypoxia regulated biomarkers (panel 3 and lung extra cellular matrix biomarkers (panel 4. Conclusions Expression analysis reveals that hypoxia induced lung cancer related biomarkers (panel 3, HIF and its modulating proteins (TGM2, CSNK1A1, CTNNA1, NAMPT/Visfatin, TNFRSF1A, ETS1, SRC-1, FN1, APLP2, DMBT1

  6. Comparison of SSS and SRS calculated from normal databases provided by QPS and 4D-MSPECT manufacturers and from identical institutional normals

    International Nuclear Information System (INIS)

    Knollmann, Daniela; Knebel, Ingrid; Gebhard, Michael; Krohn, Thomas; Buell, Ulrich; Schaefer, Wolfgang M.; Koch, Karl-Christian

    2008-01-01

    There is proven evidence for the importance of myocardial perfusion-single-photon emission computed tomography (SPECT) with computerised determination of summed stress and rest scores (SSS/SRS) for the diagnosis of coronary artery disease (CAD). SSS and SRS can thereby be calculated semi-quantitatively using a 20-segment model by comparing tracer-uptake with values from normal databases (NDB). Four severity-degrees for SSS and SRS are normally used: 99m Tc-tetrofosmin, triple-head-camera, 30 s/view, 20 views/head) from 36 men with a low post-stress test CAD probability and visually normal SPECT findings. Patient group was 60 men showing the entire CAD-spectrum referred for routine perfusion-SPECT. Stress/rest results of automatic quantification of the 60 patients were compared to M-NDB and I-NDB. After reclassifying SSS/SRS into the four severity degrees, kappa (κ) values were calculated to objectify agreement. Mean values (vs M-NDB) were 9.4 ± 10.3 (SSS) and 5.8 ± 9.7 (SRS) for QPS and 8.2 ± 8.7 (SSS) and 6.2 ± 7.8 (SRS) for 4D-MSPECT. Thirty seven of sixty SSS classifications (κ = 0.462) and 40/60 SRS classifications (κ = 0.457) agreed. Compared to I-NDB, mean values were 10.2 ± 11.6 (SSS) and 6.5 ± 10.4 (SRS) for QPS and 9.2 ± 9.3 (SSS) and 7.2 ± 8.6 (SRS) for 4D-MSPECT. Forty four of sixty patients agreed in SSS and SRS (κ = 0.621 resp. 0.58). Considerable differences between SSS/SRS obtained with QPS and 4D-MSPECT were found when using M-NDB. Even using identical patients and identical I-NDB, the algorithms still gave substantial different results. (orig.)

  7. A multi-physics analysis for the actuation of the SSS in opal reactor

    Directory of Open Access Journals (Sweden)

    Ferraro Diego

    2018-01-01

    Full Text Available OPAL is a 20 MWth multi-purpose open-pool type Research Reactor located at Lucas Heights, Australia. It was designed, built and commissioned by INVAP between 2000 and 2006 and it has been operated by the Australia Nuclear Science and Technology Organization (ANSTO showing a very good overall performance. On November 2016, OPAL reached 10 years of continuous operation, becoming one of the most reliable and available in its kind worldwide, with an unbeaten record of being fully operational 307 days a year. One of the enhanced safety features present in this state-of-art reactor is the availability of an independent, diverse and redundant Second Shutdown System (SSS, which consists in the drainage of the heavy water reflector contained in the Reflector Vessel. As far as high quality experimental data is available from reactor commissioning and operation stages and even from early component design validation stages, several models both regarding neutronic and thermo-hydraulic approaches have been developed during recent years using advanced calculations tools and the novel capabilities to couple them. These advanced models were developed in order to assess the capability of such codes to simulate and predict complex behaviours and develop highly detail analysis. In this framework, INVAP developed a three-dimensional CFD model that represents the detailed hydraulic behaviour of the Second Shutdown System for an actuation scenario, where the heavy water drainage 3D temporal profiles inside the Reflector Vessel can be obtained. This model was validated, comparing the computational results with experimental measurements performed in a real-size physical model built by INVAP during early OPAL design engineering stages. Furthermore, detailed 3D Serpent Monte Carlo models are also available, which have been already validated with experimental data from reactor commissioning and operating cycles. In the present work the neutronic and thermohydraulic

  8. A multi-physics analysis for the actuation of the SSS in opal reactor

    Science.gov (United States)

    Ferraro, Diego; Alberto, Patricio; Villarino, Eduardo; Doval, Alicia

    2018-05-01

    OPAL is a 20 MWth multi-purpose open-pool type Research Reactor located at Lucas Heights, Australia. It was designed, built and commissioned by INVAP between 2000 and 2006 and it has been operated by the Australia Nuclear Science and Technology Organization (ANSTO) showing a very good overall performance. On November 2016, OPAL reached 10 years of continuous operation, becoming one of the most reliable and available in its kind worldwide, with an unbeaten record of being fully operational 307 days a year. One of the enhanced safety features present in this state-of-art reactor is the availability of an independent, diverse and redundant Second Shutdown System (SSS), which consists in the drainage of the heavy water reflector contained in the Reflector Vessel. As far as high quality experimental data is available from reactor commissioning and operation stages and even from early component design validation stages, several models both regarding neutronic and thermo-hydraulic approaches have been developed during recent years using advanced calculations tools and the novel capabilities to couple them. These advanced models were developed in order to assess the capability of such codes to simulate and predict complex behaviours and develop highly detail analysis. In this framework, INVAP developed a three-dimensional CFD model that represents the detailed hydraulic behaviour of the Second Shutdown System for an actuation scenario, where the heavy water drainage 3D temporal profiles inside the Reflector Vessel can be obtained. This model was validated, comparing the computational results with experimental measurements performed in a real-size physical model built by INVAP during early OPAL design engineering stages. Furthermore, detailed 3D Serpent Monte Carlo models are also available, which have been already validated with experimental data from reactor commissioning and operating cycles. In the present work the neutronic and thermohydraulic models, available for

  9. 3D DDD modelling of dislocation-precipitate interaction in a nickel-based single crystal superalloy under cyclic deformation

    Science.gov (United States)

    Lin, Bing; Huang, Minsheng; Zhao, Liguo; Roy, Anish; Silberschmidt, Vadim; Barnard, Nick; Whittaker, Mark; McColvin, Gordon

    2018-06-01

    Strain-controlled cyclic deformation of a nickel-based single crystal superalloy has been modelled using three-dimensional (3D) discrete dislocation dynamics (DDD) for both [0 0 1] and [1 1 1] orientations. The work focused on the interaction between dislocations and precipitates during cyclic plastic deformation at elevated temperature, which has not been well studied yet. A representative volume element with cubic γ‧-precipitates was chosen to represent the material, with enforced periodical boundary conditions. In particular, cutting of superdislocations into precipitates was simulated by a back-force method. The global cyclic stress-strain responses were captured well by the DDD model when compared to experimental data, particularly the effects of crystallographic orientation. Dislocation evolution showed that considerably high density of dislocations was produced for [1 1 1] orientation when compared to [0 0 1] orientation. Cutting of dislocations into the precipitates had a significant effect on the plastic deformation, leading to material softening. Contour plots of in-plane shear strain proved the development of heterogeneous strain field, resulting in the formation of shear-band embryos.

  10. Successful treatment of Cushing's disease with o,p - DDD followed by pituitary irradiation in a 19-year-old male patient

    International Nuclear Information System (INIS)

    Dickerman, Z.; Kaufman, H.; Laron, Z.; Tel Aviv Univ.

    1979-01-01

    A 19-year-old male patient with Cushing's disease was treated for 15 months with a gastric-insoluble preparation of o.p'-DDD. 12 months after the start of the o.p'-DDD therapy, the dose was reduced from 6 to 2 g/day and external pituitary irradiation (4,480 rads) was initiated. No disturbance in the secretion of human growth hormone, thyroid-stimulating hormone, luteinizing hormone, follicle-stimulating hormone or prolactin was revealed. The clinical and laboratory signs of Cushing's disease disappeared gradually, and the patient tolerated the drug well, even at a dose of 12 g/day. At present, two years after the discontinuation of o.p'-DDD therapy and pituitary irradiation, the patient is symptom free and receives no medication. (B.G.)

  11. Immobilization of Deoxyadenosine Kinase from Dictyostelium discoideum (DddAK) and Its Application in the 5’-Phosphorylation of Arabinosyladenine and Arabinosyl-2-fluoroadenine

    DEFF Research Database (Denmark)

    Serra, Immacolata; Ubiali, Daniela; Piskur, Jure

    2017-01-01

    Deoxyadenosine kinase from Dictyostelium discoideum (DddAK) phosphorylates its natural substrate (2’‐deoxyadenosine, dAdo) as well as the arabinosyladenine analogues vidarabine (araA) and fludarabine (F‐araA) to their corresponding 5’‐monophosphates. DddAK has been here immobilized by ionic...... interaction on an aminated epoxy‐functionalized support (SepabeadsTM EC‐EP), and cross‐linked with oxidized dextran. The final activity recovery was 33–42 %, depending on the protein loading. Immobilization enhanced the stability of DddAK at pH 10 and, to a lesser extent, at 45 °C. Phosphorylation of d...

  12. Effect of a 188 Re-SSS lipiodol/131I-lipiodol mixture, 188 Re-SSS lipiodol alone or 131I-lipiodol alone on the survival of rats with hepatocellular carcinoma.

    Science.gov (United States)

    Garin, Elienne; Rakotonirina, Hervé; Lejeune, Florence; Denizot, Benoit; Roux, Jerome; Noiret, Nicolas; Mesbah, Habiba; Herry, Jean-Yues; Bourguet, Patrick; Lejeune, Jean-Jacques

    2006-04-01

    It has been shown that the use of a cocktail of isotopes of different ranges of action leads to an increase in the effectiveness of metabolic radiotherapy. The purpose of the present study was to compare with a control group the effectiveness of three different treatments in rats bearing hepatocellular carcinoma (HCC), using (1) a mixture of lipiodol labelled with both I and Re, (2) lipiodol labelled with I alone and (3) lipiodol labelled with Re alone. Four groups were made up, each containing 14 rats with the N1-S1 tumour cell line. Group 1 received a mixture composed of 22 MBq of Re-SSS lipiodol and 7 MBq I-lipiodol. Group 2 received 14 MBq I-lipiodol. Group 3 received 44 MBq of Re-SSS lipiodol and group 4 acted as the control. The survival of the various groups was compared by a non-parametric test of log-rank, after a follow-up of 60, 180 and 273 days. Compared with the controls, the rats treated with a mixture of Re-SSS lipiodol and I-lipiodol show an increase in survival, but only from day 60 onwards (P=0.05 at day 60 and 0.13 at days 180 and 273). For the rats treated with I-lipiodol, there was a highly significant increase in survival compared with the controls at day 60, day 180 and day 273 (P=0.03, 0.04 and 0.04, respectively). There is no significant increase in survival for the rats treated with Re-SSS lipiodol, irrespective of the follow-up duration (P=0.53 at day 60, 0.48 at day 180, and 0.59 at day 273). In this study, I-lipiodol is the most effective treatment in HCC-bearing rats, because this is the only method that leads to a prolonged improvement of survival. These results cannot necessarily be extrapolated to humans because of the relatively small size and unifocal nature of the lesions in this study. It appears necessary to carry out a study in humans with larger tumours in order to compare these three treatments, particularly with a view to replacing I-labelled lipiodol by Re-labelled lipiodol. However, this study clearly demonstrated that

  13. Preclinical models for an innovative glioblastoma therapeutical strategy by 188Re-SSS encapsulated in nano-tools: translational view

    International Nuclear Information System (INIS)

    Cikankowitz, A.; Belloche, C.; Verger, E.; Garcion, E.; Hindre, F.; Chassain, G.; Fellah, B.; Abadie, J.; Chouin, N.; Ibisch, C.; Davodeau, F.; Couez, D.; Lepareur, N.; Lacoeuille, F.; Menei, P.

    2015-01-01

    Full text of publication follows. Aim: Glioblastoma (GBM) is the most frequent cancer of the nervous system and therapies currently used cannot treat definitively this disease. By the way of NucSan (Nuclear for health) program which supports research development about the use of radio pharmaceutics in oncology, the aim of the proposed work is to provide evidences that internal radiotherapy through lipid nanocapsules loaded with Rhenium-188 (LNC 188 Re-SSS) is an alternative therapeutic strategy for GBM that can be translated to human medicine. Previous works have shown a remarkable efficiency of this tool among syngeneic rats linked with local and peripheral recruitments of the immune system's effectors. In this context, two animal models have been chosen to validate the feasibility of this new innovative therapy design (LNC 188 Re-SSS stereotactic injection). Materials and methods: the syngeneic six weeks old C57BL/6J female mice were treated 6 or 12 days after stereotactic GL261 cells implantation, by a single injection of increasing activities of LNC 188 Re-SSS (0,925; 1,85 and 2,7 MBq/5μl). MRI was used to follow tumor progression to determine the mass volume through the selection of regions of interest. The increased median survival time (IMST) was also assessed for treated mice versus control mice (stereotactic injection of saline solution). For long time survival animals (3 times the median survival time), they were rechallenged through the same procedure in the other hemisphere. The brachy-cephalic dog bearing spontaneous tumor will lead to additional evidences to specifically highlight the potential of this innovative technology for GBM treatment. In order to validate procedures of intracerebral injections, a stereotactic head frame specially designed for dog has been conceived which allow both images acquisition (MRI-SPECT and PET) and the achievement of biopsies. Results/Perspectives: as previously observed on rat models, the preliminary data show

  14. Time-resolved analysis of the emission of sidestream smoke (SSS) from cigarettes during smoking by photo ionisation/time-of-flight mass spectrometry (PI-TOFMS): towards a better description of environmental tobacco smoke.

    Science.gov (United States)

    Streibel, T; Mitschke, S; Adam, T; Zimmermann, R

    2013-09-01

    In this study, the chemical composition of sidestream smoke (SSS) emissions of cigarettes are characterised using a laser-based single-photon ionisation time-of-flight mass spectrometer. SSS is generated from various cigarette types (2R4F research cigarette; Burley, Oriental and Virginia single-tobacco-type cigarettes) smoked on a single-port smoking machine and collected using a so-called fishtail chimney device. Using this setup, a puff-resolved quantification of several SSS components was performed. Investigations of the dynamics of SSS emissions show that concentration profiles of various substances can be categorised into several groups, either depending on the occurrence of a puff or uninfluenced by the changes in the burning zone during puffing. The SSS emissions occurring directly after a puff strongly resemble the composition of mainstream smoke (MSS). In the smouldering phase, clear differences between MSS and SSS are observed. The changed chemical profiles of SSS and MSS might be also of importance on environmental tobacco smoke which is largely determined by SSS. Additionally, the chemical composition of the SSS is strongly affected by the tobacco type. Hence, the higher nitrogen content of Burley tobacco leads to the detection of increased amounts of nitrogen-containing substances in SSS.

  15. Workplace testing of the new single sphere neutron spectrometer based on Dysprosium activation foils (Dy-SSS)

    International Nuclear Information System (INIS)

    Bedogni, R.; Gómez-Ros, J.M.; Esposito, A.; Gentile, A.; Chiti, M.; Palacios-Pérez, L.; Angelone, M.; Tana, L.

    2012-01-01

    A photon insensitive passive neutron spectrometer consisting of a single moderating polyethylene sphere with Dysprosium activation foils arranged along three perpendicular axes was designed by CIEMAT and INFN. The device is called Dy-SSS (Dy foil-based Single Sphere Spectrometer). It shows nearly isotropic response in terms of neutron fluence up to 20 MeV. The first prototype, previously calibrated with 14 MeV neutrons, has been recently tested in workplaces having different energy and directional distributions. These are a 2.5 MeV nearly mono-chromatic and mono-directional beam available at the ENEA Frascati Neutron Generator (FNG) and the photo-neutron field produced in a 15 MV Varian CLINAC DHX medical accelerator, located in the Ospedale S. Chiara (Pisa). Both neutron spectra are known through measurements with a Bonner Sphere Spectrometer. In both cases the experimental response of the Dy-SSS agrees with the reference data. Moreover, it is demonstrated that the spectrometric capability of the new device are independent from the directional distribution of the neutron field. This opens the way to a new generation of moderation-based neutron instruments, presenting all advantages of the Bonner sphere spectrometer without the disadvantage of the repeated exposures. This concept is being developed within the NESCOFI@BTF project of INFN (Commissione Scientifica Nazionale 5).

  16. Workplace testing of the new single sphere neutron spectrometer based on Dysprosium activation foils (Dy-SSS)

    Science.gov (United States)

    Bedogni, R.; Gómez-Ros, J. M.; Esposito, A.; Gentile, A.; Chiti, M.; Palacios-Pérez, L.; Angelone, M.; Tana, L.

    2012-08-01

    A photon insensitive passive neutron spectrometer consisting of a single moderating polyethylene sphere with Dysprosium activation foils arranged along three perpendicular axes was designed by CIEMAT and INFN. The device is called Dy-SSS (Dy foil-based Single Sphere Spectrometer). It shows nearly isotropic response in terms of neutron fluence up to 20 MeV. The first prototype, previously calibrated with 14 MeV neutrons, has been recently tested in workplaces having different energy and directional distributions. These are a 2.5 MeV nearly mono-chromatic and mono-directional beam available at the ENEA Frascati Neutron Generator (FNG) and the photo-neutron field produced in a 15 MV Varian CLINAC DHX medical accelerator, located in the Ospedale S. Chiara (Pisa). Both neutron spectra are known through measurements with a Bonner Sphere Spectrometer. In both cases the experimental response of the Dy-SSS agrees with the reference data. Moreover, it is demonstrated that the spectrometric capability of the new device are independent from the directional distribution of the neutron field. This opens the way to a new generation of moderation-based neutron instruments, presenting all advantages of the Bonner sphere spectrometer without the disadvantage of the repeated exposures. This concept is being developed within the NESCOFI@BTF project of INFN (Commissione Scientifica Nazionale 5).

  17. Workplace testing of the new single sphere neutron spectrometer based on Dysprosium activation foils (Dy-SSS)

    Energy Technology Data Exchange (ETDEWEB)

    Bedogni, R., E-mail: roberto.bedogni@lnf.infn.it [INFN-LNF (Frascati National Laboratories), Via E. Fermi n. 40-00044 Frascati (Italy); Gomez-Ros, J.M. [INFN-LNF (Frascati National Laboratories), Via E. Fermi n. 40-00044 Frascati (Italy); CIEMAT, Av. Complutense 40, 28040 Madrid (Spain); Esposito, A.; Gentile, A.; Chiti, M.; Palacios-Perez, L. [INFN-LNF (Frascati National Laboratories), Via E. Fermi n. 40-00044 Frascati (Italy); Angelone, M. [ENEA C.R. Frascati, C.P. 65, 00044 Frascati (Italy); Tana, L. [A.O. Universitaria Pisana-Ospedale S. Chiara, Via Bonanno Pisano, Pisa (Italy)

    2012-08-21

    A photon insensitive passive neutron spectrometer consisting of a single moderating polyethylene sphere with Dysprosium activation foils arranged along three perpendicular axes was designed by CIEMAT and INFN. The device is called Dy-SSS (Dy foil-based Single Sphere Spectrometer). It shows nearly isotropic response in terms of neutron fluence up to 20 MeV. The first prototype, previously calibrated with 14 MeV neutrons, has been recently tested in workplaces having different energy and directional distributions. These are a 2.5 MeV nearly mono-chromatic and mono-directional beam available at the ENEA Frascati Neutron Generator (FNG) and the photo-neutron field produced in a 15 MV Varian CLINAC DHX medical accelerator, located in the Ospedale S. Chiara (Pisa). Both neutron spectra are known through measurements with a Bonner Sphere Spectrometer. In both cases the experimental response of the Dy-SSS agrees with the reference data. Moreover, it is demonstrated that the spectrometric capability of the new device are independent from the directional distribution of the neutron field. This opens the way to a new generation of moderation-based neutron instruments, presenting all advantages of the Bonner sphere spectrometer without the disadvantage of the repeated exposures. This concept is being developed within the NESCOFI@BTF project of INFN (Commissione Scientifica Nazionale 5).

  18. Development and validation of a five-factor sexual satisfaction and distress scale for women: the Sexual Satisfaction Scale for Women (SSS-W).

    Science.gov (United States)

    Meston, Cindy; Trapnell, Paul

    2005-01-01

    This article presents data based on the responses of over 800 women who contributed to the development of the Sexual Satisfaction Scale for Women (SSS-W). The aim of this study was to develop a comprehensive, multifaceted, valid, and reliable self-report measure of women's sexual satisfaction and distress. Phase I involved the initial selection of items based on past literature and on interviews of women diagnosed with sexual dysfunction and an exploratory factor analysis. Phase II involved an additional administration of the questionnaire, factor analyses, and refinement of the questionnaire items. Phase III involved administration of the final questionnaire to a sample of women with clinically diagnosed sexual dysfunction and controls. Psychometric evaluation of the SSS-W conducted in a sample of women meeting DSM-IV-TR criteria for female sexual dysfunction and in a control sample provided preliminary evidence of reliability and validity. The ability of the SSS-W to discriminate between sexually functional and dysfunctional women was demonstrated for each of the SSS-W domain scores and total score. The SSS-W is a brief, 30-item measure of sexual satisfaction and sexual distress, composed of five domains supported by factor analyses: contentment, communication, compatibility, relational concern, and personal concern. It exhibits sound psychometric properties and has a demonstrated ability to discriminate between clinical and nonclinical samples.

  19. Prevalence of conduction delay of the right atrium in patients with SSS: implications for pacing site selection.

    Science.gov (United States)

    Verlato, Roberto; Zanon, Francesco; Bertaglia, Emanuele; Turrini, Pietro; Baccillieri, Maria Stella; Baracca, Enrico; Bongiorni, Maria Grazia; Zampiero, Aldo; Zonzin, Pietro; Pascotto, Pietro; Venturini, Diego; Corbucci, Giorgio

    2007-09-01

    To evaluate the prevalence of severe right atrial conduction delay in patients with sinus node dysfunction (SND) and atrial fibrillation (AF) and the effects of pacing in the right atrial appendage (RAA) and in the inter-atrial septum (IAS). Forty-two patients (15 male, 72 +/- 7 years) underwent electrophysiologic study to measure the difference between the conduction time from RAA to coronary sinus ostium during stimulation at 600 ms and after extrastimulus (DeltaCTos). Patients were classified as group A if DeltaCTos > 60 ms and group B if IAS pacing and algorithms ON/OFF. Fifteen patients (36%, group A) had DeltaCTos = 76 +/- 11 ms and 27 patients (64%, group B) had DeltaCTos = 36 +/- 20 ms. Twenty-two patients were paced at the RAA and 20 at the IAS. During the study, no AF recurrences were reported in 11 of 42 (26%) patients, independently of RAA or IAS pacing. Patients from group A and RAA pacing had 0.79 +/- 0.81 episodes of AF/day during DDD, which increased to 1.52 +/- 1.41 episodes of AF/day during DDDR + Alg (P = 0.046). Those with IAS pacing had 0.5 +/- 0.24 episodes of AF/day during DDD, which decreased to 0.06 +/- 0.08 episodes of AF/day during DDDR + Alg (P = 0.06). In group B, no differences were reported between pacing sites and pacing modes. Severe right atrial conduction delay is present in one-third of patients with SND and AF: continuous pacing at the IAS is superior to RAA for AF recurrences. In patients without severe conduction delay, no differences between pacing site or mode were observed.

  20. Simultaneous determination of diastereoisomeric and enantiomeric impurities in SSS-octahydroindole-2-carboxylic acid by chiral high-performance liquid chromatography with pre-column derivatization.

    Science.gov (United States)

    Wang, Jin Zhao; Zeng, Su; Hu, Gong Yun; Wang, Dan Hua

    2009-04-10

    SSS-Octahydroindole-2-carboxylic acid (SSS-Oic) is a key intermediate used in the synthesis of some angiotensin-converting enzyme (ACE) inhibitors. The separation of diastereoisomers and enantiomers of Oic was performed using a pre-column derivatization chiral HPLC method. Phenyl isothiocyanate (PITC) was used as the derivatization reagent. Three PITC derivatives of Oic stereoisomers were separated on an Ultron ES-OVM chiral column (150 mm x 4.6 mm, 5 microm). Derivatization conditions such as reaction temperature, reaction time and derivatization reagent concentration were investigated. The chromatographic conditions for separation of the three PITC-Oic derivatives were optimized. The method was successfully applied in the diastereoisomeric and enantiomeric purity test of SSS-Oic.

  1. Role of radiolytically generated species in radiation induced polymerization of sodium p-styrene sulphonate (SSS) in aqueous solution: Steady state and pulse radiolysis study

    International Nuclear Information System (INIS)

    Bhardwaj, Y.K.; Mohan, H.; Sabharwal, S.; Majali, A.B.

    2000-01-01

    Radiation induced polymerization of sodium p-styrene sulphonate (SSS) in aqueous solution has been investigated by steady state and pulse radiolysis techniques. Effect of dose, dose rate, monomer concentration, pH and ambient conditions on polymerization was investigated. The reactions of primary radicals of water radiolysis such as OH radical, e - aq , H atom, O· - and some oxidizing radicals like N· 3 , Cl· - 2 ,Br· - 2 , and reducing specie like CO· - 2 with SSS have also been investigated. SSS reacts with OH radical with a rate constant of 5.9x10 9 dm 3 mol -1 s -1 at pH 6.3. The results indicate that ∼83% of OH radicals undergo electron transfer reaction resulting in a cation radical species while remaining ∼17% react via addition reaction. The hydrated electron reacts with SSS with a rate constant 1.3x10 10 dm 3 mol -1 s -1 to form an anion that undergoes fast protonation to form H-adduct at pH 6.3. At high pH (>10) the anion is able to transfer electron to methyl vilogen and p-nitro aceto phenone (p-NAP) where as H-adduct is unable to transfer electron. At pH ∼1 H atom reaction with SSS is diffusion controlled with a rate constant of 5x10 9 dm 3 mol -1 s -1 and results in formation of H adduct. It was seen that anion reacts with solute an order faster than cation generated radiolytically indicating anionic initiation of polymerization of SSS. Molecular weight of the polymer formed by radiation polymerization, determined by viscosity measurement, are of the order of 10 7 and higher molecular weight polymers are obtained at lower dose rates. In presence of a crosslinking agent gelation of polymer is much faster than the monomer and a polymer concentration ∼20% is most efficiently crosslinked. (author)

  2. Assessing somatic symptom burden: a psychometric comparison of the patient health questionnaire-15 (PHQ-15) and the somatic symptom scale-8 (SSS-8).

    Science.gov (United States)

    Gierk, Benjamin; Kohlmann, Sebastian; Toussaint, Anne; Wahl, Inka; Brünahl, Christian A; Murray, Alexandra M; Löwe, Bernd

    2015-04-01

    The Patient Health Questionnaire-15 (PHQ-15) is a frequently used questionnaire to assess somatic symptom burden. Recently, the Somatic Symptom Scale-8 (SSS-8) has been published as a short version of the PHQ-15. This study examines whether the instruments' psychometric properties and estimates of symptom burden are comparable. Psychosomatic outpatients (N=131) completed the PHQ-15, the SSS-8 and other questionnaires (PHQ-9, GAD-7, WI-7, SF-12). Item characteristics and measures of reliability, validity, and symptom severity were determined and compared. The reliabilities of the PHQ-15 and SSS-8 were α=0.80 and α=0.76, respectively and both scales were highly correlated (r=0.83). The item characteristics were comparable. Both instruments showed the same pattern of correlations with measures of depression, anxiety, health anxiety and health-related quality of life (r=0.32 to 0.61). On both scales a 1-point increase was associated with a 3% increase in health care use. The percentile distributions of the PHQ-15 and the SSS-8 were similar. Using the same thresholds for somatic symptom severity (5, 10, and 15 points), both instruments identified nearly identical subgroups of patients with respect to health related quality of life. The PHQ-15 and the SSS-8 showed similar reliability and validity but the comparability of severity classifications needs further evaluation in other populations. Until then we recommend the use of the previously established thresholds. Overall, the SSS-8 performed well as a short version of the PHQ-15 which makes it preferable for assessment in time restricted settings. Copyright © 2014 Elsevier Inc. All rights reserved.

  3. Studies on surface grafting of AAc/SSS binary monomers onto polytetrafluoroethylene by dielectric barrier discharge initiation

    International Nuclear Information System (INIS)

    Xi Zhenyu; Xu Youyi; Zhu Liping; Liu Fu; Zhu Baoku

    2008-01-01

    Polytetrafluoroethylene (PTFE) films were pre-treated by dielectric barrier discharge in atmospheric pressure with air as carrier gas. And then the hydrophilic sulfonate groups were introduced by the single step grafting method with binary monomer solution of acrylic acid (AAc) and sodium 4-styrenesulfonate (SSS). The effects of binary monomer ratio, reaction solution concentration and polymerization time on the degree of grafting were investigated. The surface chemical change was determined by Fourier transform infrared attenuated total reflection spectroscopy (FTIR-ATR) and X-ray photoelectron spectroscopy (XPS). Morphological changes on the film surface were described using field emitting scanning electron microscopy (SEM) and atomic force microscopy (AFM). The surface hydrophilicity of the modified film was characterized through water contact angle measurement. It was found that the water contact angle of the film surface reduced significantly when compared with the original one, indicating the introduction of hydrophilic groups and improvement of the surface hydrophilicity

  4. Socio-demographic characteristics, types and Slit Skin Smear (SSS) of the leprosy patients: a hospital based study.

    Science.gov (United States)

    Sarker, U K; Mohammad, Q D; Uddin, M J; Chowdhury, R N; Bhattacharjee, M; Mondol, G; Roy, N

    2014-07-01

    This study was aimed to identify the socio-demographic profile, to know the types and to find out the Slit Skin Smear (SSS) result associated with leprosy. It was a descriptive type of cross sectional study. Total 62 patients having clinical features of leprosy, attending in Department of Neurology of Mymensingh Medical College Hospital (MMCH) and Mymensingh Tuberculosis and Leprosy Hospital, Mymensingh from January 2010 to December 2011 were included. Patients underwent a detailed clinical evaluation followed by laboratory investigations. Out of 62 cases, the results showed that the mean age of leprosy patients were 37.8±14.6 years with the age range 12-80 years and the peak incidence was between 20-40 years. The frequency of male and female was 70.9% and 29.1% respectively with M: F of 2.4:1. From rural area 74.2% leprosy patients and 25.8% patients were from urban area and mainly day-labours (25.8%) and housewife (24.2%) by occupation. Married was 87.1% of patients and 12.9% were unmarried. Twenty one percent (21%) leprosy patients were found contact with leprosy. It was observed in this study that, 35.5% patients were PB (Pauci Bacillary) group and 64.5% of the patients were in MB (Multi Bacillary) group. Lepromatous Leprosy (LL) patients were (17.7%) and Borderline Lepromatous (BL) patients were (11.3%). Patients with Tuberculoid Type (TT) were (3.2%) and patients with Borderline Tuberculoid (BT) were (61.3%). The result of Slit skin smear (SSS) examination was negative in 59.7% patients and positive in 40.3%.

  5. Passive sampling of DDT, DDE and DDD in sediments: accounting for degradation processes with reaction-diffusion modeling.

    Science.gov (United States)

    Tcaciuc, A Patricia; Borrelli, Raffaella; Zaninetta, Luciano M; Gschwend, Philip M

    2018-01-24

    Passive sampling is becoming a widely used tool for assessing freely dissolved concentrations of hydrophobic organic contaminants in environmental media. For certain media and target analytes, the time to reach equilibrium exceeds the deployment time, and in such cases, the loss of performance reference compounds (PRCs), loaded in the sampler before deployment, is one of the common ways used to assess the fractional equilibration of target analytes. The key assumption behind the use of PRCs is that their release is solely diffusion driven. But in this work, we show that PRC transformations in the sediment can have a measurable impact on the PRC releases and even allow estimation of that compound's transformation rate in the environment of interest. We found that in both field and lab incubations, the loss of the 13 C 2,4'-DDT PRC from a polyethylene (PE) passive sampler deployed at the sediment-water interface was accelerated compared to the loss of other PRCs ( 13 C-labeled PCBs, 13 C-labeled DDE and DDD). The DDT PRC loss was also accompanied by accumulation in the PE of its degradation product, 13 C 2,4'-DDD. Using a 1D reaction-diffusion model, we deduced the in situ degradation rates of DDT from the measured PRC loss. The in situ degradation rates increased with depth into the sediment bed (0.14 d -1 at 0-10 cm and 1.4 d -1 at 30-40 cm) and although they could not be independently validated, these rates compared favorably with literature values. This work shows that passive sampling users should be cautious when choosing PRCs, as degradation processes can affect some PRC's releases from the passive sampler. More importantly, this work opens up the opportunity for novel applications of passive samplers, particularly with regard to investigating in situ degradation rates, pathways, and products for both legacy and emerging contaminants. However, further work is needed to confirm that the rates deduced from model fitting of PRC loss are a true reflection of DDT

  6. Monitoring somatic symptoms in patients with mental disorders: Sensitivity to change and minimal clinically important difference of the Somatic Symptom Scale - 8 (SSS-8).

    Science.gov (United States)

    Gierk, Benjamin; Kohlmann, Sebastian; Hagemann-Goebel, Marion; Löwe, Bernd; Nestoriuc, Yvonne

    2017-09-01

    The SSS-8 is a brief questionnaire for the assessment of somatic symptom burden. This study examines its sensitivity to change and the minimal clinically important difference (MCID) in patients with mental disorders. 55 outpatients with mental disorders completed the SSS-8 and measures of anxiety, depression, and disability before and after receiving treatment. Effect sizes and correlations between the change scores were calculated. The MCID was estimated using a one standard error of measurement threshold and the change in disability as an external criterion. There was a medium decline in somatic symptom burden for the complete sample (n=55, d z =0.53) and a large decline in a subgroup with very high somatic symptom burden at baseline (n=11, d z =0.94). Decreases in somatic symptom burden were associated with decreases in anxiety (r=0.68, pSSS-8 is sensitive to change. A 3-point decrease reflects a clinically important improvement. Due to its brevity and sound psychometric properties, the SSS-8 is useful for monitoring somatic symptom burden. Copyright © 2017 Elsevier Inc. All rights reserved.

  7. Sequential sentinel SNP Regional Association Plots (SSS-RAP): an approach for testing independence of SNP association signals using meta-analysis data.

    Science.gov (United States)

    Zheng, Jie; Gaunt, Tom R; Day, Ian N M

    2013-01-01

    Genome-Wide Association Studies (GWAS) frequently incorporate meta-analysis within their framework. However, conditional analysis of individual-level data, which is an established approach for fine mapping of causal sites, is often precluded where only group-level summary data are available for analysis. Here, we present a numerical and graphical approach, "sequential sentinel SNP regional association plot" (SSS-RAP), which estimates regression coefficients (beta) with their standard errors using the meta-analysis summary results directly. Under an additive model, typical for genes with small effect, the effect for a sentinel SNP can be transformed to the predicted effect for a possibly dependent SNP through a 2×2 2-SNP haplotypes table. The approach assumes Hardy-Weinberg equilibrium for test SNPs. SSS-RAP is available as a Web-tool (http://apps.biocompute.org.uk/sssrap/sssrap.cgi). To develop and illustrate SSS-RAP we analyzed lipid and ECG traits data from the British Women's Heart and Health Study (BWHHS), evaluated a meta-analysis for ECG trait and presented several simulations. We compared results with existing approaches such as model selection methods and conditional analysis. Generally findings were consistent. SSS-RAP represents a tool for testing independence of SNP association signals using meta-analysis data, and is also a convenient approach based on biological principles for fine mapping in group level summary data. © 2012 Blackwell Publishing Ltd/University College London.

  8. Study of DDT and its derivatives DDD, DDE adsorption and degradation over Fe-SBA-15 at low temperature

    Institute of Scientific and Technical Information of China (English)

    Hailin Wang; Hua Tian; Zhengping Hao

    2012-01-01

    Mesoporous SBA-15 with different Fe2O3 loading were synthesized by an in-situ coating progress for removals of dichlorodiphenyltrichloroethane(DDT)and its derivatives,i.e.,1,1-dichloro-2,2-bis-(p-chlorophenyl)ethane(DDD)and 1,l-dichloro-2,2-bis-(4-chloro -phenyl)ethane(DDE).The results from XRD(X-ray diffractometer),TEM(transmission electron microscopy)indicated that the iron could be well dispersed on SBA-15 within 6 wt.% Fe2O3 loading.Nitrogen adsorption-desorption tests indicated that the synthesized materials were characterized by ordered meso-structure,high surface area and large pore volume.DDTs were removed from aqueous media in 12-hr treatment and high removal efficiency of DDTs was achieved at over 94%.DDTs could be completely degraded at 350℃ under the existence of SBA-15 with 4 wt.% Fe2O3 loading.The final degradation products of DDT were dichlorobenzophenone (DCB)and bis-(4-chloro-phenyl)methane(DDM),suggesting a complete dechlorination from trichloromethyl.

  9. Octopus: LLL's computing utility

    International Nuclear Information System (INIS)

    Anon.

    1978-01-01

    The Laboratory's Octopus network constitutes one of the greatest concentrations of computing power in the world. This power derives from the network's organization as well as from the size and capability of its computers, storage media, input/output devices, and communication channels. Being in a network enables these facilities to work together to form a unified computing utility that is accessible on demand directly from the users' offices. This computing utility has made a major contribution to the pace of research and development at the Laboratory; an adequate rate of progress in research could not be achieved without it. 4 figures

  10. Occurrences and fate of DDT principal isomers/metabolites, DDA, and o,p'-DDD enantiomers in fish, sediment and water at a DDT-impacted Superfund site.

    Science.gov (United States)

    Garrison, A W; Cyterski, M; Roberts, K D; Burdette, D; Williamson, J; Avants, J K

    2014-11-01

    In the 1950s and 60s, discharges from a DDT manufacturing plant contaminated a tributary system of the Tennessee River near Huntsville, Alabama, USA. Regulatory action resulted in declaring the area a Superfund site which required remediation and extensive monitoring. Monitoring data collected from 1988, after remediation, through 2011 showed annual decreases approximating first-order decay in concentrations of total DDT and its six principal congeners (p,p'-DDT, o,p'-DDT, p,p'-DDD, o,p'-DDD, p,p'-DDE and o,p'-DDE) in filets from three species of fish. As of 2013, these concentrations met the regulatory requirements of 5 mg/kg or less total DDT for each fish tested. The enantiomer fractions (EF) of chiral o,p'-DDD in smallmouth buffalo and channel catfish were always below 0.5, indicating preferential decay of the (+)-enantiomer of this congener; this EF did not change significantly over 15 years. The often-neglected DDT metabolite p,p'-DDA was found at a concentration of about 20 μg/l in the ecosystem water. Published by Elsevier Ltd.

  11. The Sensation Seeking Scale (SSS-V and Its Use in Latin American Adolescents: Alcohol Consumption Pattern as an External Criterion for Its Validation

    Directory of Open Access Journals (Sweden)

    Vanina Schmidt

    2017-11-01

    Full Text Available Sensation Seeking is a trait defined by the seeking of varied, novel, complex, and intense situations and experiences, and the willingness to take physical, social, and financial risks for the sake of such experience. The Sensation Seeking Scale (SSS-V is the most widely used measure to assess this construct. In previous studies a variety of psychometric limitations were found when using the SSS-V with Latin American population. The purpose of this study is to present additional psychometric properties for its use with Latin American adolescents. It was applied to a 506 adolescent sample (from 12 to 20 years. The result is a scale of 22 items that cover four factors. It seems that sensation seeking among Latin American adolescents can be described in terms of four factors, but with some slightly content differences from what is usually found in adult samples from other countries. Future lines of research are proposed.

  12. The Sensation Seeking Scale (SSS-V) and Its Use in Latin American Adolescents: Alcohol Consumption Pattern as an External Criterion for Its Validation.

    Science.gov (United States)

    Schmidt, Vanina; Molina, María Fernanda; Raimundi, María Julia

    2017-11-01

    Sensation Seeking is a trait defined by the seeking of varied, novel, complex, and intense situations and experiences, and the willingness to take physical, social, and financial risks for the sake of such experience. The Sensation Seeking Scale (SSS-V) is the most widely used measure to assess this construct. In previous studies a variety of psychometric limitations were found when using the SSS-V with Latin American population. The purpose of this study is to present additional psychometric properties for its use with Latin American adolescents. It was applied to a 506 adolescent sample (from 12 to 20 years). The result is a scale of 22 items that cover four factors. It seems that sensation seeking among Latin American adolescents can be described in terms of four factors, but with some slightly content differences from what is usually found in adult samples from other countries. Future lines of research are proposed.

  13. Integrated system for production of neutronics and photonics calculational constants. Volume XVI. Tabular and graphical presentation of 175 neutron group constants derived from the LLL evaluated neutron data library (ENDL)

    International Nuclear Information System (INIS)

    Plechaty, E.F.; Cullen, D.E.; Howerton, R.J.; Kimlinger, J.R.

    1975-01-01

    As of February 3, 1975, 175 neutron group constants had been derived from the Evaluated Nuclear Data Library (ENDL) at LLL. In this volume, tables and graphs of the constants are presented along with the conventions used in their preparation. (U.S.)

  14. Short Straight Sections in the LHC Matching Sections (MS SSS) An Extension of the Arc Cryostats to Fulfil Specific Machine Functionalities

    CERN Document Server

    Parma, V; Lutton, F

    2005-01-01

    The LHC insertions require 50 specific superconducting quadrupoles in the matching sections, operating either in 1.9 K superfluid helium or in boiling helium at 4.5 K. These magnets are assembled together with corrector magnets in cold masses, and are inserted in individual cryostats to form the MS Short Straight Sections (MS SSS). The variety of quadrupoles and corrector magnets leads to 10 families of cold masses, with lengths ranging from 5 to 12 m and weights ranging from 60 to 140 kN. The MS SSS need to fulfil specific requirements related to the collider topology, its cryogenic layout and the powering scheme. Most MS SSS are standalone cryogenic and super-conducting units, i.e. they are not in the continuous arc cryostat, and therefore need dedicated cryogenic and electrical feeding. Specially designed cryostat end-caps are required to close the vacuum vessels at each end, which include low heat in-leak Cold-to-Warm transitions (CWT) for the beam tubes and 6 kA local electrical feedthrough for powering...

  15. The LHC SSS cold mass inside the cryostat. The complexity of the bus-bars for the power supply of the magnets and cryogenic links can be seen. The two apertures in the centre will house the beam lines

    CERN Document Server

    2003-01-01

    The LHC SSS cold mass inside the cryostat. The complexity of the bus-bars for the power supply of the magnets and cryogenic links can be seen. The two apertures in the centre will house the beam lines

  16. Identification of Quantitative Trait Loci That Determine Plasma Total-Cholesterol and Triglyceride Concentrations in DDD/Sgn and C57BL/6J Inbred Mice

    Directory of Open Access Journals (Sweden)

    Jun-ichi Suto

    2017-01-01

    Full Text Available DDD/Sgn mice have significantly higher plasma lipid concentrations than C57BL/6J mice. In the present study, we performed quantitative trait loci (QTL mapping for plasma total-cholesterol (CHO and triglyceride (TG concentrations in reciprocal F2 male intercross populations between the two strains. By single-QTL scans, we identified four significant QTL on chromosomes (Chrs 1, 5, 17, and 19 for CHO and two significant QTL on Chrs 1 and 12 for TG. By including cross direction as an interactive covariate, we identified separate significant QTL on Chr 17 for CHO but none for TG. When the large phenotypic effect of QTL on Chr 1 was controlled by composite interval mapping, we identified three additional significant QTL on Chrs 3, 4, and 9 for CHO but none for TG. QTL on Chr 19 was a novel QTL for CHO and the allelic effect of this QTL significantly differed between males and females. Whole-exome sequence analysis in DDD/Sgn mice suggested that Apoa2 and Acads were the plausible candidate genes underlying CHO QTL on Chrs 1 and 5, respectively. Thus, we identified a multifactorial basis for plasma lipid concentrations in male mice. These findings will provide insight into the genetic mechanisms of plasma lipid metabolism.

  17. Translation and cultural adaptation of the Shame and Stigma Scale (SSS) into Portuguese (Brazil) to evaluate patients with head and neck cancer.

    Science.gov (United States)

    Pirola, William Eduardo; Paiva, Bianca Sakamoto Ribeiro; Barroso, Eliane Marçon; Kissane, David W; Serrano, Claudia Valéria Maseti Pimenta; Paiva, Carlos Eduardo

    Head and neck cancer is the sixth leading cause of death from cancer worldwide and its treatment may involve surgery, chemotherapy and/or radiation therapy. The surgical procedure may cause mutilating sequelae, that can alter patient self-image. Thus, head and neck cancer is often connected to the negative stigma with decreased quality of life. Few studies assess the social stigma and shame perceived by patients with head and neck cancer. To perform the translation and cultural adaptation of the Shame and Stigma Scale (SSS) into Portuguese (Brazil). Two independent translations (English into Portuguese) were carried out by two professionals fluent in the English language. After the synthesis of the translations, two independent back-translations (from Portuguese into English) were performed by two translators whose native language is English. All translations were critically assessed by a committee of experts consisting of five members. A sample of 15 patients answered the Brazilian Portuguese version of the SSS to carry out the pretest. At this step, the patients were able to suggest modifications and evaluate the understanding of the items. There was no need to change the scale after this step. Based on the previous steps, we obtained the Portuguese (Brazil) version of the SSS, which was called "Escala de Vergonha e Estigma". The Portuguese (Brazil) version of the SSP was shown to be adequate to be applied to the population with HNC and, therefore, the psychometric properties of the tool will be evaluated during following steps. Copyright © 2016 Associação Brasileira de Otorrinolaringologia e Cirurgia Cérvico-Facial. Published by Elsevier Editora Ltda. All rights reserved.

  18. Role of ptsP, orfT, and sss recombinase genes in root colonization by Pseudomonas fluorescens Q8r1-96.

    Science.gov (United States)

    Mavrodi, Olga V; Mavrodi, Dmitri V; Weller, David M; Thomashow, Linda S

    2006-11-01

    Pseudomonas fluorescens Q8r1-96 produces 2,4-diacetylphloroglucinol (2,4-DAPG), a polyketide antibiotic that suppresses a wide variety of soilborne fungal pathogens, including Gaeumannomyces graminis var. tritici, which causes take-all disease of wheat. Strain Q8r1-96 is representative of the D-genotype of 2,4-DAPG producers, which are exceptional because of their ability to aggressively colonize and maintain large populations on the roots of host plants, including wheat, pea, and sugar beet. In this study, three genes, an sss recombinase gene, ptsP, and orfT, which are important in the interaction of Pseudomonas spp. with various hosts, were investigated to determine their contributions to the unusual colonization properties of strain Q8r1-96. The sss recombinase and ptsP genes influence global processes, including phenotypic plasticity and organic nitrogen utilization, respectively. The orfT gene contributes to the pathogenicity of Pseudomonas aeruginosa in plants and animals and is conserved among saprophytic rhizosphere pseudomonads, but its function is unknown. Clones containing these genes were identified in a Q8r1-96 genomic library, sequenced, and used to construct gene replacement mutants of Q8r1-96. Mutants were characterized to determine their 2,4-DAPG production, motility, fluorescence, colony morphology, exoprotease and hydrogen cyanide (HCN) production, carbon and nitrogen utilization, and ability to colonize the rhizosphere of wheat grown in natural soil. The ptsP mutant was impaired in wheat root colonization, whereas mutants with mutations in the sss recombinase gene and orfT were not. However, all three mutants were less competitive than wild-type P. fluorescens Q8r1-96 in the wheat rhizosphere when they were introduced into the soil by paired inoculation with the parental strain.

  19. Integrated system for production of neutronics and photonics calculational constants. Volume 15, Part C. The LLL Evaluated Nuclear Data Library (ENDL): translation of ENDL neutron-induced interaction data into the ENDF/B format

    International Nuclear Information System (INIS)

    Howerton, R.J.

    1976-01-01

    The LLL evaluated nuclear data library (ENDL) has been translated into the evaluated neutron data file/version B (ENDF/B) format. This translation is for the convenience of those who wish to use ENDL data but who are more familiar with ENDF/B formats and procedures. Only that portion of ENDL dealing with neutron-induced interactions (including photon production from neutron-induced reactions) has been translated

  20. Study of energetic electrons in the outer radiation-belt regions using data obtained by the LLL spectrometer on OGO-5 in 1968

    International Nuclear Information System (INIS)

    West, H.I. Jr.; Buck, R.M.; Davidson, G.

    1979-01-01

    An account is given of measurements of electrons made by the LLL magnetic electron spectrometer (60 to 3000 keV in seven differential energy channels) on the Ogo-5 satellite in the earth's outer-belt regions during 1968 and early 1969. The data were analyzed specifically to determine pitch-angle diffusion lifetimes as a function of energy in the L-range 2 to 5. As a part of this effort, the general dynamics of these regions were studied in terms of the time-dependent energy spectra, and pitch-angle distributions for the seven energy groups were obtained as a function of L with representative values presented for L = 2.5 to 6. The pitch-angle-diffusion results were used to analyze the dynamics of the electrons injected following the intense storms on October 31 and November 1, 1968, in terms of radial diffusion; the derived diffusion coefficients provide a quite reasonable picture of electron transport in the radiation belts. Both the radial- and pitch-angle-diffusion results are compared with earlier results. 53 references

  1. Validation of the MOS Social Support Survey 6-item (MOS-SSS-6) measure with two large population-based samples of Australian women.

    Science.gov (United States)

    Holden, Libby; Lee, Christina; Hockey, Richard; Ware, Robert S; Dobson, Annette J

    2014-12-01

    This study aimed to validate a 6-item 1-factor global measure of social support developed from the Medical Outcomes Study Social Support Survey (MOS-SSS) for use in large epidemiological studies. Data were obtained from two large population-based samples of participants in the Australian Longitudinal Study on Women's Health. The two cohorts were aged 53-58 and 28-33 years at data collection (N = 10,616 and 8,977, respectively). Items selected for the 6-item 1-factor measure were derived from the factor structure obtained from unpublished work using an earlier wave of data from one of these cohorts. Descriptive statistics, including polychoric correlations, were used to describe the abbreviated scale. Cronbach's alpha was used to assess internal consistency and confirmatory factor analysis to assess scale validity. Concurrent validity was assessed using correlations between the new 6-item version and established 19-item version, and other concurrent variables. In both cohorts, the new 6-item 1-factor measure showed strong internal consistency and scale reliability. It had excellent goodness-of-fit indices, similar to those of the established 19-item measure. Both versions correlated similarly with concurrent measures. The 6-item 1-factor MOS-SSS measures global functional social support with fewer items than the established 19-item measure.

  2. Relationships between molecular structure and kinetic and thermodynamic controls in lipid systems. Part II: Phase behavior and transformation paths of SSS, PSS and PPS saturated triacylglycerols--effect of chain length mismatch.

    Science.gov (United States)

    Bouzidi, Laziz; Narine, Suresh S

    2012-01-01

    The kinetic phase behavior and phase transformation paths of purified tristearoylglycerol (SSS), 3-palmitoyl-1,2-distearoyl-sn-glycerol (PSS) and 1,2-dipalmitoyl-3-stearoyl-sn-glycerol (PPS) were investigated in terms of polymorphism, crystallization and melting. The details of the phase transformation paths were obtained using the heating cycles of two sets of experiments: (a) cooling rate was varied and heating rate fixed and (b) cooling rate was fixed and heating rate varied. Kinetic effects were manifest in all measured properties, underscoring the complexity of the phase transformation paths for each TAG, and the intricate thermodynamics-molecular relationships. For the first time, XRD data obtained for SSS, PSS and PPS TAGs, cooled at rates higher than 0.5°C/min, suggested the formation of a transient structure similar to the so-called α(2)-phase which has been observed in mixed saturated-unsaturated TAGs quenched from the melt. The more stable phases (β' in PSS and PPS, and β in SSS) were only observed for cooling rates lower than 1.0°C/min. The kinetic and thermodynamic differences observed in the crystallization, structure and melting of SSS, PSS and PPS are proposed to be mainly due to the disturbances introduced at the "terrace" level via methyl-end group interactions, i.e., the missing of two or four CH(2) groups compared to SSS. The symmetrical SSS with a relatively flat "terrace" crystallizes preferably in the most stable β-form. Two missing CH(2) groups at the sn-1 position (PSS) introduces enough structural disturbances to promote the relative prevalence and persistence of the β'-phase, and four missing CH(2) groups at the sn-1 and sn-2 positions (PPS) is relatively too large of a disturbance and therefore favors the α-form. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

  3. The analysis of the Tectonics - SSS - Seismicity System in the 3D-model of the Rasvumchorr Mine - Central Open Pit Natural and Technical System (Khibiny)

    Science.gov (United States)

    Zhirov, Dmitry; Klimov, Sergey; Zhirova, Anzhela; Panteleev, Alexey; Rybin, Vadim

    2017-04-01

    Main hazardous factors during the operation of deposits represent tectonics (structural dislocation), strain and stress state (SSS), and seismicity. The cause and effect relationships in the Fault Tectonics - SSS - Seismicity system were analyzed using a 3D geological and structural Rasvumchorr Mine - Central Open Pit model. This natural and technical system (NTS) has resulted from the development of the world-class apatite-nepheline deposits the Apatite Circus and Rasvumchorr Plateau. The 3D model integrates various spatial data on the earth's surface topography before and after mining, geometry of mines and dumps, SSS measurements and rock pressure, seismicity, fault tectonics and etc. The analysis of the 3D model has clearly demonstrated the localization of three main seismic emanation zones in the areas of maximum anthropogenic variation of the initial rock state, and namely: ore pass zone under the Southern edge of the Central open pit, collapse and joining zone of the Rasvumchorr Mine and NW edge of the open pit, and zone under the Apatite Circus plate - collapse console. And, on the contrary, in the area of a large dump under the underground mine, a perennial seismic minimum zone was identified. The relation of the seismicity and fault tectonics was revealed only in three local sectors near come certain echelon fissures of the Main Fault(MF). No confinement of increased seismicity areas to the MF and other numerous echelon fissures is observed. The same picture occurs towards manifestations of rock pressure. Only an insignificant part of echelon fissures (including low rank of hierarchy) controls hazardous manifestations of rock pressure (dumps, strong deformations of the mine contour, etc.). It is shown that the anthropogenic factor (explosive, geometry and arrangement of mined spaces and collapse console), as well as the time factor significantly change orientation and structure (contrast and heterogeneity) of the stress fields. Time series of natural

  4. An Evaluation of Integrated Curriculum as It Exists in Mathematics and Science SSS as Well as the Subsequent Supportive Presentation of Those Standards in Eighth Grade Mathematics and Science Textbooks

    Science.gov (United States)

    Gill, Clara Joanne Schneberger

    2010-01-01

    This study attempted to verify points of intersection (POIs) between mathematics and science in the eighth grade Sunshine State Standards (SSS), and to develop a valid and reliable instrument to evaluate these POIs as they were presented in the respective mathematics and science textbooks approved for use in Florida public schools. Shannon and…

  5. LLL mirror fusion program: summary

    International Nuclear Information System (INIS)

    Fowler, T.K.

    1977-01-01

    During 1976, new Mirror Program plans have been laid out to take into account the significant advances during the last 18 months. The program is now focused on two new mirror concepts, field reversal and the tandem mirror, that can obtain high Q, defined as the ratio of fusion power output to the neutral-beam power injected to sustain the reaction. Theoretically, both concepts can attain Q = 5 or more, as compared to Q = 1 in previous mirror designs. Experimental planning for the next 5 years is complete in broad outline, and we are turning attention to what additional steps are necessary to reach our long-range goal of an experimental mirror reactor operating by 1990. Highlights of the events that have led to the above circumstance are listed, and experimental program plans are outlined

  6. Growth of gas hydrate mounds and gas chimneys of the eastern margin of Japan Sea as revealed by MBES, SSS and SBP of AUV

    Science.gov (United States)

    Matsumoto, R.; Satoh, M.; Hiromatsu, M.; Tomaru, H.; Machiyama, H.

    2010-12-01

    A series of PC, ROV and SCS surveys to study the origin and evolution of gas hydrate systems along the eastern margin of Japan Sea have identified a number of shallow GH accumulations on the mounds, 300m to 500m in diameter and 30m to 40m high, on the Umitaka spur and Joetsu knoll in Joetsu basin with the WD of 880m to 1200m (Matsumoto et al., 2005; 2009). All of the hydrate mounds develop on gas chimneys as recognized by seismic profiles, and some are associated with gigantic methane plumes, 600m to 700m high. Multi Beam Echo Sounder (MBES), Side Scan Sonar (SSS) and Sub-Bottom Profiler (SBP) of AUV Urashima have revealed ultra-high resolution topographic features and subsurface structures of the mounds and adjacent areas during the JAMSTEC YK10-08 cruise, July 2010. AUV Urashima ran over the spur and knoll at 50m to 80m above seafloor at a cruising speed of 2.4 knots. MBES and SSS mosaics demonstrate two types of mounds. One is a low swell with smooth surface and weak reflectance, while the other is characterized by rough and uneven topographic features with strong SSS images due to incrustation by methane-induced carbonate concretions and gas hydrates. SBP provides clear stratigraphic and structural relations down to 50mbsf to 80mbsf and recognizes three stratigraphic units as I: upper massive unit (5-10m thick), II: middle evenly bedded unit (15-25m thick) and III: lower slightly bedded unit (> 15-25m thick). Gas chimneys grow up toward the seafloor through Units III, II, and I. When the ceiling of gas chimney stays within Unit III or II, the mound above the chimney is either low swell or nearly flat, while the swell grows up higher when the ceiling reaches to Unit I or the seafloor. Eventually, the ceiling breaks through the seafloor and protrudes to form GH mound up to 40m to 50m high, and then start to decay probably due to mechanical collapse and chemical dissolution of gas hydrates. The ceiling of gas chimneys is often represented by high amplitude, uneven

  7. Prevalence of E/A wave fusion and A wave truncation in DDD pacemaker patients with complete AV block under nominal AV intervals.

    Directory of Open Access Journals (Sweden)

    Wolfram C Poller

    Full Text Available Optimization of the AV-interval (AVI in DDD pacemakers improves cardiac hemodynamics and reduces pacemaker syndromes. Manual optimization is typically not performed in clinical routine. In the present study we analyze the prevalence of E/A wave fusion and A wave truncation under resting conditions in 160 patients with complete AV block (AVB under the pre-programmed AVI. We manually optimized sub-optimal AVI.We analyzed 160 pacemaker patients with complete AVB, both in sinus rhythm (AV-sense; n = 129 and under atrial pacing (AV-pace; n = 31. Using Doppler analyses of the transmitral inflow we classified the nominal AVI as: a normal, b too long (E/A wave fusion or c too short (A wave truncation. In patients with a sub-optimal AVI, we performed manual optimization according to the recommendations of the American Society of Echocardiography.All AVB patients with atrial pacing exhibited a normal transmitral inflow under the nominal AV-pace intervals (100%. In contrast, 25 AVB patients in sinus rhythm showed E/A wave fusion under the pre-programmed AV-sense intervals (19.4%; 95% confidence interval (CI: 12.6-26.2%. A wave truncations were not observed in any patient. All patients with a complete E/A wave fusion achieved a normal transmitral inflow after AV-sense interval reduction (mean optimized AVI: 79.4 ± 13.6 ms.Given the rate of 19.4% (CI 12.6-26.2% of patients with a too long nominal AV-sense interval, automatic algorithms may prove useful in improving cardiac hemodynamics, especially in the subgroup of atrially triggered pacemaker patients with AV node diseases.

  8. Relationships between molecular structure and kinetic and thermodynamic controls in lipid systems. Part III. Crystallization and phase behavior of 1-palmitoyl-2,3-stearoyl-sn-glycerol (PSS) and tristearoylglycerol (SSS) binary system.

    Science.gov (United States)

    Bouzidi, Laziz; Narine, Suresh S

    2012-01-01

    The phase behavior of 1-palmitoyl-2,3-distearoyl-sn-glycerol (PSS)/tristearoylglycerol (SSS) binary system was investigated in terms of polymorphism, crystallization and melting behavior, microstructure and solid fat content (SFC) using widely different constant cooling rates. Kinetic phase diagrams were experimentally determined from the DSC heating thermograms and analyzed using a thermodynamic model to account for non-ideality of mixing. The kinetic phase diagram presented a typical eutectic behavior with a eutectic point at the 0.5(PSS) mixture with a probable precipitation line from 0.5(PSS) to 1.0(PSS), regardless of the rate at which the sample was cooled. The eutectic temperature decreased only slightly with increasing cooling rate. PSS has a strong effect on the physical properties of the PSS-SSS mixtures. In fact, the overall phase behavior of the PSS-SSS binary system was determined, for a very large part, by the asymmetrical TAG. Moreover, PSS is a key driver of the high stability observed in crystal growth, polymorphism and phase development. Levels as low as 10% PSS, when cooled slowly, and 30% when cooled rapidly, were found to be sufficient to suppress the effect of thermal processing. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

  9. Determinación de la condición saturada y seca superficialmente (S.S.S. de agregados orgánicos para hormigón ligero

    Directory of Open Access Journals (Sweden)

    Jaime Salazar Contreras

    1988-01-01

    Full Text Available Como parte del provecto de grado titulado "DOSIFICACION DE HORMIGONES LIGEROS UTILIZANDO COMO ARIDO LA CASCARILLA DE CAFE II PARTE", se desarrolló un procedimiento para determinar la condición saturada y seca superficialmente (S.S.S. de la cascarilla de café debido a que no existe ninguna literatura técnica que establezca los pasos a seguir para hallar la condición s.s.s de agregados ligeros, como si la hay para los agregados tradicionales del hormigón. Puesto que los agregados orgánicos presentan una elevada absorción, se hace necesario determinar un procedimiento de ensaya que permita obtener la condición s.s.s., del agregado de una manera precisa y más confiable que la obtenida mediante la inspección visual, procedimiento éste utilizado hasta ahora en el diseño de mezclas para los agregados ligeros de naturaleza orgánica. El ensayo consiste básicamente en someter a un proceso de secado una muestra de cascarilla saturada hasta que desaparece el agua libre contenida en ella, hecho que se manifiesta por la variación de la temperatura del bulbo húmedo medida por un termómetro colocado en el centro de la muestra; la humedad determinada en este momento corresponde a la condición s.s.s. de la cascarilla, valor éste que se utilizará posteriormente para determinar las propiedades físicas requeridas para el diseño y en especial para establecer con gran aproximación la relación agua-cemento (A/c parámetro fundamental que rige la resistencia del hormigón. Estos ensayos se realizaron en el laboratorio de Ingeniería Agrícola de la Universidad Nacional de Bogotá

  10. Maine's MOLLOCKET and METALLAK: Adherents of God's Secret Spirit Signal, SSS, Applied Physicists of the EMF/Manitou, Doctors, Reincarnationists, "Potlachers," Confidants of the Powerful, and, they Did Own the Land.

    Science.gov (United States)

    Andrade, Jennifer; Ferreira, Nadja; Mc Leod, Roger D.

    2007-04-01

    Northeastern ``Indians,'' reputed to ``make the weather,'' actually, from youth, observed earth phenomena, including SSS. These are subtle and barely detectable visual artifacts of the electromagnetic field, special information that led/leads to their spiritual belief in reincarnation, which came from the EMF/SSS communication, backward and forward, (up to) seven generations. It commands communal, democratic, ``potlatch'' redistribution of accumulated wealth, Mother Earth's bounty, from their land, gifted by ``The Great Spirit,'' Manitou, Peru's Ñari Huallac, ``Serpent God.'' Genetics established the non-Asian origins of 1/3 of North American Indians. Linguistics indicates a major impact westwards to us. MILLInocket is ``Adherent of God (Spirit-signal) monk Cathar.'' Katahdin, with a shared root, has Manitou. After 1820, Gov. E. Lincoln and at least one US senator went westward to MetALLAk; his biography is by a Rumford, ME Knight of Pythias. Why? MOLLOCKET frequently asserted ownership of western Maine. ``Great Council Fires,'' religious ``Law Things,'' were at Merrymeeting Bay in pre-Colonial times. ``Medicine men/priests'' often participated as their applied scientist-statesmen. To cite this abstract, use the following reference: http://meetings.aps.org/link/BAPS.2007.NES07.C2.1

  11. LLL transient-electromagnetics-measurement facility

    International Nuclear Information System (INIS)

    Deadrick, F.J.; Miller, E.K.; Hudson, H.G.

    1975-01-01

    The operation and hardware of the Lawrence Livermore Laboratory's transient-electromagnetics (EM)-measurement facility are described. The transient-EM range is useful for determining the time-domain transient responses of structures to incident EM pulses. To illustrate the accuracy and utility of the EM-measurement facility, actual experimental measurements are compared to numerically computed values

  12. The LLL compact 10-ps streak camera

    International Nuclear Information System (INIS)

    Thomas, S.W.; Houghton, J.W.; Tripp, G.R.; Coleman, L.W.

    1975-01-01

    The 10-ps streak camera has been redesigned to simplify its operation, reduce manufacturing costs, and improve its appearance. The electronics have been simplified, a film indexer added, and a contacted slit has been evaluated. Data support a 10-ps resolution. (author)

  13. Rapport final de la Collaboration CERN-CNRS pour la construction du LHC Accord Technique d'Exécution No 2 Cryostats et assemblage des sections droites courtes (SSS) du LHC

    CERN Document Server

    Bergot, JB; Poncet, A; Rohmig, P; Roy, E; Vincent, D

    2006-01-01

    Depuis 1995 et suite à la signature du protocole de Collaboration, le CERN, le CEA et le CNRS ont étroitement collaboré dans le cadre de la contribution exceptionnelle de la France à la construction du LHC. Pour le CNRS, l'Institut de Physique Nucléaire d'Orsay a pris en charge deux Accords Techniques d'Exécution. Le premier concerne la conception et l'assemblage des Sections Droites Courtes de la machine, et le deuxième, l'étalonnage des thermomètres cryogéniques du LHC. Dans le cadre de l'Accord Technique d'Exécution N°2, le Bureau d'Etudes de la Division Accélérateur de l'IPNO et le groupe AT-CRI du CERN ont travaillé de concert pour mener à bien la conception des SSS (Short Straight Section) et de tous les équipements nécessaires à l'assemblage. Ce rapport a donc pour objectif de dresser, en termes d'historique, d'organisation, de résultats quantitatifs et qualitatifs et de moyens mis en ?uvre, un tableau aussi complet que possible du déroulement de cette Collaboration entre le CERN e...

  14. SSS-A spacecraft and experiment description.

    Science.gov (United States)

    Longanecker, G. W.; Hoffman, R. A.

    1973-01-01

    The scientific objectives of the Explorer-45 mission are discussed. The primary objective is the study of the ring current responsible for the main phase of magnetic storms. Closely associated with this objective is the determination of the relationship between magnetic storms, substorms, and the acceleration of charged particles in the magnetosphere. Further objectives are the measurement of a wide range of proton, electron and alpha-particle energies, and studies of wave-particle interactions responsible for particle transport and loss in the inner magnetosphere. The orbital parameters, the spacecraft itself, and some of its unique features, such as the data handling system, which is programmable from the ground, are described.

  15. Estimulação DDD com eletrodo único usando estimulação atrial bifásica simultânea: primeiros resultados clínicos

    Directory of Open Access Journals (Sweden)

    Fernando A LUCCHESE

    1997-01-01

    Full Text Available A estimulação de dupla câmara (DDD com eletrodo único usando eletrodo atrial flutuante está limitada em função dos altos limiares encontrados para captura atrial. Avaliamos um sistema novo de cabo eletrodo para estimulação atrial que utiliza dois anéis atriais com pulsos de onda quadrada simultâneos unipolares lançados com polaridade oposta. O primeiro pulso é aplicado ao pólo distal do eletrodo e é positivo, o segundo pulso é aplicado ao pólo proximal do eletrodo e é negativo, ambos em relação à carcaça do gerador. O atraso entre os dois pulsos é programável entre 0,0 ms e 1,0 ms. A distância entre os anéis a nível atrial é de 10 mm e a distância entre o pólo distal atrial e o eletrodo ventricular unipolar pode ser selecionado entre 11, 13 e 15 cm. O posicionamento dos anéis a nível atrial é selecionado de acordo com a medida do limiar de estimulação do pulso bifásico simultâneo, incluindo manobras respiratórias para confirmar a captura/sense contínuos. O gerador de pulso tem uma única conexão para o eletrodo e a capacidade de aplicar os pulsos programáveis de onda quadrada com polaridades opostas, com atrasos programáveis de 0,0 a 1,0 ms. O gerador pode ser programado para estimulação VDD com eletrodo único. Este sistema foi implantado em 4 pacientes com bloqueio AV total e função sinusal normal. Os limiares de estimulação atrial e diafragmático foram medidos com várias configurações do pulso, larguras e atrasos, intra e pós-operatórios. A porção média do átrio direito foi selecionada como a melhor posição para os anéis atriais com captura contínua durante inspiração profunda. As medidas intra-operatórias e pós-operatórias (48 horas foram: Limiar Intra-operatório Pós-operatório atrial unipolar 3,2 + 0,47 V não realizada atrial (bifásico simultâneo 1,6 + 0,37 V 3,37 + 0,84 V diafragmático acima de 7 V 5,21 + 0,3 V sense de onda P 2,35 + 1,3 mV 1,27 + 0,8 mV Os pacientes

  16. Inleiding bij Themasessie LLL over EVC, HG 18 april 2011

    NARCIS (Netherlands)

    dr. H.A.M. van Lieshout

    2011-01-01

    Publiek onderwijs heeft twee kerntaken: 1) Erkenning van competenties (diplomering) 2) Verzorgen van onderwijs. In de meeste gevallen gaat dat gelijk op: een gediplomeerd schoolverlater van havo of vwo meldt schrijft zich in als student en behaalt na (ruim) vier jaar zijn diploma. Er zijn echter

  17. LLL development of a combined etch track: albedo dosimeter

    International Nuclear Information System (INIS)

    Griffith, R.V.; Fisher, J.C.; Harder, C.A.

    1977-01-01

    The addition of polycarbonate sheet to albedo detectors for electrochemical etching provides a simple, inexpensive way to reduce the spectral sensitivity of the personnel dosimeter without losing the albedo features of sensitivity and ease of automation. The ECEP technique also provides the dosimetrist with the potential for identifying conditions of body orientation that might otherwise lead to significant error in dosimeter evaluation

  18. Investigating the role of enterprises in LLL policies

    DEFF Research Database (Denmark)

    Larson, Anne; Cort, Pia

    The paper present the preliminary results of a study of policy trails of lifelong learning policy in two case enterprises both situated in Southern Germany. The paper is provisional, and reflects work-in-progress at an early stage. Theoretically, the study is based on theories on policy studies...... inspired by Holford et al. (2013) and Ball (2007, 2008, 2011, 2012) combined with Porter’s diamond (1990). The methodology at this stage of the study consists of internet searches focussing on human resource development policy in the two case enterprises as well as their environment in form of state policy......, educational institutions and networking with other companies. The aim of the study is to trail education policy influencing and being influenced by enterprises HRD strategies....

  19. Substitution and protonation reactions of nitrilotriaceta tochromium(lll) ions

    CSIR Research Space (South Africa)

    Visser, HG

    1994-04-01

    Full Text Available The reaction of NH4[Cr(NTA)(H2O)2] (NTA = nitrilotriacetic acid) with H+ has been studied at different temperatures and a rate constant of 1.27(3) x 10(-2) S-1 was obtained at 25.1-degrees-C. It is proposed that the reaction involves the formation...

  20. ENDL-1978. LLL evaluated Nuclear Data Library 1978

    International Nuclear Information System (INIS)

    1979-07-01

    The contents and documentation of the 1978 version of the Evaluated Nuclear Data Library of the Lawrence Livermore Laboratory, USA are summarized. The Library contains numerical neutron reaction data for 88 isotopes or elements

  1. Patient autonomy and informed consent in critically lll

    Directory of Open Access Journals (Sweden)

    Todorović Zoran M.

    2017-01-01

    Full Text Available Patient autonomy has been a cornerstone of contemporary clinical ethics since the Nuremberg trial, especially in American school of bioethics. Topic: Patient autonomy has been defined in the Nuremberg Code, and re-defined in the Declaration of Helsinki, Belmont Report and Barcelona Declaration. Founders and followers of the rights-oriented bioethics (for example, Hellegers, Beauchamp and Childers have established and promoted the patient autonomy as the main principle of bio(medical ethics since 1970s. However, there is a lot of controversy surrounding such a principle, especially in vulnerable patients. We aimed at evaluating the real meaning and value of patient autonomy in critical care settings regarding the communication between health workers and their patients and families. Conclusion: Protection of patients autonomy in critically ill is a complex issue. Careful benefit-risk assessment is needed in order to find the most appropriate way of obtaining the informed consent, proxy consent or to omit or delay it.

  2. Higher Education as Gateway of LLL for ALL

    OpenAIRE

    Alfredo Soeiro

    2013-01-01

    Universities have been providing Continuing Education and Professional Development for adults since XIX century. Most universities have been developing activities beyond educating young students and researching towards providing training and education for adults. Universities have been researching and cooperating to develop structures, procedures, teaching methods, fora and know-how to provide the framework for adult education and training.

  3. LLL magnetic fusion research: the first 25 years

    International Nuclear Information System (INIS)

    Post, R.F.

    1978-01-01

    From its inception, the Laboratory has supported research directed at tapping controlled fusion. Our magnetic fusion energy program--now one of the major elements of the national fusion energy research effort--dates back to the Laboratory's founding in 1952. This article reviews the program's beginnings, progress, and present status in terms of its ultimate goal: to demonstrate a practical and economical means of generating power from controlled fusion reactions

  4. Seismic safety of the LLL plutonium facility (Building 332)

    International Nuclear Information System (INIS)

    Torkarz, F.J.; Shaw, G.

    1980-01-01

    This report states the basis for the Lawrence Livermore Laboratory's assurance to the public that the plutonium operations at the Laboratory pose essentially no risk to anyone's health or safety, either under normal circumstances or in the event of an earthquake or a fire. The report is intended for a general audience, and so for the most part it is not highly technical. It summarizes the steps taken to ensure the seismic safety of the plutonium facility (Bldg. 332). It describes plutonium and its potential hazard and how the facility copes with that hazard. It recounts the geologic investigations and interpretations that led to the design-basis earthquake (DBE) for the Livermore site, and presents a summary analysis of the facility structure in relation to the DBE. An appendix presents a quantitative calculation of the health risk to the public associated with the worst-case hypothetical fire. The document supports the conclusions that the facility will continue to function safely after the maximum earthquake ground motion to which it may be subjected and that there is no evidence of a potential for surface offset under it

  5. DDT, DDD, AND DDE DECHLORINATION BY ZERO-VALENT IRON

    Science.gov (United States)

    Traditionally, destruction of DDT [1,1,1-trichIoro-2,2-bis(p-chlorophenyl)ethane] for environmental remediation required high-energy processes such as incineration. Here, the capability of powdered zero-valent iron to dechlorinate DDT and related compounds at room tempera...

  6. SSS-A attitude control prelaunch analysis and operations plan

    Science.gov (United States)

    Werking, R. D.; Beck, J.; Gardner, D.; Moyer, P.; Plett, M.

    1971-01-01

    A description of the attitude control support being supplied by the Mission and Data Operations Directorate is presented. Descriptions of the computer programs being used to support the mission for attitude determination, prediction, control, and definitive attitude processing are included. In addition, descriptions of the operating procedures which will be used to accomplish mission objectives are provided.

  7. Computer control and monitoring of neutral beam injectors on the 2XIIB CTR experiment at LLL

    International Nuclear Information System (INIS)

    Pollock, G.G.

    1975-01-01

    The original manual control system for the 12 neutral beam injectors on the 2XIIB Machine is being integrated with a computer control system. This, in turn, is a part of a multiple computer network comprised of the three computers which are involved in the operation and instrumentation of the 2XIIB experiment. The computer control system simplifies neutral beam operation and centralizes it to a single operating position. A special purpose console utilizes computer generated graphics and interactive function entry buttons to optimize the human/machine interface. Through the facilities of the computer network, a high level control function will be implemented for the use of the experimenter in a remotely located experiment diagnositcs area. In addition to controlling the injectors in normal operation, the computer system provides automatic conditioning of the injectors, bringing rebuilt units back to full energy output with minimum loss of useful life. The computer system also provides detail archive data recording

  8. Dynamic range studies of the RCA streak tube in the LLL streak camera

    International Nuclear Information System (INIS)

    Thomas, S.W.; Phillips, G.E.

    1979-01-01

    As indicated by tests on several cameras, the dynamic range of the Lawrence Livermore Laboratory streak-camera system appears to be about two orders of magnitude greater than those reported for other systems for 10- to 200-ps pulses. The lack of a fine mesh grid in the RCA streak tube used in these cameras probably contributes to a lower system dynamic noise and therefore raises the dynamic range. A developmental tube with a mesh grid was tested and supports this conjecture. Order-of-magnitude variations in input slit width do not affect the spot size on the phosphor or the dynamic range of the RCA tube. (author)

  9. Continuing Vocational Training (CVT) and Life Long Learning (LLL) - Policy Recommendations and Reflections

    DEFF Research Database (Denmark)

    Hansen, Leif Emil

    En sammenfattende rapport over et EU-finansieret projekt med kritiske refleksioner og anbefalinger vedrørende en øget deltagelse i livslang læring og erhvervsrettet efter- og videreuddannelse i de 4 partnerlande Bulgarien, Danmark, Grækenland og Rumænien...

  10. Quench Detection and Magnet Protection Study for MFTF. LLL final review

    International Nuclear Information System (INIS)

    1979-06-01

    The results of a Quench Detection and Magnet Protection Study for MFTF are summarized. The study was directed toward establishing requirements and guidelines for the electronic package used to protect the MFTF superconducting magnets. Two quench detection schemes were analyzed in detail, both of which require a programmable quench detector. Hardware and software recommendations for the quench detector were presented as well as criteria for dumping the magnet energy in the event of a quench. Overall magnet protection requirements were outlined in a detailed Failure Mode Effects and Criticality analysis, (FMECA). Hardware and software packages compatible with the FMECA were recommended, with the hardware consisting of flexible, dedicated intelligent modules specifically designed for magnet protection

  11. Notes on the LLL/NRC waste disposal study. II, probabilistic arithmetic

    International Nuclear Information System (INIS)

    1978-05-01

    UCRL-13998-1 outlined a formalism for risk analysis of nuclear waste disposal systems. This note looks more deeply at the probabilistic calculations necessary for its implementation. Both the underlying philosophy and the computation technique of these calculations are discussed

  12. Use of nuclear explosions to create gas condensate storage in the USSR. LLL Treaty Verification Program

    International Nuclear Information System (INIS)

    Borg, I.Y.

    1982-01-01

    The Soviet Union has described industrial use of nuclear explosions to produce underground hydrocarbon storage. To examples are in the giant Orenburg gas condensate field. There is good reason to believe that three additional cavities were created in bedded salt in the yet to be fully developed giant Astrakhan gas condensate field in the region of the lower Volga. Although contrary to usual western practice, the cavities are believed to be used to store H 2 S-rich, unstable gas condensate prior to processing in the main gas plants located tens of kilometers from the producing fields. Detonations at Orenburg and Astrakhan preceded plant construction. The use of nuclear explosions at several sites to create underground storage of highly corrosive liquid hydrocarbons suggests that the Soviets consider this time and cost effective. The possible benefits from such a plan include degasification and stabilization of the condensate before final processing, providing storage of condensate during periods of abnormally high natural gas production or during periods when condensate but not gas processing facilities are undergoing maintenance. Judging from information provided by Soviet specialists, the individual cavities have a maximum capacity on the order of 50,000 m 3

  13. Fiber Optic Telemetry System for LLL High-Voltage Test Stand

    International Nuclear Information System (INIS)

    Richter, J.P.

    1977-01-01

    This paper describes the Fiber Optic Telemetry System designed to operate in the hostile particle and electromagnetic radiation environment of the High Voltage Test Stand. It discusses system criteria, components, packaging, and performance. In all tests to date, the system exceeds its design goals with very comfortable margins. It is well advanced into the fabrication stages with all crucial components tested and only straightforward TTL (Transistor Transistor Logic) circuitry to be completed

  14. Synthesis and Identification of the Organic Reagent Ereochrom Black T and its Complex with Cobalt (lll

    Directory of Open Access Journals (Sweden)

    Jassem M. Abd Al Hassein

    2017-02-01

    Full Text Available The ligand 1–(4–Hydroxy –3–Naphthalene Azo–4–Nitro–8–Hydroxy–6–Sulfonic Naphthalene Acid Sodium Salt was synthesized (by the reaction between 3–amino–4– hydroxyl naphthalene and 3 – nitro – 7 – hydroxyl –5– sulfonic naphthalene acid sodium salt and characterized by FTIR technique, its ionization constants (PKs were determined. Synthesis and spectroscopic investigations of its complex with Co (III in aqueous solution revealed the sole formation of (1: 2 (metal: ligand complex. Specral and magnatic studies of the isolated complex indicates octahedral coordination via the N atoms of the azo groups and the O atoms of the hydroxyl groups. The molar conductivity of the complex was determined in an alcoholic solutions indicates that the complex has high molar conductivity. The magnetic properties were determined by using Gouy balance which indicates diamagnetic complex.

  15. The Early Years of Molecular Dynamics and Computers at UCRL, LRL, LLL, and LLNL

    Science.gov (United States)

    Mansigh Karlsen, Mary Ann

    I'm the young woman in the picture shown in Fig. 12.1 that appeared with the invitation to the Symposium to celebrate Berni Alder's ninetieth birthday. I worked with Berni for over 25 years on the computer programs that provided the data he needed to write the fifteen papers published in scientific journals on Studies in Molecular Dynamics. My name appears at the end of each one thanking me for computer support. It has been interesting to look on the Internet to find my name in the middle of many foreign languages, including Japanese characters and Russian Cyrillic script. It shows how Berni's work has been of interest to many scientists all over the world from the earliest years. Figure 12.1 was also included with articles written when he received the National Medal of Science from President Obama in 2009…

  16. Fission cross section measurements at the LLL 100-MeV linac

    International Nuclear Information System (INIS)

    Browne, J.C.

    1975-01-01

    The fission cross section for 235 U was measured from thermal energy to 20 MeV in several steps. First, the cross section was measured from 8 MeV to 20 MeV relative to the n,p scattering cross section and then from thermal to one MeV relative to 6 Li(n,α). In addition, a measurement of the ratio of the fission cross sections of 235 U and 238 U relative to 235 U has been completed in the range 1 keV to 30 MeV for 233 U and 100 keV to 30 MeV for 238 U. Statistical uncertainties are less than 4 percent. (U.S.)

  17. Technology of mirror machines: LLL facilities for magnetic mirror fusion experiments

    International Nuclear Information System (INIS)

    Batzer, T.H.

    1977-01-01

    Significant progress in plasma confinement and temperature has been achieved in the 2XIIB facility at Livermore. These encouraging results, and their theoretical corroboration, have provided a firm basis for the design of a new generation of magnetic mirror experiments, adding support to the mirror concept of a fusion reactor. Two new mirror experiments have been proposed to succeed the currently operating 2XIIB facility. The first of these called TMX (Tandem Mirror Experiment) has been approved and is currently under construction. TMX is designed to utilize the intrinsic positive plasma potential of two strong, and relatively small, minimum B mirror cells to enhance the confinement of a much larger, magnetically weaker, centrally-located mirror cell. The second facility, MFTF (Mirror Fusion Test Facility), is currently in preliminary design with line item approval anticipated for FY 78. MFTF is designed primarily to exploit the experimental and theoretical results derived from 2XIIB. Beyond that, MFTF will develop the technology for the transition from the present small mirror experiments to large steady-state devices such as the mirror FERF/FTR. The sheer magnitude of the plasma volume, magnetic field, neutral beam power, and vacuum pumping capacity, particularly in the case of MFTF, has placed new and exciting demands on engineering technology. An engineering overview of MFTF, TMX, and associated MFE activities at Livermore will be presented

  18. Tandem mirror hybrid reactor study (LLL Purchase Order 6887809 dated August 31, 1979)

    International Nuclear Information System (INIS)

    1980-02-01

    The results, bases, qualifications, and exclusions of the preconceptual cost estimate are presented below. This estimate is an order-of-magnitude assessment of the direct level POP Costs. The direct level cost consists of: (1) total cost of all materials forming the permanent part of the completed plant, and (2) total cost of all labor engaged in installing and erecting all materials forming the permanent part of the completed plant. A cost summary and a supporting breakdown of this estimate are shown

  19. Task 5c: measurement and instrumentation under subsystem design of the LLL safeguard material control program

    International Nuclear Information System (INIS)

    1976-01-01

    A product survey was conducted of all security products currently available on the market. Documentation is presented of the survey and a printout of the data is included. A general description is given of new but recommended instrumentation and security devices for application to fuel reprocessing plants. Security systems and hardware recommended for development, assembly, and testing are discussed briefly

  20. Monticello Mill Tailings Site, Operable Unit lll, Annual Groundwater Report, May 2015 Through April 2016

    Energy Technology Data Exchange (ETDEWEB)

    Nguyen, Jason [USDOE Office of Legacy Management (LM), Washington, DC (United States); Smith, Fred [Navarro Research and Engineering, Oak Ridge, TN (United States)

    2016-10-01

    This report provides the annual analysis of water quality restoration progress, cumulative through April 2016, for Operable Unit (OU) III, surface water and groundwater, of the U.S. Department of Energy (DOE) Office of Legacy Management (LM) Monticello Mill Tailings Site (MMTS). The MMTS is a Comprehensive Environmental Response, Compensation, and Liability Act National Priorities List site located in and near the city of Monticello, San Juan County, Utah. MMTS comprises the 110-acre site of a former uranium- and vanadium-ore-processing mill (mill site) and 1700 acres of surrounding private and municipal property. Milling operations generated 2.5 million cubic yards of waste (tailings) from 1942 to 1960. The tailings were impounded at four locations on the mill site. Inorganic constituents in the tailings drained from the impoundments to contaminate local surface water (Montezuma Creek) and groundwater in the underlying alluvial aquifer. Mill tailings dispersed by wind and water also contaminated properties surrounding and downstream of the mill site. Remedial actions to remove and isolate radiologically contaminated soil, sediment, and debris from the former mill site, Operable Unit I (OU I), and surrounding properties (OU II) were completed in 1999 with the encapsulation of the wastes in an engineered repository located on DOE property 1 mile south of the former mill site. This effectively removed the primary source of groundwater contamination; however, contamination of groundwater and surface water remains within OU III at levels that exceed water quality protection standards. Uranium is the primary contaminant of concern (COC). LM implemented monitored natural attenuation with institutional controls as the OU III remedy in 2004. Because groundwater restoration proceeded more slowly than expected and did not meet performance criteria established in the OU III Record of Decision (June 2004), LM implemented a contingency action in 2009 by an Explanation of Significant Difference to include a pump-and­ treat system using a single extraction well and treatment by zero-valent iron (ex situ treatment system). The contingency action was optimized in 2015 with the installation of8 extraction wells and 16 monitoring wells in a focused area of the aquifer, the area of attainment (AOA). Contaminated water is treated by solar evaporation at an existing facility at the LM repository.

  1. LLL2: an international global level questionnaire on toothbrushing and use of fluoride toothpaste.

    Science.gov (United States)

    Llodra, Juan Carlos; Phantumvanit, Prathip; Bourgeois, Denis M; Horn, Virginie

    2014-10-01

    To determine the evolution of toothbrushing frequency and use of fluoridetoothpaste in the FDI-Unilever partnership Live.Learn.Laugh. phase 2 programme using a self-reported questionnaire. The study was conducted in 23 countries. The key focus of this partnership was to educate people about the benefits of twice-daily brushing with fluoride toothpaste and to support people in adopting this important oral health behaviour. The partnership offers a choice of four project options to the local partnership team of the National Dental Association and local Unilever-operating companies. A self-report questionnaire was used in all participating subjects in local projects to evaluate the brushing frequency, the brushing timing and the use of fluoride toothpaste. After implementation of the project interventions, a clear improvement in the reported frequency of brushing twice a day, regardless of the type of project, was observed. Subjects also increased day and night brushing and the use of fluoride toothpaste. The strategy of using mothers to increase healthy behaviours in oral health achieved the greatest increase in twice-daily toothbrushing, followed by the intervention in schools. © 2014 FDI World Dental Federation.

  2. Comparison of the LLL HANDYL76 code with three Stanford Linac experiments

    International Nuclear Information System (INIS)

    Carson, J.K.

    1976-06-01

    HANDYL76, the Lawrence Livermore Laboratory version of SANDYL, the multidimensional Monte Carlo electron/photon computer code, was compared with experimental work performed on the Stanford Mark III Linear Accelerator. The three pieces of experimental work involved bombardment of Al, C, Cu, Sn, and Pb by using 185-MeV electrons, electron-induced cascade showers in Cu, Sn, and Pb at 900 MeV, and cascades in H 2 O and Al at 1 GeV. Agreement between experiment and code calculations were good for the 900-MeV work, but only the aluminum at 185 MeV was within associated uncertainties for the major part of the target. Although good agreement was attained at 1 GeV in aluminum, the H 2 O at 1 GeV produced moderate variations. Possible reasons for the differences obtained are discussed. 89 figures, 16 tables

  3. Fiscal year 1976 DT fusion neutron irradiations and dosimetry at the LLL rotating target neutron source

    International Nuclear Information System (INIS)

    MacLean, S.C.

    1977-01-01

    The DT fusion neutron irradiation of 319 samples during 19 irradiation periods (beam-on time of more than 1026 hours) is described. Experiments from 24 individuals representing 11 institutions are summarized. The numbers of the UCID dosimetry reports detailing each of the irradiations are given

  4. Tratamento compensatorio da má oclusnao de classe lll: revisão de literatura

    OpenAIRE

    Dílio, Rogério Cássio [UNESP; Micheletti, Kelly Regina [UNESP; Cuoghi, Osmar Aparecido [UNESP; Bertoz, André Pinheiro de Magalhães [UNESP

    2014-01-01

    Class III malocclusion is less common occlusal relationship, covering less than 5% of the population. There are various forms of treatment in Class III malocclusion. Depending on how the form is expressed Class III and age of the patient, the therapy may be orthopedic and orthodontic surgical orthodontics. The objective was to review the literature of the last 10 years about ways to compensatory treatment of Class III malocclusion. Several articles were published between 04/2003 and 04/2013 i...

  5. The biomechanical assessment of the cervical inter-vertebral kinematics, between DDD patients ICR based study

    Science.gov (United States)

    Saveh, Amir Hossein; Zali, Ali Reza; Seddighi, Amir Saeed; Zarghi, Afsaneh; Chizari, Mahmoud; Hanafiah, Yussof

    2012-01-01

    Abstract: It is very important to pay more attention to spine from the biomechanical perspective. It would allow the analysis of initial conditions of the vertebral disc degeneration syndrome and adopting of normal spine kinematics to compare and match it with a degenerated disc and providing a biomechanical index as an indicator for the conduct of any surgical intervention including arthroplasty to maximize restoring spinal biomechanical motion. It is clear that the head movement is possible with the help of muscles. However, the shape and type of motion depends on the structure and shape of the cervical spine and the interaction between them. Cervical spine kinematics depends on the anatomy of the bones and joints. Bazhdok et al (2000) investigated the cervical kinematics and mechanical behavior of the spine and its anatomical connections. They have examined the atlanto- occipital joint motion during flexion-extension and rotation as well as the mechanism of paradoxical motion of atlanto- axial joint by radiography. Bifalkou et al (2011) studied the inter-vertebral motion based on arc kinematic commentary of video fluoroscopy. They showed that the diagnosis of biomechanical instability can be done based on the kinematic examination of the spine obtained in sagittal images. They also declared that the fluoroscopy can be used as a tool for study. Using an automated algorithm, image adaption was carried out and the motion direction of vertebrae was tracked. In the present study, some patients were selected among patients with cervical disc degeneration. Following imaging by fluoroscopy, the instantaneous center of the spinal action was calculated. It was used as a biomechanical criterion and the treatment group was compared with the healthy group. The loci of the instantaneous centers of the two groups were compared and its difference with the value of healthy group was calculated. A biomechanical criterion was introduced as a basis for comparison of normal and degenerated discs. Keywords: Cervical, Degeneration, Cases selection

  6. Levels of PCBs, DDT, DDE and DDD in Italian human blood samples

    Energy Technology Data Exchange (ETDEWEB)

    Rocca, C. La; Abate, V.; Alivernini, S.; Iacovella, N.; Mantovani, A.; Turrio-Baldassarri, L. [Ist. Superiore di Sanita, Roma (Italy); Silvestroni, L.; Spera, G. [Dept. of Medical Pathophysiology, Univ. (Italy)

    2004-09-15

    The environmental contamination from polychlorinated biphenyls (PCBs) is effecting the exposure of the general population in a direct way through air inhalation, ingestion of particulate matter and dermal absorption and, most of all, in an indirect way through diet. Diet represents, in fact, the main way of human exposure to PCBs. PCBs have potential teratogenic, carcinogenic, hormonal and immunological effects. An association between endometriosis and high levels of PCB in plasma has also been reported3. Moreover, some congeners (PCB 105, PCB 118, PCB 153) have effects on thyroid hormones in animal models, although the PCB dose used in these experiments was an order of magnitude higher than the estimated human exposure. Humans are, however, exposed to a complex mixtures of PCB congeners. In this study identification and quantification of 60 PCB congeners and 3 chlorinated pesticides in human whole blood samples are presented. The subjects examined in this pilot study were a small group of patients with possible endocrine-related problems and unknown specific exposure. The aim of this study was to increase the present understanding about the distribution of the PCBs in human whole blood. The levels of DDT and metabolites were measured as well, since these compounds are consistently reported to contribute to the whole body burden of persistent chlorinated compounds, together with PCBs.

  7. ISSR markers as a tool to distinguish Idt and SSS populations of Zea mays L

    OpenAIRE

    TIAROVSKÁ, Jana; SENKOVÁ, Slavomíra; BEŽO, Milan; RAŽNÁ, Katarína; MASNICA, Miloslav; LABAJOVÁ, Mária

    2013-01-01

    Maintaining genetic diversity for crop improvement and improving the quality of genetic resource management is both an inevitable part of nowadays maize breeding. ISSR markers brings the potential of finding a marker system to discriminate Iowa Stiff Stalk Synthetic and Iodent Reid populations of Zea mays, L. and on the base on coefficients of genetic distance and UPGMA grouping appropriate maize genotypes for the best potential for hybridization can be selected. The work presents the potenti...

  8. Modulation of SST, SSS over northern Bay of Bengal on ISO time scale

    Digital Repository Service at National Institute of Oceanography (India)

    Rao, S.A.; Saha, S.K.; Pokhrel, S.; Sundar, D.; Dhakate, A.R.; Mahapatra, S.; Ali, S.; Chaudhari, H.S.; Shreeram, P.; Suneel, V.; Srikanth, A.S.; Suresh, R.R.V.

    of temperature and salinity. The amount of rainfall received at observation site could not explain the observed freshening, thus an extensive analysis using wavelet coherence is done to find out the source of advected fresh water to the observed location...

  9. A Neutron Star Binary Merger Model for GW170817/GRB 170817A/SSS17a

    Energy Technology Data Exchange (ETDEWEB)

    Murguia-Berthier, A.; Ramirez-Ruiz, E.; Kilpatrick, C. D.; Foley, R. J.; Coulter, D. A.; Pan, Y.-C.; Prochaska, J. X.; Rojas-Bravo, C.; Siebert, M. R. [Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95064 (United States); Kasen, D. [Nuclear Science Division, Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Lee, W. H. [Instituto de Astronomía, Universidad Nacional Autónoma de México, Circuito Exterior, C.U., A. Postal 70-264, 04510 Cd. de México, México (Mexico); Piro, A. L.; Drout, M. R.; Madore, B. F.; Shappee, B. J.; Simon, J. D. [The Observatories of the Carnegie Institution for Science, 813 Santa Barbara Street, Pasadena, CA 91101 (United States); Rest, A. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States)

    2017-10-20

    The merging neutron star gravitational-wave event GW170817 has been observed throughout the entire electromagnetic spectrum from radio waves to γ -rays. The resulting energetics, variability, and light curves are shown to be consistent with GW170817 originating from the merger of two neutron stars, in all likelihood followed by the prompt gravitational collapse of the massive remnant. The available γ -ray, X-ray, and radio data provide a clear probe for the nature of the relativistic ejecta and the non-thermal processes occurring within, while the ultraviolet, optical, and infrared emission are shown to probe material torn during the merger and subsequently heated by the decay of freshly synthesized r -process material. The simplest hypothesis, that the non-thermal emission is due to a low-luminosity short γ -ray burst (sGRB), seems to agree with the present data. While low-luminosity sGRBs might be common, we show here that the collective prompt and multi-wavelength observations are also consistent with a typical, powerful sGRB seen off-axis. Detailed follow-up observations are thus essential before we can place stringent constraints on the nature of the relativistic ejecta in GW170817.

  10. (188)Re-SSS/Lipiodol: Development of a Potential Treatment for HCC from Bench to Bedside.

    Science.gov (United States)

    Lepareur, Nicolas; Ardisson, Valérie; Noiret, Nicolas; Garin, Etienne

    2012-01-01

    Hepatocellular carcinoma (HCC) is the 5th most common tumour worldwide and has a dark prognosis. For nonoperable cases, metabolic radiotherapy with Lipiodol labelled with β-emitters is a promising therapeutic option. The Comprehensive Cancer Centre Eugène Marquis and the National Graduate School of Chemistry of Rennes (ENSCR) have jointly developed a stable and efficient labelling of Lipiodol with rhenium-188 (E(βmax) = 2.1 MeV) for the treatment of HCC. The major "milestones" of this development, from the first syntheses to the recent first injection in man, are described.

  11. A Spectral Geometrical Model for Compton Scatter Tomography Based on the SSS Approximation

    DEFF Research Database (Denmark)

    Kazantsev, Ivan G.; Olsen, Ulrik Lund; Poulsen, Henning Friis

    2016-01-01

    The forward model of single scatter in the Positron Emission Tomography for a detector system possessing an excellent spectral resolution under idealized geometrical assumptions is investigated. This model has the form of integral equations describing a flux of photons emanating from the same ann...

  12. Task 5c: measurement and instrumentation under subsystem design of the LLL safeguard material control program. [For fuel reprocessing plant

    Energy Technology Data Exchange (ETDEWEB)

    1976-12-31

    A product survey was conducted of all security products currently available on the market. Documentation is presented of the survey and a printout of the data is included. A general description is given of new but recommended instrumentation and security devices for application to fuel reprocessing plants. Security systems and hardware recommended for development, assembly, and testing are discussed briefly. (DLC)

  13. Hombre, bienaventuranza y Dios en Suma Teológica l-ll, qq. 1-6.

    Directory of Open Access Journals (Sweden)

    Ariadne Pérez Treviño

    2013-11-01

    Full Text Available This article studies the Aquinas' proposal on Summa Theologica I-II, qq-1-6, where he studies how should the final end of the man be and concludes that it should be transcendental in a certain way, but immanent in another and that God is the immanent end; then, he studies the way in which man will get it and he finds out that it requires unity in three ways: unity between body and soul, intelligence and will, and finally, between the man, who is well disposed to contemplation and contemplation itself.

  14. The removal of toxic metals from liquid effluents by ion exchange resins. Part lll:Copper(ll/Sulphate/Amberlite 200

    Directory of Open Access Journals (Sweden)

    Alguacil, F. J.

    2003-06-01

    Full Text Available Copper(II adsorption from aqueous sulphate media on Amberlite 200 was investigated. The influence of operating variables such as aqueous pH, temperature and copper concentration on the metal adsorption kinetics was measured. The copper{II uptake is best fitted to the film-diffusion controlled process. The resin has been used in minicolumns to investigate its performance under dynamics conditions. Copper(II desorption from the resin is accomplished using sulphuric acid solutions.

    Se estudia la adsorción de cobre(II, de disoluciones en medio sulfato, en la resina Amberlite 200. La cinética de adsorción del metal se ha estudiado en función de una serie de variables experimentales: pH de la fase acuosa, temperatura y concentración del metal en el medio acuoso. La adsorción de cobre(II se puede correlacionar como controlada por un proceso de difusión en capa límite. Se ha utilizado la resina en minicolumnas para estudiar su comportamiento bajo condiciones dinámicas. La desorción del cobre(II se lleva a cabo con disoluciones de ácido sulfúrico.

  15. National Emission Standards for Hazardous Air Pollutants (NESHAP) for the Portland Cement Manufacturing Industry Subpart LLL Rule Guidance

    Science.gov (United States)

    This Spring 2016 document is intended for the use of EPA staff, State and Local regulatory agencies and their staff, and industry plant managers for the NESHAP for the Portland Cement Manufacturing Industry.

  16. Bonderenko self-shielded cross sections and multiband parameters derived from the LLL Evaluated-Nuclear-Data Library (ENDL)

    International Nuclear Information System (INIS)

    Cullen, D.E.

    1978-01-01

    Bonderenko self-shielded cross sections and multiband parameters from the Lawrence Livermore Laboratory Evaluated-Nuclear-Data Library (ENDL) as of July 4, 1978 are presented. These data include total, elastic, capture, and fission cross sections in the TART 175 group structure. Multiband parameters are listed. Bonderenko self-shielded cross section and the multiband parameters are presented on microfiche

  17. Influence of AlGaN Buffer Growth Temperature on GaN Epilayer based on Si(lll) Substrate

    International Nuclear Information System (INIS)

    Wei Meng; Wang Xiaoliang; Pan Xu; Xiao Hongling; Wang Cuimei; Zhang Minglan; Wang Zhanguo

    2011-01-01

    This paper investigated the influence of AlGaN buffer growth temperature on strain status and crystal quality of the GaN film on Si(111) sbustrates by metal organic chemical vapor deposition. It was demonstrated by the optical microscopy that AlGaN buffer gorwth temperature had a remarkable effect on compensating tensil stress in top GaN layer and preventing the formation of cracks. X-ray diffraction and atomic force microscopy analysis showed crystal quality and surface morphology of the GaN epilayer could be improved through increasing AlGaN buffer growth temperature. 1μm crack-free GaN epilayer on Si (111) substrates was obtained with graded AlGaN buffer layer at optimized temperature of 1050 deg. C. Transmission electron microscopy analysis revealed that a significant reduction in threading dislocations was achieved in GaN epilayer.

  18. Proton Radiation Effects on Dark Signal Distribution of PPD CMOS Image Sensors: Both TID and DDD Effects.

    Science.gov (United States)

    Xue, Yuanyuan; Wang, Zujun; Chen, Wei; Liu, Minbo; He, Baoping; Yao, Zhibin; Sheng, Jiangkun; Ma, Wuying; Dong, Guantao; Jin, Junshan

    2017-11-30

    Four-transistor (T) pinned photodiode (PPD) CMOS image sensors (CISs) with four-megapixel resolution using 11µm pitch high dynamic range pixel were radiated with 3 MeV and 10MeV protons. The dark signal was measured pre- and post-radiation, with the dark signal post irradiation showing a remarkable increase. A theoretical method of dark signal distribution pre- and post-radiation is used to analyze the degradation mechanisms of the dark signal distribution. The theoretical results are in good agreement with experimental results. This research would provide a good understanding of the proton radiation effects on the CIS and make it possible to predict the dark signal distribution of the CIS under the complex proton radiation environments.

  19. 40 CFR Appendix A to Subpart Ddd... - Free Formaldehyde Analysis of Insulation Resins by the Hydroxylamine Hydrochloride Method

    Science.gov (United States)

    2010-07-01

    ... values should conform to the following statistical precision: Variance = 0.005 Standard deviation = 0.07... example levels: Expected percent free formaldehyde Sample size, grams 2 30.0 5 12.0 8 7.5 10 6.0 12 5.0 15... 30 0.5 60 ii. If the milliliters of titrant are less than 5 mL or greater than 30 mL, reestimate the...

  20. Plane-dependent ML scatter scaling: 3D extension of the 2D simulated single scatter (SSS) estimate

    Science.gov (United States)

    Rezaei, Ahmadreza; Salvo, Koen; Vahle, Thomas; Panin, Vladimir; Casey, Michael; Boada, Fernando; Defrise, Michel; Nuyts, Johan

    2017-08-01

    Scatter correction is typically done using a simulation of the single scatter, which is then scaled to account for multiple scatters and other possible model mismatches. This scaling factor is determined by fitting the simulated scatter sinogram to the measured sinogram, using only counts measured along LORs that do not intersect the patient body, i.e. ‘scatter-tails’. Extending previous work, we propose to scale the scatter with a plane dependent factor, which is determined as an additional unknown in the maximum likelihood (ML) reconstructions, using counts in the entire sinogram rather than only the ‘scatter-tails’. The ML-scaled scatter estimates are validated using a Monte-Carlo simulation of a NEMA-like phantom, a phantom scan with typical contrast ratios of a 68Ga-PSMA scan, and 23 whole-body 18F-FDG patient scans. On average, we observe a 12.2% change in the total amount of tracer activity of the MLEM reconstructions of our whole-body patient database when the proposed ML scatter scales are used. Furthermore, reconstructions using the ML-scaled scatter estimates are found to eliminate the typical ‘halo’ artifacts that are often observed in the vicinity of high focal uptake regions.

  1. VizieR Online Data Catalog: NGC3115 & NGC1399 VEGAS-SSS globular clusters (Cantiello+, 2018)

    Science.gov (United States)

    Cantiello, M.; D'Abrusco, R.; Spavone, M.; Paolillo, M.; Capaccioli, M.; Limatola, L.; Grado, A.; Iodice, E.; Raimondo, G.; Napolitano, N.; Blakeslee, J. P.; Brocato, E.; Forbes, D. A.; Hilker, M.; Mieske, S.; Peletier, R.; van de Ven, G.; Schipani, P.

    2017-11-01

    Photometric catalogs for globular cluster (GC) candidates over the the 1 sq. degree area around NGC3115 and NGC1399 (ngc3115.dat and ngc1399.dat). The catalogues are based on u-, g- and i- band images from the VST elliptical galaxies survey (VEGAS). Aperture magnitudes, corrected for aperture correction are reported. We also provide the full catalogs of matched sources, which also include the matched background and foreground sources in the frames (ngc3115_full.dat and ngc1399_full.dat). (4 data files).

  2. Comparison of linoleic and conjugated linoleic acids in enzymatic acidolysis of tristearin

    DEFF Research Database (Denmark)

    Yang, Tiankui; Xu, Xuebing; Li, L.T.

    2001-01-01

    tristearin (SSS) and linoleic (L) or conjugated linoleic (cL) acids (1:6, mol/mol). The other was between tristearin and the mixture of linoleic and conjugated linoleic acids (1:3:3, mol/mol/mol). Acyl incorporation and migration together with triacylglycerol composition of the products were monitored...... with gas chromatography, pancreatic lipase hydrolysis, and high performance liquid chromatography. Both acyl incorporation and migration of linoleic acid were faster than those of conjugated linoleic acid. At 5 h reaction, there were 13.0% LLL, 46.5% LSL, 27.7% LSS, and 5.6% SSS in the product for a system...... between tristearin and linoleic acid; whereas there were 2.4% cLcLcL, 10.4% cLScL, 50.9% cLSS, and 36.2% SSS in the product for a system between tristearin and conjugated linoleic acid. The results suggest that linoleic acid was more reactive than conjugated linoleic acid in the enzymatic acidolysis...

  3. Utilization of small changes in serum creatinine with clinical risk factors to assess the risk of AKI in critically lll adults.

    Science.gov (United States)

    Cruz, Dinna N; Ferrer-Nadal, Asunción; Piccinni, Pasquale; Goldstein, Stuart L; Chawla, Lakhmir S; Alessandri, Elisa; Belluomo Anello, Clara; Bohannon, Will; Bove, Tiziana; Brienza, Nicola; Carlini, Mauro; Forfori, Francesco; Garzotto, Francesco; Gramaticopolo, Silvia; Iannuzzi, Michele; Montini, Luca; Pelaia, Paolo; Ronco, Claudio

    2014-04-01

    Disease biomarkers require appropriate clinical context to be used effectively. Combining clinical risk factors, in addition to small changes in serum creatinine, has been proposed to improve the assessment of AKI. This notion was developed in order to identify the risk of AKI early in a patient's clinical course. We set out to assess the performance of this combination approach. A secondary analysis of data from a prospective multicenter intensive care unit cohort study (September 2009 to April 2010) was performed. Patients at high risk using this combination approach were defined as an early increase in serum creatinine of 0.1-0.4 mg/dl, depending on number of clinical factors predisposing to AKI. AKI was defined and staged using the Acute Kidney Injury Network criteria. The primary outcome was evolution to severe AKI (Acute Kidney Injury Network stages 2 and 3) within 7 days in the intensive care unit. Of 506 patients, 214 (42.2%) patients had early creatinine elevation and were deemed at high risk for AKI. This group was more likely to subsequently develop the primary endpoint (16.4% versus 1.0% [not at high risk], Pcreatinine, and hazard tier for AKI, early creatinine elevation remained an independent predictor for severe AKI (adjusted relative risk, 12.86; 95% confidence interval, 3.52 to 46.97). Addition of early creatinine elevation to the best clinical model improved prediction of the primary outcome (area under the receiver operating characteristic curve increased from 0.75 to 0.83, Phigh AKI risk, based on the combination of clinical factors and early creatinine elevation, are significantly more likely to develop severe AKI. As initially hypothesized, the high-risk combination group methodology can be used to identify patients at low risk for severe AKI in whom AKI biomarker testing may be expected to have low yield. The high risk combination group methodology could potentially allow clinicians to optimize biomarker use.

  4. Designing the selenium and bladder cancer trial (SELEBLAT, a phase lll randomized chemoprevention study with selenium on recurrence of bladder cancer in Belgium

    Directory of Open Access Journals (Sweden)

    Goossens Maria E

    2012-03-01

    Full Text Available Abstract Background In Belgium, bladder cancer is the fifth most common cancer in males (5.2% and the sixth most frequent cause of death from cancer in males (3.8%. Previous epidemiological studies have consistently reported that selenium concentrations were inversely associated with the risk of bladder cancer. This suggests that selenium may also be suitable for chemoprevention of recurrence. Method The SELEBLAT study opened in September 2009 and is still recruiting all patients with non-invasive transitional cell carcinoma of the bladder on TURB operation in 15 Belgian hospitals. Recruitment progress can be monitored live at http://www.seleblat.org. Patients are randomly assigned to selenium yeast (200 μg/day supplementation for 3 years or matching placebo, in addition to standard care. The objective is to determine the effect of selenium on the recurrence of bladder cancer. Randomization is stratified by treatment centre. A computerized algorithm randomly assigns the patients to a treatment arm. All study personnel and participants are blinded to treatment assignment for the duration of the study. Design The SELEnium and BLAdder cancer Trial (SELEBLAT is a phase III randomized, placebo-controlled, academic, double-blind superior trial. Discussion This is the first report on a selenium randomized trial in bladder cancer patients. Trial registration ClinicalTrials.gov identifier: NCT00729287

  5. Fiscal year 1976T (add-on quarter) DT fusion neutron irradiations and dosimetry at the LLL rotating target neutron source

    International Nuclear Information System (INIS)

    MacLean, S.C.

    1977-01-01

    The DT fusion neutron irradiation of more than 90 samples during seven irradiation periods (beam-on time of more than 430.9 hours) is described. Experiments from 15 individuals representing six institutions are summarized. The numbers of UCID dosimetry reports detailing each of the irradiations is given

  6. Observações citológicas em citrus: lll. megasporogênese, fertilização e poliembrionia

    Directory of Open Access Journals (Sweden)

    Osvaldo Bacchi

    1944-01-01

    Full Text Available É apresentada uma revisão geral da megasporogênese, fertilização, formação do endosperma e poliembrionia em Citrus, tendo sido confirmada, pelas observações nas espécies C. paradisi Macf. e C. aurantium L., a maioria das conclusões feitas por Strassburger (10 e Osawa (6. É descrita uma nova forma de poliembrionia causada pela existência, em alguns casos, de dois gametófitos num mesmo óvulo; explica-se, dêste modo, a origem de dois híbridos não idênticos em uma mesma semente. Três formas de poliembrionia são, portanto, conhecidas em Citrus : a a poliembrionia nucelar, dando origem a um número variável de "seedlings" "maternais" idênticos e derivados do nucelo; 2 a poliembrionia por clivagem (4, 5, originada pela suposta bipartição do embrião sexual; e 3 a poliembrionia causada pela ocorrência de mais de um gametófito normal no mesmo óvulo. O endosperma em Citrus pertence ao tipo nuclear.1. A general review is presented of megasporogenesis, fertilization, endosperm formation and polyembryony in Citrus, most of the findings of Strassburger (10 and Osawa (6 having been confirmed through investigation of C. parodisi Macf. and C. aurantium L. 2. A new form of polyembryony is presented, caused by the existence in some instances of two gametophytes in the same ovule. The origin of two non-identical hybrids from the same seed is thus explained. 3. Three forms of polyembryony are therefore known in Citrus, (a nucellar embryony, giving rise to a variable number of identical, "maternal" seedlings derived from the nucellus ; (b cleavage polyembryony (4, 5 originating through fission of the generative embryo; and (c polyembryony caused by the occurrence of more than one normal gametophyte in the same ovule. The endosperm in Citrus is free.

  7. Uso de bicarbonato de sódio na acidose metabólica do paciente gravemente enfermo Sodium bicarbonate in the critically lll patient with metabolic acidosis

    Directory of Open Access Journals (Sweden)

    Paulo Novis Rocha

    2009-12-01

    Full Text Available A acidose lática é um distúrbio do equilíbrio ácido-base muito frequente em pacientes internados em unidades de terapia intensiva e está associado a um mau prognóstico. Embora exista um acúmulo substancial de evidências de que níveis críticos de acidemia provocam inúmeros efeitos adversos sobre o funcionamento celular, a utilização de bicarbonato de sódio para o tratamento da acidose lática em pacientes gravemente enfermos permanece alvo de controvérsias. Neste artigo, pretendemos: 1 analisar as principais diferenças entre as acidoses hiperclorêmicas e as acidoses orgânicas, com ânion gap (AG elevado, visando embasar a discussão sobre os fundamentos da terapia com bicarbonato de sódio nas acidoses metabólicas; 2 avaliar os riscos associados à persistência de níveis críticos de acidemia, contrastando-os com os riscos do uso de bicarbonato de sódio; 3 analisar criticamente as evidências da literatura sobre o uso de bicarbonato de sódio no tratamento da acidose lática do paciente crítico, com ênfase em ensaios clínicos randomizados em seres humanos; 4 fornecer um fundamento para a utilização judiciosa de bicarbonato de sódio nesta situação.Lactic acidosis is an acid-base imbalance frequently found in critically ill patients. It is associated with a poor prognosis. Despite the substantial body of evidence that critical levels of acidemia have several adverse effects on cell function, the use of sodium bicarbonate to treat lactic acidosis in critically ill patients remains highly controversial. This article aimed at: 1 analyzing the main differences between hyperchloremic and organic acidoses, with high anion gap; 2 comparing the risks associated with critical levels of acidemia with those associated with the use of sodium bicarbonate; 3 critically analyzing the literature evidence about the use of sodium bicarbonate for the treatment of lactic acidosis in critically ill patients, with an emphasis on randomized control trials in human beings; and 4 providing a rationale for the judicious use of sodium bicarbonate in that situation.

  8. Occurences and Fate of DDT Principal Isomers/Metabolites, DDA, and o,p'-DDD Enantiomers in Fish, Sediment and Water at a DDT-Impacted Superfund Site

    Science.gov (United States)

    In the 1950s and 60s, discharges from a DDT manufacturing plant contaminated a tributary system of the Tennessee River near Huntsville, Alabama, USA. Regulatory action resulted in declaring the area a Superfund site which required remediation and extensive monitoring. Monitoring ...

  9. Is Continuing Contumely Relative to Mc Leod's Vision and ``Secret Sacred Science, (SSS),'': Contagiously Counterproductive in Science, or an Unhealthy Artifact of ``Turf Wars''?

    Science.gov (United States)

    Leod, Roger

    2007-04-01

    Mc Leod confirmed, with physics, his models for vision, and for electromagnetic artifacts, by traditional methods, associated with phenomena like tornados, hurricanes, and earthquakes. The latter confirmations are evidently apparent across current ethnology, cultures, linguistics, religion, rituals, exotic astronomy, somewhat concealed evidence of native record-keeping/writing, and iconography. Use of cultural anthropology while observing a modern Peruvian sacred-site-sweeping at Cuzco, coupled with their assertion that Ñari Huallac means ``serpent God,'' plus electromagnet information, reveals that their religious world-view include(s)(d) applied science that is still otherwise unacknowledged. Alexander Thom's precise megalithic site-measurements also imply that ``The Ancients' Serpent'' made/makes precise tracks that convey valuable information. The linguistics of words like Seminole, and unusual visual effects, reveal some traditionalists have done better than most scientists, for vision, and observational physics, and earth science. Tornado and hurricane tracks are predictable, as are some earthquakes. Tornado ``detuning'' or shutdown is electromagnetically possible. To cite this abstract, use the following reference: http://meetings.aps.org/link/BAPS.2007.NES07.C2.7

  10. Characterization of a novel sialic acid transporter of the sodium solute symporter (SSS) family and in vivo comparison with known bacterial sialic acid transporters.

    Science.gov (United States)

    Severi, Emmanuele; Hosie, Arthur H F; Hawkhead, Judith A; Thomas, Gavin H

    2010-03-01

    The function of sialic acids in the biology of bacterial pathogens is reflected by the diverse range of solute transporters that can recognize these sugar acids. Here, we use an Escherichia coliDeltananT strain to characterize the function of known and proposed bacterial sialic acid transporters. We discover that the STM1128 gene from Salmonella enterica serovar Typhimurium, which encodes a member of the sodium solute symporter family, is able to restore growth on sialic acid to the DeltananT strain and is able to transport [(14)C]-sialic acid. Using the DeltananT genetic background, we performed a direct in vivo comparison of the transport properties of the STM1128 protein with those of sialic acid transporters of the major facilitator superfamily and tripartite ATP-independent periplasmic families, E. coli NanT and Haemophilus influenzae SiaPQM, respectively. This revealed that both STM1128 and SiaPQM are sodium-dependent and, unlike SiaPQM, both STM1128 and NanT are reversible secondary carriers, demonstrating qualitative functional differences in the properties of sialic acid transporters used by bacteria that colonize humans.

  11. Einstein Observatory SSS and MPC observations of the complex X-ray spectra of Seyfert galaxies. [Solid State Spectrometer and Monitor Proportional Counter

    Science.gov (United States)

    Turner, T. J.; Weaver, K. A.; Mushotzky, R. F.; Holt, S. S.; Madejski, G. M.

    1991-01-01

    The X-ray spectra of 25 Seyfert galaxies measured with the Solid State Spectrometer on the Einstein Observatory have been investigated. This new investigation utilizes simultaneous data from the Monitor Proportional Counter, and automatic correction for systematic effects in the Solid State Spectrometer which were previously handled subjectively. It is found that the best-fit single-power-law indices generally agree with those previously reported, but that soft excesses of some form are inferred for about 48 percent of the sources. One possible explanation of the soft excess emission is a blend of soft X-ray lines, centered around 0.8 keV. The implications of these results for accretion disk models are discussed.

  12. Proceedings of the Annual Meeting of the Association for Education in Journalism and Mass Communication (76th, Kansas City, Missouri, August ll-l4, l993). Part XI: Advertising.

    Science.gov (United States)

    Association for Education in Journalism and Mass Communication.

    The Advertising section of this collection of conference presentations contains the following 12 papers: "How Leading Advertising Agencies Perceive and Use Barter Syndication: A Pilot Study" (Sylvia M. Chan-Olmsted); "Three Giants--Leo Burnett, David Ogilvy, William Bernbach: An Exploration of the Impact of the Founders' Written…

  13. Tables and graphs of photon-interaction cross sections from 0.1 keV to 100 MeV derived from the LLL evaluated-nuclear-data library

    International Nuclear Information System (INIS)

    Plechaty, E.F.; Cullen, D.E.; Howerton, R.J.

    1981-01-01

    Energy-dependent evaluated photon interaction cross sections and related parameters are presented for elements H through Cf(Z = 1 to 98). Data are given over the energy range from 0.1 keV to 100 MeV. The related parameters include form factors and average energy deposits per collision (with and without fluorescence). Fluorescence information is given for all atomic shells that can emit a photon with a kinetic energy of 0.1 keV or more. In addition, the following macroscopic properties are given: total mean free path and energy deposit per centimeter. This information is derived from the Livermore Evaluated-Nuclear-Data Library (ENDL) as of October 1978

  14. El Instituto de Salud Carlos lll y la sanidad española. Origen de la medicina de laboratorio, de los institutos de salud publica y de la investigación sanitaria

    OpenAIRE

    Rafael Nájera Morrondo

    2006-01-01

    El Instituto de Salud Carlos III es la sede de los Institutos Nacionales de Sanidad en España, con un componente muy importante de investigación científica en áreas relacionadas con la salud, tales como las enfermedades infecciosas, el cáncer, las enfermedades cardiovasculares y la sanidad ambiental, así como de vigilancia e investigación epidemiológica. Este artículo describe el desarrollo de los Institutos de Salud Pública, que se originan con la introducción y afianzam...

  15. Tables and graphs of photon-interaction cross sections from 0.1 keV to 100 MeV derived from the LLL Evaluated-Nuclear-Data Library

    International Nuclear Information System (INIS)

    Plechaty, E.F.; Cullen, D.E.; Howerton, R.J.

    1978-01-01

    Energy-dependent evaluated photon interaction cross sections and related parameters are presented for elements H through Cf (Z = 1 to 98). Data are given over the energy range from 0.1 keV to 100 MeV. The related parameters include form factors and average energy deposits per collision (with and without fluorescence). Fluorescence information is given for all atomic shells that can emit a photon with a kinetic energy of 0.1 keV or more. In addition, the following macroscopic properties are given: total mean free path and energy deposit per centimeter. This information is derived from the Livermore Evaluated-Nuclear-Data Library (ENDL) as of October 1978

  16. El Instituto de Salud Carlos lll y la sanidad española. Origen de la medicina de laboratorio, de los institutos de salud publica y de la investigación sanitaria

    Directory of Open Access Journals (Sweden)

    Rafael Nájera Morrondo

    2006-01-01

    Full Text Available El Instituto de Salud Carlos III es la sede de los Institutos Nacionales de Sanidad en España, con un componente muy importante de investigación científica en áreas relacionadas con la salud, tales como las enfermedades infecciosas, el cáncer, las enfermedades cardiovasculares y la sanidad ambiental, así como de vigilancia e investigación epidemiológica. Este artículo describe el desarrollo de los Institutos de Salud Pública, que se originan con la introducción y afianzamiento de la Medicina de Laboratorio y Científica, basada en la incorporación a la práctica sanitaria, de la vacunación antivariólica, el saneamiento y el control del agua y de los alimentos. Aproximadamente en la misma época, se producen los grandes descubrimientos de la microbiología y de la inmunología que se funden con los avances prácticos en el control de productos. Para hacer frente a las necesidades de orden práctico, se crearon instituciones con responsabilidad para el mantenimiento y provisión de la vacuna antivariólica, pero que incorporaron pronto la producción de sueros y otras vacunas, así como el control de aguas, del saneamiento y de los alimentos, a medida que los avances científicos lo permitían. Al mismo tiempo, la colonización de África, la exploración de muchas zonas de América Central y el Caribe, enfrentaron a los científicos de los países avanzados con nuevas enfermedades y la necesidad de laboratorios donde estudiarlas. Estas circunstancias dieron origen, a comienzos del siglo XX al nacimiento de los Institutos Nacionales de Sanidad en numerosos países, que en España llega hasta hoy con el Carlos III.

  17. LLL/DOR seismic conservatism of operating plants project. Interm report on Task II.1.3: soil-structure interaction. Deconvolution of the June 7, 1975, Ferndale Earthquake at the Humboldt Bay Power Plant

    International Nuclear Information System (INIS)

    Maslenikov, O.R.; Smith, P.D.

    1978-01-01

    The Ferndale Earthquake of June 7, 1975, provided a unique opportunity to study the accuracy of seismic soil-structure interaction methods used in the nuclear industry because, other than this event, there have been no cases of significant earthquakes for which moderate motions of nuclear plants have been recorded. Future studies are planned which will evaluate the soil-structure interaction methodology further, using increasingly complex methods as required. The first step in this task was to perform deconvolution and soil-structure interaction analyses for the effects of the Ferndale earthquake at the Humboldt Bay Power Plant site. The deconvolution analyses of bedrock motions performed are compared as well as additional studies on analytical sensitivity

  18. Randomized controlled trials of COX-2 inhibitors

    DEFF Research Database (Denmark)

    Stefansdottir, Gudrun; De Bruin, Marie L; Knol, Mirjam J

    2011-01-01

    trials after the 2004 market withdrawal of rofecoxib were excluded. RESULTS: Median defined daily dose (DDD) of celecoxib (2.00) was higher than the median DDD of rofecoxib (1.00; p ... celecoxib after the withdrawal of rofecoxib because the overall median DDD of celecoxib was substantially higher than the median DDD of rofecoxib, while non-selective NSAID DDDs were comparable....

  19. Predictors of Sick Sinus Syndrome in Patients after Successful Radiofrequency Catheter Ablation of Atrial Flutter

    OpenAIRE

    Song, Changho; Jin, Moo-Nyun; Lee, Jung-Hee; Kim, In-Soo; Uhm, Jae-Sun; Pak, Hui-Nam; Lee, Moon-Hyoung; Joung, Boyoung

    2014-01-01

    Purpose The identification of sick sinus syndrome (SSS) in patients with atrial flutter (AFL) is difficult before the termination of AFL. This study investigated the patient characteristics used in predicting a high risk of SSS after AFL ablation. Materials and Methods Out of 339 consecutive patients who had undergone radiofrequency ablation for AFL from 1991 to 2012, 27 (8%) had SSS (SSS group). We compared the clinical characteristics of patients with and without SSS (n=312, no-SSS group). ...

  20. Energy and technology review

    Energy Technology Data Exchange (ETDEWEB)

    Selden, R.W.

    1977-05-01

    Topics covered include: geothermal energy development at LLL, energy conversion engineering, continuing education at LLL, and the Western states uranium resource survey. Separate abstracts were prepared for 3 sections. (MCG)

  1. Path to Stochastic Stability: Comparative Analysis of Stochastic Learning Dynamics in Games

    KAUST Repository

    Jaleel, Hassan; Shamma, Jeff S.

    2018-01-01

    dynamics: Log-Linear Learning (LLL) and Metropolis Learning (ML). Although both of these dynamics have the same stochastically stable states, LLL and ML correspond to different behavioral models for decision making. Moreover, we demonstrate through

  2. VEGAS-SSS. II. Comparing the globular cluster systems in NGC 3115 and NGC 1399 using VEGAS and FDS survey data. The quest for a common genetic heritage of globular cluster systems

    Science.gov (United States)

    Cantiello, Michele; D'Abrusco, Raffaele; Spavone, Marilena; Paolillo, Maurizio; Capaccioli, Massimo; Limatola, Luca; Grado, Aniello; Iodice, Enrica; Raimondo, Gabriella; Napolitano, Nicola; Blakeslee, John P.; Brocato, Enzo; Forbes, Duncan A.; Hilker, Michael; Mieske, Steffen; Peletier, Reynier; van de Ven, Glenn; Schipani, Pietro

    2018-04-01

    We analyze the globular cluster (GC) systems in two very different galaxies, NGC 3115 and NGC 1399. With the papers of this series, we aim at highlighting common and different properties in the GC systems in galaxies covering a wide range of parameter space. We compare the GCs in NGC 3115 and NGC 1399 as derived from the analysis of one square degree u-, g-, and i-band images taken with the VST telescope as part of the VST early-type galaxy survey (VEGAS) and Fornax deep survey (FDS). We selected GC candidates using as reference the morpho-photometric and color properties of confirmed GCs. The surface density maps of GCs in NGC 3115 reveal a morphology similar to the light profile of field stars; the same is true when blue and red GCs are taken separately. The GC maps for NGC 1399 are richer in structure and confirm the existence of an intra-cluster GC component. We confirm the presence of a spatial offset in the NGC 1399 GC centroid and find that the centroid of the GCs for NGC 3115 coincides well with the galaxy center. Both GC systems show unambiguous color bimodality in (g - i) and (u - i); the color-color relations of the two GC systems are slightly different with NGC 3115 appearing more linear than NGC 1399. The azimuthal average of the radial density profiles in both galaxies reveals a larger spatial extent for the total GCs population with respect to the galaxy surface brightness profile. For both galaxies, the red GCs have radial density profiles compatible with the galaxy light profile, while the radial profiles for blue GCs are shallower. As for the specific frequency of GCs, SN, we find it is a factor of two higher in NGC 1399 than for NGC 3115; this is mainly the result of extra blue GCs. By inspecting the radial behavior of the specific frequency, SN(

  3. Dicty_cDB: SLF305 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ilaanql qklkngesitsigssssssssslasspltfsaggggggsyspmfnfsaisiraptgiddm vskqkghlynyygqqqhshyhhgyqhhnihqtygshpndvi...ghlynyygqqqhshyhhgyqhhnihqtygshpndvitydpnlclldpnnskiydy yrqqysdl*yrwgsfrkesrgieiyst*gsr*gy*fln*mykmq*kvk*lll

  4. The Effect of One Session Low Level Laser Therapy of Extracted Follicular Units on the Outcome of Hair Transplantation

    OpenAIRE

    Tabaie, Seyed Mehdi; Berenji Ardestani, Hoda; Azizjalali, Mir Hadi

    2016-01-01

    Introduction: Photobiostimulation with low level laser (LLL) has been used in medicine for a long time and its effects have been shown in many diseases. Some studies have evaluated the effect of LLL on androgenic alopecia. One of the most important limitations of the use of LLL in the treatment of alopecia is the requirement for multiple sessions, which is hardly accepted by patients. This study was conducted to evaluate the effect of the irradiation of extracted follicular hair units by LLL ...

  5. Selection of permanent pacing position of cardiac ventricle in patients with complete right bundle branch block

    International Nuclear Information System (INIS)

    Yang Minquan; Zhou Jun; Zhu Yan; Wang Jin; Rong Xin; Zhang Xiaoyi

    2005-01-01

    Objective: To find out the optimal pacing localization by comparing different pacing positions of the right ventricle in brady-cardiacarrhythmia patients with complete right bundle branch block. Methods: DDD type of double lumen permanent pacemaker was implanted in each of the 8 cases of sick sinus syndrome (SSS) and/or III degree atrioventricular block (III degree AVB) with complete right bundle branch block in normal heart function or class I. For each patient, four pacing positions in right ventricle were compared and the QRS pacing durations were recorded. The position with the shortest the QRS duration was chosen as the permanent pacing position. Heart function, chest X-rays and left ventricle ejection fraction (LVEF) were followed up after the operation. Results: In all the 8 cases, the posterior septum of the right ventricle were chosen as the permanent pacing position, with the shorter pacing QRS duration than that of pre-operation (P<0.05) and other pacing positions of the right ventricle. All parameters of this permanent pacing position were within the normal range. During the follow-up of 6-36 months, no abnormity was found in cardiac functions. Conclusion: In brady-cardiacarrhythmia patients with complete right bundle branch block, the implantation of permanent pacemaker should be at the junction region of inlet and outlet tracts, of the posterior septum of the right ventricle with ideal physiological function. (authors)

  6. PELE-IC test problems

    International Nuclear Information System (INIS)

    Gong, E.Y.; Alexander, E.E.; McMaster, W.H.; Quinones, D.F.

    1979-01-01

    This report provides prospective users of the Lawrence Livermore Laboratory (LLL) fluid-structure interaction computer code, PELE-IC, a variety of test problems for verifying the code on CDC 7600 computer systems at facilities external to the LLL environment. The test problems have been successfully run on CDC 7600 computers at the LLL and Lawrence Berkeley Laboratory (LBL) computer centers

  7. Cultural Learning Processes through Local Wisdom: A Case Study on Adult and Lifelong Learning in Thailand

    Science.gov (United States)

    Ratana-Ubol, Archanya; Henschke, John A.

    2015-01-01

    This article provides the background and concept of Thailand Lifelong Learning [LLL], even attempting a definition. The Thai LLL vision encompasses strategies for developing human qualities such as integrity, self-reliance, adaptability, resilience, and spirituality, to name a few. In some regards LLL seeks to recapture a more fully-developed…

  8. Clinical characteristics of RA patients with secondary SS and association with joint damage

    OpenAIRE

    Brown, Lindsay E.; Frits, Michelle L.; Iannaccone, Christine K.; Weinblatt, Michael E.; Shadick, Nancy A.; Liao, Katherine P.

    2014-01-01

    Objectives. Secondary SS (sSS) is a common extra-articular manifestation of RA. There are conflicting data regarding the association of sSS with worse joint damage. This study aims to characterize sSS patients in an RA cohort and study the association between sSS and joint damage.

  9. Incidence and risk factors for lower limb lymphedema after gynecologic cancer surgery with initiation of periodic complex decongestive physiotherapy.

    Science.gov (United States)

    Deura, Imari; Shimada, Muneaki; Hirashita, Keiko; Sugimura, Maki; Sato, Seiya; Sato, Shinya; Oishi, Tetsuro; Itamochi, Hiroaki; Harada, Tasuku; Kigawa, Junzo

    2015-06-01

    Lower limb lymphedema (LLL) is one of the most frequent postoperative complications of retroperitoneal lymphadenectomy for gynecologic cancer. LLL often impairs quality of life, activities of daily living, sleep, and sex in patients with gynecologic cancer. We conducted this study to evaluate the incidence and risk factors for LLL after gynecologic cancer surgery in patients who received assessment and periodic complex decongestive physiotherapy (CDP). We retrospectively reviewed 126 cases of gynecologic cancer that underwent surgery involving retroperitoneal lymphadenectomy at Tottori University Hospital between 2009 and 2012. All patients received physical examinations to detect LLL and underwent CDP by nurse specialists within several months after surgery. The International Society of Lymphology staging of lymphedema severity was used as the diagnostic criteria. Of 126 patients, 57 (45.2%) had LLL, comprising 45 and 12 patients with stage 1 and stage 2 LLL, respectively. No patient had stage 3 LLL. LLL was present in 37 (29.4%) patients at the initial physical examination. Multivariate analysis revealed that adjuvant concurrent chemoradiotherapy and age ≥ 55 years were independent risk factors for ≥ stage 2 LLL. To minimize the incidence of ≥ stage 2 LLL, gynecologic oncologists should be vigilant for this condition in patients who are ≥ 55 years and in those who undergo adjuvant chemoradiotherapy. Patients should be advised to have a physical assessment for LLL and to receive education about CDP immediately after surgery involving retroperitoneal lymphadenectomy for gynecologic cancer.

  10. Dynamic performances of wet turbine and steam-separator-superheater and their mathematical simulation as objects of temperature control

    International Nuclear Information System (INIS)

    Golovach, E.A.

    1985-01-01

    A mathematical model of a turbine and steam-separator-superheater (SSS) as applied to solution of the tasks of steam temperature regulaton after SSS has been developed. SSS as objects of steam temperature control are considerably less inertial, than intermediate superheaters (IS) of power units in thermal power plants, since for typical SSS and IS considered the duration of transition process according to steam temperature after SSS is 5-10 times loweA than for IS

  11. Subjective Social Status and Well-Being: The Role of Referent Abstraction.

    Science.gov (United States)

    Haught, Heather M; Rose, Jason; Geers, Andrew; Brown, Jill A

    2015-01-01

    Subjective social status (SSS) has been shown to predict well-being and mental health, above and beyond objective social status (OSS). However, little is known about the factors that moderate this relationship. Two studies explored whether the link between SSS and well-being varied depending upon the referent used for comparison in SSS judgments. Participants judged their well-being and SSS in comparison to referents that varied in abstraction. A confirmatory factor analysis on SSS judgments yielded two factors: (a) SSS perceptions toward global referents and (b) SSS perceptions toward local referents. SSS relative to a global referent was a better predictor of depression (Studies 1 and 2), life satisfaction (Studies 1 and 2), and self-esteem (Study 2) than SSS relative to a local referent. These findings have theoretical implications for understanding how people differentiate between local vs. global referents and practical implications for status-related health disparities.

  12. Manufacturing of neutral beam sources at Lawrence Livermore Laboratory

    International Nuclear Information System (INIS)

    Baird, E.D.; Duffy, T.J.; Harter, G.A.; Holland, E.D.; Kloos, W.A.; Pastrone, J.A.

    1979-01-01

    Over 50 neutral beam sources (NBS) of the joint Lawrence Berkeley Laboratory (LBL)/Lawrence Livermore Laboratory (LLL) design have been manufactured, since 1973, in the LLL Neutral Beam Source Facility. These sources have been used to provide start-up and sustaining neutral beams for LLL mirror fusion experiments, including 2XIIB, TMX, and Beta II. Experimental prototype 20-kV and 80-kV NBS have also been designed, built, and tested for the Mirror Fusion Test Facility (MFTF)

  13. Untitled

    Indian Academy of Sciences (India)

    Page 1. (BMIMITFSI. W c. 2,. W\\. O. A pw. , t. À à. 9 60 °. GaL aLaLLL LaLLL LaLL LLaL SDS SSLSL SLLS LLLS SSLS SLSSSS SJSSLS YLSLS JSLS SLL SLL SSLLS JSLS SLLLL LL LLL LLLLLL. S. L. L. L. L. L. L. طالا. H20 r. 10.

  14. The lowest Landau level in QCD

    Directory of Open Access Journals (Sweden)

    Bruckmann Falk

    2017-01-01

    Full Text Available The thermodynamics of Quantum Chromodynamics (QCD in external (electro-magnetic fields shows some unexpected features like inverse magnetic catalysis, which have been revealed mainly through lattice studies. Many effective descriptions, on the other hand, use Landau levels or approximate the system by just the lowest Landau level (LLL. Analyzing lattice configurations we ask whether such a picture is justified. We find the LLL to be separated from the rest by a spectral gap in the two-dimensional Dirac operator and analyze the corresponding LLL signature in four dimensions. We determine to what extent the quark condensate is LLL dominated at strong magnetic fields.

  15. PODAAC-AQR50-3SUCS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day, monthly, and...

  16. PODAAC-SMP20-3SMCS

    Data.gov (United States)

    National Aeronautics and Space Administration — The version 2.0 SMAP-SSS level 3, monthly gridded product is based on the first release of the validated standard mapped sea surface salinity (SSS) data from the...

  17. PODAAC-SMP20-3SPCS

    Data.gov (United States)

    National Aeronautics and Space Administration — The version 2.0 SMAP-SSS level 3, 8-Day running mean gridded product is based on the first release of the validated standard mapped sea surface salinity (SSS) data...

  18. PODAAC-AQR50-3Y7CS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) rain-flagged standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day,...

  19. PODAAC-AQR50-3S3CS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day, monthly, and...

  20. Proceedings 2015: Selected Papers from the Nineteenth College-Wide Conference for Students in Languages, Linguistics & Literature (19th, Honolulu, Hawai'i, April 18, 2015)

    Science.gov (United States)

    Aguirre, Samuel, Ed.; Plumb, Emily Gazda, Ed.; Martin, Kristyn, Ed.

    2016-01-01

    The theme for this year's annual Graduate Student Conference of the College of Languages, Linguistics and Literature (LLL) was "In a Word," which captured a basic component that runs through the College of LLL since words are essential to the work students do in each of the departments that form the College. The conference opened with a…

  1. Accelerator safety program at the Lawrence Livermore Laboratory

    International Nuclear Information System (INIS)

    Graham, C.L.

    1976-01-01

    A proposed accelerator safety standard for the Lawrence Livermore Laboratory (LLL) is given. All accelerators will comply with this standard when it is included in the LLL Health and Safety Manual. The radiation alarm and radiation safety system for a radiography facility are also described

  2. Uddannelseshistorie 2009

    DEFF Research Database (Denmark)

    Antologi om livslang læring med bidrag om den nyere nordiske udikling inden for LLL og traditionen fra Comenius til idag......Antologi om livslang læring med bidrag om den nyere nordiske udikling inden for LLL og traditionen fra Comenius til idag...

  3. Rad Chem data acquisition chassis users manual

    International Nuclear Information System (INIS)

    Jones, B.A.

    1980-01-01

    The Shiva Laser at LLL requires many forms of diagnostics to measure and analyze fusion experiments. This manual describes the operation of a Micro-Processor controlled data acquisition system designed at LLL to measure Neutron Activation during fusion experiments on the Shiva Laser

  4. Manufacturing cost study on the ion sources for the Mirror Fusion Test Facility

    International Nuclear Information System (INIS)

    A study of the cost of manufacturing 48 ion sources for the Mirror Fusion Test Facility is described. The estimate is built up from individual part costs and assembly operation times for the 80 kV prototype source constructed by LLL and described by LLL drawings furnished during December 1978. Recommendations for cost reduction are made

  5. Abstracts: NRC Waste Management Program reports

    Energy Technology Data Exchange (ETDEWEB)

    Heckman, R.A.; Minichino, C.

    1979-11-01

    This document consists of abstracts of all reports published by the Nuclear Regulatory Commission (NRC) Waste Management Program at Lawrence Livermore Laboratory (LLL). It will be updated at regular intervals. Reports are arranged in numerical order, within each category. Unless otherwise specified, authors are LLL scientists and engineers.

  6. Participation in Job-Related Lifelong Learning among Well-Educated Employees in the Nordic Countries

    Science.gov (United States)

    Tikkanen, Tarja; Nissinen, Kari

    2016-01-01

    The purpose of this study was to explore participation in job-related lifelong learning (LLL) among well-educated mature workers and compare it across four Nordic countries. Although this group generally is very active in LLL, the centrality of knowledge work in society, rapid pace of skills-renewal and rising learning demands for all…

  7. Abstracts: NRC Waste Management Program reports

    International Nuclear Information System (INIS)

    Heckman, R.A.; Minichino, C.

    1979-11-01

    This document consists of abstracts of all reports published by the Nuclear Regulatory Commission (NRC) Waste Management Program at Lawrence Livermore Laboratory (LLL). It will be updated at regular intervals. Reports are arranged in numerical order, within each category. Unless otherwise specified, authors are LLL scientists and engineers

  8. Investigation of the Lifelong Learning Tendency of College Students

    Science.gov (United States)

    Aksoy, Hamit; Erbay, Hasan; Kör, Hakan; Engin, Melih

    2017-01-01

    The concept of "lifelong learning (LLL)" has emerged because of the necessity of renewing earlier and immemorial information in time. LLL is involved in a various kind of international foundations' works. European Union is perceived as more efficient in comparison with international companies in terms of lifelong learning practices.…

  9. From Policy to Guidelines: Metamorphosis of Lifelong Learning in India

    Science.gov (United States)

    Mandal, Sayantan

    2013-01-01

    In this era of globalisation, the present perception of lifelong learning (LLL) in the Indian policy domain has been going through major changes in an attempt to make it nationally realistic yet globally viable. In this process, all facets of the concept of LLL are constantly metamorphosing, and this in many ways outperforms the older perception…

  10. Lifelong Learning as a goal - Do autonomy and self-regulation in school result in well prepared pupils?

    NARCIS (Netherlands)

    Lüftenegger, M.; Schober, B.; Van de Schoot, R.; Wagner, P.; Finsterwald, M.; Spiel, C.

    2012-01-01

    Fostering lifelong learning (LLL) is a topic of high relevance for current educational policy. School lays the cornerstone for the key components of LLL, specifically persistent motivation to learn and self-regulated learning behavior. The present study investigated the impact of classroom

  11. Lower limb lymphedema: experiences and perceptions of cancer patients in the late palliative stage.

    Science.gov (United States)

    Frid, Marianne; Strang, Peter; Friedrichsen, Maria J; Johansson, Karin

    2006-01-01

    Lower limb lymphedema (LLL) is a common but neglected problem in palliative cancer patients. No studies have focused on these patients' experiences of lymphedema. The aims of this study were to explore patients' experiences regarding LLL and how they manage to deal with this in the late palliative stage. Thirteen patients with cancer-related LLL were included to satisfy a maximum variation sampling strategy. Interviews were analyzed using a qualitative phenomenographic method. LLL influenced the patients' thoughts about the future. Body image was often strongly influenced. Interactions with other persons were perceived as both positive and negative, and a range of coping strategies were expressed. LLL can exert a considerable influence on the physical experiences and the psychosocial situation of cancer patients in palliative care. Areas in need of increased education, attention, and further research are highlighted.

  12. Eddy-induced salinity pattern in the North Pacific

    Science.gov (United States)

    Abe, H.; Ebuchi, N.; Ueno, H.; Ishiyama, H.; Matsumura, Y.

    2017-12-01

    This research examines spatio-temporal behavior of sea surface salinity (SSS) after intense rainfall events using observed data from Aquarius. Aquarius SSS in the North Pacific reveals one notable event in which SSS is locally freshened by intense rainfall. Although SSS pattern shortly after the rainfall reflects atmospheric pattern, its final form reflects ocean dynamic structure; an anticyclonic eddy. Since this anticyclonic eddy was located at SSS front created by precipitation, this eddy stirs the water in a clockwise direction. This eddy stirring was visible for several months. It is expected horizontal transport by mesoscale eddies would play significant role in determining upper ocean salinity structure.

  13. MR imaging of degenerative disc disease

    International Nuclear Information System (INIS)

    Farshad-Amacker, Nadja A.; Farshad, Mazda; Winklehner, Anna; Andreisek, Gustav

    2015-01-01

    Highlights: • This systematic literature review summarizes the current knowledge on MR imaging in degenerative disc disease. • Different classification systems for segmental spine degeneration are summarized. • It outlines the diagnostic limitations of MR imaging. - Abstract: Magnet resonance imaging (MRI) is the most commonly used imaging modality for diagnosis of degenerative disc disease (DDD). Lack of precise observations and documentation of aspects within the complex entity of DDD might partially be the cause of poor correlation of radiographic findings to clinical symptoms. This literature review summarizes the current knowledge on MRI in DDD and outlines the diagnostic limitations. The review further sensitizes the reader toward awareness of potentially untended aspects of DDD and the interaction of DDD and endplate changes. A summary of the available classifications for DDD is provided

  14. MR imaging of degenerative disc disease

    Energy Technology Data Exchange (ETDEWEB)

    Farshad-Amacker, Nadja A., E-mail: nadja.farshad@usz.ch [Institute of Diagnostic and Interventional Radiology, University Hospital of Zurich, Zurich (Switzerland); Farshad, Mazda [Department of Orthopaedic Surgery, Balgrist University Hospital, Zurich (Switzerland); Winklehner, Anna; Andreisek, Gustav [Institute of Diagnostic and Interventional Radiology, University Hospital of Zurich, Zurich (Switzerland)

    2015-09-15

    Highlights: • This systematic literature review summarizes the current knowledge on MR imaging in degenerative disc disease. • Different classification systems for segmental spine degeneration are summarized. • It outlines the diagnostic limitations of MR imaging. - Abstract: Magnet resonance imaging (MRI) is the most commonly used imaging modality for diagnosis of degenerative disc disease (DDD). Lack of precise observations and documentation of aspects within the complex entity of DDD might partially be the cause of poor correlation of radiographic findings to clinical symptoms. This literature review summarizes the current knowledge on MRI in DDD and outlines the diagnostic limitations. The review further sensitizes the reader toward awareness of potentially untended aspects of DDD and the interaction of DDD and endplate changes. A summary of the available classifications for DDD is provided.

  15. Effects of a low level laser on periodontal tissue in hypofunctional teeth.

    Directory of Open Access Journals (Sweden)

    Hidetaka Hayashi

    Full Text Available Malocclusions, such as an open bite and high canines, are often encountered in orthodontic practice. Teeth without occlusal stimuli are known as hypofunctional teeth, and numerous atrophic changes have been reported in the periodontal tissue, including reductions in blood vessels in the periodontal ligament (PDL, heavy root resorption, and reduced bone mineral density (BMD in the alveolar bone. Low Level Laser (LLL has been shown to have a positive effect on bone formation and the vasculature. Although the recovery of hypofunctional teeth remains unclear, LLL is expected to have a positive influence on periodontal tissue in occlusal hypofunction. The aim of the present study was to elucidate the relationship between LLL and periodontal tissue in occlusal hypofunction. Twenty-four male rats aged 5 weeks were randomly divided into control and hypofunctional groups. An anterior metal cap and bite plate were attached to the maxillary and mandibular incisors in the hypofunctional group to simulate occlusal hypofunction in the molars. LLL irradiation was applied to the maxillary first molar through the gingival sulcus in half of the rats. Rats were divided into four groups; control, control+LLL, hypofunctional, and hypofunctional+LLL. Exposure to LLL irradiation was performed for 3 minutes every other day for 2 weeks. Animals were examined by Micro-CT at 5 and 7 weeks and were subsequently sacrificed. Heads were resected and examined histologically and immunohistologically. The hypofunctional group had obvious stricture of the PDL. However, no significant differences were observed in the PDL and alveolar bone between the hypofunctional+LLL and the control groups. In addition, the expression of basic fibroblast growth factor (bFGF and vascular endothelial growth factor (VEGF-positive cells were higher in the hypofunctional + LLL group than in the hypofunctional group. These results indicated that LLL enhanced the production of bFGF and VEGF in the

  16. Subjective social status and health.

    Science.gov (United States)

    Euteneuer, Frank

    2014-09-01

    Subjective social status (SSS) predicts health outcomes above and beyond traditional objective measures of social status, such as education, income and occupation. This review summarizes and integrates recent findings on SSS and health. Current studies corroborate associations between low SSS and poor health indicators by extending previous findings to further populations and biological risk factors, providing meta-analytic evidence for adolescents and by demonstrating that negative affect may not confound associations between SSS and self-rated health. Recent findings also highlight the relevance of SSS changes (e.g. SSS loss in immigrants) and the need to consider cultural/ethnical differences in psychological mediators and associations between SSS and health. SSS is a comprehensive measure of one's social position that is related to several poor health outcomes and risk factors for disease. Future investigation, particularly prospective studies, should extend research on SSS and health to further countries/ethnic groups, also considering additional psychological and biological mediators and dynamic aspects of SSS. Recently developed experimental approaches to manipulate SSS may also be promising.

  17. Sensory-specific satiety is intact in rats made obese on a high-fat high-sugar choice diet.

    Science.gov (United States)

    Myers, Kevin P

    2017-05-01

    Sensory-specific satiety (SSS) is the temporary decreased pleasantness of a recently eaten food, which inhibits further eating. Evidence is currently mixed whether SSS is weaker in obese people, and whether such difference precedes or follows from the obese state. Animal models allow testing whether diet-induced obesity causes SSS impairment. Female rats (n = 24) were randomly assigned to an obesogenic high-fat, high-sugar choice diet or chow-only control. Tests of SSS involved pre-feeding a single palatable, distinctively-flavored food (cheese- or cocoa-flavored) prior to free choice between both foods. Rats were tested for short-term SSS (2 h pre-feeding immediately followed by 2 h choice) and long-term SSS (3 day pre-feeding prior to choice on day 4). In both short- and long-term tests rats exhibited SSS by shifting preference towards the food not recently eaten. SSS was not impaired in obese rats. On the contrary, in the long-term tests they showed stronger SSS than controls. This demonstrates that neither the obese state nor a history of excess energy consumption fundamentally causes impaired SSS in rats. The putative impaired SSS in obese people may instead reflect a specific predisposition, properties of the obesogenic diet, or history of restrictive dieting and bingeing. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. Documentation Driven Development for Complex Real-Time Systems

    Science.gov (United States)

    2004-12-01

    This paper presents a novel approach for development of complex real - time systems , called the documentation-driven development (DDD) approach. This... time systems . DDD will also support automated software generation based on a computational model and some relevant techniques. DDD includes two main...stakeholders to be easily involved in development processes and, therefore, significantly improve the agility of software development for complex real

  19. Impact of pacing modality and biventricular pacing on cardiac output and coronary conduit flow in the post-cardiotomy patient.

    LENUS (Irish Health Repository)

    Healy, David G

    2012-02-03

    We have previously demonstrated the role of univentricular pacing modalities in influencing coronary conduit flow in the immediate post-operative period in the cardiac surgery patient. We wanted to determine the mechanism of this improved coronary conduit and, in addition, to explore the possible benefits with biventricular pacing. Sixteen patients undergoing first time elective coronary artery bypass grafting who required pacing following surgery were recruited. Comparison of cardiac output and coronary conduit flow was performed between VVI and DDD pacing with a single right ventricular lead and biventricular pacing lead placement. Cardiac output was measured using arterial pulse waveform analysis while conduit flow was measured using ultrasonic transit time methodology. Cardiac output was greatest with DDD pacing using right ventricular lead placement only [DDD-univentricular 5.42 l (0.7), DDD-biventricular 5.33 l (0.8), VVI-univentricular 4.71 l (0.8), VVI-biventricular 4.68 l (0.6)]. DDD-univentricular pacing was significantly better than VVI-univentricular (P=0.023) and VVI-biventricular pacing (P=0.001) but there was no significant advantage to DDD-biventricular pacing (P=0.45). In relation to coronary conduit flow, DDD pacing again had the highest flow [DDD-univentricular 55 ml\\/min (24), DDD-biventricular 52 ml\\/min (25), VVI-univentricular 47 ml\\/min (23), VVI-biventricular 50 ml\\/min (26)]. DDD-univentricular pacing was significantly better than VVI-univentricular (P=0.006) pacing but not significantly different to VVI-biventricular pacing (P=0.109) or DDD-biventricular pacing (P=0.171). Pacing with a DDD modality offers the optimal coronary conduit flow by maximising cardiac output. Biventricular lead placement offered no significant benefit to coronary conduit flow or cardiac output.

  20. Comparing the Performance of Popular MEG/EEG Artifact Correction Methods in an Evoked-Response Study

    DEFF Research Database (Denmark)

    Haumann, Niels Trusbak; Parkkonen, Lauri; Kliuchko, Marina

    2016-01-01

    We here compared results achieved by applying popular methods for reducing artifacts in magnetoencephalography (MEG) and electroencephalography (EEG) recordings of the auditory evoked Mismatch Negativity (MMN) responses in healthy adult subjects. We compared the Signal Space Separation (SSS......) and temporal SSS (tSSS) methods for reducing noise from external and nearby sources. Our results showed that tSSS reduces the interference level more reliably than plain SSS, particularly for MEG gradiometers, also for healthy subjects not wearing strongly interfering magnetic material. Therefore, tSSS...... is recommended over SSS. Furthermore, we found that better artifact correction is achieved by applying Independent Component Analysis (ICA) in comparison to Signal Space Projection (SSP). Although SSP reduces the baseline noise level more than ICA, SSP also significantly reduces the signal—slightly more than...

  1. Fate of DDT in grape juice when fermented and distilled into arak

    International Nuclear Information System (INIS)

    Kawar, N.S.

    1975-01-01

    Since DDT is still used on grapevines to control insect pests, the fate of this insecticide in grape juice fermented and distilled into arak was investigated. Fermentation of the juice resulted in extensive conversion of DDT to DDD. Distillation of the fermented juice resulted in further conversion of DDT to DDD. Moreover, the major portion of both DDT and DDD remained in the undistilled fraction. The second distillation resulted in further distribution of DDT and DDD among the four fractions, thus leaving very low levels of both compounds in the finished product. DDT residue in arak constituted only 2% of the amount added to the fresh juice. (author)

  2. A pilot study and novel angiographic classification for superior sagittal sinus stenting in patients with non-thrombotic intracranial venous occlusive disease.

    Science.gov (United States)

    Raper, Daniel M S; Buell, Thomas J; Ding, Dale; Pomeraniec, I Jonathan; Crowley, R Webster; Liu, Kenneth C

    2018-01-01

    Safety and efficacy of superior sagittal sinus (SSS) stenting for non-thrombotic intracranial venous occlusive disease (VOD) is unknown. The aim of this retrospective cohort study is to evaluate outcomes after SSS stenting. We evaluated an institutional database to identify patients who underwent SSS stenting. Radiographic and clinical outcomes were analyzed and a novel angiographic classification of the SSS was proposed. We identified 19 patients; 42% developed SSS stenosis after transverse sinus stenting. Pre-stent maximum mean venous pressure (MVP) in the SSS of 16.2 mm Hg decreased to 13.1 mm Hg after stenting (p=0.037). Preoperative trans-stenosis pressure gradient of 4.2 mm Hg decreased to 1.5 mm Hg after stenting (pSSS stenosis distal to the stent construct was noted. Improvement in headache, tinnitus, and visual obscurations was reported by 66.7%, 63.6%, and 50% of affected patients, respectively, at mean follow-up of 5.2 months. We divided the SSS into four anatomically equal segments, numbered S1-S4, from the torcula to frontal pole. SSS stenosis typically occurs in the S1 segment, and the anterior extent of SSS stents was deployed at the S1-S2 junction in all but one case. SSS stenting is reasonably safe, may improve clinical symptoms, and significantly reduces maximum MVP and trans-stenosis pressure gradients in patients with VOD with SSS stenosis. The S1 segment is most commonly stenotic, and minimum pressure gradients for symptomatic SSS stenosis may be lower than for transverse or sigmoid stenosis. Additional studies and follow-up are necessary to better elucidate appropriate clinical indications and long-term efficacy of SSS stenting. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

  3. [Influence of human body target's spectral characteristics on visual range of low light level image intensifiers].

    Science.gov (United States)

    Zhang, Jun-Ju; Yang, Wen-Bin; Xu, Hui; Liu, Lei; Tao, Yuan-Yaun

    2013-11-01

    To study the effect of different human target's spectral reflective characteristic on low light level (LLL) image intensifier's distance, based on the spectral characteristics of the night-sky radiation and the spectral reflective coefficients of common clothes, we established a equation of human body target's spectral reflective distribution, and analyzed the spectral reflective characteristics of different human targets wearing the clothes of different color and different material, and from the actual detection equation of LLL image intensifier distance, discussed the detection capability of LLL image intensifier for different human target. The study shows that the effect of different human target's spectral reflective characteristic on LLL image intensifier distance is mainly reflected in the average reflectivity rho(-) and the initial contrast of the target and the background C0. Reflective coefficient and spectral reflection intensity of cotton clothes are higher than polyester clothes, and detection capability of LLL image intensifier is stronger for the human target wearing cotton clothes. Experimental results show that the LLL image intensifiers have longer visual ranges for targets who wear cotton clothes than targets who wear same color but polyester clothes, and have longer visual ranges for targets who wear light-colored clothes than targets who wear dark-colored clothes. And in the full moon illumination conditions, LLL image intensifiers are more sensitive to the clothes' material.

  4. The Relationship Between Academic Motivation and Lifelong Learning During Residency: A Study of Psychiatry Residents.

    Science.gov (United States)

    Sockalingam, Sanjeev; Wiljer, David; Yufe, Shira; Knox, Matthew K; Fefergrad, Mark; Silver, Ivan; Harris, Ilene; Tekian, Ara

    2016-10-01

    To examine the relationship between lifelong learning (LLL) and academic motivation for residents in a psychiatry residency program, trainee factors that influence LLL, and psychiatry residents' LLL practices. Between December 2014 and February 2015, 105 of 173 (61%) eligible psychiatry residents from the Department of Psychiatry, University of Toronto, completed a questionnaire with three study instruments: an LLL needs assessment survey, the Jefferson Scale of Physician Lifelong Learning (JeffSPLL), and the Academic Motivation Scale (AMS). The AMS included a relative autonomy motivation score (AMS-RAM) measuring the overall level of intrinsic motivation (IM). A significant correlation was observed between JeffSPLL and AMS-RAM scores (r = 0.39, P motivation identification domain (mean difference [M] = 0.38; 95% confidence interval [CI] [0.01, 0.75]; P = .045; d = 0.44) compared with senior residents. Clinician scientist stream (CSS) residents had significantly higher JeffSPLL scores compared with non-CSS residents (M = 3.15; 95% CI [0.52, 5.78]; P = .020; d = 0.57). The use of rigorous measures to study LLL and academic motivation confirmed prior research documenting the positive association between IM and LLL. The results suggest that postgraduate curricula aimed at enhancing IM, for example, through support for learning autonomously, could be beneficial to cultivating LLL in learners.

  5. Low level light in combination with metabolic modulators for effective therapy

    Science.gov (United States)

    Dong, Tingting; Zhang, Qi; Hamblin, Michael R.; Wu, Mei X.

    2015-03-01

    Vascular damage occurs frequently at the injured brain causing hypoxia and is associated with poor outcomes in the clinics. We found high levels of glycolysis, reduced ATP generation, and increased formation of reactive oxygen species (ROS) and apoptosis in neurons under hypoxia. Strikingly, these adverse events were reversed significantly by noninvasive exposure of injured brain to low-level light (LLL). LLL illumination sustained the mitochondrial membrane potential, constrained cytochrome C leakage in hypoxic cells, and protected them from apoptosis, underscoring a unique property of LLL. The effect of LLL was further bolstered by combination with metabolic substrates such as pyruvate or lactate both in vivo and in vitro. The combinational treatment retained memory and learning activities of injured mice to a normal level, whereas those treated with LLL or pyruvate alone, or sham light displayed partial or severe deficiency in these cognitive functions. In accordance with well-protected learning and memory function, the hippocampal region primarily responsible for learning and memory was completely protected by a combination of LLL and pyruvate, in marked contrast to the severe loss of hippocampal tissue due to secondary damage in control mice. These data clearly suggest that energy metabolic modulators can additively or synergistically enhance the therapeutic effect of LLL in energy-producing insufficient tissues like injured brain. Keywords:

  6. Detecting Myocardial Ischemia With 99mTechnetium-Tetrofosmin Myocardial Perfusion Imaging in Ischemic Stroke.

    Science.gov (United States)

    Giannopoulos, Sotirios; Markoula, Sofia; Sioka, Chrissa; Zouroudi, Sofia; Spiliotopoulou, Maria; Naka, Katerina K; Michalis, Lampros K; Fotopoulos, Andreas; Kyritsis, Athanassios P

    2017-10-01

    To assess the myocardial status in patients with stroke, employing myocardial perfusion imaging (MPI) with 99m Technetium-tetrofosmin ( 99m Tc-TF)-single-photon emission computed tomography (SPECT). Fifty-two patients with ischemic stroke were subjected to 99m Tc-TF-SPECT MPI within 1 month after stroke occurrence. None of the patients had any history or symptoms of coronary artery disease or other heart disease. Myocardial perfusion imaging was evaluated visually using a 17-segment polar map. Myocardial ischemia (MIS) was defined as present when the summed stress score (SSS) was >4; MIS was defined as mild when SSS was 4 to 8, and moderate/severe with SSS ≥9. Patients with SSS >4 were compared to patients with SSS SSS >9 were compared to patients with SSS SSS, with the oldest age exhibiting the highest SSS ( P = .01). The association of age with SSS remained statistically significant in the multivariate analysis ( P = .04). The study suggested that more than half of patients with stroke without a history of cardiac disease have MIS. Although most of them have mild MIS, we suggest a thorough cardiological evaluation in this group of patients for future prevention of severe myocardial outcome.

  7. A Structural Weight Estimation Program (SWEEP) for Aircraft. Volume 2 - Program Integration and Data Management Module. Part 1: Program Integration

    Science.gov (United States)

    1974-06-01

    MWl.OMSI«S>.0*tHlT«l,«lll«i OIIOSIOH OWIItl.OVHfMl ,D«VIMl .OMIIWOI . OVNI IMI .OVUIl IOMl oiicisiiM toiiMi, anii in lOUIvaOMX IOIII.TCinilll...0VII7lll.lD«VIII.DV»«lll. I IIMIII.DV«>IIII.IO«NI|1.0Vlt7IM.IOWTlll.DVIII2IM NMWUMK llonil.DVOIMIll. IVHI11 . OVNI tl II c OU ««MlLDVlll.tUOIfl

  8. Communication Strategy: Proper Structure Necessary but not Sufficient

    Science.gov (United States)

    2010-12-01

    Information, (1998), http://www.ncbi.nlm.nih.gov/ bookshelf /br.fcgi?book=nap6200&part=a20006484ddd00073 (accessed November 12, 2010). “The multidimensional...Biotechnology Information (1998). http://www.ncbi.nlm.nih.gov/ bookshelf /br.fcgi?book=nap6200&part=a20006484ddd000 73 (accessed November 12, 2010

  9. 47 CFR 80.324 - Transmission of distress message by station not itself in distress.

    Science.gov (United States)

    2010-10-01

    ... authorities who may be able to assist. (b) Transmission must be made on the international distress frequencies... radiotelegraphy is used: (i) The signal DDD SOS SOS SOS DDD: (ii) The word DE; (iii) The call sign of the... three times; (ii) The words THIS IS; (iii) The call sign or other identification of the transmitting...

  10. Enantiomeric ratios as an indicator of exposure processes for persistent pollutants in human placentas

    DEFF Research Database (Denmark)

    Shen, Heqing; Virtanen, H E; Main, Katharina M

    2006-01-01

    The enantiomeric ratios (ER) of alpha-HCH and o,p'-DDT ((+)-isomer concentration/(-)-isomer concentration) and o,p'-DDD (first eluting enantiomer/second enantiomer) were investigated in 112 human placentas from Finnish boys collected 1997-2001. Both o,p'-DDD and alpha-HCH showed changes in their ER...

  11. Microstructurally Based Cross-slip Mechanisms and Their Effects on Dislocation Microstructure Evolution in fcc Crystals

    Science.gov (United States)

    2015-01-01

    incorporated into DDD simulations. Accordingly, the motivation of the current work is to incorporate an atomistically informed cross-slip model into DDD... nudged elastic band method, Acta Mater. 59 (19) (2011) 7135–7144. [54] S.I. Rao, D.M. Dimiduk, J.A. El-Awady, T.A. Parthasarathy, M.D. Uchic, C. Woodward

  12. L. Sumera: Symphony No. 5 / Michael Scott Rohan

    Index Scriptorium Estoniae

    Rohan, Michael Scott

    1997-01-01

    L. Sumera: Symphony No. 5; Music for Chamber Orchestra, In memorian. Malmö Symphony Orchestra / Paavo Järvi. BIS CD-770. 64-35 DDD; Various. Searching for Roots - music from Estonia. Virgin VC 5 43242 2; 71: 34 DDD

  13. Eddy-induced Sea Surface Salinity changes in the tropical Pacific

    Science.gov (United States)

    Delcroix, T. C.; Chaigneau, A.; Soviadan, D.; Boutin, J.

    2017-12-01

    We analyse the Sea Surface Salinity (SSS) signature of westward propagating mesoscale eddies in the tropical Pacific by collocating 5 years (2010-2015) of SMOS (Soil Moisture and Ocean Salinity) SSS and altimetry-derived sea level anomalies. The main characteristics of mesoscale eddies are first identified in SLA maps. Composite analyses in the Central and Eastern ITCZ regions then reveal regionally dependent impacts with opposite SSS anomalies for the cyclonic and anticyclonic eddies. In the Central region (where we have the largest meridional SSS gradient), we found dipole-like SSS changes with maximum anomalies on the leading edge of the eddy. In the Eastern region (where we have the largest near-surface vertical salinity gradient) we found monopole-like SSS changes with maximum anomalies in the eddy centre. These dipole/monopole patterns and the rotational sense of eddies suggest the dominant role of horizontal and vertical advection in the Central and Eastern ITCZ regions, respectively.

  14. Evaluation of Aquarius Version-5 Sea Surface Salinity on various spatial and temporal scales

    Science.gov (United States)

    Lee, T.

    2017-12-01

    Sea surface salinity (SSS) products from Aquarius have had three public releases with progressive improvement in data quality: Versions 2, 3, and 4, with the last one being released in October 2015. A systematic assessment of the Version-4, Level-3 Aquarius SSS product was performed on various spatial and temporal scales by comparing it with gridded Argo products (Lee 2016, Geophys. Res. Lett.). The comparison showed that the consistency of Aquarius Version-4 SSS with gridded Argo products is comparable to that between two different gridded Argo products. However, significant seasonal biases remain in high-latitude oceans. Further improvements are being made by the Aquarius team. Aquarius Version 5.0 SSS is scheduled to be released in October 2017 as the final version of the Aquarius Project. This presentation provides a similar evaluation of Version-5 SSS as reported by Lee (2016) and contrast it with the current Version-4 SSS.

  15. Analgetikaforbrug, -overdosering og -dødsfald i Danmark 1979-1986

    DEFF Research Database (Denmark)

    Ott, P; Hansen, P B; Dalhoff, K P

    1990-01-01

    During 1978-1987 the annual sale of analgetics increased by 28% to 164 millions defined daily doses (mDDD) per year. Paracetamol changed status to over-the-counter drug by 1.1.1984 as did combinations of acetylicsalicylic acid and codein 14.5.1984. The consumption of paracetamol increased rapidly...... to 47 mDDD/-year, the mortality steadily decreasing to 0.07 deaths/mDDD in 1986. The consumption of salicylics decreased from 113 to 94 mDDD, of which the salicylic/codein combination constituted an increasing fraction. The mortality of salicylics increased from 0.05 death/mDDD in 1983 to 0.27/m...

  16. Perceived Socioeconomic Status: A New Type of Identity which Influences Adolescents’ Self Rated Health

    Science.gov (United States)

    Goodman, Elizabeth; Huang, Bin; Schafer-Kalkhoff, Tara; Adler, Nancy E.

    2007-01-01

    Purpose The cognitive, social, and biological transitions of adolescence suggest that subjective perceptions of social position based on the socioeconomic hierarchy may undergo important changes during this period, yet how such perceptions develop is poorly understood and no studies assess if changes in such perceptions influence adolescents’ health. This study describes adolescents’ subjective perceptions of familial socioeconomic status (SSS), how SSS changes over time, and how age, race, and objective socioeconomic status (SES) indicators influence SSS. In addition, the study determines if SSS independently influences adolescents’ self-rated health, an important predictor of morbidity and health service utilization. Methods 1179 non-Hispanic black and white baseline 7–12th graders from a Midwestern public school district completed a validated, teen-specific measure of SSS annually for 4 consecutive years. A parent provided information on SES. Markov modeling assessed transitions in SSS over time. Results SSS declined with age (p=.001) and stabilized among older teens. In addition to age, SES and race, but not gender, were significant correlates of SSS, but the relationships between these factors were complex. In cross-sectional and longitudinal analyses, black teens from families with low parent education had higher SSS than white teens from similarly educated families, while white teens from highly educated families had higher SSS than black teens from highly educated families. Lower SSS and changes in SSS predicted poor self rated health even when adjusting for race and objective SES measures. Conclusion Subjective evaluations of socioeconomic status predict adolescents’ global health ratings even when adjusting for the sociodemographic factors which shape them. PMID:17950168

  17. Mothers' knowledge, Perceptions and practices of Home based ...

    African Journals Online (AJOL)

    Almost all the respondents (99.0%) were aware of oral rehydration solution/salt sugar solution (ORS/SSS); and 87.7% agreed that ORS/SSS is effective for the treatment of diarrhea, but only 44.3% gave ORS/SSS, while 29.4% gave antibiotics/antidiarhea drugs to their children who suffered diarrhea. Only 40.9% knew how ...

  18. Soil Moisture Ocean Salinity (SMOS) salinity data validation over Malaysia coastal water

    International Nuclear Information System (INIS)

    Reba, M N M; Rosli, A Z; Rahim, N A

    2014-01-01

    The study of sea surface salinity (SSS) plays an important role in the marine ecosystem, estimation of global ocean circulation and observation of fisheries, aquaculture, coral reef and sea grass habitats. The new challenge of SSS estimation is to exploit the ocean surface brightness temperature (Tb) observed by the Microwave Imaging Radiometer with Aperture Synthesis (MIRAS) onboard the Soil Moisture Ocean Salinity (SMOS) satellite that is specifically designed to provide the best retrieval of ocean salinity and soil moisture using the L band of 1.4 GHz radiometer. Tb observed by radiometer is basically a function of the dielectric constant, sea surface temperature (SST), wind speed (U), incidence angle, polarization and SSS. Though, the SSS estimation is an ill-posed inversion problem as the relationship between the Tb and SSS is non-linear function. Objective of this study is to validate the SMOS SSS estimates with the ground-truth over the Malaysia coastal water. The LM iteratively determines the SSS of SMOS by the reduction of the sum of squared errors between Tb SMOS and Tb simulation (using in-situ) based on the updated geophysical triplet in the direction of the minimum of the cost function. The minimum cost function is compared to the desired threshold at each iteration and this recursive least square process updates the SST, U and SSS until the cost function converged. The designed LM's non-linear inversion algorithm simultaneously estimates SST, U and SSS and thus, map of SSS over Malaysia coastal water is produced from the regression model and accuracy assessment between the SMOS and in-situ retrieved SSS. This study found a good agreement in the validation with R square of 0.9 and the RMSE of 0.4. It is concluded that the non-linear inversion method is effective and practical to extract SMOS SSS, U and SST simultaneously

  19. The Effect of Psychological Suzhi on Problem Behaviors in Chinese Adolescents: The Mediating Role of Subjective Social Status and Self-esteem

    OpenAIRE

    Liu, Guangzeng; Zhang, Dajun; Pan, Yangu; Ma, Yuanxiao; Lu, Xingyue

    2017-01-01

    In this study, we examined subjective social status (SSS) and self-esteem as potential mediators between the association of psychological suzhi and problem behaviors in a sample of 1271 Chinese adolescents (44.5% male, grades 7–12). The results showed that SSS and self-esteem were fully mediating the relationship between psychological suzhi and problem behaviors. Moreover, the indirect effect was stronger via self-esteem than via SSS. These findings perhaps provide insight into the preliminar...

  20. Sequence Classification: 889924 [

    Lifescience Database Archive (English)

    Full Text Available the Sec61p translocation complex (Sec61p-Sss1p-Sbh1p) that forms a channel for passage of secretory protein...s through the endoplasmic reticulum membrane, and of the Ssh1p complex (Ssh1p-Sbh2p-Sss1p); interacts with Ost4p and Wbp1p; Sss1p || http://www.ncbi.nlm.nih.gov/protein/6320291 ...

  1. Subclavian steal syndrome without subclavian stenosis

    Directory of Open Access Journals (Sweden)

    Matt Cwinn, MD

    2017-09-01

    Full Text Available Subclavian steal syndrome (SSS has been well described in the setting of subclavian stenosis. We describe an unusual case of SSS caused by a high-flow arteriovenous dialysis fistula in the absence of subclavian stenosis, provide a review of the literature, and propose that arteriovenous fistula-induced SSS is an underdiagnosed cause of syncope in this population of patients.

  2. Treatment practices and quantification of antimicrobial drug usage in conventional and organic dairy farms in Wisconsin.

    Science.gov (United States)

    Pol, M; Ruegg, P L

    2007-01-01

    The objective of this study was to develop a method to quantify antimicrobial drug usage and treatment practices on conventional and organic dairy farms that had been recruited to represent a broad spectrum of potential exposure to antimicrobial drugs. Data on disease prevalence and treatment practices of organic (n = 20) and conventional (n = 20) farms were obtained during a farm visit using a survey instrument. A standardized estimate of antimicrobial drug usage was developed using a defined daily dose (DDD) of selected compounds. Density of antimicrobial drug usage was expressed as the number of DDD per adult cow per year. Differences in prevalence and management of selected diseases between conventional and organic farms were identified. The overall estimated prevalence of selected diseases was greater for conventional farms compared with organic farms. Organic farmers reported use of a variety of nonantimicrobial compounds for treatment and prevention of disease. Conventional farmers reported that penicillin was the compound most commonly used for dry cow therapy and cephapirin was most commonly used for treatment of clinical mastitis. On conventional farms, the estimated overall exposure to antimicrobial drugs was 5.43 DDD per cow per year composed of 3.58 and 1.85 DDD of intramammary and parenteral antimicrobial drugs, respectively. Of total intramammary antimicrobial drug usage, treatment of clinical mastitis contributed 2.02 DDD compared with 1.56 DDD attributed to the use of dry cow therapy. Of total parenteral treatments, the distribution of exposure was 0.52 (dry cow therapy), 1.43 (clinical mastitis treatment), 0.39 (treatment of foot disease), 0.14 (treatment of respiratory disease), and 0.32 (treatment of metritis) DDD. For treatments of foot infections (0.33 DDD), respiratory infections (0.07 DDD), and metritis (0.19 DDD), the mean density of ceftiofur usage was significantly greater compared with other compounds.

  3. Multicenter, prospective, randomized safety and efficacy study of a new atrial-based managed ventricular pacing mode (MVP) in dual chamber ICDs.

    Science.gov (United States)

    Sweeney, Michael O; Ellenbogen, Kenneth A; Casavant, David; Betzold, Robert; Sheldon, Todd; Tang, Feng; Mueller, Megan; Lingle, John

    2005-08-01

    Ventricular desynchronization caused by right ventricular pacing may impair ventricular function and increase risk of heart failure (CHF), atrial fibrillation (AF), and death. Conventional DDD/R mode often results in high cumulative percentage ventricular pacing (Cum%VP). We hypothesized that a new managed ventricular pacing mode (MVP) would safely provide AAI/R pacing with ventricular monitoring and DDD/R during AV block (AVB) and reduce Cum%VP compared to DDD/R. MVP RAMware was downloaded in 181 patients with Marquis DR ICDs. Patients were initially randomized to either MVP or DDD/R for 1 month, then crossed over to the opposite mode for 1 month. ICD diagnostics were analyzed for cumulative percentage atrial pacing (Cum%AP), Cum%VP, and duration of DDD/R pacing for spontaneous AVB. Baseline characteristics included age 66 +/- 12 years, EF 36 +/- 14%, and NYHA Class II-III 36%. Baseline PR interval was 190 +/- 53 msec and programmed AV intervals (DDD/R) were 216 +/- 50 (paced)/189 +/- 53 (sensed) msec. Mean Cum%VP was significantly lower in MVP versus DDD/R (4.1 +/- 16.3 vs 73.8 +/- 32.5, P MVP were 85.0 and 99.9, respectively. Mean Cum%AP was not different between MVP versus DDD/R (48.7 +/- 38.5 vs 47.3 +/- 38.4, P = 0.83). During MVP overall time spent in AAI/R was 89.6% (intrinsic conduction), DDD/R 6.7% (intermittent AVB), and DDI/R 3.7% (AF). No adverse events were attributed to MVP. MVP safely achieves functional atrial pacing by limiting ventricular pacing to periods of intermittent AVB and AF in ICD patients, significantly reducing Cum%VP compared to DDD/R. MVP is a universal pacing mode that adapts to AVB and AF, providing both atrial pacing and ventricular pacing support when needed.

  4. Learning Networks for Professional Development & Lifelong Learning

    NARCIS (Netherlands)

    Sloep, Peter

    2009-01-01

    Sloep, P. B. (2009). Learning Networks for Professional Development & Lifelong Learning. Presentation at a NeLLL seminar with Etienne Wenger held at the Open Universiteit Nederland. September, 10, 2009, Heerlen, The Netherlands.

  5. Astron Program final report

    International Nuclear Information System (INIS)

    Briggs, R.J.; Hester, R.E.; Porter, G.D.; Sherwood, W.A.; Spoerlein, R.; Stallard, B.W.; Taska, J.; Weiss, P.B.

    1975-01-01

    This report describes important experimental results obtained in the last two years of the Astron Program, an LLL controlled nuclear fusion program which terminated in 1973. Little theoretical work is included, but an extensive bibliography is given

  6. 76 FR 2405 - Notice of Proposed Information Collection: Brownfield Economic Development Initiative (BEDI)

    Science.gov (United States)

    2011-01-13

    ... Information Collection: Brownfield Economic Development Initiative (BEDI) AGENCY: Office of the Assistant... proposed use: The Brownfield Economic Development Initiative is authorized pursuant to Section 108(q... applicable: HUD 40123, Brownfields Economic Development Application; SF-LLL, Disclosure of Lobbying...

  7. Environmental monitoring at the Lawrence Livermore National Laboratory. 1981 annual report

    International Nuclear Information System (INIS)

    Auyong, M.; Griggs, K.S.; Buddemeier, R.W.

    1982-01-01

    This report gives methods and results of the 1981 radiation monitoring program at LLL for both radioactive and non-radioactive contamination from gaseous and liquid effluents. Off-site monitoring includes various radionuclides but especially tritium in the ecosystems

  8. The Anxiety of Meaninglessness.

    Science.gov (United States)

    Ruffin, Julian E.

    1984-01-01

    Reviews the etiology and consequences of meaninglessness and focuses on the therapeutic approaches of Viktor E. Frankl and J. F. T. Bugental. Concludes that meaninglessness is a significant contemporary problem that needs to be addressed by counselors. (Author/LLL)

  9. A generalized Fucik type eigenvalue problem for p-Laplacian

    Directory of Open Access Journals (Sweden)

    Yuanji Cheng

    2009-03-01

    \\left\\{\\begin{array}{lll} - (\\varphi( u' ' = \\psi(u, \\quad -T1.$ We obtain a explicit characterization of Fucik spectrum $(\\alpha, \\beta, \\lambda, \\mu,$ i.e., for which the (* has a nontrivial solution.

  10. Crack Propagation Test Results for Variable Amplitude Spectrum Loading in Surface Flawed D6ac Steel

    National Research Council Canada - National Science Library

    Wood, H

    1971-01-01

    .... All spectra used in the program represented the critical wing pivot locations for the F-lll aircraft and were applied in a randomized block sequence containing 58 layers representing 200 flight hours...

  11. Tanzania Journal of Forestry and Nature Conservation - Vol 79, No 1

    African Journals Online (AJOL)

    Soil erosion and sediment yield from the degraded Mzinga River Catchment in Uluguru Mountains, Tanzania · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. MK Mulengera, LLL Lulandala, SMS Maliondo, 47-57 ...

  12. F-111 Bonded Panel Repair Status

    National Research Council Canada - National Science Library

    Rider, Andrew

    1999-01-01

    A visit was made to Amberley Airbase between the 6th and 9th of September to consult with RAAF staff on current procedures and problems involved in the maintenance and repair of F-lll honeycomb panels...

  13. Lawrence Livermore Laboratory heavy ion fusion program

    International Nuclear Information System (INIS)

    Bangerter, R.O.; Lee, E.P.; Monsler, M.J.; Yu, S.S.

    1978-01-01

    Target design at LLL for heavy ion fusion power production is discussed, including target development and beam-target interaction. The energy conversion chamber design, which utilizes a liquid lithium blanket, is described. Ion beam transport theory is discussed

  14. effect of a mother-to-child hiv prevention programme on infant

    African Journals Online (AJOL)

    the time of the study the lllV seroprevalence rate among antenatal women was ... has important health, psychological and economic benefits to the mothers. ... HIV status, opinions about exclusive breast-feeding and early weaning practices ...

  15. Safeguards research at Lawrence Livermore Laboratory

    International Nuclear Information System (INIS)

    Dunn, D.R.; Huebel, J.G.; Poggio, A.J.

    1980-01-01

    The LLL safeguards research program includes inspection methods, facility assessment methodologies, value-impact analysis, vulnerability analysis of accounting systems, compliance with regulations, process monitoring, etc. Each of those projects is described as are their goals and progress

  16. School Counselors and Psychological Aspects of Learning Disabilities.

    Science.gov (United States)

    Fahey, David A.

    1984-01-01

    Provides an overview of some of the more common psychological theories and behavioral variables associated with learning disabilities. Reviews Adlerian Rational Emotive and behavioral and hypnotherapy approaches as intervention strategies for the counselor confronted with learning disabled students. (LLL)

  17. Rational-Emotive Therapy versus Systematic Desensitization: A Comment on Moleski and Tosi.

    Science.gov (United States)

    Atkinson, Leslie

    1983-01-01

    Questioned the statistical analyses of the Moleski and Tosi investigation of rational-emotive therapy versus systematic desensitization. Suggested means for lowering the error rate through a more efficient experimental design. Recommended a reanalysis of the original data. (LLL)

  18. Subjective social status predicts in vivo responsiveness of β-adrenergic receptors.

    Science.gov (United States)

    Euteneuer, Frank; Mills, Paul J; Rief, Winfried; Ziegler, Michael G; Dimsdale, Joel E

    2012-07-01

    Several poor health outcomes, including cardiovascular risk, have been associated with both subjective social status (SSS) and sympathetic overactivity. Because prolonged sympathetic overactivation down regulates beta adrenergic receptor (β-AR) function, reduced β-AR responsiveness is considered an indicator of sympathetic overactivity and a cardiovascular risk factor. Though prior research has focused on objective social status and β-AR function, no studies have examined the association between SSS and β-AR function. We aimed to learn whether SSS predicts the in vivo responsiveness of β-ARs. We assessed the chronotropic 25 dose (CD25), an in vivo marker of β-AR responsiveness, in 94 healthy participants. The MacArthur scales of subjective social status were used to assess SSS in the U.S.A. (SSS-USA) and in the local community (SSS-C). Objective social status was analyzed by calculating the Hollingshead two-factor index. β-AR responsiveness was reduced (as indicated by higher CD25 values) in participants with lower SSS-USA (p = .007) and lower SSS-C (p social status. Our results indicate that β-AR function may be an important component of the link between SSS and health.

  19. X-ray spectral models of Galactic bulge sources - the emission-line factor

    International Nuclear Information System (INIS)

    Vrtilek, S.D.; Swank, J.H.; Kallman, T.R.

    1988-01-01

    Current difficulties in finding unique and physically meaningful models for the X-ray spectra of Galactic bulge sources are exacerbated by the presence of strong, variable emission and absorption features that are not resolved by the instruments observing them. Nine Einstein solid state spectrometer (SSS) observations of five Galactic bulge sources are presented for which relatively high resolution objective grating spectrometer (OGS) data have been published. It is found that in every case the goodness of fit of simple models to SSS data is greatly improved by adding line features identified in the OGS that cannot be resolved by the SSS but nevertheless strongly influence the spectra observed by SSS. 32 references

  20. Axisymmetric thermoviscoelastoplastic state of branched laminar shells, taking account of transverse-shear and torsional deformation

    International Nuclear Information System (INIS)

    Galishin, A.Z.

    1995-01-01

    The nonaxisymmetric thermoelastic stress-strain state (SSS) of branched laminar orthotropic shells was considered; the axisymmetric thermoviscoelastic SSS of branched laminar orthotropic shells was considered; and the axisymmetric thermoviscoelastoplastic SSS of branched laminar isotropic shells was considered, taking into account of the transverse-shear deformation. In the present work, in contrast, the axisymmetric thermoviscoelastoplastic SSS of branched laminar isotropic shells is considered, taking account of transverse-shear and torsional deformation. Layers that are made from orthotropic materials and deform in the elastic region may be present

  1. Evaluation of higher brain function by MRI. Flow measurement in the superior sagittal sinus using phase contrast method

    International Nuclear Information System (INIS)

    Ono, Mototsugu

    1997-01-01

    To assess the higher brain function, flow measurement in the superior sagittal sinus (SSS) was performed noninvasively using a phase contrast MRI in 76 patients with suspicious of impaired higher brain function including dementias (senile dementia of Alzheimer type; SDAT and multi-infarct dementia; MID), strokes, and others. Thirty-one normal controls were consisted of 18 healthy volunteers and 13 patients with tension headache whose higher brain function was proved be normal. Mean flow velocity was measured in the distal portion of the SSS adjoining to the occipital lobes and was multiplied by cross-sectional area of the SSS at the measuring point to obtain mean flow volume. For intellectual index, cross-cultural cognitive examination (CCCE) was applied to all cases excluding volunteers. Normal value of SSS flow volume measured by MRI was 6.92±0.66 ml/s. Significant differences in both SSS flow and CCCE score from normal controls were found in SDAT group, MID group, and non-dementia group. No substantial differences between SDAT group and MID group were noted in both CCCE score and SSS flow. In normal controls, there was no correlation between SSS flow and age, whereas, significant inverse correlation of SSS flow with age was found in all cases. Between CCCE score and SSS flow, there were nearly linear relationships in all cases, SDAT group, MID group, and non-dementia group. Significant but relatively poor correlation was found in normals. (K.H.)

  2. Low childhood subjective social status and telomere length in adulthood: The role of attachment orientations.

    Science.gov (United States)

    Murdock, Kyle W; Seiler, Annina; Chirinos, Diana A; Garcini, Luz M; Acebo, Sally L; Cohen, Sheldon; Fagundes, Christopher P

    2018-04-01

    Low subjective social status (SSS) in childhood places one at greater risk of a number of health problems in adulthood. Theoretical and empirical evidence indicates that exposure to supportive parenting may buffer the negative effects of low childhood SSS on adult health. Given the importance of supportive caregivers and close others for the development of attachment orientations throughout the lifespan, attachment theory may be important for understanding why some individuals are resilient to the negative effects of low childhood SSS on adult health while others are not. We examined if attachment anxiety and attachment avoidance altered the association between childhood subjective social status (SSS) and length of telomeres in white blood cells in adulthood. Shorter telomere length is associated with increased risk of age-related diseases including cancer, type 2 diabetes, and cardiovascular disease. Participants (N = 128) completed self-report measures of childhood SSS and attachment orientations, as well as a blood draw. We found that among those with low childhood SSS, low attachment anxiety was associated with longer telomere length in white blood cells in comparison to high attachment anxiety controlling for participant age, sex, race, body mass index, and adult SSS. Among those with high childhood SSS, low attachment anxiety was associated with a slight decrease in telomere length. Attachment avoidance was unrelated to length of telomeres. Such findings provide further evidence for the role that close relationships may have on buffering SSS related health disparities. © 2018 Wiley Periodicals, Inc.

  3. Body Mass Index and Subjective Social Status: The Coronary Artery Risk Development in Young Adults Study.

    Science.gov (United States)

    Dhurandhar, Emily J; Pavela, Gregory; Kaiser, Kathryn A; Dutton, Gareth R; Fontaine, Kevin R; Kim, Daniel; Shikany, James M; Allison, David B; Lewis, Cora E

    2018-02-01

    Subjective social status (SSS), or perceived social status, may explain, in part, the relationship between socioeconomic status (SES) and obesity. The objective of this study was to test whether SSS mediates the relationship between two indicators of SES (income and education) and body mass index (BMI). A cross-sectional, structural equation path analysis was applied to the Coronary Artery Risk Development in Young Adults (CARDIA) study (n = 2,624). The analysis tested whether SSS (MacArthur scale), education, and income were associated with BMI at the year 20 examination (adjusting for sex, age, and race), and it was hypothesized that the associations of education and income with BMI would be at least partly mediated by SSS. SSS had a significant direct effect on BMI (-0.21, P = 0.018). Education had a significant direct relationship with SSS (0.11, P SSS (-0.02, P = 0.022). Although income did not have a significant direct relationship with BMI, it did have a significant indirect relationship through SSS (b = -0.05, P = 0.019). Results are consistent with the hypothesized model in which SSS partially mediates the relationship between SES indicators and BMI. © 2017 The Obesity Society.

  4. Choice of Magnetometers and Gradiometers after Signal Space Separation.

    Science.gov (United States)

    Garcés, Pilar; López-Sanz, David; Maestú, Fernando; Pereda, Ernesto

    2017-12-16

    Modern Elekta Neuromag MEG devices include 102 sensor triplets containing one magnetometer and two planar gradiometers. The first processing step is often a signal space separation (SSS), which provides a powerful noise reduction. A question commonly raised by researchers and reviewers relates to which data should be employed in analyses: (1) magnetometers only, (2) gradiometers only, (3) magnetometers and gradiometers together. The MEG community is currently divided with regard to the proper answer. First, we provide theoretical evidence that both gradiometers and magnetometers result from the backprojection of the same SSS components. Then, we compare resting state and task-related sensor and source estimations from magnetometers and gradiometers in real MEG recordings before and after SSS. SSS introduced a strong increase in the similarity between source time series derived from magnetometers and gradiometers (r² = 0.3-0.8 before SSS and r² > 0.80 after SSS). After SSS, resting state power spectrum and functional connectivity, as well as visual evoked responses, derived from both magnetometers and gradiometers were highly similar (Intraclass Correlation Coefficient > 0.8, r² > 0.8). After SSS, magnetometer and gradiometer data are estimated from a single set of SSS components (usually ≤ 80). Equivalent results can be obtained with both sensor types in typical MEG experiments.

  5. Simple introduction of sulfonic acid group onto polyethylene by radiation-induced cografting of sodium styrenesulfonate with hydrophilic monomers

    International Nuclear Information System (INIS)

    Tsuneda, Satoshi; Saito, Kyoichi; Furusaki, Shintaro; Sugo, Takanobu; Makuuchi, Keizo

    1993-01-01

    The sulfonic acid (SO 3 H) group was readily introduced into a polyethylene (PE) membrane by radiation-induced cografting of sodium styrenesulfonate (SSS) with hydrophilic monomers such as acrylic acid (AAc) and hydroxyethyl methacrylate (HEMA). The density of SSS grafted onto the PE membrane was determined as a function of molar ratio of hydrophilic monomer to SSS in the monomer mixture. Immersion of the electron-beam-irradiated PE membrane into the mixture of SSS and HEMA for 5 h at 323 K provided to the SO 3 H density of 2.5 mol/kg of the H-type product

  6. Views from the Coalface: What Do English Stop Smoking Service Personnel Think about E-Cigarettes?

    OpenAIRE

    Hiscock, Rosemary; Bauld, Linda; Arnott, Deborah; Dockrell, Martin; Ross, Louise; McEwen, Andy

    2015-01-01

    The UK Stop Smoking Services (SSS) are a source of information and advice on e-cigarettes for smokers and thus it is important to understand the knowledge of, and attitudes towards, e-cigarettes held by stop smoking practitioners. The datasets were English SSS quarterly monitoring returns (n = 207,883) and an online survey of English SSS practitioners, managers, and commissioners between 26th November and 15th December 2014 (n = 1801). SSS monitoring data suggested 2% of clients were using e-...

  7. Astrophysical research at Lawrence Livermore Laboratory, proposal for a formal program

    Energy Technology Data Exchange (ETDEWEB)

    Lokke, W.A.; Tarter, C.B.

    1979-12-01

    Basic research is often characterized as self-directed, moving on its own timescale, spurred by the unexpected. An effective, organized basic astrophysics research program does not have to be a contradiction in terms. A broadly chartered, long-range LLL Astrophysics Research Program, created and recognized by LLL management, can benefit the general scientific community, stimulate the staff, maintain important capability, and enrich the Laboratory.

  8. Participation in lifelong learning in Portugal and the UK

    OpenAIRE

    Hilary Ingham; Mike Ingham; Jose Adelino Afonso

    2013-01-01

    Lifelong learning (LLL) has now been on the agenda of the European Union and other major international organizations for some considerable time, with the European institutions stressing the need that such learning should be available to all, especially hard to reach groups. This paper seeks to explore LLL participation in Portugal and the UK, two countries at opposite ends of the adult learning spectrum and having very different labour market and educational contexts. Using Labour Force Surve...

  9. Mirror Fusion Test Facility (MFTF)

    International Nuclear Information System (INIS)

    Thomassen, K.I.

    1978-01-01

    A large, new Mirror Fusion Test Facility is under construction at LLL. Begun in FY78 it will be completed at the end of FY78 at a cost of $94.2M. This facility gives the mirror program the flexibility to explore mirror confinement principles at a signficant scale and advances the technology of large reactor-like devices. The role of MFTF in the LLL program is described here

  10. Miks läheb üks suur inimene lõpuks ikkagi kooli tagasi? / Agne Narusk

    Index Scriptorium Estoniae

    Narusk, Agne, 1971-

    2012-01-01

    Elukestva õppe rahvusvahelise teadusuuringu, milles osales 13 riiki, tulemustest selgub, et täiskasvanud õpivad eesmärgiga teha oma tööd paremini ja saada kõrgemat palka. Selgitusi jagavad rahvusvahelise teadusprojekti Lifelong Learning 2010 (LLL2010) töögrupi liige, Tallinna Ülikooli rahvusvaheliste ja sotsiaaluuringute instituudi teadur Eve-Liis Roosmaa ja LLL2010 koordinaator, professor Ellu Saar

  11. Miks läheb üks suur inimene lõpuks ikkagi kooli tagasi? / Agne Narusk

    Index Scriptorium Estoniae

    Narusk, Agne, 1971-

    2011-01-01

    Elukestva õppe rahvusvahelise teadusuuringu, milles osales 13 riiki, tulemustest selgub, et täiskasvanud õpivad eesmärgiga teha oma tööd paremini ja saada kõrgemat palka. Selgitusi jagavad rahvusvahelise teadusprojekti Lifelong Learning 2010 (LLL2010) töögrupi liige, Tallinna Ülikooli rahvusvaheliste ja sotsiaaluuringute instituudi teadur Eve-Liis Roosmaa ja LLL2010 koordinaator, professor Ellu Saar

  12. Astrophysical research at Lawrence Livermore Laboratory, proposal for a formal program

    International Nuclear Information System (INIS)

    Lokke, W.A.; Tarter, C.B.

    1979-12-01

    Basic research is often characterized as self-directed, moving on its own timescale, spurred by the unexpected. An effective, organized basic astrophysics research program does not have to be a contradiction in terms. A broadly chartered, long-range LLL Astrophysics Research Program, created and recognized by LLL management, can benefit the general scientific community, stimulate the staff, maintain important capability, and enrich the Laboratory

  13. Physical activity and lower limb lymphedema among uterine cancer survivors.

    Science.gov (United States)

    Brown, Justin C; John, Gabriella M; Segal, Saya; Chu, Christina S; Schmitz, Kathryn H

    2013-11-01

    Physical activity (PA) is known to provide physical and mental health benefits to uterine cancer survivors. However, it is unknown if PA is associated with lower limb lymphedema (LLL), an accumulation of protein-rich fluid in the lower limbs. Therefore, we sought to examine the association between PA and LLL in uterine cancer survivors, with a focus on walking. We conducted a cross-sectional study using mailed surveys among uterine cancer survivors who received care at a university-based cancer center. We asked about PA, walking, and LLL symptoms using validated self-report questionnaires. PA was calculated using MET-hours per week, and walking was calculated using blocks per day. The response rate to our survey was 43%. Among the 213 uterine cancer survivors in our survey, 36% were classified as having LLL. Compared with participants who reported trend = 0.003). Stratified analyses suggested the association between PA and LLL existed only among women with body mass index (BMI) trend = 0.007) compared with women with BMI ≥ 30 kg · m (P trend = 0.47). Compared with participants who reported trend trend = 0.007) and women with BMI ≥ 30 kg · m (P trend = 0.03). Participation in higher levels of PA or walking is associated with reduced proportions of LLL in dose-response fashion. These findings should be interpreted as preliminary and should be investigated in future studies.

  14. An exploration of the subjective social status construct in patients with acute coronary syndrome.

    Science.gov (United States)

    Tang, Karen L; Pilote, Louise; Behlouli, Hassan; Godley, Jenny; Ghali, William A

    2018-02-06

    Perception of low subjective social status (SSS) relative to others in society or in the community has been associated with increased risk of cardiovascular disease. Our objectives were to determine whether low SSS in society was associated with barriers to access to care or hospital readmission in patients with established cardiovascular disease, and whether perceptions of discordantly high SSS in the community modified this association. We conducted a prospective cohort study from 2009 to 2013 in Canada, United States, and Switzerland in patients admitted to hospital with acute coronary syndrome (ACS). Data on access to care and SSS variables were obtained at baseline. Readmission data were obtained 12 months post-discharge. We conducted multivariable logistic regression to model the odds of access to care and readmission outcomes in those with low versus high societal SSS. One thousand ninety patients admitted with ACS provided both societal and community SSS rankings. The low societal SSS cohort had greater odds of reporting that their health was affected by lack of health care access (OR 1.48, 95% CI 1.11, 1.97) and of experiencing cardiac readmissions (1.88, 95% CI 1.15, 3.06). Within the low societal SSS cohort, there was a trend toward fewer access to care barriers for those with discordantly high community SSS though findings varied based on the outcome variable. There were no statistically significant differences in readmissions based on community SSS rankings. Low societal SSS is associated with increased barriers to access to care and cardiac readmissions. Though attenuated, these trends remained even when adjusting for clinical and sociodemographic factors, suggesting that perceived low societal SSS has health effects above and beyond objective socioeconomic factors. Furthermore, high community SSS may potentially mitigate the risk of experiencing barriers to access to health care in those with low societal SSS, though these associations were not

  15. Adrenal metabolism of mitotane and related compounds

    International Nuclear Information System (INIS)

    Djanegara, T.K.S.

    1989-01-01

    Mitotane (o,p'-DDD; 1-[2-chlorophenyl]-1-[4-chlorophenyl]-2,2-dichloroethane) has been used in the treatment of Cushing's syndrome due to adrenal hyperfunction and it the drug of choice for adrenocortical carcinoma. The object of this investigation is to study the biotransformation of o,p'-DDD and p,p'-DDD in dogs and bovine adrenal cortex to explain its selective toxicity and mechanism of action. The in vitro biotransformation of 14 C-labeled o,p'-DDD and p,p'-DDD by dog and bovine adrenal cortex as studied. Of the cortex subcellular fractions, the cytosol fraction was found to be the most active in metabolizing the substrates, followed by the mitochondrial fraction. This metabolism including that in cytosolic fractions, did not take place with boiled enzyme preparations and required an NADPH generating system. This study has been directed towards establishing the metabolic activation mechanism which may account for the adrenocorticolytic effect of mitotane in contrast to detoxication by the liver. HPLC and TLC metabolic profiles have been generated from incubations of bovine and dog adrenal cortex homogenates and their subfractions for 14 C-labeled p,p'-DDD, o,p'-DDD and its monochloroethylene derivative, o,p'-DDMU

  16. Diversity of bacterial dimethylsulfoniopropionate degradation genes in surface seawater of Arctic Kongsfjorden.

    Science.gov (United States)

    Zeng, Yin-Xin; Qiao, Zong-Yun; Yu, Yong; Li, Hui-Rong; Luo, Wei

    2016-09-08

    Dimethylsulfoniopropionate (DMSP), which is the major source of organic sulfur in the world's oceans, plays a significant role in the global sulfur cycle. This compound is rapidly degraded by marine bacteria either by cleavage to dimethylsulfide (DMS) or demethylation to 3-methylmercaptopropionate (MMPA). The diversity of genes encoding bacterial demethylation (dmdA) and DMS production (dddL and dddP) were measured in Arctic Kongsfjorden. Both dmdA and dddL genes were detected in all stations along a transect from the outer to the inner fjord, while dddP gene was only found in the outer and middle parts of the fjord. The dmdA gene was completely confined to the Roseobacter clade, while the dddL gene was confined to the genus Sulfitobacter. Although the dddP gene pool was also dominated by homologs from the Roseobacter clade, there were a few dddP genes showing close relationships to both Alphaproteobacter and Gammaproteobacter. The results of this study suggest that the Roseobacter clade may play an important role in DMSP catabolism via both demethylation and cleavage pathways in surface waters of Kongsfjorden during summer.

  17. DETERMINATION OF A MATHEMATICAL MODEL TO ESTIMATE THE AREA AND DRY WEIGHT OF THE LEAF LIMBO OF Prunus persica CV. Jarillo DETERMINACIÓN DE UN MODELO MATEMÁTICO PARA LA ESTIMACIÓN DEL ÁREA FOLIAR Y PESO SECO DEL LIMBO DE Prunus persica CV. Jarillo

    Directory of Open Access Journals (Sweden)

    Enrique Quevedo García

    2012-06-01

    Full Text Available Abstract. A study was conducted to determine the variables that estimated the leaf limbo area and the leaf limbo dry weight of peach Prunus persica (L. Batsch cv. Jarillo. Fifty leaves, aged 2.5 months, were selected and measured: leaf limbo length and width, petiole length, leaf length, petiole diameter, leaf limbo fresh weight, petiole fresh weight, leaf fresh weight, leaf limbo dry weight, petiole dry weight, leaf dry weight, length/width limbo, petiole length/limbo length and leaf limbo area. The results allowed to obtain regression equations for estimating the leaf area and the limbo dry weight. Using the lineal models LA = b1 + b2 (LLL x LLW and LA= b1+ b2LLL + b3LLW a leaf area equation was determined. Alternative models to calculate limbo dry weight were evaluated LLDW = -b1+ b2 LLFW and LLDW= - b1 + b2LLL + b3PL. The best equations found with an R2 of 0.99 were LA = 1.572 + 0.65169(LLL x LLW, LA=-23.106+2.8064LLW + 3.6761LLL and LLDW = -0.002+0.401(LLFW.Resumen. Se realizó un estudio para determinar las variables que estimaran el área del limbo foliar y el peso seco del limbo de durazno Prunus persica (L. Batsch cv. Jarillo. Se seleccionaron cincuenta hojas con 2,5 meses de edad, fueron medidos: ancho del limbo, longitud del limbo, longitud del peciolo, longitud hoja, diámetro peciolo, peso fresco del limbo, peso fresco del peciolo, peso fresco de la hoja, peso seco del limbo, peso seco peciolo, peso seco de la hoja, longitud /ancho limbo, longitud del peciolo/longitud del limbo, área foliar del limbo. Los resultados alcanzados permitieron obtener ecuaciones de regresión para estimar el área foliar del limbo y el peso seco del limbo. Se halló una ecuación para la determinación del área foliar del limbo con los modelos lineales LA = b1 + b2 (LLL x LLW y LA= b1 + b2LLL + b3LLW. También se evaluaron modelos alternativas para calcular el peso seco del limbo, LLDW = -b1+ b2LLFW y LLDW= - b1 + b2LLL + b3PL. Las mejores ecuaciones

  18. Subband structure comparison between n- and p- type double delta-doped Ga As quantum wells

    International Nuclear Information System (INIS)

    Rodriguez V, I.; Gaggero S, L.M.

    2004-01-01

    We compute the electron level structure (n-type) and the hole subband structure (p-type) of double -doped GaAs (DDD) quantum wells, considering exchange effects. The Thomas-Fermi (TF), and Thomas-Fermi-Dirac (TFD) approximations have been applied in order to describe the bending of the conduction and valence band, respectively. The electron and the hole subband structure study indicates that exchange effects are more important in p-type DDD quantum wells than in n-type DDD Also our results agree with the experimental data available. (Author) 33 refs., 2 tabs., 5 figs

  19. Academic Attitudes and Achievement in Students of Urban Public Single-Sex and Mixed-Sex High Schools

    Science.gov (United States)

    Else-Quest, Nicole M.; Peterca, Oana

    2015-01-01

    Publicly funded single-sex schooling (SSS) has proliferated in recent years and is touted as a remedy to gaps in academic attitudes and achievement, particularly for low-income students of color. Research on SSS is rife with limitations, stemming from selective admissions processes, selection effects related to socioeconomic status, a lack of…

  20. Surgical Treatment of Snapping Scapula Syndrome Due to Malunion of Rib Fractures.

    Science.gov (United States)

    Ten Duis, Kaj; IJpma, Frank F A

    2017-02-01

    This report describes a case of snapping scapula syndrome (SSS) caused by malunited rib fractures. Abrasion of the deformed ribs was performed with good results. SSS as a cause of shoulder pain after thoracic trauma has to be considered and can be treated by a surgical abrasion technique. Copyright © 2017 The Society of Thoracic Surgeons. Published by Elsevier Inc. All rights reserved.

  1. Impact of Interactive Engagement on Reducing the Gender Gap in Quantum Physics Learning Outcomes among Senior Secondary School Students

    Science.gov (United States)

    Adegoke, Benson Adesina

    2012-01-01

    In this study, the author examines the extent to which an interactive engagement approach can reduce the gender gap in senior secondary school (SSS) (age 16-18 years) students' learning outcomes in quantum physics. One hundred and twenty one (male = 65; female = 56) SSS 3 students participated in this study. They were randomly selected from two…

  2. Relationships Between Dimensions of Anxiety and Sensation Seeking

    Science.gov (United States)

    Burkhart, Barry R.; And Others

    1978-01-01

    Undergraduates (130 males, 112 females) completed the Sensation Seeking Scale (SSS) and the S-R Inventory of General Trait Anxiousness (S-R GTA). The intercorrelations among the five scales from the SSS and the four scales from the S-R GTA were computed and compared. Findings were consistent with rational and theoretical notions. (Author)

  3. Social Support Seeking in Relation to Parental Attachment and Peer Relationships among Victims of Cyberbullying

    Science.gov (United States)

    Ševcíková, Anna; Machácková, Hana; Wright, Michelle F.; Dedková, Lenka; Cerná, Alena

    2015-01-01

    Victims use social support seeking (SSS) to buffer the negative effects of cyberbullying. It is unknown whether cybervictims' perceptions of harm and having poor peer and parental relationships influence SSS. Using a sample of 451 cyberbullying-victims, aged 12-18, 68% girls, this study examined relationships of gender, harm, peer rejection,…

  4. Low-Frequency Surface Backscattering Strengths Measured in the Critical Sea Test Experiments

    Science.gov (United States)

    2017-01-19

    same vessel over a 0.5- to 1-h period, where they exploded at depth, resulting in a bistatic source-receiver geometry. Spatially- Hammed beams with...CST-8 Run B18. 63 5. CROSS-RUN CST SSS EXAMPLES Fig. 5-1 − Cross-CST SUS SSS results at (a) 85 Hz and (b) 1360 Hz, color

  5. Precision transport of LHC superconducting magnet

    CERN Multimedia

    Maximilien Brice

    2003-01-01

    These photos show tests of the first convoy with a prototype short straight section (SSS) quadrupole in the LHC tunnel. There is little free space in the tunnel as the SSS convoy passes alongside a dipole vacuum vessel. These convoys feature infrared guidance, which offsets the minimal clearance in the tunnel and limits vibration, both of which could damage the fragile magnets.

  6. Associations of subjective social status with accelerometer-based physical activity and sedentary time among adolescents.

    Science.gov (United States)

    Rajala, Katja; Kankaanpää, Anna; Laine, Kaarlo; Itkonen, Hannu; Goodman, Elizabeth; Tammelin, Tuija

    2018-06-11

    This study examined the associations of subjective social status (SSS) with physical activity (PA) and sedentary time (ST) among adolescents. The study population consisted of 420 Finnish adolescents aged 13 to 14 years. The adolescents reported their own SSS within their school (school SSS) and their family's social position within society (society SSS) based on the youth version of the Subjective Social Status Scale. Adolescents' moderate- to vigorous-intensity physical activity (MVPA) and ST were measured objectively by accelerometers and analyzed separately for the whole day and the school day. The associations between SSS and MVPA and ST outcomes were analyzed using multilevel modeling. School SSS was positively associated with whole-day MVPA and negatively associated with school-time ST. Society SSS was not significantly associated with objectively measured MVPA or ST. Both MVPA and ST are important behavioral determinants of health. As an important correlate of MVPA and ST, school SSS should be addressed by providers when discussing obesity risk and healthy behaviors with adolescents.

  7. The dural entrance of cerebral bridging veins into the superior sagittal sinus: an anatomical comparison between cadavers and digital subtraction angiography

    International Nuclear Information System (INIS)

    Han, Hui; Tao, Wei; Zhang, Ming

    2007-01-01

    Intracranial venous structures have received increasing attention due to improved neuroimaging techniques and increased awareness of cerebral venous disease. To date, few studies have attempted to investigate the dural entrance of the cerebral bridging vein (BV). The aim of this study was to use the superior sagittal sinus (SSS) as an example to identify anatomical features of the dural entrance of the BVs into the SSS in both human cadavers and digital subtraction angiography (DSA) images. A total of 30 adult and 7 fetal human cadavers and 36 patients were examined with anatomical dissections, vascular casting and DSA. The number, diameter and angle of the BVs entering the SSS were measured and compared between the cadavers and DSA images. The results demonstrated that (1) the way a BV entered the SSS varied in three dimensions, and thus the BV dural entrance was difficult to precisely localize by DSA, (2) the distribution pattern of the dural entrance of the BVs into the SSS was relatively constant and a nontributary segment of the SSS was centered at the coronal suture and was identifiable by DSA, and (3) nearly all the BVs (97%, 561/581) entered the SSS at an angle opposite to the direction of blood flow. Unique anatomical features of the dural entrance of a BV into the SSS should be considered in neuroimaging interpretation of the sinus and its associated veins. (orig.)

  8. Effects of complexity and intensity on sensory specific satiety and food acceptance after repeated consumption

    NARCIS (Netherlands)

    Weijzen, P.L.G.; Zandstra, E.H.; Graaf, de C.

    2008-01-01

    The objectives of the present work were (1) to study the effects of complexity and intensity of foods on sensory specific satiety (SSS) and their acceptance after repeated consumption, and (2) to determine the predictive value of SSS for acceptance over repeated consumption. Two studies were

  9. Transient reduction in theta power caused by interictal spikes in human temporal lobe epilepsy.

    Science.gov (United States)

    Manling Ge; Jundan Guo; Yangyang Xing; Zhiguo Feng; Weide Lu; Xinxin Ma; Yuehua Geng; Xin Zhang

    2017-07-01

    The inhibitory impacts of spikes on LFP theta rhythms(4-8Hz) are investigated around sporadic spikes(SSs) based on intracerebral EEG of 4 REM sleep patients with temporal lobe epilepsy(TLE) under the pre-surgical monitoring. Sequential interictal spikes in both genesis area and extended propagation pathway are collected, that, SSs genesis only in anterior hippocampus(aH)(possible propagation pathway in Entorhinal cortex(EC)), only in EC(possible propagation pathway in aH), and in both aH and EC synchronously. Instantaneous theta power was estimated by using Gabor wavelet transform, and theta power level was estimated by averaged over time and frequency before SSs(350ms pre-spike) and after SSs(350ms post-spike). The inhibitory effect around spikes was evaluated by the ratio of theta power level difference between pre-spike and post-spike to pre-spike theta power level. The findings were that theta power level was reduced across SSs, and the effects were more sever in the case of SSs in both aH and EC synchronously than either SSs only in EC or SSs only in aH. It is concluded that interictal spikes impair LFP theta rhythms transiently and directly. The work suggests that the reduction of theta power after the interictal spike might be an evaluation indicator of damage of epilepsy to human cognitive rhythms.

  10. Screening and identification of steroidal saponins from Anemarrhena asphodeloides employing UPLC tandem triple quadrupole linear ion trap mass spectrometry.

    Science.gov (United States)

    Xia, Yong-Gang; Guo, Xin-Dong; Liang, Jun; Yang, Bing-You; Kuang, Hai-Xue

    2017-09-01

    This study presents a practical and valid strategy for the screening and structural characterization of Anemarrhena asphodeloides Bge steroidal saponins (SSs) using ultra-high performance liquid chromatography coupled with triple quadrupole linear ion trap mass spectrometry. The whole analytical protocols integrate four-step procedures in the positive mode: (1) rational deduction of mass fragmentation pathways of A. asphodeloides SSs; (2) untargeted screening of potential A. asphodeloides SSs by multiple-ion monitoring-information-dependent-acquiring-enhanced product ion (MIM-IDA-EPI) scan through reverse phase liquid chromatography; (3) comprehensive construction of an ammoniated precursor ion database by combining untargeted MIM-IDA-EPI scans and data literature; and (4) structural interpretation of targeted A. asphodeloides SSs using MIM-IDA-EPI and multiple reaction monitoring (MRM)-IDA-EPI with an energy-resolved technique. The protocols were used to analyze SSs in A. asphodeloides; of the 87 detected SSs that were unambiguously characterized or tentatively identified, 19 compounds were the first to be reported from A. asphodeloides and 13 ones were characterized as potential new compounds. Accuracy of the analytical procedure was demonstrated by structural identification of three SSs by NMR spectroscopy. The proposed schemes hold an excellent promise in the structural prediction and interpretation of complex SSs from plant medicines by mass spectrometry. Copyright © 2017 Elsevier Inc. All rights reserved.

  11. Analysis of the competitive position of short sea shipping : Development of policy measures

    NARCIS (Netherlands)

    Peeters, C.; Verbeke, A.; Declercq, E.; Wijnolst, N.

    1995-01-01

    This study on the potentialof Short Sea Shipping (SSS) in Europe, with a focus on four corridors, consists of four parts. In the first part (Chapter I) the existing intra-European SSS-traffic is identified and analyzed for each relevant category of goods and transport corridor. In the second part

  12. One-Month to 10-Year Survival in the Copenhagen Stroke Study

    DEFF Research Database (Denmark)

    Andersen, Klaus Kaae; Olsen, Tom Skyhøj

    2011-01-01

    .0 years; 56% women; mean Scandinavian Stroke Scale [SSS], 38.0 ± 17.4). Evaluation included stroke severity (based on the SSS), computed tomography scan, and a cardiovascular risk profile. Using logistic regression models, we examined the relevance of the SSS on mortality at 1 month and 1, 5, and 10 years....... We analyzed the proportion of the variation explained by the models and bias of risk factors estimates with and without the SSS in the model. Mortality rate was 16.6% at 1 month, 31.5% at 1 year, 60.2% at 5 years, and 81.3% at 10 years. In models including the SSS, 22.4%, 20.9%, 32.8%, and 39.......5% of the variance was explained for the endpoints of 1 month, 1 year, 5 years, and 10 years, respectively. When SSS was left out of the model, the corresponding values were 6.9%, 13.3%, 29.0%, and 35.1%. Factors significantly associated with survival were SSS at 1 month; SSS, age, diabetes, and stroke type at 1...

  13. Sensory specific satiety and intake: The difference between nibble- and bar-size snacks

    NARCIS (Netherlands)

    Weijzen, P.L.G.; Liem, D.G.; Zandstra, E.H.; Graaf, de C.

    2008-01-01

    The present study investigated (1) whether consumption of a nibble-size snack, as compared to a bar-size snack, leads to more sensory specific satiety (SSS) and a lower intake; and (2) whether attention to consumption, as compared to usual consumption, leads to more SSS and a lower intake. Subjects

  14. Subjective Social Status and Positive Indicators of Well-Being among Emerging Adult College Students

    Science.gov (United States)

    Zorotovich, Jennifer; Johnson, Elizabeth I.; Linn, Rebekah

    2016-01-01

    The current study extends research on social status and well-being among young people by examining whether subjective social status (SSS) is related to life satisfaction and happiness. Emerging adults (n = 383) between 18 and 29 provided data on demographic characteristics, SSS, life satisfaction, and happiness via an online survey. Regression…

  15. Synaesthetic perception of colour and visual space in a blind subject: An fMRI case study

    NARCIS (Netherlands)

    Niccolai, V.; Leeuwen, T.M. van; Blakemore, C.; Störig, P.

    2012-01-01

    In spatial sequence synaesthesia (SSS) ordinal stimuli are perceived as arranged in peripersonal space. Using fMRI, we examined the neural bases of SSS and colour synaesthesia for spoken words in a late-blind synaesthete, JF. He reported days of the week and months of the year as both coloured and

  16. Subjective Social Status, Mental and Psychosocial Health, and Birth Weight Differences in Mexican-American and Mexican Immigrant Women.

    Science.gov (United States)

    Fleuriet, K Jill; Sunil, T S

    2015-12-01

    Recent Mexican immigrant women on average have an unexpectedly low incidence of low birth weight (LBW). Birth weights decline and LBW incidence increases in post-immigrant generations. This pilot project tested the hypothesis that subjective social status (SSS) of pregnant women predicts variation in birth weight between Mexican immigrant and Mexican-American women. 300 low-income pregnant Mexican immigrant and Mexican-American women in South Texas were surveyed for SSS, depression, pregnancy-related anxiety, perceived social stress and self-esteem and subsequent birth weight. No significant difference in SSS levels between pregnant Mexican immigrant and Mexican-American women were found. However, SSS better predicted variation in birth weight across both groups than mental and psychosocial health variables. Results suggest distinct relationships among SSS, mental and psychosocial health that could impact birth weight. They underscore the relevance of a multilevel, biopsychosocial analytical framework to studying LBW.

  17. Dysfunctional illness perception and illness behaviour associated with high somatic symptom severity and low quality of life in general hospital outpatients in China.

    Science.gov (United States)

    Zhang, Yaoyin; Fritzsche, Kurt; Leonhart, Rainer; Zhao, Xudong; Zhang, Lan; Wei, Jing; Yang, Jianzhong; Wirsching, Michael; Nater-Mewes, Ricarda; Larisch, Astrid; Schaefert, Rainer

    2014-09-01

    In primary care populations in Western countries, high somatic symptom severity (SSS) and low quality of life (QoL) are associated with adverse psychobehavioural characteristics. This study assessed the relationship between SSS, QoL and psychobehavioural characteristics in Chinese general hospital outpatients. This multicentre cross-sectional study enrolled 404 patients from 10 outpatient departments, including Neurology, Gastroenterology, Traditional Chinese Medicine [TCM] and Psychosomatic Medicine departments, in Beijing, Shanghai, Chengdu and Kunming. A structured interview was used to assess the cognitive, affective and behavioural features associated with somatic complaints, independent of their origin. Several standard instruments were used to assess SSS, emotional distress and health-related QoL. Patients who reported low SSS (PHQ-15Western countries, high SSS was associated with negative illness and self-perception, low physical QoL with avoidance behaviour, and low mental QoL with reassurance seeking in Chinese general hospital outpatients. Copyright © 2014 Elsevier Inc. All rights reserved.

  18. Acute MRI changes in progressive ischemic stroke

    DEFF Research Database (Denmark)

    Kalowska, E.; Rostrup, E.; Rosenbaum, S.

    2008-01-01

    as a permanent decrease of >or=3 Scandinavian Stroke Scale (SSS) points for speech or >or=2 SSS points for consciousness or >or=2 SSS points for limb strength, when assessed at baseline compared to the day after admission and daily during the following week. Patients were followed up on day 90 and assessed using...... the modified Rankin Scale, Barthel Index and SSS score. Patients with and without SIP were compared using both clinical and MRI data obtained on admission, on day 7 and after 3 months. RESULTS: Fifteen patients (37%) developed SIP. Increased DWI lesion volume on day 7 in all strokes was associated with SIP...... (chi(2), p = 0.005). All lacunar infarcts with a DWI volume >1.5 cm(3) at baseline (4 patients) developed SIP (p SSS scores with severer symptoms than non-SIP patients (p Udgivelsesdato: 2008...

  19. LA phonons scattering of surface electrons in Bi2Se3

    International Nuclear Information System (INIS)

    Huang, Lang-Tao; Zhu, Bang-Fen

    2013-01-01

    Within the Boltzmann equation formalism we evaluate the transport relaxation time of Dirac surface states (SSs) in the typical topological insulator(TI) Bi 2 Se 3 due to the phonon scattering. We find that although the back-scattering of the SSs in TIs is strictly forbidden, the in-plane scattering between SSs in 3-dimensional TIs is allowed, maximum around the right-angle scattering. Thus the topological property of the SSs only reduces the scattering rate to its one half approximately. Besides, the larger LA deformation potential and lower sound velocity of Bi 2 Se 3 enhance the scattering rate significantly. Compared with the Dirac electrons in graphene, we find the scattering rate of SSs in Bi 2 Se 3 are two orders of magnitudes larger, which agree with the recent transport experiments

  20. Tumor necrosis factor inhibitor therapy but not standard therapy is associated with resolution of erosion in the sacroiliac joints of patients with axial spondyloarthritis

    DEFF Research Database (Denmark)

    Pedersen, Susanne J; Wichuk, Stephanie; Chiowchanwisawakit, Praveena

    2014-01-01

    Research Consortium of Canada (SPARCC) MRI Sacroiliac Joint (SIJ) Structural Score (SSS) assesses a spectrum of structural lesions (erosion, fat metaplasia, backfill, ankylosis) and its potential to discriminate between therapies requires evaluation. METHODS: The SSS score assesses five consecutive coronal...... (ANOVA), discrimination was assessed using Guyatt's effect size, and treatment group differences were assessed using t-tests and the Mann-Whitney test. We identified baseline demographic and structural damage variables associated with change in SSS score by univariate analysis and analyzed the effect...... of treatment by multivariate stepwise regression adjusted for severity of baseline structural damage and demographic variables. RESULTS: A significant increase in mean SSS score for fat metaplasia (P = 0.017) and decrease in mean SSS score for erosion (P = 0.017) was noted in anti-TNFα treated patients...

  1. LA phonons scattering of surface electrons in Bi{sub 2}Se{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Lang-Tao [State Key Laboratory of Low-Dimensional Quantum Physics, Department of Physics, Tsinghua University, Beijing 100084 (China); Zhu, Bang-Fen [State Key Laboratory of Low-Dimensional Quantum Physics, Department of Physics, Tsinghua University, Beijing 100084, China and Institute of Advanced Study, Tsinghua University, Beijing 100084 (China)

    2013-12-04

    Within the Boltzmann equation formalism we evaluate the transport relaxation time of Dirac surface states (SSs) in the typical topological insulator(TI) Bi{sub 2}Se{sub 3} due to the phonon scattering. We find that although the back-scattering of the SSs in TIs is strictly forbidden, the in-plane scattering between SSs in 3-dimensional TIs is allowed, maximum around the right-angle scattering. Thus the topological property of the SSs only reduces the scattering rate to its one half approximately. Besides, the larger LA deformation potential and lower sound velocity of Bi{sub 2}Se{sub 3} enhance the scattering rate significantly. Compared with the Dirac electrons in graphene, we find the scattering rate of SSs in Bi{sub 2}Se{sub 3} are two orders of magnitudes larger, which agree with the recent transport experiments.

  2. A System for Series Magnetic Measurements of the LHC Main Quadrupoles

    CERN Document Server

    Smirnov, N; Chiusano, F; Dunkel, O; Legrand, P; Schloss, S; Schnizer, P; Sievers, P

    2002-01-01

    More than 400 twin aperture lattice quadrupoles are needed for the Large Hadron Collider (LHC) which is under construction at CERN. The main quadrupole is assembled with correction magnets in a common cryostat called the Short Straight Section (SSS). We plan to measure all SSS's in cold conditions with an unprecedented accuracy: integrated gradient of the field within 150 ppm, harmonics in a range of 1 to 5 ppm, magnetic axis of all elements within 0.1 mm and their field direction within 0.2 mrad. In this paper we describe the automatic measurement system that we have designed, built and calibrated. Based on the results obtained on the two first prototypes of the SSS's (SSS3 and SSS4) we show that this system meets all above requirements.

  3. Comparative analysis of the number of neurofilaments in rat sciatic nerve undergoing neuropraxia treated by low-level laser and therapeutic ultrasound

    International Nuclear Information System (INIS)

    Matamala, F; Cornejo, R; Paredes, M; Farfan, E; Garrido, O. S; Alves, N

    2014-01-01

    Therapy by low-level laser (LLL) or ultrasound (US) are commonly used as treatment after nerve crush. The aim of this study was to determine the effectiveness of such treatments to repair the neuronal cytoskeleton evaluating the variation in the number of neurofilaments. For this an experimental design was performed, which involved 30 rats divided into 6 groups: 1 - control healthy; 2 - control injured; 3 - irradiated by LLL 2 J/cm2; 4 - irradiated by LLL 10 J/cm2; 5 - irradiated by US 0.5 W/cm2 and 6 - irradiated by US 1W/cm2. With the exception of group 1 all specimens were anesthetized and underwent right sciatic nerve compression using 40N pressure for 45 seconds. Twenty-four hours after compression irradiation was started by LLL and US according protocol. In our research we found that the increase in the number of neurofilaments was related to the applied dose of LLL and US. The average value of neurofilaments / 0.25 mm2 obtained in each group was: 1 - 128; 2-100; 3-156; 4-140; 5-100; 6-148. We concluded that the application of LLL and therapeutic US increases the number of neurofilaments in rat sciatic nerve undergoing neuropraxia, with LLL being more effective compared to the US. Furthermore we concluded that the effectiveness of therapies to induce regeneration of injured nerve is related to the type of protocol used, demonstrating the need to establish an adequate radiation dose with the purpose of obtaining the best therapeutic response, thus achieving successful treatment [es

  4. Low-level laser treatment accelerated hair regrowth in a rat model of chemotherapy-induced alopecia (CIA).

    Science.gov (United States)

    Wikramanayake, Tongyu Cao; Villasante, Alexandra C; Mauro, Lucia M; Nouri, Keyvan; Schachner, Lawrence A; Perez, Carmen I; Jimenez, Joaquin J

    2013-05-01

    Chemotherapy-induced alopecia (CIA) is one of the most distressing side effects of antineoplastic chemotherapy for which there is no effective interventional approach. A low-level laser (LLL) device, the HairMax LaserComb®, has been cleared by the FDA to treat androgenetic alopecia. Its effects may be extended to other settings; we have demonstrated that LaserComb treatment induced hair regrowth in a mouse model for alopecia areata. In the current study, we tested whether LLL treatment could promote hair regrowth in a rat model for CIA. Chemotherapy agents cyclophosphamide, etoposide, or a combination of cyclophosphamide and doxorubicin were administered in young rats to induce alopecia, with or without LLL treatment. As expected, 7-10 days later, all the rats developed full body alopecia. However, rats receiving laser treatment regrew hair 5 days earlier than rats receiving chemotherapy alone or sham laser treatment (with the laser turned off). The accelerated hair regrowth in laser-treated rats was confirmed by histology. In addition, LLL treatment did not provide local protection to subcutaneously injected Shay chloroleukemic cells. Taken together, our results demonstrated that LLL treatment significantly accelerated hair regrowth after CIA without compromising the efficacy of chemotherapy in our rat model. Our results suggest that LLL should be explored for the treatment of CIA in clinical trials because LLL devices for home use (such as the HairMax LaserComb®) provide a user-friendly and noninvasive approach that could be translated to increased patient compliance and improved efficacy.

  5. Hourly changes in sea surface salinity in coastal waters recorded by Geostationary Ocean Color Imager

    Science.gov (United States)

    Liu, Rongjie; Zhang, Jie; Yao, Haiyan; Cui, Tingwei; Wang, Ning; Zhang, Yi; Wu, Lingjuan; An, Jubai

    2017-09-01

    In this study, we monitored hourly changes in sea surface salinity (SSS) in turbid coastal waters from geostationary satellite ocean color images for the first time, using the Bohai Sea as a case study. We developed a simple multi-linear statistical regression model to retrieve SSS data from Geostationary Ocean Color Imager (GOCI) based on an in situ satellite matched-up dataset (R2 = 0.795; N = 41; Range: 26.4 to 31.9 psμ). The model was then validated using independent continuous SSS measurements from buoys, with the average percentage difference of 0.65%. The model was applied to GOCI images from the dry season during an astronomical tide to characterize hourly changes in SSS in the Bohai Sea. We found that the model provided reasonable estimates of the hourly changes in SSS and that trends in the modeled and measured data were similar in magnitude and direction (0.43 vs 0.33 psμ, R2 = 0.51). There were clear diurnal variations in the SSS of the Bohai Sea, with a regional average of 0.455 ± 0.079 psμ (0.02-3.77 psμ). The magnitude of the diurnal variations in SSS varied spatially, with large diurnal variability in the nearshore, particularly in the estuary, and small variability in the offshore area. The model for the riverine area was based on the inverse correlation between SSS and CDOM absorption. In the offshore area, the water mass of the North Yellow Sea, characterized by high SSS and low CDOM concentrations, dominated. Analysis of the driving mechanisms showed that the tidal current was the main control on hourly changes in SSS in the Bohai Sea.

  6. NEIL2 protects against oxidative DNA damage induced by sidestream smoke in human cells.

    Directory of Open Access Journals (Sweden)

    Altaf H Sarker

    Full Text Available Secondhand smoke (SHS is a confirmed lung carcinogen that introduces thousands of toxic chemicals into the lungs. SHS contains chemicals that have been implicated in causing oxidative DNA damage in the airway epithelium. Although DNA repair is considered a key defensive mechanism against various environmental attacks, such as cigarette smoking, the associations of individual repair enzymes with susceptibility to lung cancer are largely unknown. This study investigated the role of NEIL2, a DNA glycosylase excising oxidative base lesions, in human lung cells treated with sidestream smoke (SSS, the main component of SHS. To do so, we generated NEIL2 knockdown cells using siRNA-technology and exposed them to SSS-laden medium. Representative SSS chemical compounds in the medium were analyzed by mass spectrometry. An increased production of reactive oxygen species (ROS in SSS-exposed cells was detected through the fluorescent detection and the induction of HIF-1α. The long amplicon-quantitative PCR (LA-QPCR assay detected significant dose-dependent increases of oxidative DNA damage in the HPRT gene of cultured human pulmonary fibroblasts (hPF and BEAS-2B epithelial cells exposed to SSS for 24 h. These data suggest that SSS exposure increased oxidative stress, which could contribute to SSS-mediated toxicity. siRNA knockdown of NEIL2 in hPF and HEK 293 cells exposed to SSS for 24 h resulted in significantly more oxidative DNA damage in HPRT and POLB than in cells with control siRNA. Taken together, our data strongly suggest that decreased repair of oxidative DNA base lesions due to an impaired NEIL2 expression in non-smokers exposed to SSS would lead to accumulation of mutations in genomic DNA of lung cells over time, thus contributing to the onset of SSS-induced lung cancer.

  7. Meibomian Gland Dysfunction in Primary and Secondary Sjögren Syndrome.

    Science.gov (United States)

    Sullivan, David A; Dana, Reza; Sullivan, Rose M; Krenzer, Kathleen L; Sahin, Afsun; Arica, Beril; Liu, Yang; Kam, Wendy R; Papas, Athena S; Cermak, Jennifer M

    2018-01-01

    We hypothesized that women with primary (pSS) and secondary Sjögren syndrome (sSS; with systemic lupus erythematosus [SLE] or rheumatoid arthritis [RA]) have meibomian gland dysfunction (MGD). We sought to test our hypothesis. Subjects with pSS, sSS + SLE, sSS + RA, and non-SS-related MGD were recruited from the Sjögren's Syndrome Foundation or outpatient clinics at Tufts University School of Dental Medicine or Brigham and Women's Hospital. The control population was recruited from the Greater Boston area. After providing written informed consent, the subjects underwent an eye examination and/or completed two questionnaires that assess symptoms of dry eye disease (DED). Our results demonstrate that pSS and sSS patients have MGD. These subjects had meibomian gland orifice metaplasia, an increased number of occluded meibomian gland orifices, and a reduced quality of meibomian gland secretions. Further, patients with pSS, sSS + SLE, sSS + RA, and MGD had significant alterations in their tear film, lid margin, cornea, and conjunctiva. Symptoms of DED were increased ∼10-fold in all pSS, sSS, and MGD groups relative to controls. Our findings support our hypothesis and show that individuals with pSS, sSS + SLE, and sSS + RA have MGD. In addition, our study indicates that patients with pSS and sSS have both aqueous-deficient and evaporative DED. © 2018 S. Karger AG, Basel.

  8. Sibelius: Der Sturm, Op. 109, Neeme Järvi / Gerhard Pätzig

    Index Scriptorium Estoniae

    Pätzig, Gerhard

    1990-01-01

    Uuest heliplaadist "Sibelius: Der Sturm, Op. 109, (Vorspiel und Konzertsuiten zu Shakespeares Drama), Cassazione, Op.6, Preludio, Tiera. Sinfonieorchester Göteborg, Neeme Järvi". BIS/ Disco-Center CD 448 71'43") DDD

  9. Pärt, Arvo: Seven Magnificat Antiphons / Barry Witherden

    Index Scriptorium Estoniae

    Witherden, Barry

    1996-01-01

    Uuest heliplaadist "Pärt, Arvo: Seven Magnificat Antiphons. Magnificat. Summa; Tormis, Veljo: The Curse Upon Iron. Karelian Destiny. BBC Singers, Bo Holton". Collins Classics 1472-2 (61 minutes: DDD)

  10. Pärt: Berliner Messe / Rob Cowan

    Index Scriptorium Estoniae

    Cowan, Rob

    1998-01-01

    Uuest heliplaadist "Pärt: Berliner Messe. The Beatitudes. Annum per Annum. Magnificat. Seven Magnificat Antiphons. De profundis. Polyphony / Steven Layton with Andrew Lucas" Hyperion CDA66960 (74 minutes:DDD)

  11. Prognosis of intervertebral disc loss from diagnosis of degenerative disc disease

    Science.gov (United States)

    Li, S.; Lin, A.; Tay, K.; Romano, W.; Osman, Said

    2015-03-01

    Degenerative Disc Disease (DDD) is one of the most common causes of low back pain, and is a major factor in limiting the quality of life of an individual usually as they enter older stages of life, the disc degeneration reduces the shock absorption available which in turn causes pain. Disc loss is one of the central processes in the pathogenesis of DDD. In this study, we investigated whether the image texture features quantified from magnetic resonance imaging (MRI) could be appropriate markers for diagnosis of DDD and prognosis of inter-vertebral disc loss. The main objective is to use simple image based biomarkers to perform prognosis of spinal diseases using non-invasive procedures. Our results from 65 subjects proved the higher success rates of the combination marker compared to the individual markers and in the future, we will extend the study to other spine regions to allow prognosis and diagnosis of DDD for a wider region.

  12. Bartok: Concerto for Orchestra Sz 116 / Edward Seckerson

    Index Scriptorium Estoniae

    Seckerson, Edward

    1992-01-01

    Uuest heliplaadist "Bartok: Concerto for Orchestra Sz 116; Enescu: Romanian Rhapsodies Op. 11-No. 1 in A major No. 2 in D major. Royal Scottish Orchestra / Neeme Järvi" Chandos CHAN8947 (66 minutes:DDD)

  13. Prokofiev: Cantata for the 20th Anniversary of the October Revolution / David J. Fanning

    Index Scriptorium Estoniae

    Fanning, David J.

    1993-01-01

    Uuest heliplaadist "Prokofiev: Cantata for the 20th Anniversary of the October Revolution, Op. 74 a. The Tale of the Stone Flower - experts. Philharmonia Chorus and Orchestra / Neeme Järvi" Chandos ABTD 1597; CHAN9095 (75 minutes:DDD)

  14. Pärt, Arvo: Litany. Psalom. Trisagion / Robert Cowan

    Index Scriptorium Estoniae

    Cowan, Robert

    1996-01-01

    Uuest heliplaadist "Pärt, Arvo: Litany. Psalom. Trisagion. Hilliard Ensemble, Estonian Philharmonic Chamber Choir, Tallinn Chamber Orchestra, Tõnu Kaljuste; Lithuanian Chamber Orchestra, Saulius Sondeckis" ECM New Series 449 810-4; 449 810-2 (42 minutes: DDD)

  15. Tüür, Erkki-Sven: Architectonics VI. Passion. Illusion / Guy S. Rickards

    Index Scriptorium Estoniae

    Rickards, Guy S.

    1996-01-01

    Uuest heliplaadist "Tüür, Erkki-Sven: Architectonics VI. Passion. Illusion. Crystallisatio. Requiem. Estonian Philharmonic Chamber Choir, Tallinn Chamber Orchestra, Tõnu Kaljuste. ECM New Series 449 459-2 (64 minutes: DDD)

  16. Stravinsky: The Rite of Spring / Hartmut, Lück

    Index Scriptorium Estoniae

    Lück, Hartmut

    1996-01-01

    Uuest heliplaadist "Stravinsky: The Rite of Spring. Canticum Sacrum. Requiem Canticles. Choral Variations on "Vom Himmel hoch". Lausanne Pro Arte Choir, Suisse Romande Chamber Choir and Orchestra, Neeme Järvi. Chandos CHAN 9408 (75 minutes:DDD)

  17. Schmidt. Sinfonie Nr. 1 E-Dur; Strauss. Vier sinfonische Zwischenspiele aus Intermezzo. Detroit Symphony Orchestra, Neeme Järvi / Helge Grünewald

    Index Scriptorium Estoniae

    Grünewald, Helge

    1996-01-01

    Uuest heliplaadist "Schmidt. Sinfonie Nr. 1 E-Dur; Strauss. Vier sinfonische Zwischenspiele aus Intermezzo. Detroit Symphony Orchestra, Neeme Järvi. Chandos/Koch CD 9357 (WD: 68'20") DDD (WD:114'36")

  18. Pärt: Fratres in sechs Versionen. Festina lente. Summa / C. S.

    Index Scriptorium Estoniae

    C. S.

    1997-01-01

    Uuest heliplaadist "Pärt: Fratres in sechs Versionen. Festina lente. Summa. Cantus in memoriam Benjamin Britten. Orchester der Ungarischen Staatsoper, Tamas Benedek". Naxos CD 8 553 750 (WD:79'06") DDD

  19. Bernstein: Prelude, Fugue and Riffs / Edward Greenfield

    Index Scriptorium Estoniae

    Greenfield, Edward

    1998-01-01

    Uuest heliplaadist "Bernstein: Prelude, Fugue and Riffs. Facsimile. West Side Story - Symphonic Dances. Divertimento. City of Birmingham Symphony Orchestra / Paavo Järvi. Virgin Classics VC5 45295-2 (68 minutes:DDD)

  20. Bernstein: Prelude, Fugue and Riffs / Michel Parouty

    Index Scriptorium Estoniae

    Parouty, Michel

    1998-01-01

    Uuest heliplaadist "Bernstein: Prelude, Fugue and Riffs. Facsimile. West Side Story - Symphonic Dances. Divertimento. City of Birmingham Symphony Orchestra / Paavo Järvi" Virgin Classics VC5 45295-2 (68 minutes:DDD)

  1. Chopin: Concerto for piano and orchestra No. 2 in F minor / Christopher Headington

    Index Scriptorium Estoniae

    Headington, Christopher

    1992-01-01

    Uuest heliplaadist "Chopin: Concerto for piano and orchestra No. 2 in F minor, Op. 21; Schumann: Concerto for piano and orchestra in A minor Op. 54. Philharmonia Orchestra, Neeme Järvi". Chandos CHAN9061 (62 minutes:DDD)

  2. Prokofiev: The Fiery Angel.Gösta Ohlin Vocal Ensemble / David J. Fanning

    Index Scriptorium Estoniae

    Fanning, David J.

    1991-01-01

    Uuest heliplaadist "Prokofiev: The Fiery Angel.Gösta Ohlin Vocal Ensemble, Gothenburg Pro Musica Chamber Choir and Symphony Orchestra, Neeme Järvi" DG CD 431 669-2 GH2 (two discs, nas:118 minutes:DDD)

  3. Prokofiev: War and Peace - Symphonic Suite (arr. Palmer) / Ivan March

    Index Scriptorium Estoniae

    March, Ivan

    1993-01-01

    Uuest heliplaadist "Prokofiev: War and Peace - Symphonic Suite (arr. Palmer), Summer Night, Op. 123. Russian Overture, Op. 72. Philharmonia Orchestra / Neeme Järvi. Chandos ABTD 1598 CHAN9096 (64 minutes:DDD) Igor - Polovtsian Dances

  4. Various / Barry Witherden

    Index Scriptorium Estoniae

    Witherden, Barry

    1996-01-01

    Uuest heliplaadist "Various. John Keys (organ), Andrew Angus (bass). Vasari Singers / Jeremy Backhouse". EMI Eminence 7243 5 65 903 2. 74:09 DDD. Plaadil ka A. Pärdi "Summa", "The Beautitudes", "Seven Magnificat Antiphons"

  5. Jolivet: Complete Flute Music, Vol. 2 / Guy S. Rickards

    Index Scriptorium Estoniae

    Rickards, Guy S.

    1996-01-01

    Uuest heliplaadist "Jolivet: Complete Flute Music, Vol. 2. Kroumata Percussion Ensemble, Tapiola Sinfonietta, Paavo Järvi". BIS CD 739 (64 minutes: DDD). Item marked from CD630 (6/94), CD272, remainder new to UK

  6. Pärt, Arvo: "Summa". Collage sur BACH. Fratres / Patric Wiklacz

    Index Scriptorium Estoniae

    Wiklacz, Patric

    1997-01-01

    Uuest heliplaadist "Pärt, Arvo: "Summa". Collage sur BACH. Fratres. Cantus in Memoriam Benjamin Britten. Summa. Festina Lente. Tabula rasa. Tapiola Sinfonietta / Jean-Jacques Kantorow". BIS-CD-834. 62:30 DDD

  7. Stravinsky: The Rite of Spring. Canticum sacrum

    Index Scriptorium Estoniae

    1996-01-01

    Uuest heliplaadist "Stravinsky: The Rite of Spring. Canticum sacrum. Requiem canticles. Choral Variations on "Vom Himmel hoch". Lausanne Pro Arte Choir, Suisse Romande Chamber Choir and Orchestra, Neeme Järvi" Chandos CHAN 9408 (75 minutes:DDD)

  8. Raid, Kaljo: Symphony No. 2, "Stockholm" / Guy S. Rickards

    Index Scriptorium Estoniae

    Rickards, Guy S.

    1996-01-01

    Uuest heliplaadist "Raid, Kaljo: Symphony No. 2, "Stockholm"; Tubin, Eduard: Elegy for Strings (arr. Raid). Symphony No. 11 (orch. Raid). Estonian State Symphony Orchestra, Arvo Volmer". Koch International Classics 37291-2 (48 minutes:DDD)

  9. Kalinnikov: Sinfonie Nr.2 A-Dur, Ouvertüre Zar Boris / Hanspeter Krellmann

    Index Scriptorium Estoniae

    Krellmann, Hanspeter

    1990-01-01

    Uuest heliplaadist "Kalinnikov: Sinfonie Nr.2 A-Dur, Ouvertüre Zar Boris, Die Zeder und die Palme. Scottish National Orchestra, Neeme Järvi" (AD: 1989) Chandos / Koch Records CD 8805 (WD: 59'40") DDD

  10. Bartok: Der holzgeschnitzte Prinz / Bernhard Uske

    Index Scriptorium Estoniae

    Uske, Bernhard

    1991-01-01

    Uuest heliplaadist "Bartok: Der holzgeschnitzte Prinz [The Wooden Prince complete ballet] op. 13. Ungarische Bilder [Hungarian Pictures]. Philharmonia Orchestra [The Philharmonia] Neeme Järvi". Chandos/Koch Records CD 8895 (WD:65'51") DDD

  11. Sibelius: Pohjola's Daughter; Night Ride and Sunrise; Four Legends from Kalevala (Lemminkäinen Suite). Gothenburg Symphony Orchestra, Neeme Järvi / Brian Hunt

    Index Scriptorium Estoniae

    Hunt, Brian

    1997-01-01

    Uuest heliplaadist "Sibelius: Pohjola's Daughter; Night Ride and Sunrise; Four Legends from Kalevala (Lemminkäinen Suite). Gothenburg Symphony Orchestra / Neeme Järvi. Deutsche Grammophon 453 426-2; 70:37 DDD

  12. Scatter Correction with Combined Single-Scatter Simulation and Monte Carlo Simulation Scaling Improved the Visual Artifacts and Quantification in 3-Dimensional Brain PET/CT Imaging with 15O-Gas Inhalation.

    Science.gov (United States)

    Magota, Keiichi; Shiga, Tohru; Asano, Yukari; Shinyama, Daiki; Ye, Jinghan; Perkins, Amy E; Maniawski, Piotr J; Toyonaga, Takuya; Kobayashi, Kentaro; Hirata, Kenji; Katoh, Chietsugu; Hattori, Naoya; Tamaki, Nagara

    2017-12-01

    In 3-dimensional PET/CT imaging of the brain with 15 O-gas inhalation, high radioactivity in the face mask creates cold artifacts and affects the quantitative accuracy when scatter is corrected by conventional methods (e.g., single-scatter simulation [SSS] with tail-fitting scaling [TFS-SSS]). Here we examined the validity of a newly developed scatter-correction method that combines SSS with a scaling factor calculated by Monte Carlo simulation (MCS-SSS). Methods: We performed phantom experiments and patient studies. In the phantom experiments, a plastic bottle simulating a face mask was attached to a cylindric phantom simulating the brain. The cylindric phantom was filled with 18 F-FDG solution (3.8-7.0 kBq/mL). The bottle was filled with nonradioactive air or various levels of 18 F-FDG (0-170 kBq/mL). Images were corrected either by TFS-SSS or MCS-SSS using the CT data of the bottle filled with nonradioactive air. We compared the image activity concentration in the cylindric phantom with the true activity concentration. We also performed 15 O-gas brain PET based on the steady-state method on patients with cerebrovascular disease to obtain quantitative images of cerebral blood flow and oxygen metabolism. Results: In the phantom experiments, a cold artifact was observed immediately next to the bottle on TFS-SSS images, where the image activity concentrations in the cylindric phantom were underestimated by 18%, 36%, and 70% at the bottle radioactivity levels of 2.4, 5.1, and 9.7 kBq/mL, respectively. At higher bottle radioactivity, the image activity concentrations in the cylindric phantom were greater than 98% underestimated. For the MCS-SSS, in contrast, the error was within 5% at each bottle radioactivity level, although the image generated slight high-activity artifacts around the bottle when the bottle contained significantly high radioactivity. In the patient imaging with 15 O 2 and C 15 O 2 inhalation, cold artifacts were observed on TFS-SSS images, whereas

  13. Trendy ve spotřebě léčiv z ATC skupiny A10 za období 2005-2009: porovnání situace v České a Slovenské republice

    OpenAIRE

    Písaříková, Zuzana

    2009-01-01

    This thesis describes a methodology for expressing the consumption of drugs, a system of ATC/DDD, ATC classification and DDD recommended daily dose assigment. It acquaints readers with the most appropriate data source for consumption determining and also inform about diabetes mellitus. This involves also recommended standards of medical care in diabetes by the Czech Diabetes Association, with which is comparethe actual consumption of drugs in the Czech Republic and Slovakia at the conclusion....

  14. [Variations in antihypertensive drug utilization among primary care areas in the autonomous region of Valencia (Spain)].

    Science.gov (United States)

    Sanfélix-Gimeno, Gabriel; Peiró, Salvador; Librero, Julián

    2010-01-01

    To estimate consumption of five subgroups of antihypertensive drugs by primary care areas and to analyze its variation. We performed an ecological, descriptive study of antihypertensive consumption in 239 primary care areas in the autonomous region of Valencia in 2005 followed by analysis of the variability observed. The 239 primary care areas were studied by descriptive analysis of dispensation [defined daily dose (DDD) per 1,000 inhabitants/day in pensioners (DDD/1000p/day) and in the active population (DDD/1000a/day)] and standardized consumption ratios. Small-area variation analysis was used to analyze the observed variability. Associations among dispensations of the distinct therapeutic subgroups were also analyzed. Overall antihypertensive use in the autonomous region of Valencia in 2005 was 235.6DDD/1000/day. This consumption was concentrated in pensioners (800DDD/1000p/day vs. 73DDD/1000a/day). Consumption of antihypertensive subgroups oscillated from 442DDD/1000p/day for drugs with action on the renin-angiotensin system to 32DDD/1000p/day for doxazosin. The active population showed similar patterns. Variation in consumption was moderate, with coefficients of variation from 0.20 to 0.40 (slightly greater for the active population). Associations among dispensations of the different therapeutic subgroups were strong. This study shows major variations in the overall consumption of antihypertensive drugs among primary care areas of the autonomous region of Valencia. These results suggest that variation may be associated with problems of underutilization in areas with lower consumption. Copyright © 2010 SESPAS. Published by Elsevier Espana. All rights reserved.

  15. Elucidating Turnover Pathways of Bioactive Small Molecules by Isotopomer Analysis: The Persistent Organic Pollutant DDT

    Science.gov (United States)

    Ehlers, Ina; Betson, Tatiana R.; Vetter, Walter; Schleucher, Jürgen

    2014-01-01

    The persistent organic pollutant DDT (1,1,1-trichloro-2,2-bis(4-chlorophenyl)ethane) is still indispensable in the fight against malaria, although DDT and related compounds pose toxicological hazards. Technical DDT contains the dichloro congener DDD (1-chloro-4-[2,2-dichloro-1-(4-chlorophenyl)ethyl]benzene) as by-product, but DDD is also formed by reductive degradation of DDT in the environment. To differentiate between DDD formation pathways, we applied deuterium NMR spectroscopy to measure intramolecular deuterium distributions (2H isotopomer abundances) of DDT and DDD. DDD formed in the technical DDT synthesis was strongly deuterium-enriched at one intramolecular position, which we traced back to 2H/1H fractionation of a chlorination step in the technical synthesis. In contrast, DDD formed by reductive degradation was strongly depleted at the same position, which was due to the incorporation of 2H-depleted hydride equivalents during reductive degradation. Thus, intramolecular isotope distributions give mechanistic information on reaction pathways, and explain a puzzling difference in the whole-molecule 2H/1H ratio between DDT and DDD. In general, our results highlight that intramolecular isotope distributions are essential to interpret whole-molecule isotope ratios. Intramolecular isotope information allows distinguishing pathways of DDD formation, which is important to identify polluters or to assess DDT turnover in the environment. Because intramolecular isotope data directly reflect isotope fractionation of individual chemical reactions, they are broadly applicable to elucidate transformation pathways of small bioactive molecules in chemistry, physiology and environmental science. PMID:25350380

  16. Gaas Displacement Damage Dosimeter Based on Diode Dark Currents

    Directory of Open Access Journals (Sweden)

    Warner Jeffrey H.

    2017-01-01

    Full Text Available GaAs diode dark currents are correlated over a very large proton energy range as a function of displacement damage dose (DDD. The linearity of the dark current increase with DDD over a wide range of applied voltage bias deems this device an excellent candidate for a displacement damage dosimeter. Additional proton testing performed in situ enabled error estimate determination to within 10% for simulated space use.

  17. Twenty-year trends in benzodiazepine dispensing in the Australian population.

    Science.gov (United States)

    Islam, M M; Conigrave, K M; Day, C A; Nguyen, Y; Haber, P S

    2014-01-01

    Considerable concern has been expressed about overprescribing of benzodiazepines and related harms. Past analyses have relied on World Health Organization-defined daily doses (DDD) which are sometimes out of keeping with clinical usage. This study examines 20-year (1992-2011) trends of benzodiazepine dispensing in Australia using both DDD and Ashton equivalent dose. Data from the Drug Utilisation Sub-Committee and the Pharmaceutical Benefits Scheme (PBS) website were analysed. Trends in number of prescriptions, DDD/1000 people/day and DDD/prescription were examined over time, and between states/territories. In the 20-year period, 174 080 904 scripts were recorded, with temazepam the most dispensed benzodiazepine (35% of scripts), followed by diazepam (23%). Overall recorded utilisation fell from 27.7 DDD/1000 people/day in 1992 to 20.8 in 2011 (24.9% decrease). There were striking changes in use of individual benzodiazepines over time, with reductions in oxazepam and flunitrazepam and dramatic increases in alprazolam. Since 1998, there has been a steady increase, albeit modest, in per script DDD. The DDD/1000 people/day for items dispensed through PBS/Repatriaton-PBS was highest in Tasmania and lowest in Northern Territory. Despite a modest overall decline in the amount of benzodiazepine dispensed, the level of use is still likely to reflect relative over-prescribing given the paucity of accepted indications for long-term use. Since 1998, there was a polynomial increase in quantity dispensed per script. The WHO-defined DDD for clonazepam seems inappropriate and could impede monitoring of its abuse. Other problems include lack of national data for medications not subsidised on PBS/Repatriation PBS. A broad policy approach is required, not one which targets only one particular benzodiazepine. © 2013 The Authors; Internal Medicine Journal © 2013 Royal Australasian College of Physicians.

  18. Does football cause an increase in degenerative disease of the lumbar spine?

    Science.gov (United States)

    Gerbino, Peter G; d'Hemecourt, Pierre A

    2002-02-01

    Degenerative disease of the lumbar spine is exceedingly common. Whether any specific activity increases the likelihood of developing degenerative disc disease (DDD) or facet degeneration (FD) has enormous implications. Within the field of occupational medicine there are specific activities, occupations, and morphologic characteristics that have been related to low back pain. Several specific risk factors have been conclusively linked to low back pain, and in particular DDD and FD. Within the sport of American football, there has long been the feeling that many athletes have or will develop low back pain, DDD, and FD. Proving that certain risk factors present in football will predictably lead to an increase in LBP, DDD, and FD is more difficult. At this time, it can be said that football players, in general, increase their risk of developing low back pain, DDD, and FD as their years of involvement with their sport increase. Because specific spine injuries like fracture, disc herniation, and spondylolysis are more frequent in football players, the resulting DDD and FD are greater than that of the general population. The weightlifting and violent hyperextension that are part of American football are independent risk factors for degenerative spine disease.

  19. A Precise Drunk Driving Detection Using Weighted Kernel Based on Electrocardiogram.

    Science.gov (United States)

    Wu, Chung Kit; Tsang, Kim Fung; Chi, Hao Ran; Hung, Faan Hei

    2016-05-09

    Globally, 1.2 million people die and 50 million people are injured annually due to traffic accidents. These traffic accidents cost $500 billion dollars. Drunk drivers are found in 40% of the traffic crashes. Existing drunk driving detection (DDD) systems do not provide accurate detection and pre-warning concurrently. Electrocardiogram (ECG) is a proven biosignal that accurately and simultaneously reflects human's biological status. In this letter, a classifier for DDD based on ECG is investigated in an attempt to reduce traffic accidents caused by drunk drivers. At this point, it appears that there is no known research or literature found on ECG classifier for DDD. To identify drunk syndromes, the ECG signals from drunk drivers are studied and analyzed. As such, a precise ECG-based DDD (ECG-DDD) using a weighted kernel is developed. From the measurements, 10 key features of ECG signals were identified. To incorporate the important features, the feature vectors are weighted in the customization of kernel functions. Four commonly adopted kernel functions are studied. Results reveal that weighted feature vectors improve the accuracy by 11% compared to the computation using the prime kernel. Evaluation shows that ECG-DDD improved the accuracy by 8% to 18% compared to prevailing methods.

  20. Pengembangan Media Pembelajaran Fisika Menggunakan Lectora Inspire pada Materi Usaha dan Energi SMA

    Directory of Open Access Journals (Sweden)

    Inggrid Ayu Putri

    2016-12-01

    Full Text Available Abstract The development of instructional media aims to help students to do independent learning outside the classroom but still under the supervision of teachers. This study uses Research and Development (R & D DDD-E type developed by Ivers and Barron. The steps of DDD-E developing method method consist of Decide, Design, Develop, and Evaluate. Decide is determination of the project objectives, design determines the structure of the media contents to be developed, develop step is developing a media that is already planned. The evaluation exist on DDD steps, so the instructional media can be controlled. The software used in this research is Lectora Inspire. Lectora Inspire used on this research because the software user friendly or easy to use. Keywords: Lectora Inspire, media, work, energy Abstrak Pengembangan media pembelajaran ini bertujuan untuk membantu siswa dalam melakukan pembelajaran mandiri diluar kelas tetapi masih dalam pengawasan guru. Penelitian ini menggunakan metode penelitian dan pengembangan atau Research and Development (R&D tipe DDD-E yang dikembangkan oleh Ivers dan Barron. Langkah – langkah metode pengembangan DDD-E terdiri dari tahap decide, yaitu penentuan tujuan proyek, design, yaitu menentukan struktur isi dari media yang akan dikembangkan, develop adalah tahap untuk mengembangkan media pembelajaran yang sudah direncanakan. Tahap Evaluate adalah tahap evaluasi pengembangan media, dimana langkah ini terdapat pada seluruh tahapan DDD. Perangkat lunak yang digunakan adalah Lectora Inspire. Software ini dipilih karena langkah penggunaan yang user friendly atau mudah digunakan. Kata-kata kunci:Lectora Inspire, media, usaha, energi

  1. A Precise Drunk Driving Detection Using Weighted Kernel Based on Electrocardiogram

    Directory of Open Access Journals (Sweden)

    Chung Kit Wu

    2016-05-01

    Full Text Available Globally, 1.2 million people die and 50 million people are injured annually due to traffic accidents. These traffic accidents cost $500 billion dollars. Drunk drivers are found in 40% of the traffic crashes. Existing drunk driving detection (DDD systems do not provide accurate detection and pre-warning concurrently. Electrocardiogram (ECG is a proven biosignal that accurately and simultaneously reflects human’s biological status. In this letter, a classifier for DDD based on ECG is investigated in an attempt to reduce traffic accidents caused by drunk drivers. At this point, it appears that there is no known research or literature found on ECG classifier for DDD. To identify drunk syndromes, the ECG signals from drunk drivers are studied and analyzed. As such, a precise ECG-based DDD (ECG-DDD using a weighted kernel is developed. From the measurements, 10 key features of ECG signals were identified. To incorporate the important features, the feature vectors are weighted in the customization of kernel functions. Four commonly adopted kernel functions are studied. Results reveal that weighted feature vectors improve the accuracy by 11% compared to the computation using the prime kernel. Evaluation shows that ECG-DDD improved the accuracy by 8% to 18% compared to prevailing methods.

  2. Views from the Coalface: What Do English Stop Smoking Service Personnel Think about E-Cigarettes?

    Directory of Open Access Journals (Sweden)

    Rosemary Hiscock

    2015-12-01

    Full Text Available The UK Stop Smoking Services (SSS are a source of information and advice on e-cigarettes for smokers and thus it is important to understand the knowledge of, and attitudes towards, e-cigarettes held by stop smoking practitioners. The datasets were English SSS quarterly monitoring returns (n = 207,883 and an online survey of English SSS practitioners, managers, and commissioners between 26th November and 15th December 2014 (n = 1801. SSS monitoring data suggested 2% of clients were using e-cigarettes to quit with SSS and that clients using e-cigarettes had similar quit rates to clients using Varenicline. Most SSS personnel are waiting for licenced e-cigarettes to become available before they will recommend them to clients. However, less than a quarter view e-cigarettes as “a good thing”. Managers and commissioners were more positive than practitioners. SSS personnel working for the NHS (hospitals and GP surgeries were less positive about e-cigarettes than those employed elsewhere. E-cigarettes were cited as the most important reason for the recent decline in service footfall. Thus dissemination of information about e-cigarettes needs to be examined and services should address their stance on e-cigarettes with some urgency.

  3. Improving SMOS Sea Surface Salinity in the Western Mediterranean Sea through Multivariate and Multifractal Analysis

    Directory of Open Access Journals (Sweden)

    Estrella Olmedo

    2018-03-01

    Full Text Available A new methodology using a combination of debiased non-Bayesian retrieval, DINEOF (Data Interpolating Empirical Orthogonal Functions and multifractal fusion has been used to obtain Soil Moisture and Ocean Salinity (SMOS Sea Surface Salinity (SSS fields over the North Atlantic Ocean and the Mediterranean Sea. The debiased non-Bayesian retrieval mitigates the systematic errors produced by the contamination of the land over the sea. In addition, this retrieval improves the coverage by means of multiyear statistical filtering criteria. This methodology allows obtaining SMOS SSS fields in the Mediterranean Sea. However, the resulting SSS suffers from a seasonal (and other time-dependent bias. This time-dependent bias has been characterized by means of specific Empirical Orthogonal Functions (EOFs. Finally, high resolution Sea Surface Temperature (OSTIA SST maps have been used for improving the spatial and temporal resolution of the SMOS SSS maps. The presented methodology practically reduces the error of the SMOS SSS in the Mediterranean Sea by half. As a result, the SSS dynamics described by the new SMOS maps in the Algerian Basin and the Balearic Front agrees with the one described by in situ SSS, and the mesoscale structures described by SMOS in the Alboran Sea and in the Gulf of Lion coincide with the ones described by the high resolution remotely-sensed SST images (AVHRR.

  4. The Impact of the Assimilation of Aquarius Sea Surface Salinity Data in the GEOS Ocean Data Assimilation System

    Science.gov (United States)

    Vernieres, Guillaume Rene Jean; Kovach, Robin M.; Keppenne, Christian L.; Akella, Santharam; Brucker, Ludovic; Dinnat, Emmanuel Phillippe

    2014-01-01

    Ocean salinity and temperature differences drive thermohaline circulations. These properties also play a key role in the ocean-atmosphere coupling. With the availability of L-band space-borne observations, it becomes possible to provide global scale sea surface salinity (SSS) distribution. This study analyzes globally the along-track (Level 2) Aquarius SSS retrievals obtained using both passive and active L-band observations. Aquarius alongtrack retrieved SSS are assimilated into the ocean data assimilation component of Version 5 of the Goddard Earth Observing System (GEOS-5) assimilation and forecast model. We present a methodology to correct the large biases and errors apparent in Version 2.0 of the Aquarius SSS retrieval algorithm and map the observed Aquarius SSS retrieval into the ocean models bulk salinity in the topmost layer. The impact of the assimilation of the corrected SSS on the salinity analysis is evaluated by comparisons with insitu salinity observations from Argo. The results show a significant reduction of the global biases and RMS of observations-minus-forecast differences at in-situ locations. The most striking results are found in the tropics and southern latitudes. Our results highlight the complementary role and problems that arise during the assimilation of salinity information from in-situ (Argo) and space-borne surface (SSS) observations

  5. Comparison of Tear Osmolarity in Rheumatoid Arthritis Patients With and Without Secondary Sjogren Syndrome.

    Science.gov (United States)

    Ng, Alex L K; Choy, Bonnie N K; Chan, Tommy C Y; Wong, Ian Y H; Lai, Jimmy S M; Mok, Mo Yin

    2017-07-01

    To compare tear osmolarity (TO) and other dry eye parameters in rheumatoid arthritis (RA) patients with or without secondary Sjogren syndrome (sSS). Consecutive patients with RA were divided into a sSS group and no-sSS group using conventional diagnostic criteria by rheumatologists using symptomatology, Schirmer test score, and anti-Ro or anti-La autoantibody status. The TO, Ocular Surface Disease Index, dry eye disease (DED) parameters [such as tear breakup time (TBUT) and corneal staining score] and the systemic inflammatory markers [erythrocyte sedimentation rate (ESR) and C-reactive protein (CRP)] were compared. Correlation analyses between TO and the DED parameters and inflammatory markers were also performed. A total of 42 cases with mean age 54.8 ± 12.3 were included, with 12 patients (29%) having sSS and 30 (71%) without sSS. TO was increased in both groups (329 ± 20 and 319 ± 25 mOsm/L, respectively), but no statistically significant difference was found between the 2 groups (P = 0.126). RA with sSS had significantly shorter TBUT, higher corneal staining score, and ESR CRP levels (P sSS. There was no significant correlation between TO and the Schirmer test score, and the physician could not use TO to diagnose sSS. However, TO correlated well with both DED parameters (TBUT and corneal staining score) and systemic inflammatory markers (ESR and CRP).

  6. Impacts of sea-surface salinity in an eddy-resolving semi-global OGCM

    Science.gov (United States)

    Furue, Ryo; Takatama, Kohei; Sasaki, Hideharu; Schneider, Niklas; Nonaka, Masami; Taguchi, Bunmei

    2018-02-01

    To explore the impacts of sea-surface salinity (SSS) on the interannual variability of upper-ocean state, we compare two 10-year runs of an eddy-resolving ocean general circulation model (OGCM): in one, SSS is strongly restored toward a monthly climatology (World Ocean Atlas '98) and in the other, toward the SSS of a monthly gridded Argo product. The inclusion of the Argo SSS generally improves the interannual variability of the mixed layer depth; particularly so in the western tropical Pacific, where so-called "barrier layers" are reproduced when the Argo SSS is included. The upper-ocean subsurface salinity variability is also improved in the tropics and subtropics even below the mixed layer. To understand the reason for the latter improvement, we separate the salinity difference between the two runs into its "dynamical" and "spiciness" components. The dynamical component is dominated by small-scale noise due to the chaotic nature of mesoscale eddies. The spiciness difference indicates that as expected from the upper-ocean general circulation, SSS variability in the mixed layer is subducted into the thermocline in subtropics; this signal is generally advected downward, equatorward, and westward in the equator-side of the subtropical gyre. The SSS signal subducted in the subtropical North Pacific appears to enter the Indian Ocean through the Indonesian Throughflow, although this signal is weak and probably insignificant in our model.

  7. Views from the Coalface: What Do English Stop Smoking Service Personnel Think about E-Cigarettes?

    Science.gov (United States)

    Hiscock, Rosemary; Bauld, Linda; Arnott, Deborah; Dockrell, Martin; Ross, Louise; McEwen, Andy

    2015-12-21

    The UK Stop Smoking Services (SSS) are a source of information and advice on e-cigarettes for smokers and thus it is important to understand the knowledge of, and attitudes towards, e-cigarettes held by stop smoking practitioners. The datasets were English SSS quarterly monitoring returns (n = 207,883) and an online survey of English SSS practitioners, managers, and commissioners between 26th November and 15th December 2014 (n = 1801). SSS monitoring data suggested 2% of clients were using e-cigarettes to quit with SSS and that clients using e-cigarettes had similar quit rates to clients using Varenicline. Most SSS personnel are waiting for licenced e-cigarettes to become available before they will recommend them to clients. However, less than a quarter view e-cigarettes as "a good thing". Managers and commissioners were more positive than practitioners. SSS personnel working for the NHS (hospitals and GP surgeries) were less positive about e-cigarettes than those employed elsewhere. E-cigarettes were cited as the most important reason for the recent decline in service footfall. Thus dissemination of information about e-cigarettes needs to be examined and services should address their stance on e-cigarettes with some urgency.

  8. Sexual self-schema and depressive symptoms after prostate cancer.

    Science.gov (United States)

    Hoyt, Michael A; Carpenter, Kristen M

    2015-04-01

    The years following prostate cancer treatment are characterized by changes in sexual functioning and risk for depressive symptoms. Sexual self-schema (SSS) is a cognitive generalization about sexual aspects of the self that are associated with sexual behavior, affect, and the processing of sexually relevant information. This study tested if men's SSS moderates the impact of sexual morbidity on depressive symptoms. Men (N = 66) treated for localized prostate cancer in the preceding 2 years were assessed at T1 and 4 months later (T2). Questionnaires included the Center for Epidemiologic Studies Depression Scale, Sexual Self-schema Scale for Men, Sexual Experience Scale, and Expanded Prostate Cancer Index Composite. Regressions controlled for age, sexual activity, and T1 depressive symptoms revealed no significant effect of SSS on depressive symptoms; however, better sexual functioning was related to fewer depressive symptoms (B = -0.25, p < 0.05). Results showed significant interactions between SSS and sexual outcomes. Among men with high SSS, poor sexual functioning was associated with increased depressive symptoms; loss of sexual function was particularly distressing. There was no significant effect of sexual functioning. Among men with high SSS, there was an inverse relationship between sexual engagement and depressive symptoms. Among men with lower SSS, greater frequency of sexual behavior was associated with increased depressive symptoms. SSS may be an important individual difference in determining the impact of sexual morbidity on psychological adjustment. Men high on SSS are more vulnerable to psychological consequences of lower sexual functioning and less engagement in sexual activities. Copyright © 2014 John Wiley & Sons, Ltd.

  9. Functional structural motifs for protein-ligand, protein-protein, and protein-nucleic acid interactions and their connection to supersecondary structures.

    Science.gov (United States)

    Kinjo, Akira R; Nakamura, Haruki

    2013-01-01

    Protein functions are mediated by interactions between proteins and other molecules. One useful approach to analyze protein functions is to compare and classify the structures of interaction interfaces of proteins. Here, we describe the procedures for compiling a database of interface structures and efficiently comparing the interface structures. To do so requires a good understanding of the data structures of the Protein Data Bank (PDB). Therefore, we also provide a detailed account of the PDB exchange dictionary necessary for extracting data that are relevant for analyzing interaction interfaces and secondary structures. We identify recurring structural motifs by classifying similar interface structures, and we define a coarse-grained representation of supersecondary structures (SSS) which represents a sequence of two or three secondary structure elements including their relative orientations as a string of four to seven letters. By examining the correspondence between structural motifs and SSS strings, we show that no SSS string has particularly high propensity to be found interaction interfaces in general, indicating any SSS can be used as a binding interface. When individual structural motifs are examined, there are some SSS strings that have high propensity for particular groups of structural motifs. In addition, it is shown that while the SSS strings found in particular structural motifs for nonpolymer and protein interfaces are as abundant as in other structural motifs that belong to the same subunit, structural motifs for nucleic acid interfaces exhibit somewhat stronger preference for SSS strings. In regard to protein folds, many motif-specific SSS strings were found across many folds, suggesting that SSS may be a useful description to investigate the universality of ligand binding modes.

  10. Effects of parasagittal meningiomas on intracranial venous circulation assessed by the virtual reality technology.

    Science.gov (United States)

    Wang, Shousen; Ying, Jianbin; Wei, Liangfeng; Li, Shiqing; Jing, Junjie

    2015-01-01

    This study is to investigate the compensatory intracranial venous pathways in parasagittal meningiomas (PSM) patients by virtual reality technology. A total of 48 PSM patients (tumor group) and 20 patients with trigeminal neuralgia and hemifacial spasm but without intracranial venous diseases (control group) were enrolled. All patients underwent 3D CE-MRV examination. The 3D reconstructed images by virtual reality technology were used for assessment of diameter and number of intracranial veins, tumor location, venous sinus invasion degree and collateral circulation formation. Diameter of bridging veins in posterior 1/3 superior sagittal sinus (SSS) in tumor group was significantly smaller than that of the control group (P < 0.05). For tumors located in mid 1/3 SSS, diameter of bridging veins and vein of Labbé (VL) in posterior 1/3 SSS decreased significantly (P < 0.05). For tumors located in posterior 1/3 SSS, bridging vein number and transverse sinus (TS) diameter significantly decreased while superficial Sylvian vein (SSV) diameter increased significantly (P < 0.05). Compared with tumor in posterior 1/3 SSS subgroup, number of bridging veins in the tumor in mid 1/3 SSS subgroup increased significantly (P < 0.05). Compared with control group, only the bridging vein number in anterior 1/3 SSS segment in invasion Type 3-4 tumor subgroup decreased significantly (P < 0.05). Diameter of TS and bridging veins in posterior 1/3 SSS segment in sinus invasion Type 5-6 tumor subgroup decreased significantly (P < 0.05). Compared with control group, only the diameter of VL and TS of collateral circulation Grade 1 tumor subgroup decreased significantly (P < 0.05) while in Grade 3 tumor subgroup, TS diameter decreased and SSV diameter increased significantly (P < 0.05). The intracranial blood flow is mainly drained through SSV drainage after SSS occlusion by PSM.

  11. Systematic review and meta-analysis of the epidemiology of polyautoimmunity in Sjögren's syndrome (secondary Sjögren's syndrome) focusing on autoimmune rheumatic diseases.

    Science.gov (United States)

    Alani, H; Henty, J R; Thompson, N L; Jury, E; Ciurtin, C

    2018-03-01

    The epidemiology of polyautoimmunity in Sjögren's syndrome (secondary Sjögren's syndrome - sSS) is not well defined and has not been investigated before using a systematic approach. We conducted a systematic review of the epidemiology of sSS associated with rheumatoid arthritis (RA), systemic lupus erythematosus (SLE), scleroderma, and myositis, assessing the prevalence rates (PRs) and clinical and serological features of sSS. A systematic literature search of PubMed and Embase databases (updated to March 2016) was performed to identify all published data on PR, demographic profile, clinical manifestations, laboratory features, and causes of death associated with sSS. The PR's of sSS were summarized with PRs and 95% confidence intervals (CIs). The literature search identified 1639 citations, of which 42 fulfilled the inclusion criteria. Only 19 studies were of moderate to good quality and were selected for the meta-analysis. According to a random-effects model, the pooled PR for sSS associated with RA was 19.5% (95% CI 11.2 to 27.8) and the pooled PR for sSS associated with SLE was 13.96% (95% CI 8.88 to 19.04). The female/male ratio of sSS in the RA population was 14.7 (95% CI 7.09 to 256) and in the SLE population was 16.82 (95% CI 1.22 to 32.4). Prevalence rates of sSS vary widely in different populations. Both meta-analyses conducted in the RA and SLE populations were characterized by a high degree of study heterogeneity. The results of this meta-analysis highlight the need for better quality population studies.

  12. 22-year surface salinity changes in the Seasonal Ice Zone near 140°E off Antarctica

    Science.gov (United States)

    Morrow, Rosemary; Kestenare, Elodie

    2017-11-01

    Seasonal and interannual variations in sea surface salinity (SSS) are analyzed in the Sea Ice Zone south of 60°S, from a 22-year time series of observations near 140°E. In the northern sea-ice zone during the warming, melting cycle from October to March, waters warm by an average of 3.5 °C and become fresher by 0.1 to 0.25. In the southern sea-ice zone, the surface temperatures vary from - 1 to 1 °C over summer, and the maximal SSS range occurs in December, with a minimum SSS of 33.65 near the Southern Boundary of the ACC, reaching 34.4 in the shelf waters close to the coast. The main fronts, normally defined at subsurface, are shown to have more distinct seasonal characteristics in SSS than in SST. The interannual variations in SSS are more closely linked to variations in upstream sea-ice cover than surface forcing. SSS and sea-ice variations show distinct phases, with large biannual variations in the early 1990s, weaker variations in the 2000s and larger variations again from 2009 onwards. The calving of the Mertz Glacier Tongue in February 2010 leads to increased sea-ice cover and widespread freshening of the surface layers from 2011 onwards. Summer freshening in the northern sea-ice zone is 0.05-0.07 per decade, increasing to 0.08 per decade in the southern sea-ice zone, largely influenced by the Mertz Glacier calving event at the end of our time series. The summer time series of SSS on the shelf at 140°E is in phase but less variable than the SSS observed upstream in the Adélie Depression, and thus represents a spatially integrated index of the wider SSS variations.

  13. Subjective social status and mortality: the English Longitudinal Study of Ageing.

    Science.gov (United States)

    Demakakos, Panayotes; Biddulph, Jane P; de Oliveira, Cesar; Tsakos, Georgios; Marmot, Michael G

    2018-05-19

    Self-perceptions of own social position are potentially a key aspect of socioeconomic inequalities in health, but their association with mortality remains poorly understood. We examined whether subjective social status (SSS), a measure of the self-perceived element of social position, was associated with mortality and its role in the associations between objective socioeconomic position (SEP) measures and mortality. We used Cox regression to model the associations between SSS, objective SEP measures and mortality in a sample of 9972 people aged ≥ 50 years from the English Longitudinal Study of Ageing over a 10-year follow-up (2002-2013). Our findings indicate that SSS was associated with all-cause, cardiovascular, cancer and other mortality. A unit decrease in the 10-point continuous SSS measure increased by 24 and 8% the mortality risk of people aged 50-64 and ≥ 65 years, respectively, after adjustment for age, sex and marital status. The respective estimates for cardiovascular mortality were 36 and 11%. Adjustment for all covariates fully explained the association between SSS and cancer mortality, and partially the remaining associations. In people aged 50-64 years, SSS mediated to a varying extent the associations between objective SEP measures and all-cause mortality. In people aged ≥ 65 years, SSS mediated to a lesser extent these associations, and to some extent was associated with mortality independent of objective SEP measures. Nevertheless, in both age groups, wealth partially explained the association between SSS and mortality. In conclusion, SSS is a strong predictor of mortality at older ages, but its role in socioeconomic inequalities in mortality appears to be complex.

  14. Lasers, stem cells, and COPD

    Directory of Open Access Journals (Sweden)

    De Necochea-Campion Rosalia

    2010-02-01

    Full Text Available Abstract The medical use of low level laser (LLL irradiation has been occurring for decades, primarily in the area of tissue healing and inflammatory conditions. Despite little mechanistic knowledge, the concept of a non-invasive, non-thermal intervention that has the potential to modulate regenerative processes is worthy of attention when searching for novel methods of augmenting stem cell-based therapies. Here we discuss the use of LLL irradiation as a "photoceutical" for enhancing production of stem cell growth/chemoattractant factors, stimulation of angiogenesis, and directly augmenting proliferation of stem cells. The combination of LLL together with allogeneic and autologous stem cells, as well as post-mobilization directing of stem cells will be discussed.

  15. Final Safety Analysis Report (FSAR) for Building 332, Increment III

    Energy Technology Data Exchange (ETDEWEB)

    Odell, B. N.; Toy, Jr., A. J.

    1977-08-31

    This Final Safety Analysis Report (FSAR) supplements the Preliminary Safety Analysis Report (PSAR), dated January 18, 1974, for Building 332, Increment III of the Plutonium Materials Engineering Facility located at the Lawrence Livermore Laboratory (LLL). The FSAR, in conjunction with the PSAR, shows that the completed increment provides facilities for safely conducting the operations as described. These documents satisfy the requirements of ERDA Manual Appendix 6101, Annex C, dated April 8, 1971. The format and content of this FSAR complies with the basic requirements of the letter of request from ERDA San to LLL, dated March 10, 1972. Included as appendices in support of th FSAR are the Building 332 Operational Safety Procedure and the LLL Disaster Control Plan.

  16. Stemming options and their effect on containment

    International Nuclear Information System (INIS)

    Day, J.A.

    1976-01-01

    In more than 17 years of studying underground nuclear explosions, LLL has developed containment procedures that include a stemming plan. Stemming plans can be divided into either layered or continuous forms. There are marked differences between standards for these forms. The materials used in the continuous plan must meet more stringent specifications; as a consequence, they are more expensive. Both plans have been successful since the Baneberry Event. Both plans must meet the following requirements: provide a plug sufficient to match the overburden density of earth; contain radioactive gases at the lowest possible depth; minimize the generation of noncondensable gases (such as CO 2 ); minimize gas flow rates during the early post-detonation stages when cavity pressure is high; and be compatible with the experiment and its diagnostics. LLL experience in developing containment procedures is reviewed, and the reasons for the adoption of LLL's continuous stemming plan are reported

  17. Experimental study of fouling and cleaning of sintered stainless steel membrane in electro-microfiltration of calcium salt particles.

    Science.gov (United States)

    Qin, Frank G F; Mawson, John; Zeng, Xin An

    2011-05-30

    Sintered stainless steel (SSS) microfiltration membranes, which served as electrode directly, were used for the experiment of separating Alamin, a calcium salt and protein containing particles, found in dairy processing. Fouling and cleaning of the SSS membranes under the application of an external electric field were studied. The imposed electric field was found, diverging the pH of permeate and retentate. This in turn altered the solubility of the calcium salt and impacted the performance of electro microfiltration membrane. Using electric field as an enhanced cleaning-in-place (CIP) method in back flushing SSS membrane was also studied.

  18. Experimental Study of Fouling and Cleaning of Sintered Stainless Steel Membrane in Electro-Microfiltration of Calcium Salt Particles

    Directory of Open Access Journals (Sweden)

    Frank G. F. Qin

    2011-05-01

    Full Text Available Sintered stainless steel (SSS microfiltration membranes, which served as electrode directly, were used for the experiment of separating Alamin, a calcium salt and protein containing particles, found in dairy processing. Fouling and cleaning of the SSS membranes under the application of an external electric field were studied. The imposed electric field was found, diverging the pH of permeate and retentate. This in turn altered the solubility of the calcium salt and impacted the performance of electro microfiltration membrane. Using electric field as an enhanced cleaning-in-place (CIP method in back flushing SSS membrane was also studied.

  19. On double-degenerate type Ia supernova progenitors as supersoft X-ray sources - A population synthesis analysis using SeBa

    DEFF Research Database (Denmark)

    Nielsen, Mikkel T. B.; Nelemans, Gijs; Voss, Rasmus

    2013-01-01

    a SSS phase. Aims: We aim to examine the possibility of double-degenerate progenitor systems being SSSs, and place stringent upper limits on the maximally possible durations of any SSS phases and expected number of these systems in a galactic population. Method: We employ the binary population synthesis...... code SeBa to examine the mass-transfer characteristics of a possible SSS phase of double-degenerate type Ia SN progenitor systems for 1) the standard SeBa assumptions, and 2) an optimistic best-case scenario. The latter case establishes firm upper limits on the possible population of supersoft source...

  20. Quantitative Evaluation of 2 Scatter-Correction Techniques for 18F-FDG Brain PET/MRI in Regard to MR-Based Attenuation Correction.

    Science.gov (United States)

    Teuho, Jarmo; Saunavaara, Virva; Tolvanen, Tuula; Tuokkola, Terhi; Karlsson, Antti; Tuisku, Jouni; Teräs, Mika

    2017-10-01

    In PET, corrections for photon scatter and attenuation are essential for visual and quantitative consistency. MR attenuation correction (MRAC) is generally conducted by image segmentation and assignment of discrete attenuation coefficients, which offer limited accuracy compared with CT attenuation correction. Potential inaccuracies in MRAC may affect scatter correction, because the attenuation image (μ-map) is used in single scatter simulation (SSS) to calculate the scatter estimate. We assessed the impact of MRAC to scatter correction using 2 scatter-correction techniques and 3 μ-maps for MRAC. Methods: The tail-fitted SSS (TF-SSS) and a Monte Carlo-based single scatter simulation (MC-SSS) algorithm implementations on the Philips Ingenuity TF PET/MR were used with 1 CT-based and 2 MR-based μ-maps. Data from 7 subjects were used in the clinical evaluation, and a phantom study using an anatomic brain phantom was conducted. Scatter-correction sinograms were evaluated for each scatter correction method and μ-map. Absolute image quantification was investigated with the phantom data. Quantitative assessment of PET images was performed by volume-of-interest and ratio image analysis. Results: MRAC did not result in large differences in scatter algorithm performance, especially with TF-SSS. Scatter sinograms and scatter fractions did not reveal large differences regardless of the μ-map used. TF-SSS showed slightly higher absolute quantification. The differences in volume-of-interest analysis between TF-SSS and MC-SSS were 3% at maximum in the phantom and 4% in the patient study. Both algorithms showed excellent correlation with each other with no visual differences between PET images. MC-SSS showed a slight dependency on the μ-map used, with a difference of 2% on average and 4% at maximum when a μ-map without bone was used. Conclusion: The effect of different MR-based μ-maps on the performance of scatter correction was minimal in non-time-of-flight 18 F-FDG PET

  1. Development and preliminary validation of the spondyloarthritis research consortium of Canada magnetic resonance imaging sacroiliac joint structural score

    DEFF Research Database (Denmark)

    Maksymowych, Walter P; Wichuk, Stephanie; Chiowchanwisawakit, Praveena

    2015-01-01

    on magnetic resonance imaging (MRI), the Spondyloarthritis Research Consortium of Canada (SPARCC) SIJ Structural Score (SSS). METHODS: The SSS method for assessment of structural lesions is based on T1-weighted spin echo MRI, validated lesion definitions, slice selection according to well-defined anatomical...... in scores, and was highest for fat metaplasia when both ICC and SDC values were compared. CONCLUSION: The new SPARCC MRI SSS method can detect structural changes in the SIJ with acceptable reliability over a 1-2-year timeframe, and should be further validated in patients with SpA....

  2. Use of and barriers to access to opioid analgesics: a worldwide, regional, and national study.

    Science.gov (United States)

    Berterame, Stefano; Erthal, Juliana; Thomas, Johny; Fellner, Sarah; Vosse, Benjamin; Clare, Philip; Hao, Wei; Johnson, David T; Mohar, Alejandro; Pavadia, Jagjit; Samak, Ahmed Kamal Eldin; Sipp, Werner; Sumyai, Viroj; Suryawati, Sri; Toufiq, Jallal; Yans, Raymond; Mattick, Richard P

    2016-04-16

    Despite opioid analgesics being essential for pain relief, use has been inadequate in many countries. We aim to provide up-to-date worldwide, regional, and national data for changes in opioid analgesic use, and to analyse the relation of impediments to use of these medicines. We calculated defined daily doses for statistical purposes (S-DDD) per million inhabitants per day of opioid analgesics worldwide and for regions and countries from 2001 to 2013, and we used generalised estimating equation analysis to assess longitudinal change in use. We compared use data against the prevalence of some health disorders needing opioid use. We surveyed 214 countries or territories about impediments to availability of these medicines, and used regression analyses to establish the strength of associations between impediments and use. The S-DDD of opioid analgesic use more than doubled worldwide between 2001-03 and 2011-13, from 1417 S-DDD (95% CI -732 to 3565; totalling about 3.01 billion defined daily doses per annum) to 3027 S-DDD (-1162 to 7215; totalling about 7.35 billion defined daily doses per annum). Substantial increases occurred in North America (16,046 S-DDD [95% CI 4032-28,061] to 31,453 S-DDD [8121-54,785]), western and central Europe (3079 S-DDD [1274-4883] to 9320 S-DDD [3969-14,672]), and Oceania (2275 S-DDD [763-3787] to 9136 S-DDD [2508-15,765]). Countries in other regions have shown no substantial increase in use. Impediments to use included an absence of training and awareness in medical professionals, fear of dependence, restricted financial resources, issues in sourcing, cultural attitudes, fear of diversion, international trade controls, and onerous regulation. Higher number of impediments reported was significantly associated with lower use (unadjusted incidence rate ratio 0.39 [95% CI 0.29-0.52]; p<0.0001), but not when adjusted for gross domestic product and human development index (0.91 [0.73-1.14]; p=0.4271). Use of opioid analgesics has increased, but

  3. Trends in the Outpatient Utilization of Antipsychotic Drugs in the City of Zagreb in the Ten-Year Period as a Tool to Assess Drug Prescribing Rationality.

    Science.gov (United States)

    Polić-Vižintin, Marina; Tripković, Ingrid; Štimac, Danijela; Šostar, Zvonimir; Orban, Mirjana

    2016-12-01

    The aim was to determine distribution and trends in the outpatient utilization of antipsychotics to evaluate the rationality of antipsychotic drug prescribing during the ten year period. The epidemiological method of descriptive and analytical observation was used. Data on drug utilization from Zagreb Municipal Pharmacy were used to calculate the number of defined daily doses (DDD) and DDD per 1000 inhabitants per day (DDD/TID) using the World Health Organization Anatomical-Therapeutic-Chemical methodology. The ratio of typical versus atypical antipsychotics served as an indicator on assessing the rationality of the utilization. Data on the use of anticholinergics in the treatment of neuroleptic side effects were also included. Outpatient utilization of antipsychotics showed a declining pattern from 14.17 in 2001 to 8.42 DDD/TID in 2010. The utilization of atypical antipsychotics increased by 60% (from 3.68 to 5.89 DDD/TID), while the utilization of typical antipsychotics decreased by 76% (from 10.49 to 2.53 DDD/TID). The drugs showing the largest increase were olanzapine (from 1.21 to 2.78 DDD/TID) and quetiapine (from 0 to 0.68 DDD/TID). The typical/atypical antipsychotic ratio changed from 1:0.4 in 2001 to 1:2.3 in 2010. A 2.3-fold decrease was recorded in the utilization of anticholinergics (from 2.05 to 0.91 DDD/TID). Total consumption of neuroleptics significantly decreased. A decrease was also recorded in the utilization of anticholinergics. Study results pointed to two favorable features, i.e. low use of typical antipsychotics and the ratio of typical and atypical antipsychotics. Implementation of the new clinical guidelines for nervous system disorders and updating of the list of reimbursable drugs with the addition of new ones contributed to the observed improvement in the prescribing patterns during the study period. Using the WHO ATC/DDD methodology and rationality indicators in the assessment of trends in the outpatient utilization of

  4. Association of self-reported cognitive concerns with mobility in people with lower limb loss.

    Science.gov (United States)

    Kelly, Valerie E; Morgan, Sara J; Amtmann, Dagmar; Salem, Rana; Hafner, Brian J

    2018-01-01

    This study tested the hypothesis that greater perceived cognitive concerns are associated with worse mobility in a cohort of prosthesis users with lower limb loss (LLL). We performed a secondary analysis of cross-sectional self-report data from a volunteer sample of people with LLL due to dysvascular and non-dysvacular causes. Perceived cognitive difficulties were assessed using the Quality of Life in Neurological Disorders Applied Cognition - General Concerns (Neuro-QoL ACGC). Mobility was measured with the Activities-Specific Balance Confidence Scale (ABC) and the Prosthetic Limb Users Survey of Mobility (PLUS-M). Simple linear regressions examined univariate relationships between cognitive concerns and mobility. Multiple linear regression analyses included demographic and amputation-related variables that could influence this relationship. Analysis of data from 1291 people with LLL demonstrated that greater cognitive concerns, measured by the Neuro-QoL ACGC, were associated with poorer perceived mobility, measured by both ABC and PLUS-M instruments. This relationship remained statistically significant after adjusting for demographic and amputation-related factors. These results suggest that greater cognitive concerns are associated with worse mobility among a broad range of people with LLL. An improved understanding of this relationship is critical for optimizing rehabilitation outcomes for this population. Implications for rehabilitation Rehabilitation for people with lower limb loss (LLL) typically focuses on physical impairments and mobility limitations, but cognition is increasingly recognized to have an impact on functional outcomes. Greater perceived cognitive concerns are associated with poorer mobility among a broad range of people with LLL, even when adjusting for demographic and amputation-related factors. Cognitive status can impact relevant rehabilitative outcomes, including mobility, and should be considered when planning prosthetic and therapeutic

  5. The Effect of One Session Low Level Laser Therapy of Extracted Follicular Units on the Outcome of Hair Transplantation.

    Science.gov (United States)

    Tabaie, Seyed Mehdi; Berenji Ardestani, Hoda; Azizjalali, Mir Hadi

    2016-01-01

    Photobiostimulation with low level laser (LLL) has been used in medicine for a long time and its effects have been shown in many diseases. Some studies have evaluated the effect of LLL on androgenic alopecia. One of the most important limitations of the use of LLL in the treatment of alopecia is the requirement for multiple sessions, which is hardly accepted by patients. This study was conducted to evaluate the effect of the irradiation of extracted follicular hair units by LLL on the outcome of hair transplantation. We enrolled 10 patients with androgenic alopecia and after screening tests for infections and other diseases, we extracted hair follicular units. The hair units were divided in two groups. One group was irradiated by LLL 20 minutes before transplantation (660 nm, 80 Hz, 100 mW) and the other one was used as control. The containing plates were labeled as A and B and sent to the operation room. The surgeon was unaware of the therapy assigned to the plates and transplanted them randomly on the right or left side of the head. One hundred follicular units on each sides of the scalp were transplanted symmetrically. The follicles on both sides were evaluated at 3 and 6 months of transplantation for hair growth rate by another physician, blinded to the treatment assigned to each side. Ten patient with androgenic alopecia and mean (SD) age of 31.5 (6.6) years (range 25-45 years) completed the study. All patients had 100% hair growth at 3 and 6 months follow-up except one who had hair growth of 20% at three months of transplantation, which changed to 100% at sixth months. There was no significant difference between the groups regarding hair growth (P > 0.8). One session of LLL irradiation has no significant effect on the outcome of transplanted hair follicles. Studies with larger sample size are needed to draw a definite conclusion.

  6. Recommended revisions to Nuclear Regulatory Commission seismic design criteria. Technical report

    International Nuclear Information System (INIS)

    Coats, D.W.

    1980-05-01

    This report recommends changes in the Nuclear Regulatory Commission's (NRC's) criteria now used in the seismic design of nuclear power plants. Areas covered include ground motion, soil-structure interaction, structures, and equipment and components. Members of the Engineering Mechanics Section of the Nuclear Test Engineering Division at Lawrence Livermore Laboratory (LLL) generally agreed upon the recommendations, which are based on (1) reports developed under the NRC's Task Action Plan A-40, (2) other available engineering literature, and (3) recommendations of nationally recognized experts retained by LLL specifically for this task

  7. Electronics engineering research proposals for FY78

    International Nuclear Information System (INIS)

    Cleland, L.L.; Ekstrom, M.P.; Miller, E.K.

    1977-01-01

    Since most of the Electronics Engineering Research expenditures are in the Engineering Research Division (ERD), the two are inseparable when discussing plans. A reorganization of ERD aimed at further expanding LLL capabilities and being more responsive to LLL needs is now complete. Six discipline related groups constitute the research elements in ERD. Three groups remained unchanged, one group was modified slightly, two groups were added, and one group was dissolved. The technical activities of each of the six research-oriented groups within ERD are reported

  8. Phase-contrast microtomography using an X-ray interferometer having a 40-μm analyzer

    Science.gov (United States)

    Momose, A.; Koyama, I.; Hamaishi, Y.; Yoshikawa, H.; Takeda, T.; Wu, J.; Itai, Y.; Takai, , K.; Uesugi, K.; Suzuki, Y.

    2003-03-01

    Phase-contrast X-ray tomographic experiment using a triple Laue-case (LLL) interferometer having a 40-μm lamella which was fabricated to improve spatial resolution, was carried out using undulator X-rays at SPring-8, Japan. Three-dimensional images mapping the refractive index were measured for various animal tissues. Comparing the images with those obtained in previous experiments using conventional LLL interferometers having a 1-mm lamella, improvement in the spatial resolution was demonstrated in that histological structures, such as hepatic lobules in liver and tubules in kidney, were revealed.

  9. Elukestev õpe Euroopas / Raivo Juurak

    Index Scriptorium Estoniae

    Juurak, Raivo

    2007-01-01

    Tallinna Ülikooli andragoogide ja sotsioloogidega kohtus täiskasvanuhariduse teoreetik ja filosoof professor Peter Jarvis. Peter Jarvis külastas Eestit kuna, TLÜ Rahvusvaheliste ja Sotsiaaluuringute Instituut koordineerib 13 riiki hõlmavat projekti "Towards Life-long Learning Society in Europe : the Contribution of Educational System" ("Haridussüsteemi roll elukestval õppel põhineva ühiskonna rajamisel"), lühidalt LLL2010. LLL2010 on Euroopa Liidu 6. raamprogrammi integreeritud projekt, millega tahetakse saada ülevaadet täiskasvanuharidusest Euroopas

  10. Deployment of Lightweight Shock Mitigating Boat Manufacturing Innovation

    Science.gov (United States)

    2012-12-21

    hull and deck of the 11M prototype with the forward hatches temporally secured. Lift hardware was installed. The craft was loaded per the figure...35.9262 25.8100- 25.8100 36.0443 34.3043 l- EAD Wf.IG G (Pi’-\\ A r IMJ<HEAO WING E (P) r !MJ<HEAOWING O(P) ul lll ld II lll rnr Il l II I llll Il l...ii ~ "’ 57 11M- Hull Drawings – Fiberglass Design / ?--/ - ~ L 10 1&116" ______..j_j DETAIL B-50 BU~ EAD WING A OET AIL C-50 BULKHEAD

  11. Degenerative inter-vertebral disc disease osteochondrosis intervertebralis in Europe: prevalence, geographic variation and radiological correlates in men and women aged 50 and over.

    Science.gov (United States)

    Armbrecht, Gabriele; Felsenberg, Dieter; Ganswindt, Melanie; Lunt, Mark; Kaptoge, Stephen K; Abendroth, Klaus; Aroso Dias, Antonio; Bhalla, Ashok K; Cannata Andia, Jorge; Dequeker, Jan; Eastell, Richard; Hoszowski, Krzysztof; Lyritis, George; Masaryk, Pavol; van Meurs, Joyce; Miazgowski, Tomasz; Nuti, Ranuccio; Poór, Gyula; Redlund-Johnell, Inga; Reid, David M; Schatz, Helmut; Todd, Christopher J; Woolf, Anthony D; Rivadeneira, Fernando; Javaid, Muhammad K; Cooper, Cyrus; Silman, Alan J; O'Neill, Terence W; Reeve, Jonathan

    2017-07-01

    To assess the prevalences across Europe of radiological indices of degenerative inter-vertebral disc disease (DDD); and to quantify their associations with, age, sex, physical anthropometry, areal BMD (aBMD) and change in aBMD with time. In the population-based European Prospective Osteoporosis Study, 27 age-stratified samples of men and women from across the continent aged 50+ years had standardized lateral radiographs of the lumbar and thoracic spine to evaluate the severity of DDD, using the Kellgren-Lawrence (KL) scale. Measurements of anterior, mid-body and posterior vertebral heights on all assessed vertebrae from T4 to L4 were used to generate indices of end-plate curvature. Images from 10 132 participants (56% female, mean age 63.9 years) passed quality checks. Overall, 47% of men and women had DDD grade 3 or more in the lumbar spine and 36% in both thoracic and lumbar spine. Risk ratios for DDD grades 3 and 4, adjusted for age and anthropometric determinants, varied across a three-fold range between centres, yet prevalences were highly correlated in men and women. DDD was associated with flattened, non-ovoid inter-vertebral disc spaces. KL grade 4 and loss of inter-vertebral disc space were associated with higher spine aBMD. KL grades 3 and 4 are often used clinically to categorize radiological DDD. Highly variable European prevalences of radiologically defined DDD grades 3+ along with the large effects of age may have growing and geographically unequal health and economic impacts as the population ages. These data encourage further studies of potential genetic and environmental causes. © The Author 2017. Published by Oxford University Press on behalf of the British Society for Rheumatology. All rights reserved. For Permissions, please email: journals.permissions@oup.com

  12. Degenerative Inter-Vertebral Disc Disease (Osteochondrosis Intervertebralis) in Europe: Prevalence, Geographic Variation, and Radiological Correlates in Men and Women Aged 50 and Over

    Science.gov (United States)

    Armbrecht, Gabriele; Felsenberg, Dieter; Ganswindt, Melanie; Lunt, Mark; Kaptoge, Stephen K; Abendroth, Klaus; Aroso Dias, Antonio; Bhalla, Ashok K; Cannata Andia, Jorge; Dequeker, Jan; Eastell, Richard; Hoszowski, Krysztoff; Lyritis, George; Masaryk, Pavol; van Meurs, Joyce; Miazgowski, Tomasz; Nuti, Ranuccio; Poór, Gyula; Redlund-Johnell, Inga; Reid, David M; Schatz, Helmut; Todd, Christopher J; Woolf, Anthony D; Rivadeneira, Fernando; Javaid, Muhammad K; Cooper, Cyrus; Silman, Alan J; O’Neill, Terence W; Reeve, Jonathan

    2017-01-01

    Objectives To assess the prevalence across Europe of radiological indices of degenerative inter-vertebral disc disease (DDD); and to quantify their associations with, age, sex, physical anthropometry, areal bone mineral density (aBMD) and change in aBMD with time. Methods In the population-based European Prospective Osteoporosis Study 27 age-stratified samples of men and women from across the continent aged 50+ had standardized lateral radiographs of the lumbar and thoracic spine to evaluate the severity of DDD, using the Kellgren-Lawrence (KL) scale. Measurements of anterior, mid-body and posterior vertebral heights on all assessed vertebrae from T4 to L4 were used to generate indices of end-plate curvature. Results Images from 10,132 participants (56% female, mean age 63.9 years) passed quality checks. Overall, 47% of men and women had DDD grade 3 or more in the lumbar spine and 36% in both thoracic and lumbar spine. Risk ratios for DDD grades 3 and 4, adjusted for age and anthropometric determinants, varied across a three-fold range between centres, yet prevalences were highly correlated in men and women. DDD was associated with flattened, non-ovoid inter-vertebral disc spaces. KL grade 4 and loss of inter-vertebral disc space were associated with higher spine aBMD. Discussion KL Grades 3 and 4 are often used clinically to categorise radiological DDD. Highly variable European prevalences of radiologically-defined DDD Grades 3+ along with the large effects of age may have growing and geographically unequal health and economic impacts as the population ages. These data encourage further studies of potential genetic and environmental causes. PMID:28398504

  13. Quality-controlled sea surface temperature, salinity and other measurements from the NCEI Global Thermosalinographs Database (NCEI-TSG)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This collection contains global in-situ sea surface temperature (SST), salinity (SSS) and other measurements from the NOAA NCEI Global Thermosalinographs Database...

  14. Long term effects of cilostazol in a dog with sick sinus syndrome.

    Science.gov (United States)

    Kanno, Nobuyuki; Suzuki, Tomohiro

    2017-06-16

    Sick sinus syndrome (SSS) is a type of bradyarrhythmia that can lead to syncope. Cilostazol has been reported to be an effective treatment for human patients with SSS and other bradyarrhythmias. This report describes the successful long-term treatment with cilostazol in a dog with SSS. A nine-year old intact male Miniature Schnauzer presented with a history of syncopal episodes and unsteady gait. After cilostazol treatment, the total heart rate (HR), mean HR, and frequency of premature ventricular contractions (PVCs) increased, while the maximum HR and maximum pause time decreased. Additionally, the number of syncopal episodes decreased. The dog died suddenly, 1,418 days after the start of cilostazol treatment. Cilostazol may be a useful therapeutic agent in canines with SSS.

  15. Effect on School Language in Assessment of Achievement

    African Journals Online (AJOL)

    Eric Wilmot

    hundred randomly selected Senior Secondary School II (SSS II) Agricultural Science ... interaction effect of treatment and gender on students' achievement in an ...... Self-concept and science achievement in co-educational and single-sex.

  16. PODAAC-SMP30-3TPCS

    Data.gov (United States)

    National Aeronautics and Space Administration — This is the PI-produced JPL SMAP-SSS CAP, 8-day running mean, level 3 mapped, sea surface salinity product from the NASA Soil Moisture Active Passive (SMAP)...

  17. PODAAC-SMP40-3TPCS

    Data.gov (United States)

    National Aeronautics and Space Administration — This is the PI-produced JPL SMAP-SSS V4.0 CAP, 8-day running mean, level 3 mapped, sea surface salinity product from the NASA Soil Moisture Active Passive (SMAP)...

  18. PODAAC-SMP30-2TOCS

    Data.gov (United States)

    National Aeronautics and Space Administration — This is the PI-produced JPL SMAP-SSS, level 2B CAP, validated sea surface salinity orbital/swath product from the NASA Soil Moisture Active Passive (SMAP)...

  19. PODAAC-AQR40-4U7CS

    Data.gov (United States)

    National Aeronautics and Space Administration — The IPRC/SOEST Aquarius OI-SSS v4 product is a level 4, near-global, 0.5 degree spatial resolution, 7-day, optimally interpolated salinity dataset based on version...

  20. PODAAC-SMP20-2SOCS

    Data.gov (United States)

    National Aeronautics and Space Administration — The version 2.0 SMAP-SSS, level 2C product contains the first release of the validated sea surface salinity orbital/swath data from the NASA Soil Moisture Active...

  1. PODAAC-SMP40-3TMCS

    Data.gov (United States)

    National Aeronautics and Space Administration — This is the PI-produced JPL SMAP-SSS V4.0 CAP, level 3, monthly mapped sea surface salinity product from the NASA Soil Moisture Active Passive (SMAP) observatory. It...

  2. PODAAC-SMP30-3TMCS

    Data.gov (United States)

    National Aeronautics and Space Administration — This is the PI-produced JPL SMAP-SSS CAP, level 3, monthly mapped sea surface salinity product from the NASA Soil Moisture Active Passive (SMAP) observatory. It is...

  3. The Effect of Psychological Suzhi on Problem Behaviors in Chinese Adolescents: The Mediating Role of Subjective Social Status and Self-esteem.

    Science.gov (United States)

    Liu, Guangzeng; Zhang, Dajun; Pan, Yangu; Ma, Yuanxiao; Lu, Xingyue

    2017-01-01

    In this study, we examined subjective social status (SSS) and self-esteem as potential mediators between the association of psychological suzhi and problem behaviors in a sample of 1271 Chinese adolescents (44.5% male, grades 7-12). The results showed that SSS and self-esteem were fully mediating the relationship between psychological suzhi and problem behaviors. Moreover, the indirect effect was stronger via self-esteem than via SSS. These findings perhaps provide insight into the preliminary effect that SSS and self-esteem underlie psychological suzhi 's effect on adolescents' problem behaviors, and also are important in helping school-teachers and administrators to develop a better understanding of problem behaviors in their schools as a pre-requisite to the development of more effective behaviors management practices from the perspective of psychological suzhi. Implications and limitations in the present study have also been discussed.

  4. Sanjad-Sakati syndrome with macrocytic anemia and failure to thrive: a case from South Jordan.

    Science.gov (United States)

    Ajarmeh, Salma A; Al Tamimi, Eyad M

    2018-03-01

    Backgorund: Sanjad-Sakati syndrome (SSS) is a rare autosomal recessive disease caused by a deletion mutation (155-166del) in exon 3 of the TBCE gene on chromosome 1q42-43. The syndrome is characterized by primary hypoparathyroidism, typical dysmorphic features and severe growth retardation. We encountered a 2-year-old boy with hypocalcemia, failure to thrive and macrocytic anemia. The patient had the characteristic features of SSS and genetic testing confirmed that he was homozygous for the TBCE mutation. Although malabsorption was initially considered the cause of his symptoms, the results did not confirm that diagnosis. Our patient had cow milk protein allergy and folic acid deficiency, which has not been described in previous SSS cases. It was difficult to treat the patient's hyperphosphatemia and we ultimately selected sevelamer treatment, which was tolerated well and improved his hypocalcemia. SSS should be considered in the differential diagnosis of any infant with hypocalcemia, dysmorphism and failure to thrive.

  5. 285 Teachers‟ Experience and Students‟ Numerical Proficiency in ...

    African Journals Online (AJOL)

    First Lady

    2013-01-28

    Jan 28, 2013 ... (Sixty co-educational secondary schools and their SSS111 physics teachers were ... The role of science in technological development has long been realized in many developing ..... Navinegian Elementary School Level.

  6. A new technique for the estimation of sea surface salinity in the tropical Indian Ocean from OLR

    Digital Repository Service at National Institute of Oceanography (India)

    Murty, V.S.N.; Subrahmanyam, B.; Tilvi, V.; O'Brien, J.J.

    stream_size 109417 stream_content_type text/plain stream_name J_Geophys_Res_C_109_C12006.pdf.txt stream_source_info J_Geophys_Res_C_109_C12006.pdf.txt Content-Encoding UTF-8 Content-Type text/plain; charset=UTF-8 A new... Ocean. The estimated SSS at 2.5C176 C2 2.5C176 grid on monthly scale is nearer to the WOA98 SSS with lower differences within ±0.5–0.8 away from the coastal region. The estimated SSS also agrees reasonably with the observed SSS along the trans...

  7. Comparison of the sagittal sinus cross-sectional area between patients with multiple sclerosis, hydrocephalus, intracranial hypertension and spontaneous intracranial hypotension: a surrogate marker of venous transmural pressure?

    Science.gov (United States)

    Bateman, Grant A; Lechner-Scott, Jeannette; Copping, Ross; Moeskops, Christopher; Yap, Swee Leong

    2017-07-06

    There is evidence that patients with multiple sclerosis (MS) and hydrocephalus share some common pathophysiological mechanisms. Alterations in CSF pressure are known to affect cerebral venous sinus geometry. To further explore these mechanisms, we measured the superior sagittal sinus (SSS) cross-sectional area 3 cm above the torcular using T2 images in 20 MS, 10 spontaneous intracranial hypotension (SIH), 21 hydrocephalus and 20 idiopathic intracranial hypertension (IIH) patients and compared with 20 matched controls. The SSS area was reduced by 25% in hydrocephalus (p = 0.0008), increased by 22% (p = 0.037) in SIH and unchanged in IIH compared to matched controls. In MS there was a 16% increase in SSS area (p = 0.01).The findings suggest that changes in SSS cross-sectional are common between MS and SIH patients, while in hydrocephalus and IIH these are different.

  8. Prognostic value of gated 201Tl myocardial perfusion SPECT imaging in patients with coronary artery disease

    International Nuclear Information System (INIS)

    Li Zicheng; Chen Xiaoming; Xu Hao

    2006-01-01

    Objective: To study the prognostic value of gated 201 Tl myocardial perfusion SPECT imaging in patients with coronary artery disease and assessment of therapy strategy for the individual patient. Methods: Eighty-four patients underwent rest and exercise stress 201 Tl gated myocardial perfusion SPECT imaging and were followed up for (32.92 ± 16.77) months. Images were studied using 17 segments and 1 to 4 scoring. Global summed stress score (SSS), summed rest score (SRS) and summed difference score (SDS=SSS-SRS) were also calculated. Post-stress and rest ejection fraction (EF) were automatically measured. Results: Nine cardiac events occurred (3.90% per year). SSS, SDS, SRS and EF were the independent predictors of cardiac events (P 201 Tl myocardial perfusion SPECT imaging can provide prognostic assessment for the patients with coronary artery disease and guide in selection of therapeutic strategy. Among all of the indices SSS is the best predictors of cardiac events. (authors)

  9. An evaluation of instructional strategies used in hiv/aids preventive ...

    African Journals Online (AJOL)

    AIDS instructional strategies on JSS and SSS Students' knowledge, attitude and intentions about future sexual behaviour. Construct validity of the 12-item attitude scale was tested using factor analysis. Cronbach's alpha was utilised to determine ...

  10. Seasonal Mean SST images of Stellwagen Bank National Marine Sanctuary

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Average seasonal sea surface temperatures http://podaac.jpl.nasa.gov/ Naming Convention: XXXX_SSSYYYY_SST.tif XXXX=location (Stell) SSS=season (FAL=fall, SPR=spring,...

  11. Grand Seasonal SST images of the Stellwagen Bank National Marine Sanctuary

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Grand monthly mean Sea Surface Temperature http://podaac.jpl.nasa.gov/ Naming Convention: XXXX_SSSYYYY1YYYY2_GAVGSST.tif XXXX=location (Stell) SSS= season...

  12. Functional effects of treadmill-based gait training at faster speeds in stroke survivors: a prospective, single-group study.

    Science.gov (United States)

    Mohammadi, Roghayeh; Ershad, Navid; Rezayinejad, Marziyeh; Fatemi, Elham; Phadke, Chetan P

    2017-09-01

    To examine the functional effects of walking retraining at faster than self-selected speed (SSS). Ten individuals with chronic stroke participated in a 4-week training over a treadmill at walking speeds 40% faster than SSS, three times per week, 30 min/session. Outcome measures assessed before, after, and 2 months after the end of intervention were the Timed Up and Go, the 6-Minute Walk, the 10-Meter Walk test, the Modified Ashworth Scale, SSS, and fastest comfortable speed. After 4 weeks of training, all outcome measures showed clinically meaningful and statistically significant improvements (Ptraining. The results showed that a strategy of training at a speed 40% faster than SSS can improve functional activity in individuals with chronic stroke, with effects lasting up to 2 months after the intervention.

  13. The Effect of Psychological Suzhi on Problem Behaviors in Chinese Adolescents: The Mediating Role of Subjective Social Status and Self-esteem

    Directory of Open Access Journals (Sweden)

    Guangzeng Liu

    2017-08-01

    Full Text Available In this study, we examined subjective social status (SSS and self-esteem as potential mediators between the association of psychological suzhi and problem behaviors in a sample of 1271 Chinese adolescents (44.5% male, grades 7–12. The results showed that SSS and self-esteem were fully mediating the relationship between psychological suzhi and problem behaviors. Moreover, the indirect effect was stronger via self-esteem than via SSS. These findings perhaps provide insight into the preliminary effect that SSS and self-esteem underlie psychological suzhi’s effect on adolescents’ problem behaviors, and also are important in helping school-teachers and administrators to develop a better understanding of problem behaviors in their schools as a pre-requisite to the development of more effective behaviors management practices from the perspective of psychological suzhi. Implications and limitations in the present study have also been discussed.

  14. Can mothers safely prepare labon-gur salt-sugar solution after demonstration in a diarrhoeal hospital?

    DEFF Research Database (Denmark)

    Islam, M A; Kofoed, Poul-Erik; Begum, S

    1992-01-01

    Home-based salt-sugar solution (SSS) prepared with labon (locally produced sea salt) and gur (unrefined brown sugar) has been recommended as a cheap, locally available and a simple tool to prevent and treat diarrhoeal dehydration. Preparation of labon-gur SSS is demonstrated to the patients...... and the attendants at ICDDR, Bangladesh. To evaluate performances, 150 mothers were asked to measure labon and gur by finger pinch and first method and 100 mothers measured half a seer of water to prepare labon-gur SSS, shortly after the demonstration sessions. 4.0% of the samples exceeded the upper safety limit...... this knowledge. Our study suggests that demonstration of home-based SSS in a diarrhoeal hospital may positively affect health education and that health personnel should actively participate in increasing health awareness....

  15. Radiation graft post-polymerization of sodium styrene sulfonate onto polyethylene

    International Nuclear Information System (INIS)

    Kitaeva, N.K.; Duflot, V.R.; Ilicheva, N.S.

    2013-01-01

    Post-irradiation grafting of sodium styrene sulfonate (SSS) in the presence of acrylic acid (AA) has been investigated on polyethylene (PE) pre-exposed to gamma radiation at room temperature in the air. Special attention was paid to the effect of low molecular weight salt additives on the kinetics of graft copolymerization of SSS and AA. The presence of SSS links in the grafted PE copolymers was detected by the methods of UV and FTIR spectroscopy. Based on the FTIR spectroscopy and element analysis data, a mechanism was proposed for graft copolymerization of SSS and AA onto PE. The mechanical properties of the graft copolymers were studied. It was established that PE copolymers grafted with sulfonic acid and carboxyl groups have higher strength characteristics (16.3 MPa) compared to the samples containing only carboxyl groups (11 MPa). (author)

  16. Investigation of s stressed-strained state and optimization of the T-15 facility electromagnetic system design

    International Nuclear Information System (INIS)

    Vaulina, I.G.; Gusev, S.V.; Monoszon, N.A.; Sivkova, G.N.; Spirchenko, Yu.V.; Chvartatskij, R.V.; Churakov, G.F.

    1982-01-01

    The results of investigation of a stressed-strained state (SSS) of superconducting coils of toroidal field (TFSC) of the T-15 facility are presented. The TFSC SSS dependence on the forces acting in the coil plane is reduced to solving the plane problem of the elasticity theory. The problem is solved by the finite element method according to a specially developed program. The TFSC SSS dependence on the action of tilting forces is studied by the structural mechanics method. A refined rod theory taking into account shear strain of the rod cross-section in the direction perpendicular to its axis is used. A comparative analysis of different versions of the TFSC design is carried out. A TFSC design optimized over the SSS is chosen. It is used in constructing the electromagnetic system of the T-15 facility

  17. Results of Magnetic Axis Measurements on a Prototype Main Lattice Quadrupole for the LHC

    CERN Document Server

    Smirnov, N; Deferne, G; Parma, V; Rohmig, P; Tortschanoff, Theodor

    2004-01-01

    More than 470 twin aperture lattice quadrupoles are needed for the Large Hadron Collider (LHC) under construction at CERN. The lattice quadrupole, assembled with correction magnets in its helium enclosure - the cold mass and integrated in a common cryostat called the Short Straight Section (SSS). All SSS cold mass prototypes have been developed and built by CEA (Saclay) in collaboration with CNRS (Orsay, France). The last SSS prototype (SSS5) was used to investigate the behavior of the magnetic axis through various steps of the installation cycle for the series quadrupoles: including transportation, thermal-cycles, and being lowered into the tunnel. Results of extensive measurements before and after each of these stages are presented here, showing that the effect of transport is weak and within the window of measurement resolution. Also shown is that the long-term stability observed during two years is comparable with the requirements from magnet tolerances. To minimize systematic errors, all tests were perfo...

  18. Steam temperature variation behind a turbine steam separator-superheater during NPP start-up

    International Nuclear Information System (INIS)

    Lejzerovich, A.Sh.; Melamed, A.D.

    1979-01-01

    To determine necessary parameters of the steam temperature automatic regulator behind the steam separator-rheater supe (SSS) of an NPP turbine the static and dynamic characteristics of the temperature change behind the SSS were studied experimentally. The measurements were carried out at the K-220-44 turbine of the Kolskaja NPP in the case of both varying turbine loads and the flow rate of the heating vapor. Disturbances caused by the opening of the regulating valve at the inlet of the heating vapor are investigated as well. It is found that due to a relatively high inertiality of the SSS a rather simple structure of the start-up steam temperature regulators behind the SSS in composition with automatated driving systems of the turbine start-up without regard for the change of the dynamic characteristics can be used

  19. Operating Environment of the Future

    National Research Council Canada - National Science Library

    Hanson, Matthew

    1997-01-01

    ...), the Smart Surgical System (SSS), and the Intelligent Virtual Patient Environment (IVPE). The project is one of several targeting reduction in mortality and morbidity of the wounded soldier through improved far-forward combat casualty care...

  20. Cerebral venography and flow quantification with MR

    International Nuclear Information System (INIS)

    Mattle, H.; Elelman, R.R.; Reis, H.H.; O'Reilly, G.V.; Wentz, K.V.; O'Leary, D.H.; Finn, J.P.; Longmaid, H.E.

    1989-01-01

    The authors describe an approach for creating projection venograms of the head and quantifying flow in the cerebral veins and sinuses. A series of two- dimensional flow-compensated gradient-echo images were acquired. Signal from arteries was eliminated by application of a 5-cm-thick presaturation slab to the neck. The images were postprocessed with use of a maximum intensity projection algorithm to produce projection venograms. In addition, flow directionally, flow velocity, and, in the superior sagittal sinus (SSS), flow volume was assessed by means of a dynamic bolus tracking technique. Flow velocities in the SSS ranged from 20.1 to 45.5 cm/sec, and flow volumes from 269 to 612 mL/min. This technique was able to identify cerebral venous thrombosis and partial SSS obstruction, cerebral venous angiomas, and venous drainage of arteriovenous malformations and to demonstrate patency of the SSS with falx meningiomas

  1. Episodic chasing in pathological gamblers using the Iowa gambling task

    DEFF Research Database (Denmark)

    Linnet, J.; Rojskjaer, S.; Nygaard, Jørgen

    2006-01-01

    NPGs on the Iowa Gambling Task (IGT) and the Zuckerman Sensation Seeking Scale (SSS). The PGs showed significantly more chasing and had significantly poorer decision-making strategies than NPGs, particularly among males (F = 4.52, p

  2. Pituitary adenylate cyclase activating polypeptide and migraine

    DEFF Research Database (Denmark)

    Zagami, Alessandro S; Edvinsson, Lars; Goadsby, Peter J

    2014-01-01

    Pituitary adenylate cyclase activating peptide (PACAP) is found in human trigeminocervical complex and can trigger migraine. PACAP levels were measured using a sensitive radioimmunoassay. Stimulation of the superior sagittal sinus (SSS) in cat elevated PACAP levels in cranial blood. Patients...

  3. Boundary Conditions in the Navy Coastal Ocean Model

    National Research Council Canada - National Science Library

    Rochford, Peter

    2001-01-01

    ...) and sea surface salinity (SSS) to observed or climate fields can also be applied. For the vertical mixing submodels, the surface roughness can be specified and the BC for the turbulent kinetic energy (TKE...

  4. Risk factors and a prediction model for lower limb lymphedema following lymphadenectomy in gynecologic cancer: a hospital-based retrospective cohort study.

    Science.gov (United States)

    Kuroda, Kenji; Yamamoto, Yasuhiro; Yanagisawa, Manami; Kawata, Akira; Akiba, Naoya; Suzuki, Kensuke; Naritaka, Kazutoshi

    2017-07-25

    Lower limb lymphedema (LLL) is a chronic and incapacitating condition afflicting patients who undergo lymphadenectomy for gynecologic cancer. This study aimed to identify risk factors for LLL and to develop a prediction model for its occurrence. Pelvic lymphadenectomy (PLA) with or without para-aortic lymphadenectomy (PALA) was performed on 366 patients with gynecologic malignancies at Yaizu City Hospital between April 2002 and July 2014; we retrospectively analyzed 264 eligible patients. The intervals between surgery and diagnosis of LLL were calculated; the prevalence and risk factors were evaluated using the Kaplan-Meier and Cox proportional hazards methods. We developed a prediction model with which patients were scored and classified as low-risk or high-risk. The cumulative incidence of LLL was 23.1% at 1 year, 32.8% at 3 years, and 47.7% at 10 years post-surgery. LLL developed after a median 13.5 months. Using regression analysis, body mass index (BMI) ≥25 kg/m 2 (hazard ratio [HR], 1.616; 95% confidence interval [CI], 1.030-2.535), PLA + PALA (HR, 2.323; 95% CI, 1.126-4.794), postoperative radiation therapy (HR, 2.469; 95% CI, 1.148-5.310), and lymphocyst formation (HR, 1.718; 95% CI, 1.120-2.635) were found to be independently associated with LLL; age, type of cancer, number of lymph nodes, retroperitoneal suture, chemotherapy, lymph node metastasis, herbal medicine, self-management education, or infection were not associated with LLL. The predictive score was based on the 4 associated variables; patients were classified as high-risk (scores 3-6) and low-risk (scores 0-2). LLL incidence was significantly greater in the high-risk group than in the low-risk group (HR, 2.19; 95% CI, 1.440-3.324). The cumulative incidence at 5 years was 52.1% [95% CI, 42.9-62.1%] for the high-risk group and 28.9% [95% CI, 21.1-38.7%] for the low-risk group. The area under the receiver operator characteristics curve for the prediction model was 0.631 at 1 year, 0

  5. Comparison of the occlusion of experiemntal craniojugular saccular aneurysms with covered stents

    International Nuclear Information System (INIS)

    Zhang Haixia; Li Minghua; Cheng Yingsheng; Fang Chun; Li Min

    2006-01-01

    Objective: To assess the effectiveness and biocompatibility of balloon-expanding, stainless steel stents covered with biomembrane (BM-SSS) and polyurethane membrane (PUM-SSS) in the treatment of experimental saccular aneurysms in a canine model and to observe the ablation of aneurysm with preservation of the parent vessel. Methods: Sixteen healthy mongrel canines were included in our study. 26 of 29 successful experimental aneurysms were treated with covered stents, another 3 were untreated to serve as controls. Altogether there were fourteen BM-SSS and twelve PUM-SSS were placed endovascularly in the common carotid arteries covering the orifice of the aneurysms. Control angiography was performed immediately after the procedure and after 2 weeks, 4 weeks and 12 weeks. According to grouping time, each aneurysm together with stented arteries was removed with animals alive for histopathological examination. Enumeration data was analyzed by Fisher's Exact Test using SPSS 10.0. Results: Before stent placement, angiography of the common carotid arteries showed round, saccular side-wall aneurysms and complex pattern of flow. Immediately after stent placement the aneurysmal pouches were no longer visible and the stented common carotid arteries remained widely patent. All controlled aneurysms and common carotid arteries have been patent and unchanged for 1 year. 13 of 14 stented common carotid arteries with BM-SSS and 3 of 12 with PUM-SSS remained widely patent. The complete patency rate of BM-SSS and PUM-SSS was significantly different (P=0.0008). Histological analysis indicated that all treated aneurysmal pouches were almost filled with thrombus, as well as with fibrotic reactive scar tissue. Stent wires were found to be located deep within the vessel wall and encased by an extension of the tunica intima. The endothelium of the two groups was already mature at 12 weeks, and various degree of degenerate cells were seen under the transmission electron microscopy. Conclusion

  6. A survey of exercise professionals' barriers and facilitators to working with stroke survivors.

    Science.gov (United States)

    Condon, Marie; Guidon, Marie

    2018-03-01

    Stroke survivors (SSs) are largely inactive despite the benefits of exercise. Exercise professionals (EPs), skilled in exercise prescription and motivation, may have a role in promoting exercise among SSs. However, the number of EPs working with SSs is estimated to be low. This study aimed to investigate EPs' opinions on working with SSs by rating their agreement of barriers and facilitators to working with SSs. The study also investigated EPs skills, interest and experience working with SSs and the relationship between EPs' barriers and facilitators with their training on stroke. A descriptive cross-sectional study was conducted using a researcher-designed online survey between October and December 2015. Purposive sampling was used to survey EPs on the Register of Exercise Professionals in Ireland (n = 277). The response rate was 31% (87/277). Only 22% (19/86) of EPs had experience working with SSs. The primary barriers rated by EPs included insufficient training on psychological problems post-stroke (84%; 61/73), unsuitable equipment for SSs (69%; 50/73) and the level of supervision SSs require (56%; 41/73). The primary facilitators rated included access to suitable equipment (97%; 69/71), practical (100%; 71/71) and theoretical training (93%; 66/71) on stroke. Respondents with no training on stroke were significantly more likely to agree that insufficient training on psychological problems post-stroke and lack of experience were barriers. Seventy-six per cent of EPs (58/76) were interested in one-to-one exercise sessions with SSs but only 53% (40/76) were interested in group sessions. Eighty-two per cent of EPs (62/76) rated their motivational skills as good or very good but 42% (32/76) indicated having only acceptable skills dealing with psychological problems. Results indicate that EPs are interested in working with SSs despite limited experience and practical barriers. Training opportunities on stroke need to be developed; taking into account EPs' barriers

  7. An approach to effective UHF (S/L band) data communications for satellite Personal Communication Service (PCS)

    Science.gov (United States)

    Hayase, Joshua Y.

    1995-01-01

    Reliable signaling information transfer is fundamental in supporting the needs of data communication PCS via LMS (Land Mobile Service) SSs (satellite systems). The needs of the system designer can be satisfied only through the collection of media information that can be brought to bear on the pertinent design issues. We at ISI hope to continue our dialogue with fading media experts to address the unique data communications needs of PCS via LMS SSs.

  8. Assessment of the Sheffield Support Snood, an innovative cervical orthosis designed for people affected by neck muscle weakness

    OpenAIRE

    Pancani, Silvia; Rowson, Jennifer; Tindale, Wendy; Heron, Nicola; Langley, Joe; McCarthy, Avril D.; Quinn, Ann; Reed, Heath; Stanton, Andrew; Shaw, Pamela J.; McDermott, Christopher J.; Mazzà, Claudia

    2016-01-01

    The aim of this study was to quantify the biomechanical features of the Sheffield Support Snood (SSS), a cervical orthosis specifically designed for patients with neck weakness. The orthosis is designed to be adaptable to a patient’s level of functional limitation using adjustable removable supports, which contribute support and restrict movement only in desired anatomical planes. \\ud Methods: The SSS was evaluated along with two commercially available orthoses, the Vista and Headmaster. The ...

  9. Rainfall Imprint on Sea Surface Salinity in the ITCZ: new satellite perspectives

    Science.gov (United States)

    Boutin, J.; Viltard, N.; Supply, A.; Martin, N.; Vergely, J. L.; Hénocq, C.; Reverdin, G. P.

    2016-02-01

    The European Soil Moisture and Ocean Salinity (SMOS) satellite mission monitors sea surface salinity (SSS) over the global ocean for more than 5 years since 2010. The MADRAS microwave radiometer carried by the French (CNES) Indian (ISRO) satellite mission Megha-Tropiques sampled the 30° N-30° S region end of 2011 and in 2012, very complementary to other Global Precipitation Measurement(GPM) missions. In tropical regions, SMOS SSS contains a large imprint of atmospheric rainfall, but is also likely affected by oceanographic processes (advection and diffusion). At local and short time scales, Boutin et al. (2013, 2014) have shown that the spatio-temporal variability of SSS is dominated by rainfall as detected by satellite microwave radiometers and have demonstrated a close to linear relationship between SMOS SSS freshening under rain cells and satellite rain rate. The order of magnitude is in remarkable agreement with the theoretical renewal model of Schlussel et al. (1997) and compatible with AQUARIUS SSS observations, as well as with in situ drifters observations although the latter are local and taken at 45cm depth while satellite L-band SSS roughly correspond to the top 1cm depth and are spatially integrated over 43-150km. It is thus expected that the combined information of satellite rain rates and satellite SSS brings new constraints on the precipitation budget. We first look at the consistency between the spatial structures of SMOS SSS decrease and of rain rates derived either from the MADRAS microwave radiometer or from the CMORPH combined products that do not use MADRAS rain rates. This provides an indirect validation of the rain rates estimates. We then investigate the impact of rain history and of wind speed on the observed SMOS freshening. Based on these results, we discuss the precision on various precipitation estimates over 2012 in the ITCZ region and the major sources of uncertainties that the SPURS2 campaign could help to resolve.

  10. Flotation atomic absorption determination of bismuth in nonferrous metal alloys

    International Nuclear Information System (INIS)

    Ososkov, V.K.; Plintus, A.M.; Kornelli, M.Eh.; Zakhariya, A.N.; Lozanova, E.V.

    1986-01-01

    Technique of flotation concentration and atomic absorption determination of bismuth microquantities in alloys on the basis of copper and zinc has been developed. Fine-dispersed EhDEh-10P anionite was used as a carrier in flotation concentration. State standard samples (SSS) of brasses and German silver were used as analysed objects. Effect of macrocomponents on the results of bismuth content determination has been studied. Satisfactory coincidence of the results obtained and SSS certificates is shown

  11. Global Genetics and Invasion History of the Potato Powdery Scab Pathogen, Spongospora subterranea f.sp. subterranea

    OpenAIRE

    Gau, Rebecca D.; Merz, Ueli; Falloon, Richard E.; Brunner, Patrick C.

    2013-01-01

    Spongospora subterranea f. sp. subterranea (Sss) causes two diseases on potato (Solanum tuberosum), lesions on tubers and galls on roots, which are economically important worldwide. Knowledge of global genetic diversity and population structure of pathogens is essential for disease management including resistance breeding. A combination of microsatellite and DNA sequence data was used to investigate the structure and invasion history of Sss. South American populations (four countries, 132 sam...

  12. The relationship between caregivers' subjective social status and asthma symptoms and management for urban children.

    Science.gov (United States)

    Diep, Judy; Fagnano, Maria; Tremblay, Paul; Halterman, Jill S

    2018-03-01

    Subjective social status (SSS) is a person's perception of his/her social standing among others. We explored the relationship between caregivers' SSS and asthma symptoms, visits, and medication use among children with persistent asthma. We analyzed baseline data of children (3-10 years) from the SB-TEAM trial in Rochester, NY. Using a modified MacArthur Scale of SSS, caregivers rated themselves "a lot worse off" to "a lot better off" compared to 4 groups (e.g., neighbors). "Low SSS" was defined by a response of "a lot worse off" or "somewhat worse off" for any of the referent groups. Caregivers reported their child's asthma symptoms, healthcare visits for asthma, and medication use. Bivariate and multivariate statistics were used. We found that, of the 230 children enrolled (participation rate:78%, 62% Black, 72% Medicaid), 29% of caregivers had low SSS. Caregivers with low SSS had more depressive symptoms (46% vs. 28%) and lower social support (69.1 vs. 77.7). In multivariable analyses, children of caregivers with low SSS had fewer symptom-free days/2 weeks (5.8 vs. 7.9, p = .01). While they were more likely to have a routine asthma visit in the past year (35% vs. 23%, adjusted p = .03), there was no difference in their use of preventive medication. Many caregivers of children with persistent asthma report low SSS. While children of these caregivers had fewer symptom-free days, they were not more likely to use preventive medications. Efforts are needed to support these caregivers to ensure optimal preventive care and reduce morbidity.

  13. Swift follow-up of 1RXS J194211.9+255552

    DEFF Research Database (Denmark)

    Sidoli, L.; Fiocchi, M.; Bird, A. J.

    2011-01-01

    there is only one pointlike source, at the following position (J2000): RA(hh mm ss.s) = 19h42m11.13s, Dec(dd mm ss.s) = +25:56:07.32 (3.6 arcsec error radius). The source light curve is variable on time scale of about 1000 s (similar to the Jem-X light curve). A fit to the XRT spectrum (1-10 keV) with a power...

  14. Efficacy of a Blend of Sulfuric Acid and Sodium Sulfate against Shiga Toxin-Producing Escherichia coli, Salmonella, and Nonpathogenic Escherichia coli Biotype I on Inoculated Prerigor Beef Surface Tissue.

    Science.gov (United States)

    Scott-Bullard, Britteny R; Geornaras, Ifigenia; Delmore, Robert J; Woerner, Dale R; Reagan, James O; Morgan, J Bred; Belk, Keith E

    2017-12-01

    A study was conducted to investigate the efficacy of a sulfuric acid-sodium sulfate blend (SSS) against Escherichia coli O157:H7, non-O157 Shiga toxin-producing E. coli (STEC), Salmonella, and nonpathogenic E. coli biotype I on prerigor beef surface tissue. The suitability of using the nonpathogenic E. coli as a surrogate for in-plant validation studies was also determined by comparing the data obtained for the nonpathogenic inoculum with those for the pathogenic inocula. Prerigor beef tissue samples (10 by 10 cm) were inoculated (ca. 6 log CFU/cm 2 ) on the adipose side in a laboratory-scale spray cabinet with multistrain mixtures of E. coli O157:H7 (5 strains), non-O157 STEC (12 strains), Salmonella (6 strains), or E. coli biotype I (5 strains). Treatment parameters evaluated were two SSS pH values (1.5 and 1.0) and two spray application pressures (13 and 22 lb/in 2 ). Untreated inoculated beef tissue samples served as controls for initial bacterial populations. Overall, the SSS treatments lowered inoculated (6.1 to 6.4 log CFU/cm 2 ) bacterial populations by 0.6 to 1.5 log CFU/cm 2 (P SSS was applied to samples inoculated with any of the tested E. coli inocula; however, solution pH did have a significant effect (P SSS was applied to samples inoculated with Salmonella. Results indicated that the response of the nonpathogenic E. coli inoculum to the SSS treatments was similar (P ≥ 0.05) to that of the pathogenic inocula tested, making the E. coli biotype I strains viable surrogate organisms for in-plant validation of SSS efficacy on beef. The application of SSS at the tested parameters to prerigor beef surface tissue may be an effective intervention for controlling pathogens in a commercial beef harvest process.

  15. Starch accumulation in hulless barley during grain filling.

    Science.gov (United States)

    Zheng, Xu-Guang; Qi, Jun-Cang; Hui, Hong-Shan; Lin, Li-Hao; Wang, Feng

    2017-12-01

    Starch consists of two types of molecules: amylose and amylopectin. The objective of this study was increase understanding about mechanisms related to starch accumulation in hulless barley (Hordeum vulgare L.) grain by measuring temporal changes in (i) grain amylose and amylopectin content, (ii) starch synthase activity, and (iii) the relative expressions of key starch-related genes. The amylopectin/amylose ratio gradually declined in both Beiqing 6 and Kunlun 12. In both cultivars, the activities of adenosine diphosphate glucose pyrophosphorylase, soluble starch synthase (SSS), granule bound starch synthase (GBSS), and starch branching enzyme (SBE) increased steadily during grain filling, reaching their maximums 20-25 days after anthesis. The activities of SSS and SBE were greater in Ganken 5 than in either Beiqing 6 or Kunlun 12. The expression of GBSS I was greater in Beiqing 6 and Kunlun 12 than in Ganken 5. In contrast, the expression of SSS I, SSS II and SBE I was greater in Ganken 5 than in Beiqing 6 and Kunlun 12. The peak in GBSS I expression was later than that of SSS I, SSS II, SBE IIa and SBE IIb. The GBSS I transcript in Kunlun 12 was expressed on average 90 times more than the GBSS II transcript. The results suggest that SBE and SSS may control starch synthesis at the transcriptional level, whereas GBSS I may control starch synthesis at the post transcriptional level. GBSS I is mainly responsible for amylose synthesis whereas SSS I and SBE II are mainly responsible for amylopectin synthesis in amyloplasts.

  16. TRPM7 regulates angiotensin II-induced sinoatrial node fibrosis in sick sinus syndrome rats by mediating Smad signaling.

    Science.gov (United States)

    Zhong, Hongbin; Wang, Tingjun; Lian, Guili; Xu, Changsheng; Wang, Huajun; Xie, Liangdi

    2018-03-06

    Sinoatrial node fibrosis is involved in the pathogenesis of sinus sick syndrome (SSS). Transient receptor potential (TRP) subfamily M member 7 (TRPM7) is implicated in cardiac fibrosis. However, the mechanisms underlying the regulation of sinoatrial node (SAN) fibrosis in SSS by TRPM7 remain unknown. The aim of this study was to investigate the role of angiotensin II (Ang II)/TRPM7/Smad pathway in the SAN fibrosis in rats with SSS. The rat SSS model was established with sodium hydroxide pinpoint pressing permeation. Forty-eight rats were randomly divided into six groups: normal control (ctrl), sham operation (sham), postoperative 1-, 2-, 3-, and 4-week SSS, respectively. The tissue explant culture method was used to culture cardiac fibroblasts (CFs) from rat SAN tissues. TRPM7 siRNA or encoding plasmids were used to knock down or overexpress TRPM7. Collagen (Col) distribution in SAN and atria was assessed using PASM-Masson staining. Ang II, Col I, and Col III levels in serum and tissues or in CFs were determined by ELISA. TRPM7, smad2 and p-smad2 levels were evaluated by real-time PCR, and/or western blot and immunohistochemistry. SAN and atria in rats of the SSS groups had more fibers and higher levels of Ang II, Col I and III than the sham rats. Similar findings were obtained for TRPM7 and pSmad2 expression. In vitro, Ang II promoted CFs collagen synthesis in a dose-dependent manner, and potentiated TRPM7 and p-Smad2 expression. TRPM7 depletion inhibited Ang II-induced p-Smad2 expression and collagen synthesis in CFs, whereas increased TRPM7 expression did the opposite. SAN fibrosis is regulated by the Ang II/TRPM7/Smad pathway in SSS, indicating that TRPM7 is a potential target for SAN fibrosis therapy in SSS.

  17. Associations Between Parental SES and Children's Health-Related Quality of Life: The Role of Objective and Subjective Social Status.

    Science.gov (United States)

    Kim, Kay W; Wallander, Jan L; Peskin, Melissa; Cuccaro, Paula; Elliott, Marc N; Schuster, Mark A

    2018-06-01

    We examined (1) the relationship that parental objective social status (OSS) and subjective social status (SSS) have with children's health-related quality of life (HRQOL), (2) whether SSS mediates the association between OSS and HRQOL, and (3) whether these associations differ among Black, Latino, and White children. Data came from 4,824 Black, Latino, and White 5th graders in the Healthy PassagesTM study. OSS was measured as parent educational attainment and net equivalent household income. SSS was measured by parent rating of community and national standing on the MacArthur Scale of Subjective Social Status. Child HRQOL was measured with child report on the Pediatric Quality of Life Inventory (PedsQL) physical and psychosocial scales. Structural equation modeling path analysis was conducted using Mplus version 7.4. The data supported the hypothesized measurement and structural models. Whereas parental OSS was positively related to psychosocial HRQOL for all three racial/ethnic groups and to physical HRQOL for Latino children, parental SSS was not related to either for any of the racial/ethnic groups. Therefore, mediation by SSS was not supported for any group. OSS was confirmed to have stronger association with children's HRQOL than parental SSS. This is in contrast to some research on adults, raising the questions of how best to assess SSS relevant to children and at what point in development SSS may influence children's health and well-being. The persistent relationship found between parental OSS and child health suggests that efforts to improve low socioeconomic resources in families may contribute to improve children's health.

  18. Subjective social status predicts quit-day abstinence among homeless smokers.

    Science.gov (United States)

    Reitzel, Lorraine R; Kendzor, Darla E; Cao, Yumei; Businelle, Michael S

    2014-01-01

    Smoking prevalence is alarmingly high among the homeless. Few studies have focused on predictors of smoking abstinence in this population. Subjective social status, a person's ranking of their own social standing relative to others in the United States or in their own self-defined communities, has predicted smoking cessation among domiciled smokers in analyses adjusted for objective socioeconomic status and other demographic variables. This study examined if subjective social status predicted quit-day abstinence among homeless smokers making a quit attempt. Longitudinal study using self-reported survey data. Transitional homeless shelter in Dallas, Texas. A total of 57 homeless smokers enrolled in a cessation program. Predictors were the Subjective Social Status-U.S (SSS-U.S.) and the Subjective Social Status-Community (SSS-Community) ladders measured 1 week pre quit. Covariates were sociodemographics and tobacco dependence measured 1 week pre quit. The outcome was self-reported and biochemically verified smoking abstinence on the quit day. Analysis . Covariate-adjusted logistic regression models. Higher rankings on the SSS-U.S. ladder, but not the SSS-Community ladder, predicted abstinence on the quit day (p = .005). Lower rankings on the SSS-U.S. ladder predicted increased risk of relapse on the quit day or the inability to quit at all. The SSS-U.S. ladder might be useful in identifying homeless smokers needing additional preparation and intervention before initiating a quit attempt.

  19. Spatial and Temporal Distribution of Sea Surface Salinity in Coastal Waters of China Based on Aquarius

    International Nuclear Information System (INIS)

    Wang, Ying; Jiang, Hong; Zhang, Xiuying; Jin, Jiaxin

    2014-01-01

    Sea surface salinity (SSS) is a fundamental parameter for the study of global ocean dynamics, water cycle, and climate variability. Aquarius launched by NASA and the Space Agency of Argentina is a breakthrough which could achieve the remote sensing data of SSS. The present paper takes the coastal of China as study area, which is a representative area of ocean boundary and influenced by continental rivers (Yangtze River and Pearl River). After analyze the temporal and spatial variation of SSS in the coastal of China, the estuary area has obvious low salinity because the injected of freshwater from continent. Take the East China Sea (ECS) and South China Sea (SCS) as representative region to discuss the effect of freshwater to SSS. The salinity is almost equal in winter when the diluted water is inadequate in both rivers. However, an obvious decrease appeared in summer especial July in Yangtze River for abundance discharge inflow the ECS. This is a reasonable expression of Yangtze River discharge is remarkable influence the SSS in coastal area then Pearl River. Survey the distribution range of Yangtze River diluted water (SSS<31psu). The range is small in winter and expands to peak value in summer

  20. The Potential Explanatory Role of Perceived Stress in Associations Between Subjective Social Status and Health-Related Quality of Life Among Homeless Smokers.

    Science.gov (United States)

    Garey, Lorra; Reitzel, Lorraine R; Kendzor, Darla E; Businelle, Michael S

    2016-01-01

    Homeless individuals smoke at high rates relative to the general population and are at heightened risk of tobacco-related illnesses and poor health-related quality of life (HRQoL). Homeless smokers also report low subjective social status (SSS) or perceived social standing relative to others. SSS may contribute to poor HRQoL, potentially through perceived stress. The current study examined the role of perceived stress in the association of SSS and HRQoL among 227 (70.9% male, Mage = 43.2) homeless smokers. Participants completed self-report measures of SSS, perceived stress, and HRQoL. Perceived stress partially explained the relation between SSS (United States and Community) and HRQoL in covariate-adjusted analyses. Results suggested that perceived stress is a pathway through which SSS contributes to HRQoL among homeless smokers. Findings broaden current understanding of the impact of social disadvantage and perceived stress on HRQoL among homeless smokers. © The Author(s) 2015.

  1. Climatic variability and trends in the surface waters of coastal British Columbia

    Science.gov (United States)

    Cummins, Patrick F.; Masson, Diane

    2014-01-01

    Multi-decadal records of monthly sea surface temperature (SST) and sea surface salinity (SSS) collected at a set of lighthouse stations are used to examine climatic variability and trends in the coastal waters of British Columbia. Particular attention is given to relations between the water property anomalies and variability in coastal freshwater discharge and alongshore wind stress. Within the Strait of Georgia, SSS anomalies are closely related to Fraser River discharge anomalies. Along the Pacific coast, anomalies in alongshore wind stress and freshwater runoff have the characteristics of white noise processes. A cross-correlation analysis demonstrates that SST and SSS variability along the open west coast is consistent with the response of a first-order autoregressive process driven by anomalous alongshore wind stress and coastal freshwater discharge, respectively. Thus climatic variability of SST and SSS along the Pacific coast of British Columbia occurs, in part, through the integration of noisy atmospheric forcing and coastal precipitation. Seasonal correlations show that SST is strongly related to wind stress during winter and fall. Conversely, SSS is relatively weakly related to the alongshore wind during spring, suggesting that variability in upwelling makes only a modest contribution to variability of SSS in the nearshore environment. Consistent with previous studies, secular trends indicate long-term warming and freshening of the coastal ocean at most stations. It is shown that long-term SST trends can be obscured by the pronounced climatic variability of these waters, requiring that time series extend for several decades to be reliably detected.

  2. Low subjective socioeconomic status stimulates orexigenic hormone ghrelin - A randomised trial.

    Science.gov (United States)

    Sim, A Y; Lim, E X; Leow, M K; Cheon, B K

    2018-03-01

    Recent evidence suggests that lower perceived socioeconomic status is linked to increased appetite and intake of greater calories. Yet, whether insecurity of socioeconomic resources directly influences regulatory systems of appetite and energy intake is not known. Considering psychological states, mindsets and beliefs have shown to meaningfully affect physiological responses to food, the present study tested the hypothesis that low subjective socioeconomic status (SSS) will have a direct influence on physiological responses, such as appetite-related hormones (ghrelin, pancreatic polypeptide and insulin). Forty-eight healthy males were randomly (crossover, counterbalanced) assigned, to two experimental conditions where participants were either experimentally induced to feel low SSS or not (control; CON). Feelings of low SSS resulted in an increase in active ghrelin (an orexigenic hormone) following the SSS manipulation compared with baseline, while no change in active ghrelin was observed in CON. Furthermore, participants reported lower fullness and satiety following low SSS compared with CON. Our findings demonstrate that SSS may influence hunger regulation and appetite, and suggest that physiological systems regulating energy balance (i.e. caloric resources) may also be sensitive to perceived deprivation or imbalances in critical non-food resources (socioeconomic resources). Copyright © 2018 Elsevier Ltd. All rights reserved.

  3. Occupational asthma due to manual metal-arc welding of special stainless steels.

    Science.gov (United States)

    Hannu, T; Piipari, R; Kasurinen, H; Keskinen, H; Tuppurainen, M; Tuomi, T

    2005-10-01

    Occupational asthma (OA) can be induced by fumes of manual metal-arc welding on stainless steel. In recent years, the use of special stainless steels (SSS) with high chromium content has increased. This study presents two cases of OA caused by manual metal-arc welding on SSS. In both cases, the diagnosis of OA was based on respiratory symptoms, occupational exposure and positive findings in the specific challenge tests. In the first case, a 46-yr-old welder had experienced severe dyspnoea while welding SSS (SMO steel), but not in other situations. Challenge tests with both mild steel and stainless steel using a common electrode were negative. Welding SSS with a special electrode caused a delayed 37% drop in forced expiratory volume in one second (FEV1). In the second case, a 34-yr-old male had started to experience dyspnoea during the past few years, while welding especially SSS (Duplex steel). The workplace peak expiratory flow monitoring was suggestive of OA. Challenge tests with both mild steel and stainless steel using a common electrode did not cause bronchial obstruction. Welding SSS with a special electrode caused a delayed 31% drop in FEV1. In conclusion, exposure to manual metal-arc welding fumes of special stainless steel should be considered as a new cause of occupational asthma.

  4. The New Superfluid Helium Cryostats for the Short Straight Sections of the CERN Large Hadron Collider (LHC)

    CERN Document Server

    Cameron, W; Kurtyka, T; Parma, Vittorio; Renaglia, T; Rifflet, J M; Rohmig, P; Skoczen, Blazej; Tortschanoff, Theodor; Trilhe, P; Védrine, P; Vincent, D

    1998-01-01

    The lattice of the CERN Large Hadron Collider (LHC) contains 364 Short Straight Section (SSS) units, one in every 53 m long half-cell. An SSS consists of three major assemblies: the standard cryostat section, the cryogenic service module, and the jumper connection. The standard cryostat section of an SSS contains the twin aperture high-gradient superconducting quadrupole and two pairs of superconducting corrector magnets, operating in pressurized helium II at 1.9 K. Components for isolating cryostat insulation vacuum, and the cryogenic supply lines, have to be foreseen. Special emphasis is given to the design changes of the SSS following adoption of an external cryogenic supply line (QRL). A jumper connection connects the SSS to the QRL, linking all the cryogenic tubes necessary for the local full-cell cooling loop [at every second SSS]. The jumper is connected to one end of the standard cryostat section via the cryogenic service module, which also houses beam diagnostics, current feedthroughs, and instrument...

  5. Ehealth

    DEFF Research Database (Denmark)

    Pedersen, Natalia; Andersen, Nynne Nyboe; Végh, Zsuzsanna

    2014-01-01

    with LFD, LGG or a normal Danish/Western diet (ND) in patients with IBS fulfilling Rome III diagnostic criteria, recruited between November 2009 and April 2013. Patients were required to complete on a weekly basis the IBS severity score system (IBS-SSS) and IBS quality of life (IBS-QOL) questionnaires...... in a specially developed IBS web self-monitoring application. We investigated whether LFD or LGG could reduce IBS-SSS and improve QOL in IBS patients. RESULTS: One hundred twenty-three patients (median age 37 years, range: 18-74 years), 90 (73%) females were randomised: 42 to LFD, 41 to LGG and 40 to ND....... A significant reduction in mean ± SD of IBS-SSS from baseline to week 6 between LFD vs LGG vs ND was revealed: 133 ± 122 vs 68 ± 107, 133 ± 122 vs 34 ± 95, P SSS for baseline covariates showed statistically significant reduction of IBS-SSS in LFD group compared to ND (IBS-SSS...

  6. Synthesis and electrochemical probing of water-soluble poly(sodium 4-styrenesulfonate-co-acrylic acid)-grafted multiwalled carbon nanotubes

    International Nuclear Information System (INIS)

    Du Feipeng; Yang Yingkui; Xie Xiaolin; Wu Kangbing; Gan Tian; Liu Lang

    2008-01-01

    Water-soluble poly(sodium 4-styrenesulfonate-co-acrylic acid)-grafted multiwalled carbon nanotubes (MWNT-g-P(SSS-co-AA)) with core-shell nanostructure were successfully synthesized by in situ free radical copolymerization of sodium 4-strenesulfonate (SSS) and acrylic acid (AA) in the presence of MWNTs terminated with vinyl groups; their structure was characterized by FTIR, 1 H NMR, Raman, TGA and TEM. The results showed that the thickness and content of the copolymer layer grafted onto the MWNT surface are about 7-12 nm and 82.3%, respectively. The P(SSS-co-AA) covalently grafted on MWNTs provides MWNT-g-P(SSS-co-AA) with good hydrophilicity and solubility in water. Then a novel MWNT-g-P(SSS-co-AA)-modified glassy carbon electrode was fabricated by coating; its electrochemical properties were evaluated by electrochemical probe of K 3 [Fe(CN) 6 ], and its catalytic behaviors to the electrochemical oxidation processes of dopamine (DA) and serotonin (5-HT) were investigated. Since the MWNT-g-P(SSS-co-AA)-modified electrode possesses strong electron transfer capability, high electrochemical activity and catalytic ability, it can be used in sensitive, selective, rapid and simultaneous monitoring of biomolecules

  7. Comparison of the Retrieval of Sea Surface Salinity Using Different Instrument Configurations of MICAP

    Directory of Open Access Journals (Sweden)

    Lanjie Zhang

    2018-04-01

    Full Text Available The Microwave Imager Combined Active/Passive (MICAP has been designed to simultaneously retrieve sea surface salinity (SSS, sea surface temperature (SST and wind speed (WS, and its performance has also been preliminarily analyzed. To determine the influence of the first guess values uncertainties on the retrieved parameters of MICAP, the retrieval accuracies of SSS, SST, and WS are estimated at various noise levels. The results suggest that the errors on the retrieved SSS have not increased dues poorly known initial values of SST and WS, since the MICAP can simultaneously acquire SST information and correct ocean surface roughness. The main objective of this paper is to obtain the simplified instrument configuration of MICAP without loss of the SSS, SST, and WS retrieval accuracies. Comparisons are conducted between three different instrument configurations in retrieval mode, based on the simulation measurements of MICAP. The retrieval results tend to prove that, without the 23.8 GHz channel, the errors on the retrieved SSS, SST, and WS for MICAP could also satisfy the accuracy requirements well globally during only one satellite pass. By contrast, without the 1.26 GHz scatterometer, there are relatively large increases in the SSS, SST, and WS errors at middle/low latitudes.

  8. Aspects correlates with Scandinavian Stroke Scale for predicting early neurological impairment

    Directory of Open Access Journals (Sweden)

    Gustavo José Luvizutto

    2015-05-01

    Full Text Available Objective To investigate the correlation between the Alberta Program Early CT Score (ASPECTS and the Scandinavian Stroke Scale (SSS for the evaluation of neurological impairment in patients with acute stroke. Method 59 patients with a first acute ischemic stroke were evaluated. The ASPECTS were evaluated by 2 neurologists at admission and by another neurologist after 48 hours. The NIHSS and SSS was applied to determinate stroke severity. Correlations and agreements were analysed statistically by Spearman and Kappa tests. Results ASPECTS was correlated with National Institute of Health Stroke Scale (NIHSS at admission (r = -0.52; p < 0.001 and SSS (r = 0.50; p < 0.001. The ASPECTS and SSS items were most correlated with arm (r = 0.52; p < 0.001 and hand (r = 0.49; p < 0.001 motor power, and speech (r = 0.51; p < 0.001. The SSS of 25.5 shows sensitivity (68% and specificity (72% when associated with ASPECTS ≤ 7. Conclusion The SSS can predict worst neurological impairment when associated with lower values of ASPECTS.

  9. Numerical simulation of stress-strain state of electrophoretic shell molds

    Science.gov (United States)

    Sviridov, A. V.; Odinokov, V. I.; Dmitriev, E. A.; Evstigneev, A. I.; Bashkov, O. V.

    2017-10-01

    In the foundry engineering, castings obtained in one-piece non-gas-generating high-refractory electrophoretic shell molds (ShM) by investment patterns (IP) have an increased rejects percentage associated with low deformation resistance and crack resistance of the SM at different stages of their formation and manufacturing. Crack resistance of the ShM based on IP depends mainly on their stress-strain state (SSS) at various stages of mold forming. SSS decrease significantly improves their crack resistance and decreases their rejects percentage of castings occurring due to clogging and surface defects. In addition, the known methods of decreasing the SSS are still poorly understood. Thus, current research trends are to determine SSS at each stage of ShM forming and develop the ways to decrease it. Theoretical predicting of crack formation in multiple-layer axisymmetric shell molds is given in the work [1], and SSS of multiple-layer axisymmetric shell molds is given in the work [2]. Monolayer electrophoretic ShM had a lack of concern in this field, thus it became an argument for the present workMathematical Model of ShM SSS

  10. Existence and stability of circular orbits in general static and spherically symmetric spacetimes

    Science.gov (United States)

    Jia, Junji; Liu, Jiawei; Liu, Xionghui; Mo, Zhongyou; Pang, Xiankai; Wang, Yaoguang; Yang, Nan

    2018-02-01

    The existence and stability of circular orbits (CO) in static and spherically symmetric (SSS) spacetime are important because of their practical and potential usefulness. In this paper, using the fixed point method, we first prove a necessary and sufficient condition on the metric function for the existence of timelike COs in SSS spacetimes. After analyzing the asymptotic behavior of the metric, we then show that asymptotic flat SSS spacetime that corresponds to a negative Newtonian potential at large r will always allow the existence of CO. The stability of the CO in a general SSS spacetime is then studied using the Lyapunov exponent method. Two sufficient conditions on the (in)stability of the COs are obtained. For null geodesics, a sufficient condition on the metric function for the (in)stability of null CO is also obtained. We then illustrate one powerful application of these results by showing that three SSS spacetimes whose metric function is not completely known will allow the existence of timelike and/or null COs. We also used our results to assert the existence and (in)stabilities of a number of known SSS metrics.

  11. Improvement of spatial discretization error on the semi-analytic nodal method using the scattered source subtraction method

    International Nuclear Information System (INIS)

    Yamamoto, Akio; Tatsumi, Masahiro

    2006-01-01

    In this paper, the scattered source subtraction (SSS) method is newly proposed to improve the spatial discretization error of the semi-analytic nodal method with the flat-source approximation. In the SSS method, the scattered source is subtracted from both side of the diffusion or the transport equation to make spatial variation of the source term to be small. The same neutron balance equation is still used in the SSS method. Since the SSS method just modifies coefficients of node coupling equations (those used in evaluation for the response of partial currents), its implementation is easy. Validity of the present method is verified through test calculations that are carried out in PWR multi-assemblies configurations. The calculation results show that the SSS method can significantly improve the spatial discretization error. Since the SSS method does not have any negative impact on execution time, convergence behavior and memory requirement, it will be useful to reduce the spatial discretization error of the semi-analytic nodal method with the flat-source approximation. (author)

  12. Comparison of Long-Term Effect of Dual-Chamber Pacing and Alcohol Septal Ablation in Patients with Hypertrophic Obstructive Cardiomyopathy

    Directory of Open Access Journals (Sweden)

    Jan Krejci

    2013-01-01

    Full Text Available Introduction. Nonpharmacological treatment of patients with hypertrophic obstructive cardiomyopathy (HOCM comprises surgical myectomy (SME, alcohol septal ablation (ASA, and dual-chamber (DDD pacing. The aim of the study was to compare the long-term effect of DDD pacing and ASA in symptomatic HOCM patients. Patients and Methods. We evaluated retrospective data from three cardiocenters; there were 24 patients treated with DDD pacing included and 52 treated with ASA followed for 101 ± 49 and 87 ± 23 months, respectively. Results. In the group treated with DDD pacing, the left ventricle outflow tract gradient (LVOTG decreased from 82 ± 44 mmHg to 21 ± 21 mmHg, and NYHA class improved from 2.7 ± 0.5 to 2.1 ± 0.6 (both P<0.001. In the ASA-treated group, a decline in LVOTG from 73 ± 38 mmHg to 24 ± 26 mmHg and reduction in NYHA class from 2.8 ± 0.5 to 1.7 ± 0.8 were observed (both P<0.001. The LVOTG change was similar in both groups (P=0.264, and symptoms were more affected by ASA (P=0.001. Conclusion. ASA and DDD pacing were similarly effective in reducing LVOTG. The symptoms improvement was more expressed in patients treated with ASA.

  13. Familial history, age and smoking are important risk factors for disc degeneration disease in Arabic pedigrees

    International Nuclear Information System (INIS)

    Livshits, Gregory; Cohen, Zvi; Higla, Orabi; Yakovenko, Konstantin

    2001-01-01

    The present study used computed tomography imaging to evaluate the extent and pattern of the intergenerational transmission of spinal disc degeneration disease (DDD) in complex pedigrees. Contribution of a number of the potential covariates was also studied using univariate and multivariate logistic regression analysis, as well as two types of complex segregation analysis models. Among 161 individuals studied, DDD was diagnosed in 60 individuals. The number of protruded discs varied from 1 to 4, mostly in lumbar or lumbosacral regions. The average age at onset of the disease was similar for both women (36.0 years) and men (34.8 years). The proportion of the individuals affected by the DDD status of their parents ranged from 10% in families of two healthy parents to 55.5% of two affected parents (p < 0.01). The results of the logistic regression analyses and complex segregation analysis were qualitatively the same: DDD status of parents, age and smoking were the main risk factors for disc herniation in the Arabic families we examined. All analyses showed a predominating role of the family history as a risk factor for DDD in offsprings. It showed, for example, four times higher risk at age 50 for individuals with two affected parents vs. those who have two non-affected parents. However, the results of models-fitting genetic analysis, did not confirm a monogenic Mendelian pattern of inheritance

  14. Outpatient utilization of psychopharmaceuticals: comparison between the cities of Zagreb and Sarajevo (2006-2009).

    Science.gov (United States)

    Catić, Tarik; Stimac, Danijela; Zivković, Krešimir; Zelić, Ana

    2012-08-01

    To determine the real outpatient utilization of psychiatric drugs in Zagreb (Croatia) and Sarajevo (Bosnia and Herzegovina) and to compare the outpatient utilization of psychiatric drugs between this two cities. Data on the outpatient utilization of psycholpetics and psychoanaleptics (N05 and N06) in both cities were received from pharmacies and collected during 2006-2009. Based on the data obtained, a number of DDD and DDD per 1000 inhabitants perday (DDD/1000/day) has been calculated. The data in Zagreb were received from all pharmacies in Zagreb, whereas only 50% of pharmacies in Sarajevo participated, thus an extrapolation of data for Sarajevo was required and accomplished. All drugs were classified according to the ATC system. Based on the data obtained, a number of DDD and DDD/1000/day was calculated for all N05 and N06 drugs. Overall utilization trend was similar between the cities Sarajevo and Zagreb and followed trends in other neighbouring countries. Total consumption of psycholeptics and psychoanaleptics in Sarajevo was 22.6% (on average) lower than in Zagreb, during the 4-year period. During the 2006-2009 period the total consumption of psychopharmaceuticals showed increasing trend with peak in 2008 with similar trend between Zagreb and Sarajevo. It is necessary to implement systematic approach to drug utilization monitoring in Sarajevo and Bosnia and Herzegovina in general in order to improve prescribing quality as it is done in Croatia.

  15. Clinical and pathological features of dense deposit disease in Chinese patients.

    Science.gov (United States)

    Wang, Jinquan; Tang, Zheng; Luo, Chunlei; Hu, Yanglin; Zeng, Caihong; Chen, Huiping; Liu, Zhihong

    2012-09-01

    Dense deposit disease (DDD) is a rare disease that has no universally effective treatment. Herein we explore the clinical and pathological features of DDD in Chinese patients and the therapeutic effect of Tripterygium wilfordii (TW). Clinical and pathological data of 10 Chinese patients with biopsy-proved DDD were collected and analyzed retrospectively. The patients consisted of 6 males and 4 females. All of them had heavy proteinuria and microscopic hematuria. Gross hematuria, renal insufficiency, anemia, hypertension and low serum complement 3 (C3) occurred in 3, 3, 5, 6 and 8 cases, respectively. Under light microscopy (LM), 8 cases exhibited membranoproliferative glomerulonephritis (MPGN). Periodic acid-Schiff (PAS) stain disclosed intense PAS-positive bright ribbon-like thickening of glomerular basement membranes (GBM). Immunofluorescence mainly showed diffuse fine granular and short linear deposition of C3 along the glomerular capillary wall. Under electron microscopy, ribbon-like electrondense intramembranous deposits were identified in the lamina densa of the GBM, along the tubule basement membranes (TBM) and wall of Bowman's capsule. Before admission, 6 cases were treated with prednisone, cyclophosphamide and/or cyclosporin A with no response. Proteinuria in 8 cases who received TW during the course decreased at different degrees. The clinical and pathological features in DDD patients were various. The effect of TW in patients with DDD merits further investigation.

  16. [Resistance of uropathogenic strains of Escherichia coli in pregnant women and other women in generative ages in comparison with antibiotics consumption in Zagreb].

    Science.gov (United States)

    Culig, Josip; Mlinarić-Dzepina, Ana; Leppée, Marcel; Vranes, Jasmina

    2010-02-01

    To compare resistance of uropathogenic strains of Escherichia coli (UPEC) to antibiotics in women in generative ages and pregnant women during two year period (2004 and 2008) in Zagreb, and comparison of resistance and the consumption of antibiotics. The standard disk-diffusion method was used for sensitivity testing to 16 different antibiotics. Data on antibiotic utilization were used to calculate the number of defined daily doses (DDD) and DDD per 1000 inhabitants using Anatomical-Therapeutic-Chemical/DDD methodology. Data on antibiotic consumption during pregnancy were collected using a questionnaire filled in by 893 women after delivery. During 2004 resistance of UPEC to antimicrobial drugs was not different in pregnant and in non-pregnant women, with the exception of amoxicillin and nitrofurantoin, with statistically higher resistance in pregnant women (p drugs in Zagreb increased significantly, from 32 to 39 DDD/1000 inhabitants per day. The most used antibiotic was co-amoxiclav, and its utilization increased from 9.6 to 12.2 DDD/1000/day. Amoxicillin and co-amoxiclav were used during pregnancy by 9.6% interviewed women. The observed significant decrease of resistance to cefalexin makes that antibiotic the drug of choice for treatment of urinary tract infections in women in generative ages, and together with coamoxiclav can be administered in pregnancy. Constant monitoring of urinary tract pathogens resistance to antimicrobial agents ensures the effectiveness of empirical therapy, whose versatile use is limited due the potentially harmful effects of antimicrobial drugs on fetus.

  17. Frequency of MMPI Profile Types in Three Chronic Illness Populations.

    Science.gov (United States)

    Naliboff, Bruce D.; And Others

    1983-01-01

    Developed sorting rules to identify Minnesota Multiphasic Personality Inventory configurations and applied these to patients with chronic low back pain, migraine headaches, hypertension, and diabetes (N=157). Results showed that profile types did not differ in frequency among the groups but were more elevated in the back pain patients. (LLL)

  18. Metabolic Consequences of Dieting and Exercise in the Treatment of Obesity.

    Science.gov (United States)

    Donahoe, Clyde P.; And Others

    1984-01-01

    Investigated the effects of dieting and exercise on resting metabolic rate (RMR) in overweight women (N=10). Results showed that dieting lowered RMR by nearly double that expected on the basis of resulting weight loss; and that exercise caused RMR to rise to a level appropriate to prevailing body weight. (LLL)

  19. Finding of No Significant Impact for Porposed Replacement of Senior Officers Quarters Project, McConnell Air Force Base, Kansas

    Science.gov (United States)

    2006-08-08

    renovation from the four existing units would nearly equal tbe cost of reconstructing new lll’lils. No Action Alternative: tinder the11o action...cumulative impacts." 4.10 RELATIONSHIP BETWEEN-TERM USES AND ENHANCEMENT OF LONG- TERM PRODUCTIVITY Preferred Action: Implementation of the preferred...Indirect and Cumulative Impacts ........................................................................ 24 3.10 Relationship between Short-Term Uses

  20. A novel switched inductor configuration for modified SEPIC DC-to-DC converter for renewable energy application

    DEFF Research Database (Denmark)

    Maroti, Pandav Kiran; Padmanaban, Sanjeevikumar; Blaabjerg, Frede

    2017-01-01

    The proposed work is on the Modified SEPIC Converter (MSC) and its different configuration with switched inductor structure (SI). In this paper, five different configuration of modified SEPIC Converter namely-Modified SEPIC converter without switched inductor configuration (MSC-LLL), Modified SEP...

  1. Role Differentiation in Groups: The Relationship Between Instrumental and Expressive Leadership.

    Science.gov (United States)

    Rees, C. Roger; Segal, Mady Wechsler

    1984-01-01

    Examined the degree of differentiation between instrumental and expressive leadership roles in two natural groups (N=101). Results showed a relatively high degree of leadership role integration with several members of each group fulfilling both instrumental and expressive leadership roles. (LLL)

  2. Improved detection probability of low level light and infrared image fusion system

    Science.gov (United States)

    Luo, Yuxiang; Fu, Rongguo; Zhang, Junju; Wang, Wencong; Chang, Benkang

    2018-02-01

    Low level light(LLL) image contains rich information on environment details, but is easily affected by the weather. In the case of smoke, rain, cloud or fog, much target information will lose. Infrared image, which is from the radiation produced by the object itself, can be "active" to obtain the target information in the scene. However, the image contrast and resolution is bad, the ability of the acquisition of target details is very poor, and the imaging mode does not conform to the human visual habit. The fusion of LLL and infrared image can make up for the deficiency of each sensor and give play to the advantages of single sensor. At first, we show the hardware design of fusion circuit. Then, through the recognition probability calculation of the target(one person) and the background image(trees), we find that the trees detection probability of LLL image is higher than that of the infrared image, and the person detection probability of the infrared image is obviously higher than that of LLL image. The detection probability of fusion image for one person and trees is higher than that of single detector. Therefore, image fusion can significantly enlarge recognition probability and improve detection efficiency.

  3. Preventing Relapse to Cigarette Smoking by Behavioral Skill Training.

    Science.gov (United States)

    Hall, Sharon M.; And Others

    1984-01-01

    Crossed two relapse prevention conditions (skills training-vs-discussion control) with two levels of aversive smoking in volunteer subjects (N=123). Results indicated that relapse-prevention skill training did prevent relapse among cigarette smokers. Lighter smokers were more favorably influenced. (LLL)

  4. Proceedings 2014: Selected Papers from the Eighteenth College-Wide Conference for Students in Languages, Linguistics & Literature (18th, Honolulu, Hawai'i, April 26, 2014)

    Science.gov (United States)

    Leal, Priscila, Ed.; West, Gordon, Ed.

    2015-01-01

    The theme for this year's annual graduate student conference of the College of Languages, Linguistics, and Literature (LLL) was "Your Voice, My Voice: Literature, Language, Culture and Society." Translation and interpretation guided the theme for the conference, with Dr. Marvin Puakea Nogelmeier of the Kawaihuelani Center for Hawaiian…

  5. Principles and methods of neutron interferometry

    International Nuclear Information System (INIS)

    Bonse, U.

    1978-01-01

    The merits of Angstrom range interferometry with neutrons are briefly outlined. The energy (wavelength) range which is accessible with the triple Laue case (LLL) crystal interferometer is estimated, assuming a neutron source with flux characteristics similar to that of the HFR at Grenoble. It appears that a range in E from roughly 2.3 meV to 8.2eV (lambda approximatly equal to 6A to 0.1A) can be covered with LLL interferometers manufactured with presently available perfect crystals of silicon. Within this range there exists a number of scattering resonances that it seems worth while to investigate interferometrically. The attainable resolution ΔE/E is estimated to be at least 10 -3 for E -2 above. The essentials of zero absorption Bragg diffraction optics of the neutron LLL interferometer are described. Virtues and weaknesses of different LLL geometries are discussed. The influence of geometrical abberrations, strain and position instabilities are surveyed. Aspects of coherent scattering length measurements and of neutron phase topography are discussed

  6. Application of FRAMIS to K/sub D/ data

    International Nuclear Information System (INIS)

    Storch, N.

    1980-01-01

    This report documents an application of the FRAMIS relational data base management system. A geochemical data base of ion exchange distribution coefficients (K/sub D/) is created and maintained by using very simple commands. Reports are automatically generated. Familiarity with the LLL Octopus Time-Sharing System and FRAMIS is assumed

  7. Elder Abuse: A Review of the Literature.

    Science.gov (United States)

    Giordano, Nan Hervig; Giordano, Jeffrey A.

    1984-01-01

    Reviews the literature on elder abuse and examines categories of abuse, the incidence of abuse, and characteristics of the typical abused person. Concluded that the abused person is characteristically a severely impaired woman, aged 75 and over, White, widowed, and living with relatives. (LLL)

  8. Nutrition and human immunodeficiency virus infection in children ...

    African Journals Online (AJOL)

    Objectives. To review the relationship between nutrition and paediatric HIV infection, and to discuss treatment options and their applicability to situations with scarce resources. Results. Growth failure and malnutrition are frequent complications of paediatric lllV infection. Intra-uterine growth of infants born to HIV-seropositive ...

  9. Person Perception Change, Its Possibilities for Clinical Application.

    Science.gov (United States)

    Frazier, Mark; And Others

    1984-01-01

    Conducted three studies using college student populations to determine if what has been learned by social psychologists in the area of perception can be useful in effecting changes in person perception of another. Results supported use of the knowledge in the area of person perception for changing the person perception of another. (LLL)

  10. Quality Assurance in Lifelong Learning. ENQA Workshop Report 18

    Science.gov (United States)

    Bengoetxea, Endika; Kallioinen, Outi; Schmidt-Jortzig, Immo; Thorn, Richard

    2011-01-01

    The implementation of Lifelong Learning (LLL) in European higher education institutions is one of the most important educational and carrier development oriented initiatives of this decade. Albeit an essential path in the continuous improvement of skills, competences and knowledge throughout the life of an individual, this project is also…

  11. Lifelong Learning Policy Agenda in the European Union: A Bi-Level Analysis

    Science.gov (United States)

    Panitsides, Eugenia A.; Anastasiadou, Sofia

    2015-01-01

    The Lisbon European Summit in 2000 has been a milestone in reframing education policies to foster a "knowledge economy", whilst amid the challenges of the new decennium Lifelong Learning (LLL) has been propounded as a powerful lever for attaining "sustainable growth". The present article aims to elucidate the development of an…

  12. Workplaces as key transformative learning spaces for facing socioeconomic crisis in post-Soviet contexts

    DEFF Research Database (Denmark)

    Maslo, Elina; Leví Orta, Genoveva; Persevica, Aija

    2012-01-01

    -Europe Meeting (ASEM-LLL). The objectives of this comparative study were to find out what people understand to be voluntary and compulsory with respect to workplace learning, what companies and organisations offer in terms of formal and non-formal work-related learning, which of these are voluntary and which...

  13. Growth of Co on Cu(111), Subsurface growth of trilayer Co islands

    DEFF Research Database (Denmark)

    Pedersen, M.Ø.; Bönicke, I.A.; Lægsgaard, E.

    1997-01-01

    The growth of cobalt on Cu(lll) has been studied using a variable-temperature scanning tunneling microscope (STM). Al a deposition temperature of 150 K, one observes the growth of three-layer Co islands with one subsurface layer. The Co islands are surrounded by a brim of Cu. The distinction...

  14. Long-life cathode for the Berkeley-type ion source

    International Nuclear Information System (INIS)

    Fink, J.H.; Biagi, L.A.

    1977-01-01

    Preliminary experiments indicate that a hollow cathode, made from impregnated tungsten emitters, can be adapted for the Lawrence Berkeley Laboratory (LBL)/Lawrence Livermore Laboratory (LLL) ion source. Such cathodes could be the basis of a long life, continuously operated positive-ion source

  15. Attacks on the AJPS Mersenne-based cryptosystem

    NARCIS (Netherlands)

    K. de Boer (Koen); L. Ducas (Léo); S. Jeffery (Stacey); R. M. de Wolf (Ronald)

    2018-01-01

    textabstractAggarwal, Joux, Prakash and Santha recently introduced a new potentially quantum-safe public-key cryptosystem, and suggested that a brute-force attack is essentially optimal against it. They consider but then dismiss both Meet-in-the-Middle attacks and LLL-based attacks. Very soon after

  16. Validity of Two WPPSI Short Forms in Outpatient Clinic Settings.

    Science.gov (United States)

    Haynes, Jack P.; Atkinson, David

    1983-01-01

    Investigated the validity of subtest short forms for the Wechsler Preschool and Primary Scale of Intelligence in an outpatient population of 116 children. Data showed that the short forms underestimated actual level of intelligence and supported use of a short form only as a brief screening device. (LLL)

  17. Dream Symbol or Dream Process?

    Science.gov (United States)

    Himelstein, Philip

    1984-01-01

    Discusses the relationship of the symbolic content of dreams to the theory of the dream in psychoanalysis and Gestalt therapy. Points out that the utility of the dream depends upon the techniques of the therapist and not on the validity of the underlying theory of the dream. (LLL)

  18. Die hervertolking van die paradigma in verband met die ...

    African Journals Online (AJOL)

    Kerkorde van De Mist en die Algemene Reglement van 1816, wat onderskeidelik vir die Kaapse Kerk en die .... Een van die eerstes was Sam Freiherr von Pufendorf (1632-1694) wat in sy werk De habitu religionis ..... Koning was weer aan bewind (vgl Diepenhorst sj:74w; De Visser 1926/1927 lll:202w). 43.1 JD Janssen ...

  19. Bulimia and Binge Eating in College Women: A Comparison of Personality and Behavioral Characteristics.

    Science.gov (United States)

    Katzman, Melanie A.; Wolchik, Sharlene A.

    1984-01-01

    Assessed several behavioral and personality characteristics that have been implicated in studying the onset of bulimia in female college students (N=80) classified into bulimia, binge eating, and control groups. Results indicated that bulimics and binge eaters differed significantly on all but a few variables. (LLL)

  20. Development and Validation of a Test for Bulimia.

    Science.gov (United States)

    Smith, Marcia C.; Thelen, Mark H.

    1984-01-01

    Developed the Bulimia Test (BULIT) based on responses of clinically identified females (N=18) and normal female college students (N=119) to preliminary test items. Results showed that the BULIT provided an objective, reliable, and valid measure by which to identify individuals with symptoms of bulimia. (Instrument is appended.) (LLL)

  1. U.S. EPA, Pesticide Product Label, BONIDE TOMATO-PEPPER-VEGETABLE SPRAY, 09/07/1983

    Science.gov (United States)

    2011-04-13

    I ~ " r \\ (Lahel Prart) , op'·'lin·· \\·:it', rOL". or "0.1. 'In not .~11(,,: loo·;{' ,irt to cov('r h.\\ it. ':n~~ci!'it; .lirL'l.-"ri,lll": for ro\\.~l.(\\t ~:o~\\llt'r~. :10 not appl~' hy ...

  2. Treatment of hypertension following endotracheal intubation

    African Journals Online (AJOL)

    Treatment of hypertension following endotracheal intubation. A study comparing the efficacy of labetalol, practolol and placebo. R. J. MAHARAJ, M. THOMPSON, J. G. BROCK-UTNE,. J. W. DOWNING. R. WI LLlAMSON,. Summary. Labetalol, a new adrenergic receptor antagonist, has both a- and B-blocking properties.

  3. Collaborative efforts in the characterization of stack-collected fly ash

    International Nuclear Information System (INIS)

    Fisher, G.L.; Prentice, B.A.; Silberman, D.; Ondov, J.M.; Ragaini, R.C.; Bierman, A.H.

    1976-01-01

    A collaborative study with Lawrence Livermore Laboratory (LLL) has been initiated to characterize the physical and chemical properties of stack-collected fly ash. The expertise of the two laboratories with respect to chemical analysis and particle sizing is complementary and allows for comparison and extension of analytical results not possible with independent analysis

  4. die geni,rasie-ini'erva[, van dte suid-afrikaanse vleismerino 31)00

    African Journals Online (AJOL)

    met 'n afname in kuddegrootte is hierdie parameter beraam vir elke afsonderlike stratum van die teeltstruk- tuur soos diagrammaties voorgestel in Figure I en 2. Die belangrikheid hiervan is veral geled in die feit dat teeltvordering in die bedryf in 'n groot mate aangewys. f l 0. - 1 0. Int erva I. Velandering in die interval lll lare.

  5. The growth of various buffer layer structures and their influence on the quality of (CdHg)Te epilayers

    CSIR Research Space (South Africa)

    Gouws, GJ

    1993-05-01

    Full Text Available The suitability of various buffer layer structures on (100) GaAs for (CdHg)Te growth by organometallic vapour phase epitaxy (OMVPE) was investigated. The preferred epitaxial orientation of (100) GaAs/ (lll) CdTe was found to be unsuitable due...

  6. Cognitive-Behavioral Treatment of Depressed Affect among Epileptics: Preliminary Findings.

    Science.gov (United States)

    Davis, Gay R.; And Others

    1984-01-01

    Evaluated a program where cognitive-behavioral methods were utilized in a structured learning format with clinically depressed epileptics (N=13). Results indicated that cognitive behavioral interventions result in significant decreases in depression and increases in related areas of psychosocial functioning that are maintained over time. (LLL)

  7. Why Learning Not Education?--Analysis of Transnational Education Policies in the Age of Globalization

    Science.gov (United States)

    Mandal, Sayantan

    2012-01-01

    The profound influence of globalization seems helping outshine the concept of "education" with the more flexible notion of "learning" in the education policies of major transnational organizations. With considerable differences in concepts, all of them are promoting "learning", more specifically LLL (lifelong…

  8. Further Investigation of the SI Scale of the MMPI: Reliabilities, Correlates, and Subscale Utility.

    Science.gov (United States)

    Williams, Carolyn L.

    1983-01-01

    Administered the SI scale of the Minnesota Multiphasic Personality Inventory (MMPI) and several measures typically used in social skills and assertiveness training research to college students (N=218). Results demonstrated acceptable reliability and support for the utility of the subscales of the SI scale of the MMPI. (LLL)

  9. Mechanical design for a large fusion laser system

    International Nuclear Information System (INIS)

    Hurley, C.A.

    1979-01-01

    The Nova Mechanical Systems Group at LLL is responsible for the design, fabrication, and installation of all laser chain components, for the stable support structure that holds them, and for the beam lines that transport the laser beam to the target system. This paper is an overview of the group's engineering effort, emphasizing new developments

  10. The Impact of Drug Abuse upon Adolescent Suicide.

    Science.gov (United States)

    Downey, Ann M.

    1991-01-01

    Explored the hypothesis that the increased use, misuse, and abuse of drugs is one of the myriad explanations for the escalation in youth suicidal behavior during the past 25 years. Used clinical case histories and research results to exemplify the impact of heightened drug usage as an argument for the upsurge in youth suicide. (Author/LLL)

  11. Meeting the needs of the people through species domestication: A ...

    African Journals Online (AJOL)

    Meeting the needs of the people through species domestication: A basis for effective conservation of the Eastern Arc Mountain forest biodiversity. LLL Lulandala. Abstract. Threats of biodiversity loss, caused by the overexploitation of natural resources are serious local and global concerns. Available information on the ...

  12. Author Details

    African Journals Online (AJOL)

    Lulandala, LLL. Vol 79, No 1 (2009) - Articles Soil erosion and sediment yield from the degraded Mzinga River Catchment in Uluguru Mountains, Tanzania Abstract. ISSN: 2408-8137. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's ...

  13. Southern Forests: a Journal of Forest Science - Vol 199 (2003)

    African Journals Online (AJOL)

    African sandalwood (Osyris lanceolata): resource assessment and quality variation among populations in Tanzania: research note · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. PL Mwang'ingo, Z Teklehaimanot, JB Hall, LLL Lulandala, 77-88 ...

  14. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 506 ... PL Mwang'ingo, Z Teklehaimanot, JB Hall, LLL Lulandala. Vol 206 (2006), Age determination of miombo species Brachystegia spiciformis (Leguminosae – Caesalpinoideae) in Zimbabwe using growth rings, Abstract. IM Grundy. Vol 73, No 2 (2011), Air layering and its potential in propagating Uapaca ...

  15. Study on Continuing Vocational Training System in Denmark

    DEFF Research Database (Denmark)

    Hansen, Leif Emil; Thoregaard, Kamille

    2009-01-01

    4 partnerlande (Bulgarien, Danmark, Grækenland og Rumænien) har i et EU-finansieret projekt analyseret stærke og svage sider ved landenes respektive systemer og situationer vedrørende erhvervsrettet efter- og videreuddannelse (CVT) og livslang læring (LLL) - med henblik på at øge den fremtidige...

  16. The effect of different combinations of industrial and agricultural ...

    African Journals Online (AJOL)

    Fry of tilapia (Oreochromis niloticus (average initial weight, 0.04g) were stocked at a density of 100/m3 in floating net-hapas and fed different combinations of agro-industrial wastes under the following treatments: I, Corn bran only; ll, Corn bran+ Rice bran (1:1) and lll, Corn bran+ Rice bran + Brewer's waste (1:1:1).

  17. The Dutch Lifelong Learning scene : Continuing unresolved issues and two alternative perspectives

    NARCIS (Netherlands)

    van Dellen, Teije

    2015-01-01

    Lifelong learning (LLL) in the Netherlands is under debate in this article. The article shows the state of the art of the Dutch lifelong learning education, and training and development field. In particular the unfulfilled expectations of the field are shown in a polemic manner by discussing the

  18. Promoting Social Change amongst Students in Higher Education: A ...

    African Journals Online (AJOL)

    The Listen, Live and Learn (LLL) initiative at SU is a senior student housing programme with the aim of providing experiential opportunities for students to make contact with 'the other'. By being in closer, more regular contact with 'the other', students' stereotypes, biases and discriminatory attitudes should start changing for ...

  19. Kaposi's sarcoma in renal transplant recipients

    African Journals Online (AJOL)

    The cause of the increased frequency of KS among renal transplant recipients is multifactorial: (l) genetic predisposition, i.e. increased incidence of specific lll.A types; (il) chronic immunostimulation in the presence of. T-cell dysfunction; (iil) proliferation of suppressor cells with the production of specific growth factors; and (iv).

  20. Observing SU(2) phases with neutrons

    Indian Academy of Sciences (India)

    A 2.35 ˚A polarized neutron beam illuminated a skew symmetric (220) LLL silicon in- terferometer. Due to the space constraints within the interferometer, the maximum me- chanical rotation of each flipper was limited to ¦22Ж. Larger angles Ж¬ were therefore achieved electrically. A reversal of current in F½ effectively rotates ...