WorldWideScience

Sample records for lizzy kontsert jb

  1. Kontsert

    Index Scriptorium Estoniae

    2005-01-01

    Vanemuise kontserdimajas 22. okt.saksa vokaalansambli Singer Pur kontsert "The Sound of Beauty" festivali NYYD'05 raames, 27. okt. Ralf Taali kontsert kammerlaval. Tartu Ülikooli aulas 14. okt. hõimukontsert, 15. okt. ansambli Corelli Consort kontsert "Ajaloo ilu", 19. okt. esinevad bariton Aare Saal ja pianist Pille Paemurru kontserdiasarja "Meistrite Akadeemia" raames, 25. okt TÜ asutamispäeva kontsert "Barokiaja õied baltisaksa, prantsuse ja saksa heliloojatelt" (esineb Corelli Consort)

  2. Kontsert

    Index Scriptorium Estoniae

    2006-01-01

    Kontsertidest TÜ aulas: Puhkpilliorkester Popsid 8. dets., TTÜ Kammerkoor 9. dets. ja TÜ Akadeemilise Naiskoori ning Tartu Akadeemilise Meeskoori jõulukontsert 15. detsembril. Bonzo, Tõuni, Üllar Saaremäe ja tshellokvarteti C-JAM kontsert 13. dets.,Isabelle Vernet' ja Olivier Vernet' kontsert 14. dets. Vanemuise kontserdimajas. Vox Clamantise 10. aastapäeva kontsert 8. dets. Jaani kirikus

  3. Kontsert

    Index Scriptorium Estoniae

    2007-01-01

    Pianist Manuela Gouveia Portugali päevade raames 2. nov., Tartu I Muusikakooli 63. aastapäeva kontsert 4. nov., klaveriõhtute sarja "Pianissimo" kontsert 6. nov. ja MTÜ Puhkpillisõprade Selts 10. nov. TÜ aulas, kontsert "Farinelli" 26. okt. Vanemuise kontserdimajas

  4. Kontsert

    Index Scriptorium Estoniae

    2005-01-01

    Vanemuise kontserdimajas 11. nov. isadepäeva kontserdil "Isad ja pojad" esinemas Olav Ehala ja Tanel Ehala klaveril ja Pärnu Linnaorkester, kaastegev Kiigelaulukuuik (dirigent Erki Pehk). 12. nov. kammerlaval festivalil "Fiesta de la guitarra '05" kitarriduo Katona Twins, 17. nov. Aleksander Rudini ja Tallinna Kammerorkestri kontsert. TÜ aulas 11. nov. kitarrikontsert: Rody van Gemert & Mikko Ikäheimo, 13. nov. "Fiesta de la guitarra '05" pidulik gala. TÜ ajaloo muuseumis 14. nov. Elleri Muusikakooli kontsert "Sügisbarokk". Jaani kirikus 13. nov. festivalil "Fiesta de la guitarra '05" Miguel Rivera ja Luis Carro Barquero

  5. Kontsert

    Index Scriptorium Estoniae

    2007-01-01

    Eesti Kammerkooride Liidu kontsert "Mart Saar 125 ja Ester Mägi 85" 17. märtsil TÜ aulas, anglo-eesti jazzkvintett 16. märtsil Vanemuise Kontserdimaja jazzisaalis ja Eesti Rahvusmeeskoor 22. märtsil Jaani kirikus

  6. Kontsert

    Index Scriptorium Estoniae

    2006-01-01

    Viljandi kultuuriakadeemia tudengite etnomuusika kontserdist "Eesti ja handi unustatud viisid" 2. dets., Miina Härma Gümnaasiumi kooride kontserdist "Valge klaver" 6. dets., puhkpilliorkestri Popsid kontserdist 8. dets. ja TÜ Kammerkoori kontserdist 9. dets. TÜ aulas. Max Bruchi oratooriumi "Mooses" esitusest 2. dets. ja Pepe Justicia flamenkogrupi esinemisest 7. sept. Vanemuise Kontserdimajas

  7. Kontsert

    Index Scriptorium Estoniae

    2006-01-01

    Kontserdist "Isad ja pojad - Uno, Tõnu ja Marko Naissoo" 11. nov. ja Timo Korhoneni kontserdist 18. nov. Vanemuise kontserdisaalis, vanamuusikaansambli Cantores Vagantes kontserdist (külalisesinejaks Fumikata Saito) 12. nov. Tartu Linnamuuseumis ja Tallinna kitarrikvarteti (Heiki Mätlik, Julia Kahro, Kristo Käo, Jorma Puusaag) kontserdist 16. nov. TÜ Ajaloo Muuseumis

  8. Kontsert

    Index Scriptorium Estoniae

    2006-01-01

    Kontsertidel TÜ aulas 18. mail esinemas H. Elleri Tartu Muusikakooli noorteosakond ja 20. mail Lahti Naislauljad ning Lahti Meeskoor, Linnamuuseumis 26. mail hispaania kitarrist Agustin Maruri, Jaani kirikus 26. mail Tartu Üliõpilassegakoor ja segakoor Tampereen Akateemiset Laulajat

  9. Kontsert

    Index Scriptorium Estoniae

    2006-01-01

    Kontsertidel TÜ aulas 26. mail esinemas Kuopio konservatooriumi kammerkoor Vox Nova, Linnamuuseumis 26. mail hispaania kitarrist Agustin Maruri, Jaani kirikus 26. mail Tartu Üliõpilassegakoor ja segakoor Tampereen Akateemiset Laulajat

  10. Kontsert

    Index Scriptorium Estoniae

    2006-01-01

    Festivali "Fiesta de la Guitara 2006" lõppkontserdist 19. nov. ja Vitali Kototajevi kontserdist 24. nov. TÜ aulas. Timo Korhoneni kontserdist 18. nov. ja Kristjan Randalu ning Bodek Janke kontserdist 21. nov. Vanemuise kontserdimajas

  11. Kontsert

    Index Scriptorium Estoniae

    2005-01-01

    Elleri Tartu Muusikakooli trompetistide kontserdist 31. märtsil ja Tanel Joametsa klaverikontserdist 3. apr.TÜ aulas. Osiris Piano Trio kontserdist 1. apr. TÜ Ajaloo Muuseumis. Kontserdist 26. märtsil Vanemuise kontserdimajas. Camerata Scotland kontserdist Christopher Adey juhatusel 6. apr. Vanemuise kontserdimajas

  12. Kontsert

    Index Scriptorium Estoniae

    2006-01-01

    Ansambli Picante jazzkontserdist "Ma tulen, ma lähen, ma olen..." 21. jaan. Tallinna raekojas, kontserdist "Õhtu Carmeniga" 22. jaan. Estonia Talveaias, magistrikontserdist 24. jaan. Rootsi-Mihkli kirikus

  13. Kontsert

    Index Scriptorium Estoniae

    2007-01-01

    II rahvusvahelisest noortekooride festivalist 1.-3. veebr. TÜ aulas. Gustav Mahleri "Poisi võlusarv" esitusest 1. veebr. TÜ Ajaloo Muuseumis (esitajad Annaliisa Pillak, Taavi Tampuu ja Kadri-Ann Sumera). Cyprien Katsarise kontserdist 30. jaan. Vanemuise kontserdimajas. Kontserdil "Vocalissimo 2007. Vajatakse Muusat!" 28. jaan. Tartu Linnamuuseumis (esinejad Mati Turi ja Martti Raide)

  14. Kontsert : 80ndad kindlalt tagasi. Tuleb

    Index Scriptorium Estoniae

    2007-01-01

    Kontsertidest Tallinnas: Bryan Ferry 2. nov., Oslo Filharmoonia Orkester 29. aug.Estonia kontserdisaalis, kontsert "80's are back!" (esinevad Thomas Anders ja Ricci E Poveri) 18. okt. Saku Suurhallis, Grammyle kandideerinud USA metalcore'i bänd Killswitch Engage 15. okt. Club Hollywoodis

  15. "Kontsert porgandipirukale" kandideerib Cartoon d'Or'i auhinnale

    Index Scriptorium Estoniae

    2004-01-01

    Heiki Ernitsa ja Janno Põldma "Kontsert porgandipirukale" valiti Santiago de Compostelas (Hispaania) üleantava animafilmi auhinna Cartoon d'Or viie nominendi hulka. Loetletud ka konkureerivad filmid

  16. Main: 1JB9 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1JB9 トウモロコシ Corn Zea mays L. Ferredoxin-Nadp Reductase Precursor Zea Mays Molecule:...SLLYDEEFTSYLKQYPDNFRYDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVAERRGESWDQKLAQLKKNKQWHVEVY corn_1JB9.jpg ...

  17. Klišeed muusikas ja filmis : kontsert, mis rõhub nostalgiale / Brigitta Davidjants

    Index Scriptorium Estoniae

    Davidjants, Brigitta, 1983-

    2005-01-01

    Põhjamaade Sümfooniaorkestri kontsert Anu Tali juhatusel Keila lauluväljakul "Russkoje kino - "Aleksandr Nevski", kus esitati vene nõukogude filmimuusikat ning lühendatud versioon Sergei Eisensteini filmist "Aleksandr Nevski" koos Sergei Prokofjevi filmiainelise kantaadiga

  18. Tudengijazz '06. VKA ja Eesti Kontsert teevad koostööd

    Index Scriptorium Estoniae

    2006-01-01

    Festivalist Tudengijazz '06 14.-18. veebr.Viljandis, Tartus ja Tallinnas. TÜ Viljandi Kultuuriakadeemia (VKA) ja Eesti Kontsert sõlmisid koostöölepingu võimaldamaks VKA tudengite praktikate ja täiendõppe läbiviimist Eesti Kontserdi kontserdimajades

  19. JB*-Algebras of Topological Stable Rank 1

    Directory of Open Access Journals (Sweden)

    Akhlaq A. Siddiqui

    2007-01-01

    Full Text Available In 1976, Kaplansky introduced the class JB*-algebras which includes all C*-algebras as a proper subclass. The notion of topological stable rank 1 for C*-algebras was originally introduced by M. A. Rieffel and was extensively studied by various authors. In this paper, we extend this notion to general JB*-algebras. We show that the complex spin factors are of tsr 1 providing an example of special JBW*-algebras for which the enveloping von Neumann algebras may not be of tsr 1. In the sequel, we prove that every invertible element of a JB*-algebra is positive in certain isotope of ; if the algebra is finite-dimensional, then it is of tsr 1 and every element of is positive in some unitary isotope of . Further, it is established that extreme points of the unit ball sufficiently close to invertible elements in a JB*-algebra must be unitaries and that in any JB*-algebras of tsr 1, all extreme points of the unit ball are unitaries. In the end, we prove the coincidence between the λ-function and λu-function on invertibles in a JB*-algebra.

  20. Required characteristics of Paenibacillus polymyxa JB-0501 as potential probiotic.

    Science.gov (United States)

    Naghmouchi, Karim; Baah, John; Cudennec, Benoit; Drider, Djamel

    2013-08-01

    The ability of Paenibacillus polymyxa to inhibit the growth of Escherichia coli generic ATCC 25922 (Escherichia coli ATCC 25922) and to adhere to monolayers of the enterocyte-like human cell line Caco-2 was evaluated. P. polymyxa JB-0501 (P. polymyxa JB-0501), found in a livestock feed probiotic supplement, was compared to P. polymyxa reference strain ATCC 43685 and ATCC 7070 (P. polymyxa ATCC) in terms of carbohydrate utilization and resistance to lysozyme, acid, bile salts, and hydrogen peroxide. JB-0501 grew at pH 4.5 and at H2O2 concentrations less than 7.3 μg/ml and presented a higher affinity to hexadecane and decane. Bile salts at 0.2 % inhibited the growth of all three strains. P. polymyxa JB-0501 and P. polymyxa ATCC 43865 adhered to Caco-2 cell monolayers. The percentage of cells that adhered ranged from about 0.35 to 6.5 % and was partially proportional to the number applied. Contact time (from 15 min to 1 h) had little impact on adhesion. P. polymyxa JB-0501 inhibited the growth of E. coli ATCC 25922, as proven by the diffusion tests in agar. Taken together, these results suggested that P. polymyxa JB-0501 has the potential probiotic properties to justify its consideration as a livestock feed supplement.

  1. JB-300: An advanced medium size transport for 2005

    Science.gov (United States)

    Debrouwer, Giles; Graham, Katherine; Ison, Jim; Juarez, Vince; Moskalik, Steve; Pankonin, Jon; Weinstein, Arnold

    1993-01-01

    In the fall of 1992, the TAC Team was presented with a Request for Proposal (PFP) for a mid-size (250-350 passenger) commercial transport. The aircraft was to be extremely competitive in the areas of passenger comfort, performance, and economic aspects. Through the use of supercritical airfoils, a technologically advanced Very High By-pass Ratio (VHBR) turbofan engine, a low overall drag configuration, a comparable interior layout, and mild use of composites, the JB-300 offers an economically viable choice to the airlines. The cents per passenger mile of the JB-300 is 1.76, which is considerably lower than current aircraft in the same range. Overall, the JB-300 is a technologically advanced aircraft, which will meet the demands of the 21st century.

  2. Genetic Characterization of Bacillus anthracis 17 JB strain.

    Science.gov (United States)

    Seyed-Mohamadi, Sakineh; Moradi Bidhendi, Soheila; Tadayon, Keyvan; Ghaderi, Rainak

    2015-06-01

    Bacillus anthracis is one of the most homogenous bacteria ever described. Some level of diversity. Bacillus anthracis 17JB is a laboratory strain It is broadly used as a challenge strain in guinea pigs for potency test of anthrax vaccine. This work describes genetic characterization of B. anthracis 17 JB strain using the SNPs and MLVA genotyping. In SNPs typing, the originally French 17JB strain represented the A.Br. 008/009 subgroup. In Levy's genotyping method, 843, 451 and 864 bp long fragments were identified at AA03, AJ03 and AA07 loci, respectively. In the vaccine manufacturer perspective these findings are much valuable on their own account, but similar research is required to extend molecular knowledge of B. anthracis epidemiology in Persia.

  3. Ansambel Smilers esineb täna Kadrinas. Sex Pistolsi kontsert Tallinnas jääb ära

    Index Scriptorium Estoniae

    2008-01-01

    Ansambli Smilers kontserdist ETV Live raames 29. juulil Kadrinas. Briti punkansambli Sex Pistols kontsert 22. aug. Tallinnas Rocca al Mare suurhallis jääb ära, piletid kehtivad 20. aug. Riias toimuval kontserdil või ostetakse tagasi kuni 21. septembrini

  4. Uudised : Therese Raide loominguline õhtu. Küünlakuu kontsert Adamson-Ericus. Maailmamuusika tippansambel Eestis / Toomas Kuter

    Index Scriptorium Estoniae

    Kuter, Toomas, 1965-

    2001-01-01

    20. veebr. toimub T. Raide loominguline õhtu, kus tähistatakse muusiku 80. sünnipäeva. 18. veebr. toimub Adamson-Ericu muuseumis kolmas kontsert sarjast "Barokkmaastikud". Terem-Quartet esineb 22. veebr. Tartus ja 23. veebr. Tallinnas

  5. JB-9322, a new selective histamine H2-receptor antagonist with potent gastric mucosal protective properties.

    Science.gov (United States)

    Palacios, B; Montero, M J; Sevilla, M A; Román, L S

    1995-05-01

    1. JB-9322 is a selective histamine H2-receptor antagonist with gastric antisecretory activity and mucosal protective properties. 2. The affinity of JB-9322 for the guinea-pig atria histamine H2-receptor was approximately 2 times greater than that of ranitidine. 3. In vivo, the ID50 value for the inhibition of gastric acid secretion in pylorus-ligated rats was 5.28 mg kg-1 intraperitoneally. JB-9322 also dose-dependently inhibited gastric juice volume and pepsin secretion. In gastric lumen-perfused rats, intravenous injection of JB-9322 dose-dependently reduced histamine-, pentagastrin- and carbachol-stimulated gastric acid secretion. 4. JB-9322 showed antiulcer activity against aspirin and indomethacin-induced gastric lesions and was more potent than ranitidine. 5. JB-9322 effectively inhibited macroscopic gastric haemorrhagic lesions induced by ethanol. Intraperitoneal injection was effective in preventing the lesions as well as oral treatment. The oral ID50 value for these lesions was 1.33 mg kg-1. By contrast, ranitidine (50 mg kg-1) failed to reduce these lesions. In addition, the protective effect of JB-9322 was independent of prostaglandin synthesis. 6. These results indicate that JB-9322 is a new antiulcer drug that exerts a potent cytoprotective effect in addition to its gastric antisecretory activity.

  6. Pharmacology of JB-9315, a new selective histamine H2-receptor antagonist.

    Science.gov (United States)

    Palacios, B; Montero, M J; Sevilla, M A; San Román, L

    1998-02-01

    1. The histamine H2-receptor antagonistic activity and antisecretory and antiulcer effects of JB-9315 were studied in comparison with the standard H2 blocker ranitidine. 2. In vitro, JB-9315 is a competitive antagonist of histamine H2 receptors in the isolated, spontaneously beating guinea-pig right atrium, with a pA2 value of 7.30 relative to a value of 7.36 for ranitidine. JB-9315 was specific for the histamine H2 receptor because, at high concentration, it did not affect histamine- or acetylcholine-induced contractions in guinea-pig isolated ileum or rat isolated duodenum, respectively. 3. JB-9315 dose dependently inhibited histamine-, pentagastrin- or carbachol-stimulated acid secretion and basal secretion in the perfused stomach preparation of the anesthetized rat. In the pylorus-ligated rat after intraperitoneal administration, total acid output over 4 h was inhibited by JB-9315 with an ID50 of 32.8 mg/kg, confirming its H2-receptor antagonist properties. 4. JB-9315 showed antiulcer activity against cold stress plus indomethacin-induced lesions with an ID50 of 6.8 mg/kg. 5. JB-9315, 50 and 100 mg/kg, inhibited macroscopic gastric hemorrhagic lesions induced by ethanol. In contrast, ranitidine (50 mg/kg) failed to reduce these lesions. 6. These results indicate that JB-9315 is a new antiulcer drug that exerts a cytoprotective effect in addition to its gastric antisecretory activity.

  7. Pharmacological, neurochemical, and behavioral profile of JB-788, a new 5-HT1A agonist.

    Science.gov (United States)

    Picard, M; Morisset, S; Cloix, J F; Bizot, J C; Guerin, M; Beneteau, V; Guillaumet, G; Hevor, T K

    2010-09-01

    A novel pyridine derivative, 8-{4-[(6-methoxy-2,3-dihydro-[1,4]dioxino[2,3-b]pyridine-3-ylmethyl)-amino]-butyl}-8-aza-spiro[4.5]decane-7,9-dione hydrochloride, termed JB-788, was designed to selectively target 5-HT(1A) receptors. In the present study, the pharmacological profile of JB-788 was characterized in vitro using radioligands binding tests and in vivo using neurochemical and behavioural experiments. JB-788 bound tightly to human 5-HT(1A) receptor expressed in human embryonic kidney 293 (HEK-293) cells with a K(i) value of 0.8 nM. Its binding affinity is in the same range as that observed for the (+/-)8-OH-DPAT, a reference 5HT(1A) agonist compound. Notably, JB-788 only bound weakly to 5-HT(1B) or 5-HT(2A) receptors and moreover the drug displayed only weak or indetectable binding to muscarinic, alpha(2), beta(1) and beta(2) adrenergic receptors, or dopaminergic D(1) receptors. JB-788 was found to display substantial binding affinity for dopaminergic D(2) receptors and, to a lesser extend to alpha(1) adrenoreceptors. JB-788 dose-dependently decreased forskolin-induced cAMP accumulation in HEK cells expressing human 5-HT(1A), thus acting as a potent 5-HT(1A) receptor agonist (E(max.) 75%, EC(50) 3.5 nM). JB-788 did not exhibit any D(2) receptor agonism but progressively inhibited the effects of quinpirole, a D(2) receptor agonist, in the cAMP accumulation test with a K(i) value of 250 nM. JB-788 induced a weak change in cAMP levels in mouse brain but, like some antipsychotics, transiently increased glycogen contents in various brain regions. Behavioral effects were investigated in mice using the elevated plus-maze. JB-788 was found to increase the time duration spent by animals in anxiogenic situations. Locomotor hyperactivity induced by methamphetamine in mouse, a model of antipsychotic activity, was dose-dependently inhibited by JB-788. Altogether, these results suggest that JB-788 displays pharmacological properties, which could be of interest in the area

  8. Psychoactive bacteria Lactobacillus rhamnosus (JB-1) elicits rapid frequency facilitation in vagal afferents.

    Science.gov (United States)

    Perez-Burgos, Azucena; Wang, Bingxian; Mao, Yu-Kang; Mistry, Bhavik; McVey Neufeld, Karen-Anne; Bienenstock, John; Kunze, Wolfgang

    2013-01-15

    Mounting evidence supports the influence of the gut microbiome on the local enteric nervous system and its effects on brain chemistry and relevant behavior. Vagal afferents are involved in some of these effects. We previously showed that ingestion of the probiotic bacterium Lactobacillus rhamnosus (JB-1) caused extensive neurochemical changes in the brain and behavior that were abrogated by prior vagotomy. Because information can be transmitted to the brain via primary afferents encoded as neuronal spike trains, our goal was to record those induced by JB-1 in vagal afferents in the mesenteric nerve bundle and thus determine the nature of the signals sent to the brain. Male Swiss Webster mice jejunal segments were cannulated ex vivo, and serosal and luminal compartments were perfused separately. Bacteria were added intraluminally. We found no evidence for translocation of labeled bacteria across the epithelium during the experiment. We recorded extracellular multi- and single-unit neuronal activity with glass suction pipettes. Within minutes of application, JB-1 increased the constitutive single- and multiunit firing rate of the mesenteric nerve bundle, but Lactobacillus salivarius (a negative control) or media alone were ineffective. JB-1 significantly augmented multiunit discharge responses to an intraluminal distension pressure of 31 hPa. Prior subdiaphragmatic vagotomy abolished all of the JB-1-evoked effects. This detailed exploration of the neuronal spike firing that encodes behavioral signaling to the brain may be useful to identify effective psychoactive bacteria and thereby offer an alternative new perspective in the field of psychiatry and comorbid conditions.

  9. Draft genome sequences of Streptococcus bovis strains ATCC 33317 and JB1

    Science.gov (United States)

    We report the draft genome sequences of Streptococcus bovis type strain ATTC 33317 (CVM42251) isolated from cow dung and strain JB1 (CVM42252) isolated from a cow rumen in 1977. Strains were subjected to Next Generation sequencing and the genome sizes are approximately 2 MB and 2.2 MB, respectively....

  10. Cometabolic Degradation of Dibenzofuran and Dibenzothiophene by a Naphthalene-Degrading Comamonas sp. JB.

    Science.gov (United States)

    Ji, Xiangyu; Xu, Jing; Ning, Shuxiang; Li, Nan; Tan, Liang; Shi, Shengnan

    2017-12-01

    Comamonas sp. JB was used to investigate the cometabolic degradation of dibenzofuran (DBF) and dibenzothiophene (DBT) with naphthalene as the primary substrate. Dehydrogenase and ATPase activity of the growing system with the presence of DBF and DBT were decreased when compared to only naphthalene in the growing system, indicating that the presence of DBF and DBT inhibited the metabolic activity of strain JB. The pathways and enzymes involved in the cometabolic degradation were tested. Examination of metabolites elucidated that strain JB cometabolically degraded DBF to 1,2-dihydroxydibenzofuran, subsequently to 2-hydroxy-4-(3'-oxo-3'H-benzofuran-2'-yliden)but-2-enoic acid, and finally to catechol. Meanwhile, strain JB cometabolically degraded DBT to 1,2-dihydroxydibenzothiophene and subsequently to the ring cleavage product. A series of naphthalene-degrading enzymes including naphthalene dioxygenase, 1,2-dihydroxynaphthalene dioxygenase, salicylaldehyde dehydrogenase, salicylate hydroxylase, and catechol 2,3-oxygenase have been detected, confirming that naphthalene was the real inducer of expression the degradation enzymes and metabolic pathways were controlled by naphthalene-degrading enzymes.

  11. Reactive flow modeling of initial density effect on divergence JB-9014 detonation driving

    Science.gov (United States)

    Yu, Xin; Huang, Kuibang; Zheng, Miao

    2016-06-01

    A serious of experiments were designed and the results were represented in this paper, in which 2mm thickness cooper shells were impacted by explosives named JB-9014 with different densities, and the surface velocities of the OFHC shells were measured. The comparison of experimental data shows the free surface velocity of the OFHC shell increase with the IHE density. Numerical modeling, which occupied phenomenological reactive flow rate model using the two-dimensional Lagrange hydrodynamic code, were carried out to simulate the above experiments, and empirical adjustments on detonation velocity and pressure and Pier Tang's adjustments on EOS of detonation products were both introduced in our numerical simulation work. The computational results agree well with that of experiments, and the numerical results with original parameters of products and the adjusted ones of JB-9014 could describe the density effect distinctly.

  12. Embedding, serial sectioning and staining of zebrafish embryos using JB-4 resin.

    Science.gov (United States)

    Sullivan-Brown, Jessica; Bisher, Margaret E; Burdine, Rebecca D

    2011-01-01

    Histological techniques are critical for observing tissue and cellular morphology. In this paper, we outline our protocol for embedding, serial sectioning, staining and visualizing zebrafish embryos embedded in JB-4 plastic resin-a glycol methacrylate-based medium that results in excellent preservation of tissue morphology. In addition, we describe our procedures for staining plastic sections with toluidine blue or hematoxylin and eosin, and show how to couple these stains with whole-mount RNA in situ hybridization. We also describe how to maintain and visualize immunofluorescence and EGFP signals in JB-4 resin. The protocol we outline-from embryo preparation, embedding, sectioning and staining to visualization-can be accomplished in 3 d. Overall, we reinforce that plastic embedding can provide higher resolution of cellular details and is a valuable tool for cellular and morphological studies in zebrafish.

  13. Biosorption of cationic basic dye and cadmium by the novel biosorbent Bacillus catenulatus JB-022 strain.

    Science.gov (United States)

    Kim, Su Young; Jin, Mi Ra; Chung, Chang Ho; Yun, Yeoung-Sang; Jahng, Kwang Yeop; Yu, Kang-Yeol

    2015-04-01

    Biosorption of heavy metals and dyes is a promising technology that involves the removal of toxic metals from industrial wastes. The present study aims to screen the bacterial strains isolated from soils and polluted pond for their potential biosorption of both cationic dye and cadmium. Bacillus catenulatus JB-022 strain removed 58% and 66% of cationic basic blue 3 (BB3) and cadmium (Cd(II)) at the respective concentrations of 2000 mg/L and 150 mg/L. The biosorption equilibrium data were well fitted by the Langmuir adsorption isotherm, and the kinetic studies indicated that the biosorption followed the pseudo-second-order model. The biosorption kinetics showed that the equilibrium was reached within 10 min and 5 min for BB3 and Cd(II), respectively. According to the Langmuir model, the maximum uptakes of BB3 and Cd(II) by the JB-022 biomass were estimated to be 139.74 and 64.28 mg/g, respectively. To confirm the surface morphology and functional groups, field emission scanning electron microscope, energy-dispersive X-ray spectrometer, X-ray diffraction, and Fourier transform infrared spectroscopy analyses were carried out, and the results revealed that the biomass of JB-022 has carboxyl and phosphonate groups as potential surface functional groups capable of binding to cationic pollutants. In conclusion, B. catenulatus JB-022 is proposed as an excellent biosorbent with potentially important applications in removal of cationic pollutants from wastewaters. Copyright © 2014 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  14. Copper and dyes enhance laccase production in gamma-proteobacterium JB.

    Science.gov (United States)

    Malhotra, Kanam; Sharma, Prince; Capalash, Neena

    2004-07-01

    Laccase production in gamma-proteobacterium JB was enhanced 13-fold by adding 0.1 mM CuSO(4) 24 h after the onset of growth. Ethidium bromide (2.5 microM), Malachite Green, Phenol Red and Thymol Blue (10 microM each) enhanced laccase production 17-, 19-, 4- and 2-fold, respectively. Among the fourteen aromatic/organic compounds tried, p-aminobenzoic acid and an industrial effluent, from where the organism was isolated, showed 1.2- and 1.26-fold increases in production.

  15. Xenobiotics enhance laccase activity in alkali-tolerant γ-proteobacterium JB.

    Science.gov (United States)

    Singh, Gursharan; Batish, Mona; Sharma, Prince; Capalash, Neena

    2009-01-01

    Various genotoxic textile dyes, xenobiotics, substrates (10 µM) and agrochemicals (100 µg/ml) were tested for enhancement of alkalophilic laccase activity in γ-proteobacterium JB. Neutral Red, Indigo Carmine, Naphthol Base Bordears and Sulphast Ruby dyes increased the activity by 3.7, 2.7, 2.6 and 2.3 fold respectively. Xenobiotics/substrates like p-toluidine, 8-hydroxyquinoline and anthracine increased it by 3.4, 2.8 and 2.3 fold respectively. Atrazine and trycyclozole pesticides enhanced the activity by 1.95 and 1.5 fold respectively.

  16. Lactobacillus rhamnosus strain JB-1 reverses restraint stress-induced gut dysmotility.

    Science.gov (United States)

    West, C; Wu, R Y; Wong, A; Stanisz, A M; Yan, R; Min, K K; Pasyk, M; McVey Neufeld, K-A; Karamat, M I; Foster, J A; Bienenstock, J; Forsythe, P; Kunze, W A

    2017-01-01

    Environmental stress affects the gut with dysmotility being a common consequence. Although a variety of microbes or molecules may prevent the dysmotility, none reverse the dysmotility. We have used a 1 hour restraint stress mouse model to test for treatment effects of the neuroactive microbe, L. rhamnosus JB-1 ™ . Motility of fluid-filled ex vivo gut segments in a perfusion organ bath was recorded by video and migrating motor complexes measured using spatiotemporal maps of diameter changes. Stress reduced jejunal and increased colonic propagating contractile cluster velocities and frequencies, while increasing contraction amplitudes for both. Luminal application of 10E8 cfu/mL JB-1 restored motor complex variables to unstressed levels within minutes of application. L. salivarius or Na.acetate had no treatment effects, while Na.butyrate partially reversed stress effects on colonic frequency and amplitude. Na.propionate reversed the stress effects for jejunum and colon except on jejunal amplitude. Our findings demonstrate, for the first time, a potential for certain beneficial microbes as treatment of stress-induced intestinal dysmotility and that the mechanism for restoration of function occurs within the intestine via a rapid drug-like action on the enteric nervous system. © 2016 John Wiley & Sons Ltd.

  17. A novel chimeric prophage vB_LdeS-phiJB from commercial Lactobacillus delbrueckii subsp. bulgaricus.

    Science.gov (United States)

    Guo, Tingting; Zhang, Chenchen; Xin, Yongping; Xin, Min; Kong, Jian

    2016-05-01

    Prophage vB_LdeS-phiJB (phiJB) was induced by mitomycin C and UV radiation from the Lactobacillus delbrueckii subsp. bulgaricus SDMCC050201 isolated from a Chinese yoghurt sample. It has an isometric head and a non-contractile tail with 36,969 bp linear double-stranded DNA genome, which is classified into the group a of Lb. delbrueckii phages. The genome of phiJB is highly modular with functionally related genes clustered together. Unexpectedly, there is no similarity of its DNA replication module to any phages that have been reported, while it consists of open-reading frames homologous to the proteins of Lactobacillus strains. Comparative genomic analysis indicated that its late gene clusters, integration/lysogeny modules and DNA replication module derived from different evolutionary ancestors and integrated into a chimera. Our results revealed a novel chimeric phage of commercial Lb. delbrueckii and will broaden the knowledge of phage diversity in the dairy industry.

  18. Biodegradation of Benzene, Toluene, Ethylbenzene, and o-, m-, and p-Xylenes by the Newly Isolated Bacterium Comamonas sp. JB.

    Science.gov (United States)

    Jiang, Bei; Zhou, Zunchun; Dong, Ying; Tao, Wei; Wang, Bai; Jiang, Jingwei; Guan, Xiaoyan

    2015-07-01

    A bacterium designated strain JB, able to degrade six benzene, toluene, ethylbenzene, and o-, m-, and p-xylene (BTEX) compounds, was isolated from petroleum-contaminated soil. Taxonomic analyses showed that the isolate belonged to Comamonas, and until now, the genus Comamonas has not included any known BTEX degraders. The BTEX biodegradation rate was slightly low on the mineral salt medium (MSM), but adding a small amount of yeast extract greatly enhanced the biodegradation. The relationship between specific degradation rate and individual BTEX was described well by Michaelis-Menten kinetics. The treatment of petrochemical wastewater containing BTEX mixture and phenol was shown to be highly efficient by BTEX-grown JB. In addition, toxicity assessment indicated the treatment of the petrochemical wastewater by BTEX-grown JB led to less toxicity than untreated wastewater.

  19. Isolation of Burkholderia cepacia JB12 from lead- and cadmium-contaminated soil and its potential in promoting phytoremediation with tall fescue and red clover.

    Science.gov (United States)

    Jin, Zhong Min; Sha, Wei; Zhang, Yan Fu; Zhao, Jing; Ji, Hongyang

    2013-07-01

    Phytoremediation combined with suitable microorganisms and biodegradable chelating agents can be a means of reclaiming lands contaminated by toxic heavy metals. We investigated the ability of a lead- and cadmium-resistant bacterial strain (JB12) and the biodegradable chelator ethylenediamine-N,N'-disuccinic acid (EDDS) to improve absorption of these metals from soil by tall fescue and red clover. Strain JB12 was isolated from contaminated soil samples, analysed for lead and cadmium resistance, and identified as Burkholderia cepacia. Tall fescue and red clover were grown in pots to which we added JB12, (S,S)-EDDS, combined JB12 and EDDS, or water only. Compared with untreated plants, the biomass of plants treated with JB12 was significantly increased. Concentrations of lead and cadmium in JB12-treated plants increased significantly, with few exceptions. Plants treated with EDDS responded variably, but in those treated with combined EDDS and JB12, heavy metal concentrations increased significantly in tall fescue and in the aboveground parts of red clover. We conclude that JB12 is resistant to lead and cadmium. Its application to the soil improved the net uptake of these heavy metals by experimental plants. The potential for viable phytoremediation of lead- and cadmium-polluted soils with tall fescue and red clover combined with JB12 was further enhanced by the addition of EDDS.

  20. Loengud. Kontsert. Koorid. Teated

    Index Scriptorium Estoniae

    2006-01-01

    Loengust "Muusikaesseistika I" 19. sept. Lai t 34 aud 72. Kontsertidest: Tartu raekojas 22. sept. esineb hispaania ansambel Zarabanda, TÜ aulas 20. sept. esinevad "Meistrite akadeemia" sarjas Pille Lille Muusikute Toetusfondi laureaat Anna-Liisa Bezrodnõi viiulil ja Thea Nestor klaveril. TÜ Kammerkoor ja Tartu Akadeemiline Meeskoor võtavad vastu uusi liikmeid (info: www.ut.ee/TYKK ja www.tam.eu). Tartu Ülikooli rahvakunstiansambel ootab uusi tantsijaid (info: www.ut.ee)

  1. Uudised : Muusika. Kontsert. Muusikal

    Index Scriptorium Estoniae

    2005-01-01

    Hans Christian Anderseni elulool põhineva Stephin Merritt'i ooperist "My Life as a Fairy Tale" (lavastuse esietendus New Yorgi Lincoln Centeri festivalil juuli lõpus). Duubelplaadist "Two Chinese Operas". Autorilaulufestivalist "Mailaul" 20. ja 21.mail Tartus. Inglismaal esilinastunud muusikalist "Billy Elliott" (helilooja Elton John)

  2. Kontserdisarja "Rosaarium" viimane kontsert

    Index Scriptorium Estoniae

    2008-01-01

    21. sept. esinevad Jäneda mõisa suures saalis kontserdiga Kait Tamra ja Eesti Nukuteatri segakoor Kaire Vilgatsi juhatamisel. Selle suve esimesel kontserdil esinesid Tõnis Mägi koos Mikk Dedega ja Rakvere kammerkoor Solare dirigent Elo Forseli juhendamisel, teisel kontserdil astusid üles Chalice ja segakoor Suisapäisa Kuldar Schützi juhatamisel

  3. August toob Vainupeale kontserte

    Index Scriptorium Estoniae

    2006-01-01

    Kontsertidest Vainupeal: Kunda suvekooli noored saksofonistid 10. aug., Jaan Arder ja Henn Rebane 15. aug., kunstinäituse "Blended X" sulgemiskontsert 19. aug., Silvi Vrait ja Jaak Jürisson 26. augustil

  4. Basic Fibroblast Growth Factor Regulates Persistent ERK Osciliations in Premaligant but not Malignant JB6 Cells

    Energy Technology Data Exchange (ETDEWEB)

    Weber, Thomas J.; Shankaran, Harish; Wiley, H. S.; Opresko, Lee K.; Chrisler, William B.; Quesenberry, Ryan D.

    2010-05-02

    basic fibroblast growth factor (bFGF or FGF2) plays an important role in epidermal wound healing in vivo and is associated with a persistent increased in the extracellular signal-regulated kinase (ERK) pathway in vitro. Here we have examined whether bFGF induces the closure of an experimental scratch wound in JB6 mouse epidermal cells and have explored the regulation of the ERK pathway by bFGF in the context of kinase oscillations. bFGF stimulation is associated with increases in cellular phospho-ERK and phospho-c-Jun levels. In addition, bFGF increases cell proliferation and a change in cell morphology (stellate appearance) in a dose-dependent fashion (0.1 – 100 ng/ml). bFGF treatment also promoted the closure of an experimental scratch wound in vitro. JB6 cells were stably transfected with an ERK1-GFP chimera to follow temporal ERK subcellular distribution patterns. We observe a persistent upregulation of the ERK pathway, as evidenced by a significant increase in nuclear ERK1-GFP levels at time points up to 24 hr after bFGF treatment. Interestingly, at the single cell level, ERK is observed to oscillate between nuclear and cytosolic compartments in response to bFGF treatment. Because this oscillatory behavior is asynchronous in the cell population, it is only clearly resolved at the single cell level. Collectively, data presented here are consistent with an important role for bFGF in wound healing and suggest a more complex regulation of the ERK pathway by bFGF than has previously been appreciated.

  5. Loss of retrovirus production in JB/RH melanoma cells transfected with H-2Kb and TAP-1 genes.

    Science.gov (United States)

    Li, M; Xu, F; Muller, J; Huang, X; Hearing, V J; Gorelik, E

    1999-01-20

    JB/RH1 melanoma cells, as well as other melanomas of C57BL/6 mice (B16 and JB/MS), express a common melanoma-associated antigen (MAA) encoded by an ecotropic melanoma-associated retrovirus (MelARV). JB/RH1 cells do not express the H-2Kb molecules due to down-regulation of the H-2Kb and TAP-1 genes. When JB/RH1 cells were transfected with the H-2Kb and cotransfected with the TAP-1 gene, it resulted in the appearance of H-2Kb molecules and an increase in their immunogenicity, albeit they lost expression of retrovirus-encoded MAA recognized by MM2-9B6 mAb. Loss of MAA was found to result from a complete and stable elimination of ecotropic MelARV production in the H-2Kb/TAP-1-transfected JB/RH1 cells. Northern blot analysis showed no differences in ecotropic retroviral messages in MelARV-producing and -nonproducing melanoma cells, suggesting that loss of MelARV production was not due to down-regulation of MelARV transcription. Southern blot analysis revealed several rearrangements in the proviral DNA of H-2Kb-positive JB/RH1 melanoma cells. Sequence analysis of the ecotropic proviral DNA from these cells showed numerous nucleotide substitutions, some of which resulted in the appearance of a novel intraviral PstI restriction site and the loss of a HindIII restriction site in the pol region. PCR amplification of the proviral DNAs indicates that an ecotropic provirus found in the H-2Kb-positive cells is novel and does not preexist in the parental H-2Kb-negative melanoma cells. Conversely, the ecotropic provirus of the parental JB/RH1 cells was not amplifable from the H-2Kb-positive cells. Our data indicate that stable loss of retroviral production in the H-2Kb/TAP-1-transfected melanoma cells is probably due to the induction of recombination between a productive ecotropic MelARV and a defective nonecotropic provirus leading to the generation of a defective ecotropic provirus and the loss of MelARV production and expression of the retrovirus-encoded MAA. Copyright 1999

  6. Sesquiterpene lactones isolated from indigenous Middle Eastern plants inhibit tumor promoter-induced transformation of JB6 cells

    Directory of Open Access Journals (Sweden)

    Saikali Melody

    2012-07-01

    Full Text Available Abstract Background Sesquiterpene lactones (SL are plant secondary metabolites that are known for their anti-fungal, anti-bacterial, anti-inflammatory, and anti-tumor properties. Considering that several SL-derived drugs are currently in cancer clinical trials, we have tested two SL molecules, 3-β-methoxy-iso-seco-tanapartholide (β-tan isolated from Achillea falcata and salograviolide A (Sal A isolated from Centaurea ainetensis, for their anti-tumor properties. We used the mouse epidermal JB6P + cells as a model for tumor promotion and cellular transformation. Key players that are involved in cellular transformation and tumorigenesis are the AP-1 and NF-κB transcription factors; therefore, we assessed how β-tan and Sal A modulate their signaling pathways in JB6P + cells. Methods The effects of β-tan and Sal A on the growth of normal and neoplastic keratinocytes and on the tumor promotion-responsive JB6P + cells were determined using the MTT assay. Anchorage-independent cell growth transformation assays were used to evaluate the anti-tumor promoting properties of these SL molecules in JB6P + cells and dual luciferase reporter assays and western blot analysis were used to investigate their effects on tumor promoter-induced AP-1 and NF-κB activities and protein levels of key AP-1 and NF-кB target genes. Results β-tan and Sal A selectively inhibited tumor promoter-induced cell growth and transformation of JB6P + cells at concentrations that do not affect JB6P + and primary keratinocytes basal cell growth. In addition, both molecules reduced basal and tumor promoter-induced NF-κB transcriptional activities, differentially regulated basal and tumor promoter-induced AP-1 transcriptional activities, and modulated key players of the AP-1 and NF-κB signaling pathways. Conclusions These results highlight the anti-tumor promoting properties of β-tan and Sal A. These SL molecules isolated from two plant species native to

  7. Sesquiterpene lactones isolated from indigenous Middle Eastern plants inhibit tumor promoter-induced transformation of JB6 cells.

    Science.gov (United States)

    Saikali, Melody; Ghantous, Akram; Halawi, Racha; Talhouk, Salma N; Saliba, Najat A; Darwiche, Nadine

    2012-07-09

    Sesquiterpene lactones (SL) are plant secondary metabolites that are known for their anti-fungal, anti-bacterial, anti-inflammatory, and anti-tumor properties. Considering that several SL-derived drugs are currently in cancer clinical trials, we have tested two SL molecules, 3-β-methoxy-iso-seco-tanapartholide (β-tan) isolated from Achillea falcata and salograviolide A (Sal A) isolated from Centaurea ainetensis, for their anti-tumor properties. We used the mouse epidermal JB6P + cells as a model for tumor promotion and cellular transformation. Key players that are involved in cellular transformation and tumorigenesis are the AP-1 and NF-κB transcription factors; therefore, we assessed how β-tan and Sal A modulate their signaling pathways in JB6P + cells. The effects of β-tan and Sal A on the growth of normal and neoplastic keratinocytes and on the tumor promotion-responsive JB6P + cells were determined using the MTT assay. Anchorage-independent cell growth transformation assays were used to evaluate the anti-tumor promoting properties of these SL molecules in JB6P + cells and dual luciferase reporter assays and western blot analysis were used to investigate their effects on tumor promoter-induced AP-1 and NF-κB activities and protein levels of key AP-1 and NF-кB target genes. β-tan and Sal A selectively inhibited tumor promoter-induced cell growth and transformation of JB6P + cells at concentrations that do not affect JB6P + and primary keratinocytes basal cell growth. In addition, both molecules reduced basal and tumor promoter-induced NF-κB transcriptional activities, differentially regulated basal and tumor promoter-induced AP-1 transcriptional activities, and modulated key players of the AP-1 and NF-κB signaling pathways. These results highlight the anti-tumor promoting properties of β-tan and Sal A. These SL molecules isolated from two plant species native to the Middle East may provide opportunities for complementary

  8. Isolation of perchlorate-reducing Azospira suillum strain JB524 from tidal flats of the Yellow Sea

    Directory of Open Access Journals (Sweden)

    Nirmala Bardiya

    2016-11-01

    Full Text Available Objective: To isolate and identify perchlorate-reducing bacterium from an enriched consortium from tidal flats of the Yellow Sea. Methods: A perchlorate-enriched consortium from tidal flats of the Yellow Sea was used to isolate Azospira suillum (A. suillum strain JB524. The strain was identified based on partial 16S rDNA sequencing. Perchlorate reduction by the strain was tested with acetate as the e - donor in the presence of NaCl, nitrate and at different growth temperatures using standard anaerobic techniques. The complete enzymatic destruction of perchlorate was confirmed as evolution of O2 by chlorite dismutase in the absence of acetate. Results: Strain JB524 shared 100% 16S rDNA sequence similarity with the type strain A. suillum PST isolated from a swine waste treatment lagoon. Perchlorate reduction coincided with concomitant increase in cell density. Although, acclimatization of the strain PST at suboptimal temperature for perchlorate reduction is not reported, the newly isolated strain could rapidly reduce perchlorate at 22 °C after brief acclimatization. Conclusions: Reduction of perchlorate by A. suillum strain JB524 was negatively affected in the presence of NaCl, suboptimal temperature, presence of nitrate, and limiting amount of acetate as the e-donor.

  9. Bioremediation of Petrochemical Wastewater Containing BTEX Compounds by a New Immobilized Bacterium Comamonas sp. JB in Magnetic Gellan Gum.

    Science.gov (United States)

    Jiang, Bei; Zhou, Zunchun; Dong, Ying; Wang, Bai; Jiang, Jingwei; Guan, Xiaoyan; Gao, Shan; Yang, Aifu; Chen, Zhong; Sun, Hongjuan

    2015-05-01

    In this study, we investigated the bioremediation of petrochemical wastewater containing BTEX compounds by immobilized Comamonas sp. JB cells. Three kinds of magnetic nanoparticles were evaluated as immobilization supports for strain JB. After comparison with Fe3O4 and a-Fe2O3 nanoparticles, r-Fe2O3 nanoparticle was selected as the optimal immobilization support. The highest biodegradation activity of r-Fe2O3-magnetically immobilized cells was obtained when the concentration of r-Fe2O3 nanoparticle was 120 mg L(-1). Additionally, the recycling experiments demonstrated that the degradation activity of r-Fe2O3-magnetically immobilized cells was still high and led to less toxicity than untreated wastewater during the eight recycles. qPCR suggested the concentration of strain JB in r-Fe2O3-magnetically immobilized cells was evidently increased after eight cycles of degradation experiments. These results supported developing efficient biocatalysts using r-Fe2O3-magnetically immobilized cells and provided a promising technique for improving biocatalysts used in the bioremediation of not only petrochemical wastewater but also other hazardous wastewater.

  10. Mouse Strain Affects Behavioral and Neuroendocrine Stress Responses Following Administration of Probiotic Lactobacillus rhamnosus JB-1 or Traditional Antidepressant Fluoxetine

    Directory of Open Access Journals (Sweden)

    Karen-Anne McVey Neufeld

    2018-05-01

    Full Text Available Currently, there is keen interest in the development of alternative therapies in the treatment of depression. Given the explosion of research focused on the microbiota-gut-brain axis, consideration has turned to the potential of certain probiotics to improve patient outcomes for those suffering from mood disorders. Here we examine the abilities of a known antidepressant, fluoxetine, and the probiotic Lactobacillus rhamnosus JB-1™, to attenuate responses to two established criteria for depressive-like behavior in animal models, the tail suspension test (TST and the corticosterone response to an acute restraint stressor. We examine two different strains of mice known to differ in the extent to which they express both anxiety-like behavior and measures of despair—BALB/c and Swiss Webster—with respectively high and normal behavioral phenotypes for each. While adult male BALB/c mice responded with increased antidepressive-like behavior to both fluoxetine and L. rhamnosus JB-1 in both the TST and the corticosterone stress response, SW mice did not respond to either treatment as compared to controls. These findings highlight the importance of investigating putative antidepressants in mouse strains known to express face validity for some markers of depression. Clinical studies examining the activity of L. rhamnosus JB-1 in patients suffering from mood disorders are warranted, as well as further pre-clinical work examining how interactions between host genotype and intestinal microbial alterations may impact behavioral responses. This study adds to the literature supporting the possibility that modifying the intestinal microbiota via probiotics represents a promising potential therapeutic breakthrough in the treatment of psychiatric disease.

  11. Mouse Strain Affects Behavioral and Neuroendocrine Stress Responses Following Administration of Probiotic Lactobacillus rhamnosus JB-1 or Traditional Antidepressant Fluoxetine.

    Science.gov (United States)

    McVey Neufeld, Karen-Anne; Kay, Sebastian; Bienenstock, John

    2018-01-01

    Currently, there is keen interest in the development of alternative therapies in the treatment of depression. Given the explosion of research focused on the microbiota-gut-brain axis, consideration has turned to the potential of certain probiotics to improve patient outcomes for those suffering from mood disorders. Here we examine the abilities of a known antidepressant, fluoxetine, and the probiotic Lactobacillus rhamnosus JB-1™, to attenuate responses to two established criteria for depressive-like behavior in animal models, the tail suspension test (TST) and the corticosterone response to an acute restraint stressor. We examine two different strains of mice known to differ in the extent to which they express both anxiety-like behavior and measures of despair-BALB/c and Swiss Webster-with respectively high and normal behavioral phenotypes for each. While adult male BALB/c mice responded with increased antidepressive-like behavior to both fluoxetine and L. rhamnosus JB-1 in both the TST and the corticosterone stress response, SW mice did not respond to either treatment as compared to controls. These findings highlight the importance of investigating putative antidepressants in mouse strains known to express face validity for some markers of depression. Clinical studies examining the activity of L. rhamnosus JB-1 in patients suffering from mood disorders are warranted, as well as further pre-clinical work examining how interactions between host genotype and intestinal microbial alterations may impact behavioral responses. This study adds to the literature supporting the possibility that modifying the intestinal microbiota via probiotics represents a promising potential therapeutic breakthrough in the treatment of psychiatric disease.

  12. Comparison of the insulin reaction of peripheral blood T cells between healthy Holstein dairy cows and JB during the periparturient period.

    Science.gov (United States)

    Ohtsuka, Hiromichi; Kitagawa, Madoka; Kohiruimaki, Masayuki; Tanami, Erika; Masui, Machiko; Hayashi, Tomohito; Ando, Takaaki; Watanabe, Daisaku; Koiwa, Masateru; Sato, Shigeru; Kawamura, Seiichi

    2006-11-01

    To compare the changes in the insulin reaction of Holstein dairy cows and Japanese Black cows (JB) during the periparturient period, the insulin resistance test in vivo and lymphocytes proliferation with insulin in vitro were performed. Ten healthy Holstein dairy cows (Holstein group) and 10 healthy JB cows (JB group) used in this study were observed on days 60, 40, and 20 before calving and days 7 and 20 after calving. In insulin resistance reaction in vivo and in vitro, a low insulin-stimulated glucose disposal rate and lymphocyte proliferation with insulin were observed in the Holstein group compared with the JB group during the experimental period. An analysis of the lymphocytes cultured with insulin showed that the percentage of CD4+CD45R- T cells in the Holstein group was significantly lower than that of the JB group before day 20. These findings indicate that T cells reaction to insulin in healthy periparturient Holstein cows is lower than that in Japanese Black.

  13. Human dendritic cell DC-SIGN and TLR-2 mediate complementary immune regulatory activities in response to Lactobacillus rhamnosus JB-1.

    Directory of Open Access Journals (Sweden)

    Patrycja Konieczna

    Full Text Available The microbiota is required for optimal host development and ongoing immune homeostasis. Lactobacilli are common inhabitants of the mammalian large intestine and immunoregulatory effects have been described for certain, but not all, strains. The mechanisms underpinning these protective effects are beginning to be elucidated. One such protective organism is Lactobacillus rhamnosus JB-1 (Lb. rhamnosus JB-1. Lb. murinus has no such anti-inflammatory protective effects and was used as a comparator organism. Human monocyte-derived dendritic cells (MDDCs were co-incubated with bacteria and analysed over time for bacterial adhesion and intracellular processing, costimulatory molecule expression, cytokine secretion and induction of lymphocyte polarization. Neutralising antibodies were utilized to identify the responsible MDDC receptors. Lb. rhamnosus JB-1 adhered to MDDCs, but internalization and intracellular processing was significantly delayed, compared to Lb. murinus which was rapidly internalized and processed. Lb. murinus induced CD80 and CD86 expression, accompanied by high levels of cytokine secretion, while Lb. rhamnosus JB-1 was a poor inducer of costimulatory molecule expression and cytokine secretion. Lb. rhamnosus JB-1 primed MDDCs induced Foxp3 expression in autologous lymphocytes, while Lb. murinus primed MDDCs induced Foxp3, T-bet and Ror-γt expression. DC-SIGN was required for Lb. rhamnosus JB-1 adhesion and influenced IL-12 secretion, while TLR-2 influenced IL-10 and IL-12 secretion. Here we demonstrate that the delayed kinetics of bacterial processing by MDDCs correlates with MDDC activation and stimulation of lymphocytes. Thus, inhibition or delay of intracellular processing may be a novel strategy by which certain commensals may avoid the induction of proinflammatory responses.

  14. Human Dendritic Cell DC-SIGN and TLR-2 Mediate Complementary Immune Regulatory Activities in Response to Lactobacillus rhamnosus JB-1

    Science.gov (United States)

    Konieczna, Patrycja; Schiavi, Elisa; Ziegler, Mario; Groeger, David; Healy, Selena; Grant, Ray; O’Mahony, Liam

    2015-01-01

    The microbiota is required for optimal host development and ongoing immune homeostasis. Lactobacilli are common inhabitants of the mammalian large intestine and immunoregulatory effects have been described for certain, but not all, strains. The mechanisms underpinning these protective effects are beginning to be elucidated. One such protective organism is Lactobacillus rhamnosus JB-1 (Lb. rhamnosus JB-1). Lb. murinus has no such anti-inflammatory protective effects and was used as a comparator organism. Human monocyte-derived dendritic cells (MDDCs) were co-incubated with bacteria and analysed over time for bacterial adhesion and intracellular processing, costimulatory molecule expression, cytokine secretion and induction of lymphocyte polarization. Neutralising antibodies were utilized to identify the responsible MDDC receptors. Lb. rhamnosus JB-1 adhered to MDDCs, but internalization and intracellular processing was significantly delayed, compared to Lb. murinus which was rapidly internalized and processed. Lb. murinus induced CD80 and CD86 expression, accompanied by high levels of cytokine secretion, while Lb. rhamnosus JB-1 was a poor inducer of costimulatory molecule expression and cytokine secretion. Lb. rhamnosus JB-1 primed MDDCs induced Foxp3 expression in autologous lymphocytes, while Lb. murinus primed MDDCs induced Foxp3, T-bet and Ror-γt expression. DC-SIGN was required for Lb. rhamnosus JB-1 adhesion and influenced IL-12 secretion, while TLR-2 influenced IL-10 and IL-12 secretion. Here we demonstrate that the delayed kinetics of bacterial processing by MDDCs correlates with MDDC activation and stimulation of lymphocytes. Thus, inhibition or delay of intracellular processing may be a novel strategy by which certain commensals may avoid the induction of proinflammatory responses. PMID:25816321

  15. Human dendritic cell DC-SIGN and TLR-2 mediate complementary immune regulatory activities in response to Lactobacillus rhamnosus JB-1.

    Science.gov (United States)

    Konieczna, Patrycja; Schiavi, Elisa; Ziegler, Mario; Groeger, David; Healy, Selena; Grant, Ray; O'Mahony, Liam

    2015-01-01

    The microbiota is required for optimal host development and ongoing immune homeostasis. Lactobacilli are common inhabitants of the mammalian large intestine and immunoregulatory effects have been described for certain, but not all, strains. The mechanisms underpinning these protective effects are beginning to be elucidated. One such protective organism is Lactobacillus rhamnosus JB-1 (Lb. rhamnosus JB-1). Lb. murinus has no such anti-inflammatory protective effects and was used as a comparator organism. Human monocyte-derived dendritic cells (MDDCs) were co-incubated with bacteria and analysed over time for bacterial adhesion and intracellular processing, costimulatory molecule expression, cytokine secretion and induction of lymphocyte polarization. Neutralising antibodies were utilized to identify the responsible MDDC receptors. Lb. rhamnosus JB-1 adhered to MDDCs, but internalization and intracellular processing was significantly delayed, compared to Lb. murinus which was rapidly internalized and processed. Lb. murinus induced CD80 and CD86 expression, accompanied by high levels of cytokine secretion, while Lb. rhamnosus JB-1 was a poor inducer of costimulatory molecule expression and cytokine secretion. Lb. rhamnosus JB-1 primed MDDCs induced Foxp3 expression in autologous lymphocytes, while Lb. murinus primed MDDCs induced Foxp3, T-bet and Ror-γt expression. DC-SIGN was required for Lb. rhamnosus JB-1 adhesion and influenced IL-12 secretion, while TLR-2 influenced IL-10 and IL-12 secretion. Here we demonstrate that the delayed kinetics of bacterial processing by MDDCs correlates with MDDC activation and stimulation of lymphocytes. Thus, inhibition or delay of intracellular processing may be a novel strategy by which certain commensals may avoid the induction of proinflammatory responses.

  16. SN 2008jb: A 'LOST' CORE-COLLAPSE SUPERNOVA IN A STAR-FORMING DWARF GALAXY AT ∼10 Mpc

    International Nuclear Information System (INIS)

    Prieto, J. L.; Lee, J. C.; Drake, A. J.; Djorgovski, S. G.; McNaught, R.; Garradd, G.; Beacom, J. F.; Beshore, E.; Catelan, M.; Pojmanski, G.; Stanek, K. Z.; Szczygieł, D. M.

    2012-01-01

    We present the discovery and follow-up observations of SN 2008jb, a core-collapse supernova in the southern dwarf irregular galaxy ESO 302–14 (M B = –15.3 mag) at 9.6 Mpc. This nearby transient was missed by galaxy-targeted surveys and was only found in archival optical images obtained by the Catalina Real-time Transient Survey and the All-Sky Automated Survey. The well-sampled archival photometry shows that SN 2008jb was detected shortly after explosion and reached a bright optical maximum, V max ≅ 13.6 mag (M V,max ≅ –16.5). The shape of the light curve shows a plateau of ∼100 days, followed by a drop of ∼1.4 mag in the V band to a slow decline with an approximate 56 Co decay slope. The late-time light curve is consistent with 0.04 ± 0.01 M ☉ of 56 Ni synthesized in the explosion. A spectrum of the supernova obtained two years after explosion shows a broad, boxy Hα emission line, which is unusual for normal Type II-Plateau supernovae at late times. We detect the supernova in archival Spitzer and WISE images obtained 8-14 months after explosion, which show clear signs of warm (600-700 K) dust emission. The dwarf irregular host galaxy, ESO 302–14, has a low gas-phase oxygen abundance, 12 + log(O/H) = 8.2 (∼1/5 Z ☉ ), similar to those of the Small Magellanic Cloud and the hosts of long gamma-ray bursts and luminous core-collapse supernovae. This metallicity is one of the lowest among local (∼ 5 M ☉ for the star formation complex, assuming a single-age starburst. These properties are consistent with the expanding Hα supershells observed in many well-studied nearby dwarf galaxies, which are tell-tale signs of feedback from the cumulative effect of massive star winds and supernovae. The age estimated for the star-forming region where SN 2008jb exploded suggests a relatively high-mass progenitor star with an initial mass M ∼ 20 M ☉ and warrants further study. We discuss the implications of these findings in the study of core

  17. Performance of an alkalophilic and halotolerant laccase from gamma-proteobacterium JB in the presence of industrial pollutants.

    Science.gov (United States)

    Singh, Gursharan; Sharma, Prince; Capalash, Neena

    2009-08-01

    An alkalophilic and halotolerant laccase from gamma-proteobacterium JB catalyzed in high concentrations of organic solvents and various salts. The enzyme retained 80-100% activity in 10% concentration of dimethylsulfoxide (DMSO), ethanol, acetone or methanol; 100, 85 and 50% activity in 20 mM MgCl(2), 5.0 mM MnCl(2) and 0.1 mM CuCl(2); 140, 120 and 110% activity in 5.0 mM MnSO(4), 10 mM MgSO(4) and 1mM CaSO(4), respectively. Sodium halides inhibited the enzyme in the order: F(-)> Br(-)> I(-)> Cl(-). In 0.5 M NaCl, pH 6.0, laccase was approximately 60% active. Decolorization of indigo carmine by laccase at pH 9.0 was not inhibited even in the presence of 0.5 M NaCl. Release of chromophoric, reducing and hydrophobic compounds during biobleaching of straw rich-soda pulp by laccase was not inhibited when the enzyme was applied in the presence of 1 M NaCl at pH 8.0. Laccase retained 50% residual activity even when incubated with 5% calcium hypochlorite for 30 min.

  18. c-Jun/AP-1 pathway-mediated cyclin D1 expression participates in low dose arsenite-induced transformation in mouse epidermal JB6 Cl41 cells

    International Nuclear Information System (INIS)

    Zhang Dongyun; Li Jingxia; Gao Jimin; Huang Chuanshu

    2009-01-01

    Arsenic is a well-documented human carcinogen associated with skin carcinogenesis. Our previous work reveals that arsenite exposure is able to induce cell transformation in mouse epidermal cell JB6 Cl41 through the activation of ERK, rather than JNK pathway. Our current studies further evaluate downstream pathway in low dose arsenite-induced cell transformation in JB6 Cl41 cells. Our results showed that treatment of cells with low dose arsenite induced activation of c-Jun/AP-1 pathway, and ectopic expression of dominant negative mutant of c-Jun (TAM67) blocked arsenite-induced transformation. Furthermore, our data indicated that cyclin D1 was an important downstream molecule involved in c-Jun/AP-1-mediated cell transformation upon low dose arsenite exposure, because inhibition of cyclin D1 expression by its specific siRNA in the JB6 Cl41 cells resulted in impairment of anchorage-independent growth of cells induced by low dose arsenite. Collectively, our results demonstrate that c-Jun/AP-1-mediated cyclin D1 expression is at least one of the key events implicated in cell transformation upon low dose arsenite exposure

  19. AR42J-B-13 cell: An expandable progenitor to generate an unlimited supply of functional hepatocytes

    International Nuclear Information System (INIS)

    Wallace, Karen; Fairhall, Emma A.; Charlton, Keith A.; Wright, Matthew C.

    2010-01-01

    Hepatocytes are the preparation of choice for Toxicological research in vitro. However, despite the fact that hepatocytes proliferate in vivo during liver regeneration, they are resistant to proliferation in vitro, do not tolerate sub-culture and tend to enter a de-differentiation program that results in a loss of hepatic function. These limitations have resulted in the search for expandable rodent and human cells capable of being directed to differentiate into functional hepatocytes. Research with stem cells suggests that it may be possible to provide the research community with hepatocytes in vitro although to date, significant challenges remain, notably generating a sufficiently pure population of hepatocytes with a quantitative functionality comparable with hepatocytes. This paper reviews work with the AR42J-B-13 (B-13) cell line. The B-13 cell was cloned from the rodent AR42J pancreatic cell line, express genes associated with pancreatic acinar cells and readily proliferates in simple culture media. When exposed to glucocorticoid, 75-85% of the cells trans-differentiate into hepatocyte-like (B-13/H) cells functioning at a level quantitatively similar to freshly isolated rat hepatocytes (with the remaining cells retaining the B-13 phenotype). Trans-differentiation of pancreatic acinar cells also appears to occur in vivo in rats treated with glucocorticoid; in mice with elevated circulating glucocorticoid and in humans treated for long periods with glucocorticoid. The B-13 response to glucocorticoid therefore appears to be related to a real pathophysiological response of a pancreatic cell to glucocorticoid. An understanding of how this process occurs and if it can be generated or engineered in human cells would result in a cell line with the ability to generate an unlimited supply of functional human hepatocytes in a cost effective manner.

  20. Metallic nickel nano- and fine particles induce JB6 cell apoptosis through a caspase-8/AIF mediated cytochrome c-independent pathway

    Directory of Open Access Journals (Sweden)

    Castranova Vincent

    2009-04-01

    Full Text Available Abstract Background Carcinogenicity of nickel compounds has been well documented. However, the carcinogenic effect of metallic nickel is still unclear. The present study investigates metallic nickel nano- and fine particle-induced apoptosis and the signal pathways involved in this process in JB6 cells. The data obtained from this study will be of benefit for elucidating the pathological and carcinogenic potential of metallic nickel particles. Results Using 3-(4,5-dimethylthiazol-2-yl-2,5-diphenyltetrazolium bromide (MTT assay, we found that metallic nickel nanoparticles exhibited higher cytotoxicity than fine particles. Both metallic nickel nano- and fine particles induced JB6 cell apoptosis. Metallic nickel nanoparticles produced higher apoptotic induction than fine particles. Western-blot analysis showed an activation of proapoptotic factors including Fas (CD95, Fas-associated protein with death domain (FADD, caspase-8, death receptor 3 (DR3 and BID in apoptotic cells induced by metallic nickel particles. Immunoprecipitation (IP western blot analysis demonstrated the formation of the Fas-related death-inducing signaling complex (DISC in the apoptotic process. Furthermore, lamin A and beta-actin were cleaved. Moreover, we found that apoptosis-inducing factor (AIF was up-regulated and released from mitochondria to cytoplasm. Interestingly, although an up-regulation of cytochrome c was detected in the mitochondria of metallic nickel particle-treated cells, no cytochrome c release from mitochondria to cytoplasm was found. In addition, activation of antiapoptotic factors including phospho-Akt (protein kinase B and Bcl-2 was detected. Further studies demonstrated that metallic nickel particles caused no significant changes in the mitochondrial membrane permeability after 24 h treatment. Conclusion In this study, metallic nickel nanoparticles caused higher cytotoxicity and apoptotic induction than fine particles in JB6 cells. Apoptotic cell death

  1. A highly thermostable alkaline cellulase-free xylanase from thermoalkalophilic Bacillus sp. JB 99 suitable for paper and pulp industry: purification and characterization.

    Science.gov (United States)

    Shrinivas, Dengeti; Savitha, Gunashekaran; Raviranjan, Kumar; Naik, Gajanan Ramchandra

    2010-11-01

    A highly thermostable alkaline xylanase was purified to homogeneity from culture supernatant of Bacillus sp. JB 99 using DEAE-Sepharose and Sephadex G-100 gel filtration with 25.7-fold increase in activity and 43.5% recovery. The molecular weight of the purified xylanase was found to be 20 kDA by SDS-PAGE and zymogram analysis. The enzyme was optimally active at 70 °C, pH 8.0 and stable over pH range of 6.0-10.0.The relative activity at 9.0 and 10.0 were 90% and 85% of that of pH 8.0, respectively. The enzyme showed high thermal stability at 60 °C with 95% of its activity after 5 h. The K (m) and V (max) of enzyme for oat spelt xylan were 4.8 mg/ml and 218.6 µM min(-1) mg(-1), respectively. Analysis of N-terminal amino acid sequence revealed that the xylanase belongs to glycosyl hydrolase family 11 from thermoalkalophilic Bacillus sp. with basic pI. Substrate specificity showed a high activity on xylan-containing substrate and cellulase-free nature. The hydrolyzed product pattern of oat spelt xylan on thin-layer chromatography suggested xylanase as an endoxylanase. Due to these properties, xylanase from Bacillus sp. JB 99 was found to be highly compatible for paper and pulp industry.

  2. Bringing research to farmers' fields in Malawi: Lizzie Shumba ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2010-12-09

    Dec 9, 2010 ... By intercropping protein-rich legumes like pigeon pea, soybeans, and groundnuts that ... Legumes are now part of the diet in the area. ... Canadian researchers helped us understand why we had high rates of malnutrition and ...

  3. Pigeon pea waste as a novel, inexpensive, substrate for production of a thermostable alkaline protease from thermoalkalophilic Bacillus sp. JB-99.

    Science.gov (United States)

    Johnvesly, B; Manjunath, B R; Naik, G R

    2002-03-01

    Thermoalkaliphilic Bacillus sp. JB-99 was grown in a 250 ml Erlenmeyer flask containing 50 ml medium containing (g/l) Pigeon pea waste 10; NaNO3, 5.0; K2HPO4, 5.0; MgSO4 x 2H2O, 0.2 and Na2CO3, 10.0. Incubations were carried out at 50 degrees C on a rotary incubator shaker for 15 h. A high level of extra cellular thermostable protease activity was observed after 24 h incubation. The optimum temperature and pH for activity were 70 degrees C and 11, respectively, so this enzyme showed stable activity at high temperature and under alkaline conditions.

  4. Biobleaching of wheat straw-rich soda pulp with alkalophilic laccase from gamma-proteobacterium JB: optimization of process parameters using response surface methodology.

    Science.gov (United States)

    Singh, Gursharan; Ahuja, Naveen; Batish, Mona; Capalash, Neena; Sharma, Prince

    2008-11-01

    An alkalophilic laccase from gamma-proteobacterium JB was applied to wheat straw-rich soda pulp to check its bleaching potential by using response surface methodology based on central composite design. The design was employed by selecting laccase units, ABTS (2,2'-azino-bis (3-ethylbenzothiazoline-6-sulfonic acid)) concentration and pH as model factors. The results of second order factorial design experiments showed that all three independent variables had significant effect on brightness and kappa number of laccase-treated pulp. Optimum conditions for biobleaching of pulp with laccase preparation (specific activity, 65 nkat mg(-1) protein) were 20 nkat g(-1) of pulp, 2mM ABTS and pH 8.0 which enhanced brightness by 5.89% and reduced kappa number by 21.1% within 4h of incubation at 55 degrees C, without further alkaline extraction of pulp. Tear index (8%) and burst index (18%) also improved for laccase-treated pulp as compared to control raw pulp. Treatment of chemically (CEH1H2) bleached pulp with laccase showed significant effect on release of chromophores, hydrophobic and reducing compounds. Laccase-prebleaching of raw pulp reduced the use of hypochlorite by 10% to achieve brightness of resultant hand sheets similar to the fully chemically bleached pulp.

  5. Enhanced production of alkaline thermostable keratinolytic protease from calcium alginate immobilized cells of thermoalkalophilic Bacillus halodurans JB 99 exhibiting dehairing activity.

    Science.gov (United States)

    Shrinivas, Dengeti; Kumar, Raghwendra; Naik, G R

    2012-01-01

    The thermoalkalophilic Bacillus halodurans JB 99 cells known for production of novel thermostable alkaline keratinolytic protease were immobilized in calcium alginate matrix. Batch and repeated batch cultivation using calcium alginate immobilized cells were studied for alkaline protease production in submerged fermentation. Immobilized cells with 2.5% alginate and 350 beads/flask of initial cell loading showed enhanced production of alkaline protease by 23.2% (5,275 ± 39.4 U/ml) as compared to free cells (4,280 ± 35.4 U/ml) after 24 h. In the semicontinuous mode of cultivation, immobilized cells under optimized conditions produced an appreciable level of alkaline protease in up to nine cycles and reached a maximal value of 5,975 U/ml after the seventh cycle. The enzyme produced from immobilized cells efficiently degraded chicken feathers in the presence of a reducing agent which can help the poultry industry in the management of keratin-rich waste and obtaining value-added products.

  6. Jõuluaja võimsaim kontsert / Kersti Inno

    Index Scriptorium Estoniae

    Inno, Kersti, 1954-

    2008-01-01

    Eesti Filharmoonia Kammerkoor esitab Georg Friedrich Händeli teose "Iisrael Egiptuses" 19. dets. Estonia kontserdisaalis, 20. dets. Jõhvi kontserdimajas ja 21. dets. Pärnu kontserdimajas (dirigent Daniel Reuss)

  7. Uudised : Loits. Kontsert. Moodne ooper. DVD

    Index Scriptorium Estoniae

    2005-01-01

    Briti ekstreem-metal-ajakiri Terrorizer arvustas oma jaanuarinumbris Eesti bändi Loits albumit "Vere kutse kohustab". Eksperimentaalse house-muusika produtsent ja DJ, pianist ja helilooja Matthew Herbert ja bigbänd annab kontserdi Tallinnas ürituse "Jazz'n Motion" raames. 30. jaan. esietendub Antverpeni Flandria Ooperis itaalia helilooja Giorgio Battistelli kahevaatuseline moodne ooper "Richard III" (lavastaja Robert Carsen). 31. jaan. ilmub poplaulja Marc Almondi uus DVD "Sin Songs, Torch and Romance Live from the Almeida"

  8. Hullumisstseenid ja kontsert-roim ooperis

    Index Scriptorium Estoniae

    2008-01-01

    Installatsioon-ooperi "Hullumisstseene kvaliteetooperitest" esietendusest 6. juulil Pärnu vanalinna põhikooli õuel ja kontserdist Toots & Friends esituses 7. ja 21. juulil Pärnu mudaravilas ja (vt.www.ooper.parnu.ee)

  9. Eesti Filharmoonia Kammerkoori kontsert / Raul Pettai

    Index Scriptorium Estoniae

    Pettai, Raul, 1928-

    2006-01-01

    19. märtsil St. Ignatius Loyola kirikus New Yorgis, kaastegev inglise organist ja helilooja Christopher Bowers-Broadbent, dirigent Paul Hillier. Esitati Arvo Pärdi, Cyrillus Kreegi ja Sergei Rahmaninovi kooriloomingut

  10. Production and Its Anti-hyperglycemic Effects of γ-Aminobutyric Acid from the Wild Yeast Strain Pichia silvicola UL6-1 and Sporobolomyces carnicolor 402-JB-1.

    Science.gov (United States)

    Han, Sang-Min; Lee, Jong-Soo

    2017-09-01

    This study was done to produce γ-aminobutyric acid (GABA) from wild yeast as well as investigate its anti-hyperglycemic effects. Among ten GABA-producing yeast strains, Pichia silvicola UL6-1 and Sporobolomyces carnicolor 402-JB-1 produced high GABA concentration of 134.4 µg/mL and 179.2 µg/mL, respectively. P. silvicola UL6-1 showed a maximum GABA yield of 136.5 µg/mL and 200.8 µg/mL from S. carnicolor 402-JB-1 when they were cultured for 30 hr at 30℃ in yeast extract-peptone-dextrose medium. The cell-free extract from P. silvicola UL6-1 and S. carnicolor 402-JB-1 showed very high anti-hyperglycemic α-glucosidase inhibitory activity of 72.3% and 69.9%, respectively. Additionally, their cell-free extract-containing GABA showed the anti-hyperglycemic effect in streptozotocin-induced diabetic Sprague-Dawley rats.

  11. Cr(VI) induces mitochondrial-mediated and caspase-dependent apoptosis through reactive oxygen species-mediated p53 activation in JB6 Cl41 cells

    International Nuclear Information System (INIS)

    Son, Young-Ok; Hitron, J. Andrew; Wang Xin; Chang Qingshan; Pan Jingju; Zhang Zhuo; Liu Jiankang; Wang Shuxia; Lee, Jeong-Chae; Shi Xianglin

    2010-01-01

    Cr(VI) compounds are known to cause serious toxic and carcinogenic effects. Cr(VI) exposure can lead to a severe damage to the skin, but the mechanisms involved in the Cr(VI)-mediated toxicity in the skin are unclear. The present study examined whether Cr(VI) induces cell death by apoptosis or necrosis using mouse skin epidermal cell line, JB6 Cl41 cells. We also investigated the cellular mechanisms of Cr(VI)-induced cell death. This study showed that Cr(VI) induced apoptotic cell death in a dose-dependent manner, as demonstrated by the appearance of cell shrinkage, the migration of cells into the sub-G1 phase, the increase of Annexin V positively stained cells, and the formation of nuclear DNA ladders. Cr(VI) treatment resulted in the increases of mitochondrial membrane depolarization and caspases activation. Electron spin resonance (ESR) and fluorescence analysis revealed that Cr(VI) increased intracellular levels of reactive oxygen species (ROS) such as hydrogen peroxide and superoxide anion radical in dose-dependent manner. Blockage of p53 by si-RNA transfection suppressed mitochondrial changes of Bcl-2 family composition, mitochondrial membrane depolarization, caspase activation and PARP cleavage, leading to the inhibition of Cr(VI)-induced apoptosis. Further, catalase treatment prevented p53 phosphorylation stimulated by Cr(VI) with the concomitant inhibition of caspase activation. These results suggest that Cr(VI) induced a mitochondrial-mediated and caspase-dependent apoptosis in skin epidermal cells through activation of p53, which are mainly mediated by reactive oxidants generated by the chemical.

  12. Lost in translation? The potential psychobiotic Lactobacillus rhamnosus (JB-1) fails to modulate stress or cognitive performance in healthy male subjects.

    Science.gov (United States)

    Kelly, John R; Allen, Andrew P; Temko, Andriy; Hutch, William; Kennedy, Paul J; Farid, Niloufar; Murphy, Eileen; Boylan, Geraldine; Bienenstock, John; Cryan, John F; Clarke, Gerard; Dinan, Timothy G

    2017-03-01

    Preclinical studies have identified certain probiotics as psychobiotics - live microorganisms with a potential mental health benefit. Lactobacillus rhamnosus (JB-1) has been shown to reduce stress-related behaviour, corticosterone release and alter central expression of GABA receptors in an anxious mouse strain. However, it is unclear if this single putative psychobiotic strain has psychotropic activity in humans. Consequently, we aimed to examine if these promising preclinical findings could be translated to healthy human volunteers. To determine the impact of L. rhamnosus on stress-related behaviours, physiology, inflammatory response, cognitive performance and brain activity patterns in healthy male participants. An 8week, randomized, placebo-controlled, cross-over design was employed. Twenty-nine healthy male volunteers participated. Participants completed self-report stress measures, cognitive assessments and resting electroencephalography (EEG). Plasma IL10, IL1β, IL6, IL8 and TNFα levels and whole blood Toll-like 4 (TLR-4) agonist-induced cytokine release were determined by multiplex ELISA. Salivary cortisol was determined by ELISA and subjective stress measures were assessed before, during and after a socially evaluated cold pressor test (SECPT). There was no overall effect of probiotic treatment on measures of mood, anxiety, stress or sleep quality and no significant effect of probiotic over placebo on subjective stress measures, or the HPA response to the SECPT. Visuospatial memory performance, attention switching, rapid visual information processing, emotion recognition and associated EEG measures did not show improvement over placebo. No significant anti-inflammatory effects were seen as assessed by basal and stimulated cytokine levels. L. rhamnosus was not superior to placebo in modifying stress-related measures, HPA response, inflammation or cognitive performance in healthy male participants. These findings highlight the challenges associated with

  13. JB_518_ESM.doc

    Indian Academy of Sciences (India)

    Jian Zeng and Shunv Cai. J. Biosci. 42(1), March 2017 © Indian Academy of Sciences. Supplementary material. Supplementary figure 1. Overexpression of miR-7 enhanced A549 cell apoptosis in response to BVP (100 µM). A TUNEL assay was performed according to the manufacturer's instructions (Promega Corporation, ...

  14. JB_224_ESM.docx

    Indian Academy of Sciences (India)

    121

    (A) Subcellular localization of CFP-AtMBD6 along with YFP protein was performed in onion epidermal cells. YFP was present in both cytoplasm and nucleus. It did not show a pattern of localization in the nucleus, which was similar to that of the interacting partners. The energy transfer between CFP-AtMBD6 and YFP was ...

  15. JB_378_ESM.docx

    Indian Academy of Sciences (India)

    Sushila

    Paraffin sections hybridized with antisense probe are shown. Purple staining indicates a positive reaction only in the corpus luteum but not in the corpus (B) and cauda (C). Supplementary figure 2. Determining specificity of amplicons of Ovgp1 (A) and Gapdh (B) by melt curve analysis. Melt peak for Ovgp1 PCR fragment is ...

  16. Lizzie Shumba, Malawi Intégrer la recherche au travail des ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    9 déc. 2010 ... Des chercheurs du Malawi et du Canada — spécialistes de l'agriculture, de la nutrition et des sciences sociales —ont collaboré avec le personnel de l'hôpital et des agriculteurs pour trouver les légumineuses les plus adéquates. Ce projet, que le CRDI appuie depuis 2001, a amélioré la nutrition, des ...

  17. JB_054_Supplementary_Tables.docx

    Indian Academy of Sciences (India)

    LENOVO

    TRI 10032, T. aestivum L. var. aestivum, Mexico, Spring, Q4 ... TRI 10311, T. aestivum L. var. aestivum, Japan, Spring, Q2 ..... precursor (sucrose export defective 1), dihydrolipoamide dehydrogenase precursor, disulfide-isomerase precursor.

  18. JB_054_Supplementary_Tables.docx

    Indian Academy of Sciences (India)

    LENOVO

    TRI 3569, T. aestivum L. var. lutescens, Uruguay, Spring, Q4 ..... putative resistance complex protein, putative disease resistance protein, cold shock protein, barley stem rust resistance protein, seven transmembrane protein, cytochrome P450, glutamate dehydrogenase, pyruvate decarboxylase, peroxidase and chaperonin.

  19. Kontserdikaja : David Oistrahhi Festival. Öökontsert / Toomas Velmet

    Index Scriptorium Estoniae

    Velmet, Toomas, 1942-

    2004-01-01

    "Europa Festiva" festivalisarja esimesel kontserdil Pärnu Eliisabeti kirikus 29. juunil esinesid rootsi flötist Anders Jonhäll, tšellist Allar Kaasik ja soome organist Markku Mäkinen. Maailmaesiettekandele tulid Erkki-Sven Tüüri "Spectrum IV" (tšellole ja orelile) ning rootsi helilooja Anders Nilssoni "Lamento - in memoriam m/s Estonia" (flöödile, tšellole ja orelile)

  20. Siim Nestor soovitab : Elektroakustiline kontsert. Supreme Võrus / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2002-01-01

    21. juunil Tallinnas Kalinini tehases installatsiooninäituse Four Songs For Siivi raames toimuvast elektroakustilisest eksperiment-kontserdist, kus peaosas prantslane Mathieu Werchowski. Diskost Võru rannabaaris 21. juunil

  1. "Jõulujazzi" kõige "jazzim" kontsert / Joosep Sang

    Index Scriptorium Estoniae

    Sang, Joosep

    2011-01-01

    29. novembrist kuni 17. detsembrini toimunud festivali kontsertidest, pikemalt 11. detsembril Vene Kultuurikeskuses kontserdist, kus esinesid trummar Francis Lassus, saksofonist Philippe Sellam ja bassist Linley Marthe

  2. Uudised : Neoandertals müristas Euroopas. Kontsert paavstile

    Index Scriptorium Estoniae

    2007-01-01

    Lõuna-Eestist pärit ülibrutaalse death metal'i duo Neoandertals rändas 5.-14. okt. koos läti death metal'i bändiga Flaying Kesk-Euroopas, esinedes ja tutvustades oma albumit "Neanderthals Were Master Butchers"underground-klubides Austrias, Tšehhis, Poolas ja Slovakkias. Baieri Ringhäälingu Sümfooniaorkester lätlasest peadirigendi Mariss Jansonsi juhtimisel sai Baierist pärit paavsti Benedictus XVI kutse esineda 27. okt. Vatikanis, kontserdil esitatakse L. van Beethoveni 9. sümfoonia

  3. Kontsertide sari "Saue kontsertsügis" / Kristiina Liivik

    Index Scriptorium Estoniae

    Liivik, Kristiina

    2006-01-01

    Kontsertidel Sauel esinemas: vene laulja Aleksander Dedik kontserdiga "Minu südame laul" 7. sept., saksa tšellist Holger-Faust Peters 15. sept., järgnevatel kuudel Aleksandra Juozapenaite-Eesmaa, laulja Toomas Kuter ja ansambel Hinkus

  4. Kontsert : Suve tervitama Sõru Jazzile. Mehed Naissaarel. 19.09

    Index Scriptorium Estoniae

    2008-01-01

    20.-21. juunil Hiiumaal Sõru sadamas toimuvast festivalist "Sõru Jazz 2008" (korraldajad näitleja Guido Kangur ja Teatripuhvet, vt. www.puhvet.ee). Kontsertidest pealkirjaga "Mehed Naissaarel" Omari küünis Naissaarel 21. juunil (esinevad Riho Sibul ja Tõnis Mägi), 26. juunil (Tommyboy) ja 28. juunil (Jaan Tätte). Tuuri "Cosmos Rocks" raames 19. sept. Riias toimuvast briti rockansambli Queen ja Paul Rodgersi kontserdist

  5. Kontsert : Hardi Volmer hakkab loitsima. Kuus stiilset kontsertetendust

    Index Scriptorium Estoniae

    2008-01-01

    Kontserdist "Tõrva loits" 16. aug. Tõrvas. 15.-24. augustini annab kontserdisarjas "Eesti mõisad 2008" kuus kontsertetendust barokkmuusika ansambel Corelli Consort (vt. www.corelli.ee), kontsertetenduste kostüümid on loonud Ivo Nikkolo brändi naisteriiete peadisainer Eve Hanson

  6. Lizzy Kinsey and the Adult Friendfinders: an ethnographic study of Internet sex and pornographic self-display in Hong Kong.

    Science.gov (United States)

    Jacobs, Katrien

    2010-08-01

    This paper investigates web users, their sexual behaviours and self-representations as observed on a sex and dating site. The website concerned is a massive social network for sexual self-display and encourages members to find real-life partners for sex--whether this be casual sex affairs between singles, swinging couples or extra-marital affairs between 'aba' (attached but available) individuals and their lovers. The paper analyses the imaging strategies of Chinese and non-Chinese web users in reference to the playful adoption of commonplace notions of sexiness as 'cybertypes'. The aim is to reflect on these online behaviours as changing sexual culture while also debating the use of libidinal online personalities as a cognitive apparatus within sex research. The paper thus explores sexual identity within social networks as auto-ethnography and the dual identities and boundary-crossing agencies of web-based researchers and their subjects.

  7. JB 536.pdf | forthcoming | jbsc | Volumes | public | Indian Academy of ...

    Indian Academy of Sciences (India)

    error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 28th Mid Year Meeting. Posted on 26 May 2017. [30 June – 1 July 2017 at Faculty Hall, Indian Institute of Science]. 83rd Annual Meeting. Posted on ...

  8. JB 204.pdf | forthcoming | jbsc | Volumes | public | Indian Academy of ...

    Indian Academy of Sciences (India)

    error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held from 29–30 June 2018 in Infosys, Mysuru ...

  9. JB 92.pdf | forthcoming | jbsc | Volumes | public | Indian Academy of ...

    Indian Academy of Sciences (India)

    error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held from 29–30 June 2018 in Infosys, Mysuru ...

  10. JB 742.pdf | forthcoming | jbsc | Volumes | public | Indian Academy of ...

    Indian Academy of Sciences (India)

    error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held from 29–30 June 2018 in Infosys, Mysuru ...

  11. J.B. McLachlan: a biography

    Energy Technology Data Exchange (ETDEWEB)

    Frank, D.

    1999-07-01

    This social history and biography of James Bryson McLaughlin (1869-1916) describes McLaughlin's leadership as an educator and instigator in organizing Nova Scotia's coal miners during the labour wars in the 1920s. McLaughlin's background and childhood, education, reputation, religion, family life, health, and death are described. Included are descriptions of the life of coal miners in Cape Breton, radical left politics in Canada and the organizers involved, the political economy of the coal industry, child labour, churches, coal markets and prices, company towns and housing, mining disasters and fatalities, elections, First World War efforts, the depression, immigrants, and strikes. The labour organizations, companies, churches, and politicians involved in the struggles for union acceptance are discussed. 872 refs., 7 figs., 24 photos.

  12. JB 480.pdf | forthcoming | jbsc | Volumes | public | Indian Academy of ...

    Indian Academy of Sciences (India)

    Ethical Guidelines and Procedures document. Posted on 17 January 2017. A revised version of the document 'Scientific Values: Ethical Guidelines and Procedures' has been produced by the Academy's Panel on Scientific Values. For more details, see the Academy Committee on Scientific Values page.

  13. JB 660.pdf | forthcoming | jbsc | Volumes | public | Indian Academy of ...

    Indian Academy of Sciences (India)

    Ethical Guidelines and Procedures document. Posted on 17 January 2017. A revised version of the document 'Scientific Values: Ethical Guidelines and Procedures' has been produced by the Academy's Panel on Scientific Values. For more details, see the Academy Committee on Scientific Values page.

  14. JB 230.pdf | forthcoming | jbsc | Volumes | public | Indian Academy of ...

    Indian Academy of Sciences (India)

    error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held from 29–30 June 2018 in Infosys, Mysuru ...

  15. Kontsert : "Legends of Rock". Eesti tippsolistide paraad. Kodune hiphop Paunkülas

    Index Scriptorium Estoniae

    2007-01-01

    Suurkontserdist 2. dets. Tallinnas Saku Suurhallis (esinevad Alice Cooper ja ansambel Foreigner). Tallinna kammermuusika festivalist 2007 Tallinna vanalinnas 20.-25. augustini. Eesti Hip-Hop Festivalist (EHHF) 17.-19. aug. Paunküla puhkekeskuses Kõue vallas Harjumaal

  16. Uudised : Estonia maja renoveerimisest. EMNi juhatuse tegevusest. Meredith Monki kontsert Tallinnas

    Index Scriptorium Estoniae

    2001-01-01

    7. märtsil kiitis rahvusooperi Estonia nõukogu heaks Estonia teatri- ja kontserdimaja renoveerimistööde tehnilise projekti. EMNi juhatuse koosolekul 27. veebr. arutati E. Teatri- ja Muusikamuuseumi perspektiive, muusikahariduse probleeme ja EMNi töösuundi. 20. märtsil esineb Tallinnas Sakala keskuses M. Monk

  17. Muusikamaailm : Klaverifestival Luzernis. Rahvusvahelistel konkurssidel. Ooperiharuldus Huddersfieldi festivalil. Strausside kontsert ka Helsingisse / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    Klaverifestivalist Luzernis. Weimaris toimunud Liszti nim. pianistide konkursi võitjatest, Hannoveris toimunud Joseph Joachimi viiuldajate konkursi võitjatest. Huddersfieldi festivalil etendus C. Vivier' ooper "Kopernikus". Helsingi Messikeskuse Amfisaalis hakatakse korraldama pidulikke uusaastakontserte sarnaselt Viinile, kontserdist 1. jaan. 2001//Labeque, Katia ja Marielle - kanada klaveriduo//Jacques Loussier trio - dzhässtrio//Sibeliuse Akadeemia Sümfooniaorkester

  18. Uudised : Kõlas eesti koorilooming. Barokk-kontsert EMAs. Interpretatsioonipedagoogika konverents. 33. Balti muusikateaduse konverents / Reet Varblane

    Index Scriptorium Estoniae

    Varblane, Reet, 1952-

    1999-01-01

    18. nov. esitas inglise koor Bristolis kava eesti muusikast. 21. nov. toimuvast barokkmuusikakontserdist EMAs. 12.-13. nov. EMAs toimunud teaduslik-metoodilisest konverentsist "Interpretatsioonipedagoogika probleemid I". 26.-28. nov. toimuva 33. Balti muusikateaduse konverentsi kavast

  19. Tasuta kontsert - tänuväärne mõte / Ott Kask

    Index Scriptorium Estoniae

    Kask, Ott

    2009-01-01

    12. novembril Tallinna Metodisti kirikus toimunud kontserdist "Virtuoosid Vahemere äärest", kus esinesid Tallinna Filharmoonikud Andres Mustoneni dirigeerimisel, solistideks Massimo Mercelli (flööt) ja Darko Brlek (klarnet)

  20. Kontsert põhiseaduse auks. Riccardo ja Pupo varsti Eestis. Laulud Püha Katarina kirikule. Saadikud Itaaliast

    Index Scriptorium Estoniae

    2007-01-01

    Vabaõhukontserdist Eesti Vabariigi põhiseaduse 15. aastapäeva tähistamise auks 7. sept. Tartus Toomemäe pargis. Itaalia estraadilauljate Riccardo Fogli ja Pupo kontserdist 20. sept. Tallinna Linnahallis. Heategevuskontserdist 13. sept. Tallinnas Püha Katariina kirikus. Sümfooniaorkestri Europa Galante kontserdist 13. sept. Estonia kontserdisaalis

  1. Uudised : Vanemuise Sümfoonikute kontsert. Kaks õhtut TMMis. Esimene puhkpilli- ja bigbändiõhtu / Jaanika Juhanson

    Index Scriptorium Estoniae

    Juhanson, Jaanika, 1977-

    2000-01-01

    Eelinfo 11. märtsil toimuva Vanemuise Sümfoonikute kontserdi kohta Vanemuise kontserdimajas. M. Korjuse vitriini avamisest 23. veebr. Teatri- ja Muusikamuuseumis, D. Kokkeri mälestusõhtust 29. veebr. TMMi Assauwe tornis. 4. märtsil EMA saalis toimunud puhkpilliorkestri ja bigbändi kontserdist

  2. GENGTC-JB: a computer program to calculate temperature distribution for cylindrical geometry capsule

    International Nuclear Information System (INIS)

    Someya, Hiroyuki; Kobayashi, Toshiki; Niimi, Motoji; Hoshiya, Taiji; Harayama, Yasuo

    1987-09-01

    In design of JMTR irradiation capsules contained specimens, a program (named GENGTC) has been generally used to evaluate temperature distributions in the capsules. The program was originally compiled by ORNL(U.S.A.) and consisted of very simple calculation methods. From the incorporated calculation methods, the program is easy to use, and has many applications to the capsule design. However, it was considered to replace original computing methods with advanced ones, when the program was checked from a standpoint of the recent computer abilities, and also to be complicated in data input. Therefore, the program was versioned up as aim to make better calculations and improve input method. The present report describes revised calculation methods and input/output guide of the version-up program. (author)

  3. J.B. van Wyk,* G.J. Erasmus and K.V. Konstantinov

    African Journals Online (AJOL)

    closed population of finite size. ... separately identified throughout the course of the project. Individual ... analysis, records of stillborn lambs and of years 1941 and ... djj is the diagonal element of the ith animal in Wright's num- .... The first step.

  4. Caffeine inhibits cell proliferation by G0/G1 phase arrest in JB6 cells.

    Science.gov (United States)

    Hashimoto, Takashi; He, Zhiwei; Ma, Wei-Ya; Schmid, Patricia C; Bode, Ann M; Yang, Chung S; Dong, Zigang

    2004-05-01

    Caffeine is a major biologically active constituent in coffee and tea. Because caffeine has been reported to inhibit carcinogenesis in UVB-exposed mice, the cancer-preventing effect of caffeine has attracted considerable attention. In the present study, the effect of caffeine in quiescent (G0 phase) cells was investigated. Pretreatment with caffeine suppressed cell proliferation in a dose-dependent manner 36 h after addition of fetal bovine serum as a cell growth stimulator. Analysis by flow cytometry showed that caffeine suppressed cell cycle progression at the G0/G1 phase, i.e., 18 h after addition of fetal bovine serum, the percentages of cells in G0/G1 phase in 1 mM caffeine-treated cells and in caffeine-untreated cells were 61.7 and 29.0, respectively. The percentage of cells in G0/G1 phase at 0 h was 75.5. Caffeine inhibited phosphorylation of retinoblastoma protein at Ser780 and Ser807/Ser811, the sites where retinoblastoma protein has been reported to be phosphorylated by cyclin-dependent kinase 4 (cdk4). Furthermore, caffeine inhibited the activation of the cyclin D1-cdk4 complex in a dose-dependent manner. However this compound did not directly inhibit the activity of this complex. In addition, caffeine did not affect p16INK4 or p27Kip1 protein levels, but inhibited the phosphorylation of protein kinase B (Akt) and glycogen synthase kinase 3beta. Our results showed that caffeine suppressed the progression of quiescent cells into the cell cycle. The inhibitory mechanism may be due to the inhibition of cell growth signal-induced activation of cdk4, which may be involved in the inhibition of carcinogenesis in vivo.

  5. 'Re-storying' Africa: The harvest festival in Chadian writer, J.B. Seid ...

    African Journals Online (AJOL)

    This article reads the harvest festival in the preface to Joseph Brahim Seid's 1962 Au Tchad sous les étoiles (Told by starlight in Chad) as 're-storying' Africa. The coming together at harvest-time as well as the exchange of produce, evidence of social cohesion is read as reflective of the communal nature of African societies.

  6. Manuscript Click here to download Manuscript JB_209_Edited.docx ...

    Indian Academy of Sciences (India)

    43

    nitric oxide measurement, real-time PCR and immunohistochemistry analysis were employed to assess ..... The amount of NO is an important factor in analysing certain endothelial cell behaviours such as ..... Smitha B, Sridhar S and Khan A 2005 Chitosan–sodium alginate polyion complexes as fuel cell membranes. Eur.

  7. Kontserdid ja etendused toimuvad ikkagi / Tiina Kangro

    Index Scriptorium Estoniae

    Kangro, Tiina, 1961-

    2007-01-01

    Idamaise muusika festivalist "Orient" 2.-8. maini Tallinnas. Edasilükkunud kontsertidest: Vene rockansambli Zemfira kontsert Rock Cafes toimub 28. mail, Filharmoonia Kammerkoori kontsert "Õhtu Arvo Pärdiga" Niguliste kirikus 18. mail. Briti ansambli Pet Shop Bousi kontsert 2. mail, Saxoni kontsert 3. mail

  8. Stenbocki maja õues kuuleb põnevaid kodumaiseid artiste

    Index Scriptorium Estoniae

    2008-01-01

    Stenbocki maja õuemuusika kontserdisarja kontsertidest: 18. juunil esinevad Rein Rannap ja Tiit Kikas, 2. juulil kontsert "Jazz Emotion" (Sofia Rubina), 16. juulil eesti-ukraina folkansambel Svjata Vatra, juuli eelviimasel nädalal kontsert "Tshellopalavik" (C-Jam ja Kaire Vilgats), augustis kontsert "Hea-tuju-laulud" (Revalia kammermeeskoor), 20. aug. kontsert "Aeg ei peata" (esitusel Ott Arderi sõnadele loodud laulud)

  9. Berlinskaja stena i Rimskije kanikulõ / Jevgeni Levik

    Index Scriptorium Estoniae

    Levik, Jevgeni

    2003-01-01

    Mängufilmid "Hüvasti, Lenin!" ("Good Bye, Lenin!") : režissöör Wolfgang Becker : Saksamaa 2003 ja "Lizzie McGuire - koolitüdrukust popstaariks" ("The Lizzie McGuire Movie") : režissöör Jim Fall : Ameerika Ühendriigid 2003

  10. ON THE ANALYST'S IDENTIFICATION WITH THE PATIENT: THE CASE OF J.-B. PONTALIS AND G. PEREC.

    Science.gov (United States)

    Schwartz, Henry P

    2016-01-01

    The writer Georges Perec was in psychoanalysis with Jean-Bertrand Pontalis for four years in the early 1970s. In this essay, the author presents the exceptional interest this analyst took in this patient and the ways in which that interest manifested itself in his work, psychoanalytic and otherwise. Many correlative factors suggest that identificatory processes persisted beyond the treatment and were maintained into Pontalis's later life. While this paper is primarily intended to provide evidence to support this view of a specific case, the author closes by reflecting that this may be a more general phenomenon and the reasons for this. © 2016 The Psychoanalytic Quarterly, Inc.

  11. Omega 3 but not omega 6 fatty acids inhibit AP-1 activity and cell transformation in JB6 cells

    OpenAIRE

    Liu, Guangming; Bibus, Douglas M.; Bode, Ann M.; Ma, Wei-Ya; Holman, Ralph T.; Dong, Zigang

    2001-01-01

    Epidemiological and animal-based investigations have indicated that the development of skin cancer is in part associated with poor dietary practices. Lipid content and subsequently the derived fatty acid composition of the diet are believed to play a major role in the development of tumorigenesis. Omega 3 (ω3) fatty acids, including docosahexaenoic acid (DHA) and eicosapentaenoic acid (EPA), can effectively reduce the risk of skin cancer whereas omega 6 (ω6) fatty acids such as arachidonic ac...

  12. Laccase from a non-melanogenic, alkalotolerant gamma-proteobacterium JB isolated from industrial wastewater drained soil.

    Science.gov (United States)

    Bains, Jasleen; Capalash, Neena; Sharma, Prince

    2003-07-01

    A gram-negative, alkalotolerant bacterium, isolated from the soil continually drained with industrial wastewater and identified as gamma-proteobacterium by partial 16S rRNA sequence analysis, produced a polyphenol oxidase, which showed laccase but not tyrosinase activity. The organism grew well from pH 6 to 10 and produced laccase maximally at pH 10. The enzyme was stable from pH 3 to 10.6 for at least 24 h and was optimally active at 55 degrees C and pH 6.5 in a 5 min assay.

  13. Paraadile annavad sära sõjaväeorkestrid. Kultuuri ja uunikumi / Andris Tammela

    Index Scriptorium Estoniae

    Tammela, Andris

    2005-01-01

    Võidupüha üritustest Paides 23. juunil. Suure-Jaani muusikapäevadest: Mati Palmi ja Aare-Paul Lattiku kontsert 22. juun. Suure-Jaani jahimajas, Sven Grünbergi, Lilian Langsepa ja Vambola Kriguli kontsert 22. juun. Suure-Jaani kirikus, Urmas Sisaski autoriõhtu 23. juun. Suure-Jaani kirikus, Jassi Zahharovi kontsert 23. juun. Soomaal Hüpassaares

  14. Final Environmental Assessment for Proposed Multi-Purpose Machine Gun Range at Joint Base McGuire-Dix-Lakehurst (JB MDL), New Jersey

    Science.gov (United States)

    2015-09-01

    the Preferred Alternative location. Sanitary services would be provided through the use of portable, contractor-serviced toilets. Under the Preferred... Sanitary services would be provided through the use of portable, contractor-serviced toilets. Under the Competing Build Alternative, the existing MPMGR...February 2013. MDEP 2009 MDEP. 2009. Assessment of Ecological Risk Associated with Lead Shot at Trap, Skeet, & Sporting Clay Ranges. Massachusetts

  15. Transdifferentiated rat pancreatic progenitor cells (AR42J-B13/H) respond to phenobarbital in a rat hepatocyte-specific manner.

    Science.gov (United States)

    Osborne, M; Haltalli, M; Currie, R; Wright, J; Gooderham, N J

    2016-07-01

    Phenobarbital (PB) is known to produce species-specific effects in the rat and mouse, being carcinogenic in certain mouse strains, but only in rats if treated after a DNA damaging event. PB treatment in the rat and mouse also produces disparate effects on cell signalling and miRNA expression profiles. These responses are induced by short term and prolonged PB exposure, respectively, with the latter treatments being difficult to examine mechanistically in primary hepatocytes due to rapid loss of the original hepatic phenotype and limited sustainability in culture. Here we explore the rat hepatocyte-like B13/H cell line as a model for hepatic response to PB exposure in both short-term and longer duration treatments. We demonstrate that PB with Egf treatment in the B13/H cells resulted in a significant increase in Erk activation, as determined by the ratio of phospho-Erk to total Erk, compared to Egf alone. We also show that an extended treatment with PB in the B13/H cells produces a miRNA response similar to that seen in the rat in vivo, via the time-dependent induction of miR-182/96. Additionally, we confirm that B13/H cells respond to Car activators in a typical rat-specific manner. These data suggest that the B13/H cells produce temporal responses to PB that are comparable to those reported in short-term primary rat hepatocyte cultures and in the longer term are similar to those in the rat in vivo. Finally, we also show that Car-associated miR-122 expression is decreased by PB treatment in B13/H cells, a PB-induced response that is common to the rat, mouse and human. We conclude that the B13/H cell system produces a qualitative response comparable to the rat, which is different to the response in the mouse, and that this model could be a useful tool for exploring the functional consequences of PB-sensitive miRNA changes and resistance to PB-mediated tumours in the rat. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  16. Rolling Stonesi kinokontsert kannab toorest rokiväge / Maris Meiessaar

    Index Scriptorium Estoniae

    Meiessaar, Maris

    2009-01-01

    Martin Scorsese muusikalisest dokumentaalfilmist "Shine a Light - Valgus peale" (USA-Suurbritannia, 2008), mille keskmes on 2006. a. New Yorgi Beaconi teatris toimunud briti ansambli Rolling Stones kontsert

  17. Bedwetters esineb tänutuuri raames Rakveres

    Index Scriptorium Estoniae

    2007-01-01

    Münchenis MTV Euroopa muusikaauhindade jagamisel Uue Euroopa Heli kategoorias lauluga "Dramatic Letter to Conscience"esikoha võitnud Pärnu pop-punkbändist Bedwetters (kontsert 30. nov. Rakveres, soojendusbändiks Driven, koostöös MTVga korraldatavaid kontsertõhtuid juhivad MTV VJd Martin Veismann ja Piret Järvis)

  18. Résultats de recherche | Page 406 | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Jeter des ponts enmatière de recherche en économie: John Whalley (Canada). Research in Action. Agrifood markets Biodiversity Crops Farming Systems Food security Gender. Lizzie Shumba, Malawi Intégrer la recherche au travail des agriculteurs. Research in Action. Water. Comment éviter la crise de l'eau. Research in ...

  19. Muusika DVD-d / Priit Hõbemägi

    Index Scriptorium Estoniae

    Hõbemägi, Priit, 1957-

    2006-01-01

    Uutest DVD-dest Moody Blues "Lovely to See You - Live", Nick Cave and The Bad Seeds "Road to God Knows Wherw", Thin Lizzy "Thunder and Lightning Tour", Eels "Eels With Strings - Live at Town Hall", Moby "Live. Hotel Tour 2005", Corvus Corax "Cantus Buranus", Destiny's Child "Live in Atlanta"

  20. Search Results | Page 810 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 8091 - 8100 of 8491 ... Bringing research to farmers' fields in Malawi: Lizzie Shumba (Malawi). Research in Action. -. Raising the Bar for Microbiologists. Research in Action. -. The human consequences of animal health. Research in Action. Water. About WaDImena. Research in Action. -. Putting medical knowledge at ...

  1. Saksamaa teatrilavadel taas 1920. aastad / Erkki Otsman

    Index Scriptorium Estoniae

    Otsman, Erkki, 1966-

    2006-01-01

    Berliinis ja Hamburgis nähtud kabaree-etendustest : Bertolt Brechti "Kolmekrossiooper" Berliini uues teater-kontserdisaalis Admiralspalast (lavastaja Klaus Maria Brandauer), Max Raabe ja Palast Orchesteri kontsertetendus "Palast Revue" Hamburgi Thalia teatris, Georgette Dee kontsert Brechti lauludest

  2. Elu on Rock 'n' roll! / Mari Hiiemäe

    Index Scriptorium Estoniae

    Hiiemäe, Mari

    2007-01-01

    Üritusesarjast "The 1st Tallinn Rocknroll Weekend Party" (korraldaja Eero Palusalu) Tallinnas Rock Cafés. Inglise rockansamblitest Matchbox ja Crazy Cavan & The Rhythm Rockers (kontsert 15. sept. Rock Cafés)

  3. Uudised : Võistlevad noored orkestrijuhid. Csaba Szilvay ansambel tulemas. Rootsi tattoo-orkester Tallinnas / Tiit Mesila

    Index Scriptorium Estoniae

    Mesila, Tiit, 1942-

    2000-01-01

    TPÜs toimub III noorte puhkpilliorkestrijuhtide konkurss. S. Szilvay tšello- ja kontrabassiansambel esineb 23. ja 24. apr. Tallinnas. Möödunud nädalavahetusel andis Tallinnas kontserte Rootsi kaitseväe orkester

  4. Uudised : "Odessa Pop uuel ringil". Neoandertals jõuab plaadile. "Xanadu" Hollandis muusikalilaval

    Index Scriptorium Estoniae

    2007-01-01

    Kontsertõhtust sarja Odessa Pop raames 17. veebr. Tallinnas baar-klubis Juuksur. Ultrabrutaalse deathmetali duo Neoandertals heliplaadi "Neanderthals Were Master Butchers" esitluskontserdist 17. veebr. Tallinnas KuKu klubis. 1980. aastal valminud diskofilmi "Xanadu" muusikaliversioonist

  5. Galakontserti Wiedemanni võimlas toetab uhke lavasõu / Jüri-Ruut Kangur

    Index Scriptorium Estoniae

    Kangur, Jüri-Ruut, 1975-

    2005-01-01

    31. juulil toimub Haapsalu Wiedemanni spordihoones filmimuusika kontsert "Gladiaator". Kultusfilmidest tuntud muusikat esitab noortest muusikutest koosnev sajaliikmeline sümfooniaorkester. Muusikat toetab efektne lavashow. Dirigeerib prantslane Thierry Stallano

  6. "Gladiaator" pakkus kuulajaile traagelniitideta meelelahutust / Kaie Ilves

    Index Scriptorium Estoniae

    Ilves, Kaie

    2005-01-01

    31. juulil toimub Haapsalu Wiedemanni spordihoones suurejooneline filmimuusika kontsert "Gladiaator". Kultusfilmidest tuntud muusikat esitab noortest muusikutest koosnev sajaliikmeline sümfooniaorkester. Muusikat toetab efektne lavashow. Dirigeerib prantslane Thierry Stallano

  7. James Wertsi ja SaxEsti ühiskontsert. "Valge gospel" asub taas tuurile

    Index Scriptorium Estoniae

    2007-01-01

    Ameerika laulja ja kitarristi James Wertsi ning saksofonikvarteti SaxEst kontserdituurist Eestis algusega 1. dets. Haljala rahvamajast. Kontserdituurist "Valge gospel" alates 11. dets. kuues Eestimaa kirikus (viimane kontsert 20. dets. Tallinna Linnahallis)

  8. Epohhi looja jõuab Eestisse / Mari Hiiemäe

    Index Scriptorium Estoniae

    Hiiemäe, Mari

    2008-01-01

    Ameerika lauljast ja heliloojast Bob Dylanist (kontsert 4. juunil Tallinnas Saku Suurhallis). Kinos Sõprus esilinastuvast Bob Dylani elust ja muusikast inspireeritud mängufilmist "Kus on Bob Dylan?"

  9. Eesti joonisfilm taas edukas

    Index Scriptorium Estoniae

    2003-01-01

    Riia I rahvusvahelisel animafilmide festivalil võitis "Kontsert porgandipirukale" parima animafilmi auhinna. Grand prix'i sai inglase Ignacio Ferreresi film "How to Cope With a Death". Žüriisse kuulus ka Rein Raamat

  10. Muusika / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2005-01-01

    8. okt. avab Eesti Kontsert pidulikult vastvalminud Jõhvi kontserdimaja. Estonia kammersaalis esietenduvad Gian Carlo Menotti ooperid "Meedium" ja "Telefon". 1. X toimus Toronto Eesti Majas uue kontsertklaveri Estonia sisseõnnistamise galakontsert. Klassikaraadios algab uus saatesari "Mõttehelin"

  11. Tämbrimuusika "NYYDil" / Mart Jaanson

    Index Scriptorium Estoniae

    Jaanson, Mart, 1966-

    1999-01-01

    27. nov. toimub festivali "NYYD '99" raames ans. Court-Circuit kontsert. Ettekandele tulevate teoste tutvustus - T. Muraili "La barque mystique", G. Grisey "Vortex temporum" ja T. Tulevi "Gare de l"Est"

  12. Sasha, ja gorda, tshto ja tvoi utshitel! / Boris Tuch

    Index Scriptorium Estoniae

    Tuch, Boris, 1946-

    2001-01-01

    18. mail toimub Vene Draamateatris rahvusvahelist stepipäeva tähistav kontsert. Korraldajaks on Duff-tap studio, mida juhendab Aleksandr Ivashkevitsh. Kontserdil osalevad Barbara Duffy (USA) ja Vladimir Kirsanov (Venemaa)

  13. Öeksanda märtsi tegevuskunstifestival

    Index Scriptorium Estoniae

    2002-01-01

    Non-profit-tegevuskunstiüritus Viljandis. Toimuvad performanceid mõisa ja lauluväljaku piirkonnas, kontsert ja performanceid "Ugala" keldrisaalis. Kilpkonna galeriis avatakse isikukultuslik näitus,

  14. Valjala kiriku orel kõlab / Heli Salong

    Index Scriptorium Estoniae

    Salong, Heli, 1958-

    2004-01-01

    Valjala Püha Martini kiriku Gustav Normanni valmistatud ja Ago Tindi põhjalikult remonditud oreli taaspühitsemisest piduliku kontsert-jumalateenistusega 10. nov., külalisesinejaks saksa organist ja orelimeister Martin ter Haseborg

  15. Vaata ja kuula / Annika Koppel

    Index Scriptorium Estoniae

    Koppel, Annika

    2005-01-01

    Heliplaatidest: Jane Birkin "Randez-Vous", "Chill Brazili", "Jazzland Sampler 2005", Mylene Farmer "Avant Que L'Ombre". Norra ansamblist Jaga Jazzist (kontsert 15. juunil Pirita lillepaviljonis, soojendusesinejaks soome kitarrist Jarmo Saari). Jane Birkin esineb Tallinnas 29. juunil

  16. Hector Zazou helisulamid ekraani ja ajalooga / Immo Mihkelson

    Index Scriptorium Estoniae

    Mihkelson, Immo, 1959-

    2005-01-01

    IX Pimedate Ööde Filmifestivali avalöögiks on kontsert-filmiseansid Tartus ja Tallinnas, kus Theodor Dreyeri tummfilmi "Jeanne d'Arci kannatused" (Prantsusmaa 1928) saadab prantsuse muusik Hector Zazou

  17. Meenutades maestro Voldemar Tagot / Arnold Anton

    Index Scriptorium Estoniae

    Anton, Arnold

    2007-01-01

    Metsasarvemängijast ja dirigendist Voldemar Taggost (22. 08. 1887 - 18.09.1960) (kontsert "Voldemar Tago - 120" projekti "Inimesed Pärnu kultuurimaastikul" raames 22. aug. Pärnu raekojas, õhtujuht Toomas Kuter)

  18. Pop / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2004-01-01

    Heliplaatidest: Current 909 "The price for existence is eternal warfare", Aapo Ilves "Pilpaküla kontsert", Yello "The Eye", Maian Kärmas, Ain Agan, Riho Sibul, Arvo Haasma "Tuigutuled", Manatark "Chaos Engine"

  19. Anneli Remme soovitab : Armastuse ja sõja laulud / Anneli Remme

    Index Scriptorium Estoniae

    Remme, Anneli, 1968-

    2008-01-01

    Eesti Filharmoonia Kammerkoori ja Helsingi Barokkorkestri kontserdist Claudio Monteverdi loominguga 25. jaan. Rakvere Gümnaasiumis, 26. jaan. Tartu Jaani kirikus ja 27. jaan. Tallinnas Mustpeade majas, Euroraadio kontsert 29. jaan. Tallinna Metodisti kirikus

  20. Uudised : Kas Nael lõpetab? Pärt ilma Björkita. Piazzolla esiettekanne Hollandis

    Index Scriptorium Estoniae

    2000-01-01

    Ajakirja "Nael" ilmumisega seotud probleemidest. 1. sept. Tallinnas Kaarli kirikus toimuvast kontserdist, kus tuleb ettekandele Pärdi teos "Which was the son of...". Hollandis tuleb septembris esiettekandele A:Pizzolla senitundmatu kontsert

  1. Valged ööd ja Tallinn Londonis ehk 60 kraadi põhjalaiust / Ann Alari

    Index Scriptorium Estoniae

    Alari, Ann

    2009-01-01

    19. juunist 9. juulini toimub City of London Festival, millel osalevad Põhjamaad. Üheks oodatumaks sündmuseks on 30. juunil St Pauli katedraalis Inglise Rahvusballeti orkestri kontsert ja etendus "Chopiniana", kus tantsivad Age Oks ja Toomas Edur

  2. Maailma tipud Mozarti festivalil / Kersti Inno

    Index Scriptorium Estoniae

    Inno, Kersti, 1954-

    2006-01-01

    Korea kammerorkestrist (kontserdid festivali "Mozart 250" raames 20. jaan. Pärnu kontserdimajas, 21. jaan. Estonia kontserdisaalis ja 22. jaan. Jõhvi kontserdimajas). Orkestrist The Orchestra of the Age of Enlightenment (kontsert 26. jaan. Estonia kontserdisaalis)

  3. Vene tuntumaid rokkbände Bi-2 tuleb Õllesummerile. Candy Dulfer annab Eestis kaks kontserti

    Index Scriptorium Estoniae

    2007-01-01

    Vene ansamblist Bi-2 (kontsert Õllesummeri festivali pealaval 5. juulil Tallinna Lauluväljakul). Kontserdist "Candy Dulfer & Friends" 8. juulil Pärnu Vallikäärus ja 9. juulil Estonia kontserdisaalis

  4. Philip Glass tuleb Eestisse

    Index Scriptorium Estoniae

    2002-01-01

    26. nov. Tallinnas Sakala keskuses toimuvast muusikafestivali NYYD ja Pimedate Ööde filmifestivali ühisprojektist, mis kujutab endast Godfrey Reggio ja Philip Glassi kultusfilmi "Koyaanisqatsi" kontsert-linastust

  5. "Porgandipirukas" ei võitnud Cartoon d'Ori

    Index Scriptorium Estoniae

    2004-01-01

    Heiki Ernitsa ja Janno Põldma "Kontsert porgandipirukale" valiti Santiago de Compostelas (Hispaania) üleantava animafilmi auhinna Cartoon d'Or viie nominendi hulka. Auhinna sai siiski Virgil Widrichi lühifilm "Kiire film" ("Fast Film") : Austria - Luksemburg 2003

  6. Kirikumuusika sari tutvustab tänapäevast reekviemi / Silja Joon

    Index Scriptorium Estoniae

    Joon, Silja, 1966-

    2010-01-01

    Suurel reedel toimub Pärnu kontserdimajast kontsert "Reekviem täna ja romantismiajal", esitusele tulevad Jüri Reinvere ja Gabriel Fauré reekviemid, esitavad Pärnu Linnaorkester ja Tallinna Georg Otsa nimelise muusikakooli segakoor

  7. Stuudio Joy tegi perepublikule sügisese päikeselise pai / Helju Keskpalu

    Index Scriptorium Estoniae

    Keskpalu, Helju

    2005-01-01

    Stuudio Joy korraldatud kontsert "Üks päikeseline pai kogu perele" Valga kultuurikeskuses 9. oktoobril. Esinesid ka Narva tantsutrupp Lions, rahvatantsurühm Narvast, Tõrvast, Valkast ja paljud teised

  8. Lähme, naised / Tiina Kuuler

    Index Scriptorium Estoniae

    Kuuler, Tiina, 1969-

    2008-01-01

    Muusikasündmustest: "Levimuusikapäevad" 24.-27. apr. Tartus Genialistide klubis Lutsu teatrimajas, "Peda Folk" 22. apr. Tallinnas Kultuurikatlas (Põhja pst 27a), etnosari "Sotto Voce" 23. apr. Estonia Talveaias, kontsert "Sotspop 2008" 26. apr. Tallinna linnahallis, Jüripäeva kontsert 23. apr. Tallinna Jaani kirikus, Bonzo ja Tõun "Soojad laulud" 18. apr. Pirita Vaba Aja Keskuses, The Suni uue plaadi esitlus 19. apr. Tallinnas Rock Cafes

  9. Kevadfestival pakub põnevaid elamusi / Ireen Lill

    Index Scriptorium Estoniae

    Lill, Ireen

    2008-01-01

    Üritustest 29. maist kuni 1. juunini toimuva Türi Kevadfestivali raames: koomilise laulumängu "Lopi ja Lapi" esietendus 31. mail Oisu rahvamajas (autoriteks kirjanik Leelo Tungal ja helilooja Tõnis Kaumann), Kadri-Ann Sumera kontsert pealkirjaga "Metsastseenid" 29. mail, Alo Põldmäe loodusfotode näituse "Muusikaline Neeruti" avamine, ansambli Svetilen kontsert 30. mail Türi kirikus, regilaulude laulmine Jaak Johansoni ja Riina Roose eestvedamisel ürituse "Ööülikool" raames 30. mail, festivali lõppkontsert Türi kirikus 1. juunil (esineb organist Ulla Krigul)

  10. Kevadfestival kutsub metsa ja kontserdisaali / Iren Lill

    Index Scriptorium Estoniae

    Lill, Iren

    2008-01-01

    Üritustest 29. maist kuni 1. juunini toimuva Türi Kevadfestivali raames: koomilise laulumängu "Lopi ja Lapi" esietendus 31. mail Oisu rahvamajas (autoriteks kirjanik Leelo Tungal ja helilooja Tõnis Kaumann), Kadri-Ann Sumera kontsert pealkirjaga "Metsastseenid" 29. mail, Alo Põldmäe loodusfotode näituse "Muusikaline Neeruti" avamine, ansambli Svetilen kontsert 30. mail Türi kirikus, regilaulude laulmine Jaak Johansoni ja Riina Roose eestvedamisel ürituse "Ööülikool" raames 30. mail, festivali lõppkontsert Türi kirikus 1. juunil (esineb organist Ulla Krigul)

  11. Genetics Home Reference: FG syndrome

    Science.gov (United States)

    ... MJ, Hoo JJ, Jones KL, McKeown C, Moeschler JB, Raymond FL, Rogers RC, Schwartz CE, Battaglia A, ... E, Huddleston L, Clark RD, Jones KL, Moeschler JB, Opitz JM, Morford J, Simensen R, Rogers RC, ...

  12. Comparing the Use of Books with Enhanced Records versus Those Without Enhancements: Methodology Leads to Questionable Conclusions. A review of: Madarash‐Hill, Cherie and J.B. Hill. “Electronically Enriched Enhancements in Catalog Records: A Use Study of Books Described on Records With URL Enhancements Versus Those Without.” Technical Services Quarterly 23.2 (2005: 19‐31.

    Directory of Open Access Journals (Sweden)

    Susan Haigh

    2007-06-01

    Full Text Available Objective – To compare the use of books described by catalogue records that are enhanced with URL links to such information as dust jackets, tables of contents, sample text, and publishers’ descriptions, with the use of books described by records that are not enhanced with such links.Design – Use study.Setting – Academic library (Southeastern Louisiana University, Sims Memorial Library.Subjects – 180 records with enhancements and 180 records (different titles without enhancements.Methods – The study identified the sample of unenhanced records by conducting searches of the broad subject terms “History”, “United States”, “Education”,and “Social” and limiting the searches to books. The enhanced sample was derived in the same manner, but with additional search limiters to identify only those records that had URL enhancements. An equal sample of enhanced and unenhanced records (50 or 30 of each was tracked for each of four search terms. Only records for books that could be checked out were included, as use statistics were based on whether or not a book was borrowed. While half of the enhanced records had full‐text elements (such as descriptions that were indexed and thus searchable, the rate of use for these records was not tracked separately from the enhanced records that only had URL enhancements.Main results – Books described on records with URL enhancements for publisher descriptions, tables of contents, book reviews, or sample text had higher use than those without URL enhancements. Only 7% of titles with URLs, compared with 21% of those without, had not been borrowed. 74.67% of titles with URLs had been checked out one or two times, compared with 69.5% of those without URLs. The number of titles with enhanced records that had 3 or more checkouts was almost double the rate of unenhanced titles (18% to 9.5%.Conclusion – The authors conclude that catalogue records that have electronic links to book reviews, cover jackets, tables of contents, or publisher descriptions can lead to higher use of books, particularly if textual enhancements such as descriptions are also searchable.

  13. Commentary on "tissue-specific mutagenesis by N-butyl-N-(4-hydroxybutyl) nitrosamine as the basis for urothelial cell carcinogenesis." He Z, Kosinska W, Zhao ZL, Wu XR, Guttenplan JB, Department of Basic Science, New York University Dental College, NY, USA.: Mutat Res 2012;742(1-2):92-5 [Epub 2011 Dec 4].

    Science.gov (United States)

    Scherr, Douglas S

    2014-02-01

    Bladder cancer is one of the few cancers that have been linked to carcinogens in the environment and tobacco smoke. Of the carcinogens tested in mouse chemical carcinogenesis models, N-butyl-N-(4-hydroxybutyl)nitrosamine (BBN) is one that reproducibly causes high-grade, invasive cancers in the urinary bladder, but not in any other tissues. However, the basis for such a high-level tissue-specificity has not been explored. Using mutagenesis in lacI (Big Blue™) mice, we show here that BBN is a potent mutagen and it causes high-level of mutagenesis specifically in the epithelial cells (urothelial) of the urinary bladder. After a 2-6-week treatment of 0.05% BBN in the drinking water, mutagenesis in urothelial cells of male and female mice was about two orders of magnitude greater than the spontaneous mutation background. In contrast, mutagenesis in smooth muscle cells of the urinary bladder was about five times lower than in urothelial tissue. No appreciable increase in mutagenesis was observed in kidney, ureter, liver or forestomach. In lacI (Big Blue™) rats, BBN mutagenesis was also elevated in urothelial cells, albeit not nearly as profoundly as in mice. This provides a potential explanation as to why rats are less prone than mice to the formation of aggressive form of bladder cancer induced by BBN. Our results suggest that the propensity to BBN-triggered mutagenesis of urothelial cells underlies its heightened susceptibility to this carcinogen and that mutagenesis induced by BBN represents a novel model for initiation of bladder carcinogenesis. Copyright © 2014 Elsevier Inc. All rights reserved.

  14. Verbaalne soolo Jaanus Nõgistolt : Led R-ist, Narva Linna Sümfooniaorkestrist ja Led Zeppelinist / Jaanus Nõgisto ; interv. Margo Pajuste

    Index Scriptorium Estoniae

    Nõgisto, Jaanus, 1956-

    2007-01-01

    Rockansambli Led Zeppelini muusikast, ansamblist Led R ja heliplaadist "Led the R Out" räägib kitarrist Jaanus Nõgisto. Led R ja Narva Linna Sümfooniaorkestri kontserdid: 22. juunil Pärnus ja 14. juulil Haapsalu lossihoovis, ansambli Led R kontsert koos Havana Blackiga 3. aug. Sõru sadamas Hiiumaal

  15. Siim Nestor soovitab : DJ Suv. Reaalsessioonid Tartus / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2001-01-01

    DJ Suv esineb koos MC Guyvoriga üritusel Dzhungli kellad 21. detsembril Kunstiakadeemias, hiljaaegu valmis tema soolo debüüt-LP "Desert Rose". 21. detsembril Tartu klubis Illegaard toimuvast CD-kogumiku "Tallinn: psühhedeelne linn" esitlus-kontsert-peost

  16. President Ilves : Estonia's road back to freedom and an equitable world started from Hirve Park

    Index Scriptorium Estoniae

    2007-01-01

    President Toomas Hendrik Ilvese kõnest Hirvepargi meeleavalduse 20. aastapäevale pühendatud kontsert-kõnekoosolekul. Vt. samas: President Ilves Calls for Monument to Victims of Communism. President T.H. Ilves kutsus üles rajama mälestusmärki kommunismiohvritele

  17. No-Big-Silence teeb klubituuri / Urmas Hännile

    Index Scriptorium Estoniae

    Hännile, Urmas

    2009-01-01

    Rockansamblist No-Big-Silence ja dark-popansamblist Sinine, nende kontsertttuurist mööda Eestimaad, tutvustamisel bändide uued albumid (No-Big-Silence "Starstealer" ja Sinine "Butterflies"), Pärnus on kontsert 24. oktoobril klubis Sugar

  18. K. A. Somov : Sillamjaeskije peizazhi / Alevtina Krasnova

    Index Scriptorium Estoniae

    Krasnova, Alevtina

    2004-01-01

    Vene maalikunstniku Konstantin Andrejevitsh Somovi elust ja loomingust. K. Somovi Sillamäel 1900. a. maalitud töödest (15 loodusvaadet ja akvarell "Kontsert"), nende asukohad praegu. Illustratsiooniks Sillamäel maalitud "Õhtused varjud", "Kevad mere kaldal" ja "Puudesalu mere ääres" reprod

  19. Mr. Lawrence tuleb Rabarockiks kokku! Peer Günt uues kuues. Pervert ja ämma unistus

    Index Scriptorium Estoniae

    2007-01-01

    Rockansamblist Mr. Lawrence, albumitest "Mr. Lawrence", "Swing", "Sitandspin". Soome hardrock'i ansamblist Peer Günt, albumist "Backseat". Etno-folkrockansamblist Dagö (kontsert 15. juunil Rabarockil), albumitest "Toiduklubi", "Hiired tuules", "Joonistatud mees". Info festivalist: www.rabarock.delfi.ee / www.rabarock.ee

  20. Boy George Helsingi-Tallinna geikruiisil

    Index Scriptorium Estoniae

    2006-01-01

    Angel Café & Gayclub ja firmade Tallink ja Madrenalin Ltd korraldatavast geikruiisist Lovebot 2006 (30. apr.-1. mai), kus show-programmi peaesinejateks briti laulja Boy Gerry ja ameerika laulja Sherry Vine (Sherry Vine kontsert ka 29. apr. Tallinnas Angeli klubis)

  1. Ennekuulmatud loomalaulud / Panda Bear (Noah Lennox) ; interv. Siim Nestor

    Index Scriptorium Estoniae

    Panda Bear (Noah Lennox)

    2006-01-01

    Intervjuu eksperimentaalset popmuusikat viljeleva ameerika ansambli Animal Collective laulja Panda Bear'iga (kontsert 4. juulil Tallinnas Lillepaviljonis). Heliplaatidest: "Spirit They're Gone, Spirit They've Vanished", "Danse Manatee", "Hollindagain", "Campfire Songs", "Here Comes the Indian", "Sung Tongs", "Feels"

  2. Plaat

    Index Scriptorium Estoniae

    2006-01-01

    Heliplaadid kauplustest Lasering: David Gilmour "On An Island", Liisi Koikson "Väike järv - kontsert Pirgu mõisas" (CD+DVD), Chris Isaak "Best Of", Tool "10 000 Days", Morrissey "Ringleader Of The Tormentors", No-Big-Silence "War In Wonderland"

  3. Uudised : Muusikaline ringreis Mustpeades. Plaat kannelde ja kitarride kvartetilt. Jõulumuusika / Joosep Sang

    Index Scriptorium Estoniae

    Sang, Joosep

    2000-01-01

    Stuudio Cantores Vagantese kontserdist Mustpeade Majas 18. dets. Uuest heliplaadist "Holy Lake". Euroraadio jõulukontserdi otseülekandest Estonia kontserdisaalist 17. dets. 9. dets. Kadrioru lossis toimunud UNICEFi heategevuskontserdist. 17. dets. toimub Adamson-Ericu muuseumis kontsert sarjast "Barokkmaastikud". M. Voitese kontserdist Pärnus. TAMi uuest heliplaadist "Anno Domini", jõulukontserdist 23. dets. Kaarli kirikus

  4. Siim Nestor soovitab : Hea Uus Heli. Vibe 5. sünnipäev / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2003-01-01

    Üritustest "Võlu Music" Mustpeade Majas 9. okt., "1ÖÖ%" Von Krahlis 10. okt., "Kontsert" Tartu Peetri kirikus 10. okt ja Tallinna Niguliste kirikus 11. okt., "Valge Laigu Klubi" Hobuveskis 11. okt. popmuusikafestivali "Hea Uus Heli" raames. Üritusest "Vibe" Liiva keskuses 11. oktoobril

  5. Ohtralt suuremeelset sallivust teistsuguste suhtes / Nele Suisalu

    Index Scriptorium Estoniae

    Suisalu, Nele

    2008-01-01

    29.X - 2. XI Korsikal toimunud festivalist "Festiventu / Festival du vent" (Tuulefestival), kus toimus teatri- ja tänavaetendusi, kontserte, installatsioone, filmilinastusi, raadiosaadete otseülekandeid, vestlusringe, loenguid keskkonnasõbralikkuse ühisnimetaja all. Pikemalt Makadam Kanibali tänavaetendusest "Cirque des curiosites"

  6. Birgitta festival tulekul

    Index Scriptorium Estoniae

    2006-01-01

    Birgitta festivali üritustest Tallinnas Pirita kloostri varemetes: 11. ja 12. aug. Astor Piazzolla tango-ooper "Maria de BuenosAires", 15. aug. Mozarti ooper "Tituse halastus", 17. aug. D. Shostakovitshi ooper "Mtsenski maakonna lady Macbeth", 18. aug. Carl Orffi "Carmina Burana, 19. aug. Verdi "Reekviem", 20. aug. Tõnis Mägi, Ultima Thule ja Tallinna Kammerorkestri kontsert

  7. Uudised : Kellad orelis. RAM laulab Tubinat. Washingtoni Ülikooli Kammerkoor / Joosep Sang

    Index Scriptorium Estoniae

    Sang, Joosep

    2000-01-01

    18. juunil toimub Tallinna Toomkirikus kontsert "Kellad orelis", kus esitletakse ka I. Maidre samanimelist CD-plaati. E. Tubina 95. sünniaastapäeva tähistatakse täna kontserdiga Tallinna Jaani kirikus. TÜ aulas esineb täna Washingtoni Ülikooli Kammerkoor

  8. U2 laulusõnade tundmine lennutab Hawaile

    Index Scriptorium Estoniae

    2006-01-01

    Iiri bänd U2 algatas oma uue albumi "U2 18 Singles väljatuleku puhul internetis võistluse "Hunt The Lyric", kus fännidel on võimalus võita reis Hawaile (reisi paketis ka U2 "Vertigo" tuuri kontsert 9. dets.)

  9. Jõulud Hamiltonis

    Index Scriptorium Estoniae

    2009-01-01

    laste jõulupeost 30. novembril, kontsert-jumalateenistusest 14. detsembril, Hamiltoni Eesti Võitlejate Ühingu pere jõulukoosviibimisest 17. detsembril, Eesti Pensionäride Klubi jõuludest 18. detsembril ja jõululaupäeva jumalateenistusest Grace Lutheran kirikus

  10. Teated

    Index Scriptorium Estoniae

    2008-01-01

    Kontserdid TÜ aulas: Tartu Ülikooli kammerkoori kevadkontsert 16. märtsil, pianist Peep Lassmann 18. märtsil (kavas: Sumera "Pala aastast 1981", Liszt-Rossini "Stabat Mater", Liszt-Verdi "Rigoletto parafraas", Liszt "Tuisk" ja "Hispaania rapsoodia"), saksofonikvartett Sax-Est 19. märtsil, kontsert "Richard Ritsing - 105" 28. märtsil

  11. Muusika : Kaljuste Madalmaade kooriga USAs. Weekend Guitar Trio Lüneburgis. Petrovi koor Iirimaal ja Norras. Poola kvintett Tallinna Raekojas. Esineb Tatjana Smelova. "improvizz'01" Tartus. "Klassikaraadio" Wagnerit avastamas

    Index Scriptorium Estoniae

    2001-01-01

    Tõnu Kaljuste käis Madalmaade kammerkooriga USAs. Weekend Guitar Trio esineb Lüneburgis. Õigeusu Vaimuliku Muusika Kammerkoor Valeri Petrovi juhatusel käis Iirimaal ja Norras esinemas. Poola keelpillikvintett MultiCamerata esines Tallinna Raekojas. Eestis annab kontserte pianist Tatjana Smelova. 8.-10. nov. toimub Tartus "improvizz'01" . "Klassikaraadio" Wagnerit avastamas

  12. Barokkmuusika festival toob Pärnusse sufi muusika / Silja Joon

    Index Scriptorium Estoniae

    Joon, Silja, 1966-

    2007-01-01

    XVIII barokkmuusika festivalist (kunstiline juht ja korraldaja Andres Mustonen) 1.-11. veebr. Tallinnas, Tartus, Pärnus, Jõhvis ja Viljandis. Kontsertidest: Risto Joost, Robert Staak ja Ene Salumäe 6. veebr. Pärnu raekoja saalis, Inglise vokaalansambel The Clerks Group 8. veebr. ja sufi muusika kontsert 11. veebr. Pärnu kontserdimajas, esinejatest

  13. Muusika : Kreegi "Requiemi" partituur ilmunud. Heliloojaühingud. Kitarriseltsi sügisene pidu

    Index Scriptorium Estoniae

    2001-01-01

    SP Muusikaprojekt andis välja Kreegi "Requiemi" partituuri. Estonia talveaias peeti Eduard Tubina õhtut. 26. X asutati Suure-Jaanis Rahvusvaheline Heliloojate Kappide Ühing. 23.-30. X toimus Otepääl Eesti Kitarriseltsi aastaseminar. Pärnu Linnaorkester ja Pärnu Muusikakooli keelpilliorkester annavad ühiseid isadepäeva kontserte

  14. Folkansambel Pillipiigad võõrustas serblasi / Juta Helilaid

    Index Scriptorium Estoniae

    Helilaid, Juta

    2008-01-01

    2007. aasta hilissuvel Serbias ja Horvaatias folkloorifestivalidel osalenud Kose folklooriansambel Pillipiigad võõrustas Selenca linna Jan Kollari nimelise kooli folkloorirühma Pramienok. Kontserte anti 5. juunil Eesti Vabaõhumuuseumis Rocca al Mares, 6. juunil Albu mõisas ja 7.-8. juunil rahvusvahelisel VIII laste folkloorifestivalil Porkuni Pillar, festivalist

  15. Uudised : Bella Musica presentatsioon. Muusikaesseede võistlus läks korda / Anu Kõlar

    Index Scriptorium Estoniae

    Kõlar, Anu, 1961-

    2001-01-01

    14. veebr. toimusid läbirääkimised saksa firma Bella Musica, saksa muusikapromotsiooni firma Pro Classics ja äsjaloodud plaadiproduktsioonide firma ERP (Estonian Record Productions) vahel. Toimus ka kaubamärgi Antes Classics presentatsioon ning kontsert. Muusikateemaliste esseede võistlusest ja selle tulemustest

  16. Kurat, kus sa küll täna õhtul oled? / Tristan Priimägi

    Index Scriptorium Estoniae

    Priimägi, Tristan, 1976-

    2009-01-01

    Martin Scorsese muusikalisest dokumentaalfilmist "Shine a Light - Valgus peale" (USA - Suurbritannia, 2008), mille keskmes on 2006.a. New Yorgi Beaconi teatris toimunud briti ansambli Rolling Stones kontsert. Ka varasematest filmidest selle ansambli kohta (Jean-Luc Godard'i "Symphaty for the Devil", Albert ja David Mayslesi "Gimme Shelter")

  17. Terve päev emale / Christel Karits

    Index Scriptorium Estoniae

    Karits, Christel, 1966-

    2008-01-01

    Emadepäevakontsertidest: Vendade Urbide kevadkontsert 10. mail Tallinnas Arigato spordiklubis, pidu 11. mail Eesti Vabaõhumuuseumis, Elioni heategevuskontsert 10. mail Tallinna Raekoja platsil, "Sulle ma laulan..." 11. mail Pärnu kontserdimajas, kontsert Siiri Sisaski ja Urmas Lattikasega 11. mail Tartu Jaani kirikus

  18. Leigo tulevärk võimsam kui varem / Christel Karits

    Index Scriptorium Estoniae

    Karits, Christel, 1966-

    2005-01-01

    Leigo Järvemuusika 2005 üritustest Leigo vanal järvel: Tallinna rahvusvahelise orelifestivali avakontsert 30. juulil (Veljo Tormise 75. juubeli tähistamine), rockkontsert "Suurte masinate muusika II" 6. aug., Põhjamaade Sümfooniaorkestri kontsert 13. augustil

  19. Uudised : Eesti muusikud Saksamaal. Räätsa teose esiettekanne Saksamaal. Sumera seljatas Sikorski / Merike Utt

    Index Scriptorium Estoniae

    Utt, Merike

    2001-01-01

    U. Vulp, H.-D. Varema ja H. Mätlik esinesid kontsertidega saksa linnades. 18. mail kõlab Saksamaal Baden-Badenis J. Räätsa Kontsert flöödile, kitarrile ja orkestrile. Saksa ülemkohtu positiivsest otsusest L. Sumera kasuks Sumera ja H. Sikorski vahelises kohtuasjas autoriõiguse küsimuses

  20. Magik Markers Trehvis

    Index Scriptorium Estoniae

    2008-01-01

    Müra-rock'i viljelevast USA duost Magik Markers (ansambel osaleb režissöör Veiko Õunapuu uue mängufilmi "Püha Tõnu kiusamine" võtetel, kontsert 15. nov. Tartus klubis Trehv, vt. www.magikmarkers.audiosport.org.)

  1. Laulvad kirjanikud Prima Vistal

    Index Scriptorium Estoniae

    2008-01-01

    Kirjandusfestivalist Prima Vista 8.-11. maini Tartus ja laulvate kirjanike kontsertidest: 9. mail Tõnu Trubetsky kontsert ansambliga The Flovers of Romance, 10. mail Villu Tamme, Mathura, Lauri Sommer, Kaarel B. Väljamäe, Andreas Kalkuni, Kauksi Ülle, Merca ja Aapo Ilves

  2. Eesti Muusika Päevad 2000 : ECPNMi juhatus Tallinnas / Consuelo Diez ; interv. Evelin Kõrvits

    Index Scriptorium Estoniae

    Diez, Consuelo

    2000-01-01

    28.-30. apr. pidas Tallinnas aastakoosolekut ning külastas Eesti Muusika Päevade kontserte ECPNMi (European Conference of Promoters of New Music) juhatus. ECPNMi juhatuse liikmed räägivad uue muusika üritustest oma riikides, muljeid eesti muusika päevadelt

  3. Bagatellid : maailm / Ivo Heinloo

    Index Scriptorium Estoniae

    Heinloo, Ivo

    2011-01-01

    Muusikasõnumeid mujalt maailmast: Romantilist muusikat Silvio Berlusconilt. WOMEXi maailmamuusika auhind Hugh Masekelale. keith Jarreti Brasiilia kontsert vormus plaadiks. Jagati filmimuusika aihindu. David Lynch debüteerib muusikuna. Lahkus Pete Rugolo. Norra kõigi aegade parim plaat valitud

  4. 30. III tutvustab Mooste külalisstuudio Tallinna Kunstihoone galeriis...

    Index Scriptorium Estoniae

    2005-01-01

    Tutvustatakse resideerimisprogrammi võimalusi ning keskkonnakunsti sümpoosioni "PostsovkhoZ". Ürituse kava (John Grzinichi lühifilm MoKSist", Dirk Lange näituse "ööTöö" avamine, ajakirja Palaster esitlus, Marcus Öhrnilt oma projekti, video ja performance'i tutvustus, Kurt Korthalsi, John Grzinichi kontsert jne.)

  5. Uudised : Jaani kirik taastab Normanni oreli. Pärdi "Passio" Tallinna toomkirikus. Esiettekandeid "Raemuusikas" / Heili Vaus-Tamm

    Index Scriptorium Estoniae

    Vaus-Tamm, Heili, 1961-

    2000-01-01

    Jaani Kiriku Oreli Fondi nõukogu volitas 13. apr. toimunud koosolekul juhatust sõlmima eellepingut Dresdeni firmaga Kristian Wegscheider. 21. apr. tuleb Tallinna toomkirikus esitusele A. Pärdi "Passio". 22. apr. toimub "Raemuusika" 1. kontsert sarjas "Ajastu muusikas ja tantsus" pealkirjaga "New York 1980", kus toimub S. Reichi, G. Crumbi ja M. Siimeri teoste eesti esiettekanne

  6. "7 vaprat" ei lõpeta ka suvel / H. S.

    Index Scriptorium Estoniae

    H. S.

    2002-01-01

    Populaarne muusikaedetabelisaade "7 vaprat" läheb juunis ansamblitega Terminaator, Tuberkuloited, No Big Silence, Blacky, Speed Free ja Hell Can Wait suvetuurile. 11. juunil antakse kontsert Tartus, 12. juunil Rakveres, 13. juunil Pärnus ja 15. juunil Tallinnas. Kontsertidest valmivad ka telesaated, saatejuht Villu Tamme

  7. Tuneeslane esineb koos eesti lauluansambliga

    Index Scriptorium Estoniae

    2007-01-01

    Gregoraani ansambli Vox Clamatise ja tuneesia päritolu udimängija ja sufilaulja Dhafer Youssef'i ühisprojektiga "Sacred Voices" anti tänavu maikuus kontserte Suurbritannias ja esinetakse Jõulujazzi raames 12. dets. Tartu Jaani kirikus ning 13. dets. Tallinna Jaani kirikus, esinejatest

  8. Bagatellid : maailm / Nele-Eva Steinfeld, Ivo Heinloo

    Index Scriptorium Estoniae

    Steinfeld, Nele-Eva

    2010-01-01

    Sõnumeid muusikamaailmast: Neeme Järvist saab Orchestre de la Suisse Romande kunstiline ja muusikaline juht. Selgusid ajakirja Gramophone auhinnad. Lahkus koloratuursopran Joan Sutherland. Šotimaal avastati Antonio Vivaldi kodunud kontsert. Arvatavalt Napoleonile kuulunud Stradivari viiul müüdi internetioksjonil kõrge hinnaga. Dave Holland teeb flamenkot. Panama kultuurisaadik Danilo Perez sai auhinna. Jazzmuusik kaebas Snoop Doggi kohtusse

  9. Aeg on inimeste kanda / Sirje Semm

    Index Scriptorium Estoniae

    Semm, Sirje, 1950-

    2009-01-01

    5. septembril meenutati Anna kirikus koos kihelkonna rahvaga aja kulgu ja lugu. Täpselt 325 aastat tagasi, 5. septembril 1684. aastal sai Anna kogudusest iseseisev kogudus. Seda sündmust tähistati piduliku kontsert-jumalateenistusega. Avati ülevaatenäitus kihelkonna ja koguduse ajaloost.

  10. Linn toetab kohalikke kultuuritegijaid / Karin Klaus

    Index Scriptorium Estoniae

    Klaus, Karin

    2008-01-01

    Pärnu linnavalitsuse toetuste saajate seas ka MTÜ Pärnu Kontserdibüroo, MTÜ Pärnu David Oistrahhi Festival, RE Eesti Kontsert Pärnu Kontserdimaja, MTÜ Pärnu Rahvusvaheline Koorifestival, MTÜ Jazzkaare Sõprade Ühing ja MTÜ Suupilliklubi Piccolo

  11. "Üksinduse võlud" kõlavad Cafe Grandis / Kersti Inno

    Index Scriptorium Estoniae

    Inno, Kersti, 1954-

    2008-01-01

    Agentuur Corelli Music avas Pärnu hotellis Victoria "Café Grand muusikasalongi", mis pakub kord kuus pühapäeviti matinée-kontserte. Barokkansambli Corelli Consort kontserdist kavaga "Üksinduse võlud" 15. juunil ja tshellokvarteti C-JAM kontserdist 13. juulil (vt. www.corelli.ee)

  12. Kõlakojas saab kuulata suvemuusikat / Eevi Laanemaa

    Index Scriptorium Estoniae

    Laanemaa, Eevi, 1962-

    2009-01-01

    13. hooaega alustavast kontserdisarjast "Kuressaare "Suvemuusika"" (projektijuht Katre Roolaht, kunstiline juht dirigent Matis Männa): Kuressaare Muusikakooli brassansambli ja Nõmme Muusikakooli brassansambli kontsert 7. juunil, Kuressaare Linnaorkester koos koos Maria Väliga 20. juunil, Big Band Tartu koos laulusolist Kreet Stubenderiga 27. juunil, tšellokvartett C-Jam 12. juulil ja Talsi Brassband Lätist 17. juulil

  13. Maaleht soovitab : Staarisaate vabaõhukontsert. Memmed-taadid kutsuvad peole. Esimene punklaulupidu Rakveres. C-JAM Illuka mõisas

    Index Scriptorium Estoniae

    2008-01-01

    Muusikasündmustest: Telesaate "Eesti otsib superstaari" finalistide kontsert 30. mail Tallinnas Rotermanni keskuse välilaval, Lõuna-Eesti ühisest memmede-taatide-peost 1. juunil Intsikurmu laululaval, esimesest punklaulupeost 7. juunil Rakvere laululaval, tshellokvarteti C-JAM kontserdist sarja "Mõisaromantika" raames 14. juunil Illuka mõisas

  14. Kontserdipeegel / Igor Garshnek

    Index Scriptorium Estoniae

    Garšnek, Igor, 1958-

    2001-01-01

    21.XI Estonia kontserdisaalis esines Eesti-Soome Sümfooniaorkester, kavas Viini klassikud. 23.XI toimus kontsert "Joaquín Rodrigo 100", kus ERSOt juhatas Toomas Vavilov. 30.XI esines Estonia kontserdisaalis ERSO Nikolai Aleksejevi dirigeerimisel, kavas Brahmsi, Stravinski teosed ja Toivo Tulevi Viiulikontsert

  15. Annely Peebo kutsus presidendi kontserdile / Maria Ulfsak

    Index Scriptorium Estoniae

    Ulfsak, Maria, 1981-

    2003-01-01

    Laulja Anneli Peebo kohtus president Arnold Rüütliga, et anda üle kutse Andrea Bocelli ja Annely Peebo ühiskontserdile. Vt. samas: Andrea Bocelli ja Annely Peebo kontsert Tallinna lauluväljakul 23. augustil; Andrea Bocelli

  16. Uudised : Dirigendid Järvid Manchesteris. Jätkub NYYD Ensemble'i kontserdisari. Volkonski ja Uus Tallinna Trio / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    N. ja P. Järvi dirigeerivad Manchesteris, s.h. eesti autorite teoseid. Kontserdisarja "I Got Rhythm" III kontsert toimub 17. märtsil Tartus ja 18. märtsil Tallinnas. Viimasest kontserdist tsüklis "Ajastu muusikas ja sõnas" "Raemuusika" sarjas

  17. Cafe Grandis kõlab lautomuusika / Anneli Remme

    Index Scriptorium Estoniae

    Remme, Anneli, 1968-

    2008-01-01

    Corelli Musicu salongiõhtutel festivali "Fiesta de la Guitarra" raames esineb trio koosseisus Stewart McCoy (lautomängija), Robert Staak (lautomängija) ja Maria Staak (laulja), esinejatest. Esitatakse renessansiaja autorite lautoduette ja -laule. Kontsert 8. nov. Pärnu hotellis sarjas "Café Grandi muusikasalong"

  18. Cafe Grandi muusikasalong pakub värvika barokikava / Kersti Inno

    Index Scriptorium Estoniae

    Inno, Kersti, 1954-

    2008-01-01

    Agentuur Corelli Music avas Pärnu hotellis Victoria "Café Grand muusikasalongi", mis pakub kord kuus pühapäeviti matinée-kontserte. Barokkansambli Corelli Consort kontserdist kavaga "Üksinduse võlud" 15. juunil (vt. www.corelli.ee)

  19. Cafe Grandi muusikasalong pakub värvika barokikava / Silja Joon

    Index Scriptorium Estoniae

    Joon, Silja, 1966-

    2008-01-01

    Agentuur Corelli Music avas Pärnu hotellis Victoria "Café Grand muusikasalongi", mis pakub kord kuus pühapäeviti matinée-kontserte. Barokkansambli Corelli Consort kontserdist kavaga "Üksinduse võlud" 15. juunil (vt. www.corelli.ee)

  20. 80 aastat tagasi : Oktoober 1926 / Mati Märtin

    Index Scriptorium Estoniae

    Märtin, Mati

    2006-01-01

    Muusikasündmustest 80 aastat tagasi: kirikukontserdist Põltsamaal 10. okt., Lääne-Nigula kiriku uue oreli pühitsemisest 17. okt., laulja Aino Tamme kontserdist 31. okt. Tallinna Kaarli kirikus, kontsertidest Tartu Ülikooli Kirikus, noorte kontsert-jumalateenistusest 9. okt. Pärnu Eliisabethi kirikus

  1. 80 aastat tagasi : Mai 1928 / Mati Märtin

    Index Scriptorium Estoniae

    Märtin, Mati

    2008-01-01

    Muusikasündmustest 80 aastat tagasi: Tallinna konservatooriumi IV lennu kontsert-aktusest Estonia kontserdisaalis (esinesid prof. Artur Kapi õpilased), lüürilisest tenorist Rudolf Jõksist, Tallinna Jaani koguduse laulukoori tegemistest, IX üldlaulpeo ettevalmistamisest, August Topman tegi 10. mail luterliku kiriku liturgilise komisjoni koosolekul ettepaneku asutada nelja-aastase kursusega kirikumuusikakool

  2. Pirita klooster tänasest ooperikires / Kersti Inno

    Index Scriptorium Estoniae

    Inno, Kersti, 1954-

    2006-01-01

    Birgitta Festivalist 11.-22. aug. Tallinnas Pirita kloostris. Astor Piazzolla tango-ooperist "Maria de Buenos Aires" (etendused 11. ja 12. aug. Pirita kloostri varemetes). Moskva Helikon Opera etendustest: 15. aug. Mozarti ooper "Tituse halastus" ja 17. aug. Shostakovitshi ooper "Mtsenski maakonna Lady Macbeth". Carl Orffi "Carmina Burana" 18. aug., Verdi "Reekviem" 19. aug. ja kontsert "Tuulatud Thule" 20. augustil

  3. Vozmozhno, võ jeshtshjo ne znajete, tshto...

    Index Scriptorium Estoniae

    2003-01-01

    Lindal leping Universal Music Russiaga. Kraftwergi kontsert kantakse üle televisioonis. L. Minnellit süüdistatakse mehe peksmises. Ilmub J. Cashi senitundmatute lugude kogumik. One Minute Silence läheb laiali. Destiny's Child liikmed esinevad ka sooloprojektidega

  4. Ramón Reichert and Annika Richterich, eds., Digital Material/ism Vol. 1, Issue 1 – Digital Culture and Society

    OpenAIRE

    Pournara, Lizzy

    2017-01-01

    Ramón Reichert and Annika Richterich, eds., Digital Material/ism Vol. 1, Issue 1 – Digital Culture and Society Bielefeld: [transcript] Verlag, 2015. ISBN 978-3-8376-3153-1. Lizzy Pournara Aristotle University of Thessaloniki The issue Digital Material/ism edited by Ramón Reichert and Annika Richterich inaugurates the first volume of the journal Digital Culture & Society. The significance of this volume’s work lies in its attempt to redress the concept of materiality in digital environments an...

  5. Surface magnetization of the Ising ferromagnet in semi-infinite cubic lattice: renormalization group approach

    International Nuclear Information System (INIS)

    Chame, A.M.N.; Tsallis, C.

    1988-01-01

    The behaviour of the spontaneous surface and bulk magnetizations as function of the temperature for the Ising ferromagnet in a semi-infinitre cubic lattice for various ratios JS/JB (JS and JB are the surface and bulk coupling constants, respectively), is studied. The extraordinary transition where the surface maintains its magnetization as the bulk disorders, was study, in particular; a discontinuity on the first derivative of the surface magnetization at the bulk transition temperature was found. The criticality of the system (universality classes, critical exponents and amplitudes) is discussed. An unexpected slight lack of monotonicity of the surface magnetization as a function of JS/JB for JS/JB [pt

  6. Advanced Oxygen Systems for Aircraft (Systemes d’Oxygene Avances)

    Science.gov (United States)

    1996-04-01

    Oxygen Generating System (NAOGS), SAM-TR-80-12, Brooks AFB TX 78235, 1980. 11. Horch TC, Miller RL, Bomar JB, Tedor JB, Holden RD, Ikels KG, and...sieve oxygen generation sys- tem. Data from Horch et al (15). cabin altitude. The minimum and maximum oxygen concen- tration lines depict the...an AV-8A Aircraft; Naval Air Test Center Report No. SY-136R-81, 1981. 15. Horch TC, Miller RL, Bomar JB Jr, Tedor JB, Holden RD, Ikels KG, and

  7. Lähme, naised / Tiina Kuuler

    Index Scriptorium Estoniae

    Kuuler, Tiina, 1969-

    2008-01-01

    Muusikasündmustest: Volbriöö peod 30. apr. Tallinnas, Tõrvas, Tartus ja Rakveres, ansambli Köök, ETV tütarlastekoori ja G. Otsa nim. Tallinna Muusikakooli bigbändi kontsert 29. apr. Viljandis Pärimusmuusika Aidas, löökpillimuusika 25. apr. Viljandis Pärimusmuusika Aidas, ürituses "Cabaret Derrida" 25. apr. Tallinnas Kultuurikatlas ja 30. apr. Tartus Sadamateatris, Anne Veski soolokontsert 1. mail Tallinna Linnahallis, kontsert "Anarhy in the Est 2008" 1. mail Tartus, Tshellokvartett C-JAM 26. apr. Vihterpalu mõisas, öölaulupidu 28. apr. Tartu kevadpäevade raames Kassitoome nõlvadel, No Smoking Orchestra 26. apr. Tallinnas Club Von Überblingenis, löökpillimängijate showgrupp Trash.dk 25. apr. Pärnu kontserdimajas ja 26. apr. Vanemuise kontserdimajas

  8. 80 aastat tagasi : Detsember 1927 / Mati Märtin

    Index Scriptorium Estoniae

    Märtin, Mati

    2007-01-01

    Muusikasündmustest 80 aastat tagasi: Pidulikul jumalateenistusel 11. dets. Tallinna Jaani kirikus kõlas Händeli oratoorium "Messias" koguduse koori, Estonia orkestri ja solistide L. Talviku, A. Kivisilla, H. Kubu ja K. Viitoli esituses (juhatas Enn Võrk, orelil August Topman), 18. dets. Tallinna Toomkirikus esinesid meeskoor ja organist A. Topman, 4. dets. Estonia kontserdisaalis tähistati Oleviste kiriku muusikajuhi Valter Sewighi 25aastast muusikalise tegevuse juubelit, kus esinesid Oleviste laulukoor ja Tallinna Saksa Meeslaulu Ühing Valter Sewighi juhatusel (esitati F. Liszti oratoorium "Legend Pühast Elisabethist"), 13. dets. korraldas Tallinna Loomakaitse Selts kontsert-jumalateenistuse Tallinna Püha-Vaimu kirikus, 11. dets. tähistati Jüri kiriku aastapäeva kontsert-jumalateenistusega, kus esinesid ühendkoorina Rae, Lagedi ja Lehmja laulukoorid (juhatas H. Mets) ja organist Paul Pressnikoff

  9. Commentary on "Surveillance guidelines based on recurrence patterns after radical cystectomy for bladder cancer: the Canadian Bladder Cancer Network experience." Yafi FA, Aprikian AG, Fradet Y, Chin JL, Izawa J, Rendon R, Estey E, Fairey A, Cagiannos I, Lacombe L, Lattouf JB, Bell D, Saad F, Drachenberg D, Kassouf W. Department of Surgery (Urology), McGill University, Quebec, Canada: BJU Int 2012;110(9):1317-23 [Epub 2012 Apr 13].

    Science.gov (United States)

    Kamat, Ashish M

    2013-07-01

    Study Type-Prognosis (cohort) Level of Evidence 2a. What's known on the subject? and What does the study add? Radical cystectomy with pelvic lymph node dissection is recognized as the standard of care for carcinoma invading bladder muscle and for refractory non-muscle-invasive bladder cancer. Owing to high recurrence and progression rates, a two-pronged strict surveillance regimen, consisting of both functional and oncological follow-up, has been advocated. It is also well recognized that more aggressive tumours with extravesical disease and node-positive disease recur more frequently and have worse outcomes. This study adds to the scant body of literature available regarding surveillance strategies after radical cystectomy for bladder cancer. In the absence of any solid evidence supporting the role of strict surveillance regimens, this extensive examination of recurrence patterns in a large multi-institutional project lends further support to the continued use of risk-stratified follow-up and emphasizes the need for earlier strict surveillance in patients with extravesical and node-positive disease. To review our data on recurrence patterns after radical cystectomy (RC) for bladder cancer (BC). To establish appropriate surveillance protocols. We collected and pooled data from a database of 2287 patients who had undergone RC for BC between 1998 and 2008 in eight different Canadian academic centres. Of the 2287 patients, 1890 had complete recurrence information and form the basis of the present study. A total of 825 patients (43.6%) developed recurrence. According to location, 48.6% of recurrent tumours were distant, 25.2% pelvic, 14.5% retroperitoneal and 11.8% to multiple regions such as pelvic and retroperitoneal or pelvic and distant. The median (range) time to recurrence for the entire population was 10.1 (1-192) months with 90 and 97% of all recurrences within 2 and 5 years of RC, respectively. According to stage, pTxN+ tumours were more likely to recur than p ≥ T3N0 tumours and p ≤ T2N0 tumours (5-yr RFS 25% vs. 44% vs. 66% respectively, P < 0.001). Similarly, pTxN+ tumours had a shorter median time to recurrence (9 months, range 1-72 months) than p ≥ T3N0 tumours (10 months, range 1-70 months) or p ≤ T2N0 tumours (14 months, range 1-192 months, P < 0.001). Differences in recurrence patterns after RC suggest the need for varied follow-up protocols for each group. We propose a stage-based protocol for surveillance of patients with BC treated with RC that captures most recurrences while limiting over-investigation. Copyright © 2013. Published by Elsevier Inc.

  10. Tutvustatakse Suzuki meetodit

    Index Scriptorium Estoniae

    2001-01-01

    Jaapanlase Scinichi Suzuki (1898-1991) meetod rajaneb põhimõttel, et kõigil on sünnihetkest alates teatud võimekus omandada mitmesuguseid oskusi, mida saab arendada selleks loodud soodsas keskkonnas. Tema meetod on kasutusel muusikainstrumentide õpetamisel, koolieelikute muusikatundides ning üldainete õpetamisel. 2001.a. märtsis külastab Eestit ja annab kontserte grupp USA Capitali Ülikooli suzukiõpilasi, Kontsertide ajakava

  11. Muusika / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2005-01-01

    Revalia Kammermeeskoor oli edukas Klaipeda XV SHimkuse-nimelisel rahvusvahelisel koorikonkursil. Tänavuste Tallinna toomkiriku X toompäevade motoks on "Eesti, Läti, Leedu - omapäi ja üheskoos". 27. X sõitis Eesti Filharmoonia Kammerkoor kontserditurneele aasiasse. Heliloomingu konkursist noortele tshellistidele. Kultuurifestival "Ost West Kontakte" Saksamaal kutsus oma külalisesinejaks Tartu klaveriduo Ebe Münteli ja Jorma Tootsi. Dirigent Olari Elts sõitis Shotimaale, et anda kontserte Shoti Kammerorkestriga

  12. Siim Nestor soovitab : Eclectica / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2005-01-01

    Nu-weird-folk tähe Kago albumiesitlus 2. sept. Lutsu teatrimajas, Tõnis Mäe ja Chalice'i ühiskontsert H. Treffneri gümnaasiumi hoovilaval, rockkontsert Toomemäel ja elektromuusikaöö "Phennophobia" Sadamateatris 2. sept., EuRoClAsH.CoM&Samizdad - elektomuusikaöö 3. sept. Sadamateatris ja Sven Grünbergi kontsert 4. sept. Peetri kirikus (kaastegev Kiwa) avangard-festivali Eclectica raames Tartus

  13. Uudised : Eesti Filharmoonia Kammerkoor Iisraelis. RAM esineb USAs. Suur koorikontsert Kuno Arengu auks. Riho Pätsi mälestuspäev / Leelo Kõlar

    Index Scriptorium Estoniae

    Kõlar, Leelo, 1927-

    1999-01-01

    EFK T. Kaljuste juhatusel annab 28.09-3.10 Abu-Goshi muusikafestivalil Iisraelis kuus kontserti. RAM alustas kahekümnepäevast USA-turneed. 2. okt. toimub Estonia kontserdisaalis kontsert K. Arengu 70. juubeli puhul. Rahvusraamatukogus toimub 4. okt. R. Pätsi 100. sünniaastapäevale pühendatud teaduskonverents "Muusikakasvatuse minevik ja tänapäev"

  14. Muusikamaailm : Gaudeamuse muusikanädal Amsterdamis. The Last Night of the Prom"s. Uusaastakontsert tuleb Uus-Meremaalt. Baieri Riigiooperi orkestri Euroopa reis. Kimanen jääb aastaks eemale Kuhmost / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    12. sept. lõppes Amsterdamis Gaudeamuse rahvusvaheline muusikanädal "Surprising New Sounds". Promenaadikontserdid Londoni Royal Albert Hallis (16.07-11.09) lõppesid suure lõppkontserdiga. Traditsioonilise uusaastakontserdi asemel Viinis kantakse sel aastavahetusel üle kontsert Uus-Meremaalt Gisborne"ist. Seoses R. Straussi mälestusaastapäevaga toimus Baieri Riigiooperi orkestri ringreis Euroopas. 30 aastat Kuhmo kammermuusikafestivali juhtinud S. Kimanen võtab aasta puhkust

  15. Kaks Jeanne d'Arci ja Nosferatu / Sirje Normet

    Index Scriptorium Estoniae

    Normet, Sirje

    2006-01-01

    IX Pimedate Ööde Filmifestival. Lähemalt kontsert-filmiseansist Tallinnas, kus Theodor Dreyeri tummfilmi "Jeanne d'Arci kannatused" (Prantsusmaa 1928) saatis prantsuse muusik Hector Zazou; Dzhanik Faizijevi mängufilmist "Türgi gambiit" (Venemaa 2005); Friedrich Wilhelm Murnau õudusfilmist "Nosferatu - õuduste sümfoonia" (Saksamaa 1922), mida näidati 1. dets. Viru Keskuses ja mille taustaks mängis ansambel Kriminaalne Elevant

  16. Täna austatakse kunstnik Edgar Valteri ja helilooja Raimo Kangro mälestust

    Index Scriptorium Estoniae

    2009-01-01

    Edgar Valteri 80. sünniaastapäeva tähistav konverents, tema raamatu "Karid ja kõrgused. I" (Tartu : Elmatar, 2009) esitlus ning Helle Laanpere ja Külli Leppiku koostatud näituse "Edgar Valter 80. Vaikse vaatlemise keeles" avamine 21. septembril Eesti Rahvusraamatukogus. Eesti Lastekirjanduse Keskuse Edgar Valteri galeriis näitus "Ilusad pildid". Estonia kontserdisaalis Raimo Kangro 60. sünniaastapäevale pühendatud kontsert

  17. Uudised : Reggae. Tants. Balletiskandaal

    Index Scriptorium Estoniae

    2005-01-01

    18. veebr. Von Krahlis reggaepeol "Bashment" ska-ansambli Kontrapanda esinemisest ja debüütsingli "Kui tantsuhallis möllab ska!" esitlusest. Hollandi tantsukompanii Club guy & roni ja NYYD Ensemble'i kontsert-tantsuetendusest "Myrrh and Cinnamon" 22.-23. veebr. Tallinnas Kanuti Gildi saalis ja 25.-26. veebr. Tartu Sadamateatris. Jekaterinburgi õigeusklike tahtest oma linnas keelata vene Keiserliku Balleti külalisetendust - balletti "Rasputin"

  18. Muusika / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2005-01-01

    Operatsioon B. Eesti Lastekoor võitis Varssavis koorifestivalil noortekooride kategoorias esikoha. 13. XI toimub Teatri- ja Muusikamuuseumis kontsert "J. S. Bachi minimaraton". Tubin Saksamaal ja Soomes. Stockholmi kontserdimaja korraldatud festivali nimiheliloojaks on tänavu John Adams. Olari Elts Riias ja Viinis. Indrek Laul kutsuti esinema Bostoni Televisiooni, kuhu oli selleks puhuks toodud Estonia klaver. Rahvusraamatukogu muusikasaalis avatakse näitus "Enno ja Viive Mäemetsa kingitus Eesti Rahvusraamatukogule: 10 aastat = 500 CDd"

  19. Põhjataeva peegeldused II

    Index Scriptorium Estoniae

    2007-01-01

    Tekstiilikunsti ja sepise õpitoad Põhjala põlisrahvaste kultuurifestivalil Palmse mõisas 21.-26. V 2007. Osalevad kunstnikud Eestist, Soomest, Taanist, Rootsist. 26. V näituse avamine Palmse härjatallis ja Evelin Samueli kontsert mõisas. Jean-Loup Rousselot' loengud põhjarahvaste kultuurist 21., 22. ja 25. V Palmse mõisas, 23. V Rakvere linnuses, 24. V Käsmu meremuuseumis

  20. Bonzo tuuritab kirikutes

    Index Scriptorium Estoniae

    2007-01-01

    Laulja Bonzo ja Ahti Bachblumi kirikukontserdituurist kavaga "Mees ja Jumal" 29. juulil Haljalas, 30. juulil Harjumaal Leesis, 31. juulil Käsmus, 1. aug. Vainupeal, 2. aug. Ida-Virumaal Lüganusel, 3. aug. Hiiumaal Pühalepas, 5. aug. Harjumaal Rannamõisas ja 6. aug. Ida-Virumaal Pühajõel. Bonzol koos ansambliga Jäääär kontsert ka 5. aug. Kohilas

  1. Muusika

    Index Scriptorium Estoniae

    2004-01-01

    Tapiola koori esinemistest Eestis. Paul Himma valiti Opera Europa juhatusse. EMA prorektor Marje Lohuaru valiti Luzernis Euroopa kunstikõrgkoole ühendava koostöövõrgu ELIA juhatusse. 15. XI toimub TÜ ajaloomuuseumis kontsert, millega tutvustatakse Elleri-kooli uut klavessiini. 8. XI lõppes Estonia kontserdisaalis Eesti noorte interpreetide konkurssfestivali "Con brio '04" eelvoor. Eesti Kitarriselts korraldab Tartus kitarrimuusikapäevi "Fiesta de la guitarra". Rahvusooper Estonia korraldab konkursi lauljatele vabade kohtade täitmiseks ooperikooris

  2. Pop nädal : popuudised. UK Album Chart Top 20

    Index Scriptorium Estoniae

    2002-01-01

    1. juulil tuleb müügile ansambli Prodigy uus singel "Baby's Got a Temper". Pet Shop Boys'i uue albumi "Release" tuuri avakontsert oli Hispaanias. Inglise juhtiv synth-electropop-artist Mesh planeerib oma teist turneed Euroopas, Põhja- ja Kesk-Ameerikas, Rootsis ja Venemaal. Depeche Mode'i liikmed lõpetavad oma sooloalbumeid. Rammsteini kontsert Moskvas 19. juulil jääb ära

  3. Bedwetters kihutab Eesti tuurile

    Index Scriptorium Estoniae

    2007-01-01

    Münchenis MTV Euroopa muusikaauhindade jagamisel Uue Euroopa Heli kategoorias lauluga "Dramatic Letter to Conscience"esikoha võitnud Pärnu pop-punkbändist Bedwetters (kontserdid 29. nov. Tartus, 30. nov. Rakveres, 1. dets. Haapsalus ja 2. dets. Pärnus, soojendusbändiks Driven, koostöös MTVga korraldatavaid kontsertõhtuid juhivad MTV VJd Martin Veismann ja Piret Järvis)

  4. Täna kell 19 avatakse Kultuuritehases Polymer...

    Index Scriptorium Estoniae

    2005-01-01

    EKA Erasmuse programmi vahetusüliõpilaste ja nende eesti sõprade multimeediaüritus "PC - rahvusvahelised lained Tallinnas!". Osalevad Austria, Mehhiko, Saksamaa, Itaalia, Soome, Eesti, Poola, Hispaania, Prantsusmaa, Belgia, Šveitsi, Portugali, Tšehhi, USA ja Läti 2004. ja 2005. a. Eestis elanud kunstiüliõpilased. Kunstiprogrammile järgneb kontsert ja pidu DJde Andres Lõo, Valner Valme ja Christoph Höschele osavõtul

  5. Eesti Filharmoonia Kammerkoor esineb kanalis Mezzo

    Index Scriptorium Estoniae

    2004-01-01

    Üleeuroopalise klassikalise muusika telekanali Mezzo ja ETV koostöös valiti välja kolm telesaadet telekanalis Mezzo tutvustamaks Euroopale Eesti süvakultuuri: 2002 suvel Tallinna Rootsi Mihkli kirikus Tallinna Kammerorkestri ja Kammerkoori kontsert kavaga "Baltic Voices" on eetris 14-16. apr.õhtul, teistel õhtutel ka Erkki-Sve Tüüri teos "Ardor" ning Vanemuise teatri balletitrupi tantsuetendus "Fluxus"

  6. Suur 'Alternatsioon 98' / Tiiu Leis, Al Paldrok

    Index Scriptorium Estoniae

    Leis, Tiiu

    1998-01-01

    Kaheosalise Pärnu kultuuriürituse 'Alternatsioon 98' tutvustus: 8.-9. mail kujutav-, video- ja tegevuskunst; 5.-6. juunil muusika, tants, sport, mood. 8. mai: punkansambli 'Kurjam' kontsert, avatakse näitused 'Alternatsioon 2' Soolalaos, Tallinnas keelatud 'Eesti Vabariik 80' ja Taave Tuutma 'Rikaste toetamise fond', performance'id Rüütli tänaval; 9. mai: seksuaalvähemuste ja teiste protestimarss.

  7. Eesti joonisfilm võitis Indias elevandi

    Index Scriptorium Estoniae

    2003-01-01

    Eesti Joonisfilmi "Karl ja Marilyn" : stsenarist, režissöör, kunstnik, värvikunstnik ja monteerija Priit Pärn ja Kaspar Jancise "Weitzenbergi tänav" võitsid Inglismaal Norwichis rahvusvahelisel animafilmide festivalil vastavalt esikoha rahvusvahelises ja diplomi tudengifilmide kategoorias. Heiki Ernitsa ja Janno Põldma "Kontsert porgandipirukale" sai aga Indias Hyderabadis lastefilmide festivalil parima animafilmi auhinna - Hõbedase Elevandi

  8. Maailmakülas kõlab talvemuusika

    Index Scriptorium Estoniae

    2006-01-01

    Kontsertidest Maailmaküla muusikafestivali raames: Johansonid 15. nov. Eesti eri paikades, ansambel Metsatöll 6. dets.Tartus Vanemuise kontserdimajas ning Metsatöll ja Rahvusmeeskoor 7. dets. Tallinnas Rock Cafés, ansamblid Oort, Vägilased ja Svjata Vatra 8. dets. Rock Cafés, segakoor Noorus alustab kontserte 9. detsembril kavaga "Lapsemeelsed jõulud" Eesti eri paikades

  9. Jolkinolide B induces apoptosis of colorectal carcinoma through ROS-ER stress-Ca2+-mitochondria dependent pathway.

    Science.gov (United States)

    Zhang, Jing; Wang, Yang; Zhou, Ye; He, Qing-Yu

    2017-10-31

    Colorectal carcinoma (CRC) remains one of the leading causes of death in cancer-related diseases. In this study, we aimed to investigate the anticancer effect of Jolkinolide B (JB), a bioactive diterpenoid component isolated from the dried roots of Euphorbia fischeriana Steud, on CRC cells and its underlying mechanisms. We found that JB suppressed the cell viability and colony formation of CRC cells, HT29 and SW620. Annexin V/PI assay revealed that JB induced apoptosis in CRC cells, which was further confirmed by the increased expression of cleaved-caspase3 and cleaved-PARP. iTRAQ-based quantitative proteomics was performed to identify JB-regulated proteins in CRC cells. Gene Ontology (GO) analysis revealed that these JB-regulated proteins were mainly involved in ER stress response, which was evidenced by the expression of ER stress marker proteins, HSP90, Bip and PDI. Moreover, we found that JB provoked the generation of reactive oxygen species (ROS), and that inhibition of the ROS generation with N-acetyl L-cysteine could reverse the JB-induced apoptosis. Confocal microscopy and flow cytometry showed that JB treatment enhanced intracellular and mitochondrial Ca 2+ level and JC-1 assay revealed a loss of mitochondrial membrane potential in CRC after JB treatment. The mitochondrial Ca 2+ uptake and depolarization can be blocked by Ruthenium Red (RuRed), an inhibitor of mitochondrial Ca 2+ uniporter. Taken together, we demonstrated that JB exerts its anticancer effect by ER stress-Ca 2+ -mitochondria signaling, suggesting the promising chemotherapeutic potential of JB for the treatment of CRC.

  10. Autistic Spectrum Disorder and Assistive Technology: Action Research Case Study of Reading Supports

    Science.gov (United States)

    Lindsey, Pam

    2012-01-01

    This descriptive action research experience with case study procedures examined the use of best practices paired with assistive technologies as interventions to individualize fiction reading instruction for a high-functioning elementary student, JB (pseudonym), diagnosed with autistic spectrum disorder. JB's instructional, reading goals were to…

  11. Subduction of the Rivera plate beneath the Jalisco block as imaged by magnetotelluric data

    OpenAIRE

    Corbo-Camargo, Fernando; Arzate-Flores, Jorge Arturo; Álvarez-Béjar, Román; Aranda-Gómez, José Jorge; Yutsis, Vsevolod

    2013-01-01

    Two magnetotelluric (MT) profiles perpendicular to the trench provide information on the subduction of the Rivera plate under the Jalisco block (JB). The geometry of the subducting slab is inferred by the anomalous conductor on the top of the profile in the central part of the JB. High conductivity zones (

  12. Jolkinolide B inhibits glycolysis by downregulating hexokinase 2 expression through inactivating the Akt/mTOR pathway in non-small cell lung cancer cells.

    Science.gov (United States)

    Gao, Xiang; Han, Han

    2018-06-01

    Jolkinolide B (JB), a bioactive compound isolated from herbal medicine, has been found to inhibit tumor growth by altering glycolysis. However, whether glycolysis is influenced by JB in non-small cell lung cancer (NSCLC) cells and the mechanism remain unknown. The aim of the present study was to evaluate the effect of JB on the glycolysis in NSCLC cells and the underlying molecular mechanism. The results showed that JB treatment inhibited cell viability of A549 and H1299 cells in a concentration-dependent manner. JB reduced the glucose consumption, lactate production, and HK2 expression. The expressions of p-Akt and p-mTOR were also decreased by JB treatment. Knockdown of HK2 reduced glucose consumption and lactate production. Inhibition of the Akt/mTOR pathway decreased HK2 expression and inhibited glycolysis. In conclusion, the results indicated that JB inhibits glycolysis by down-regulating HK2 expression through inactivating the Akt/mTOR pathway in NSCLC cells, suggesting that JB might be a potential therapeutic agent for the treatment of NSCLC. © 2018 Wiley Periodicals, Inc.

  13. Jaspine B induces nonapoptotic cell death in gastric cancer cells independently of its inhibition of ceramide synthase.

    Science.gov (United States)

    Cingolani, Francesca; Simbari, Fabio; Abad, Jose Luis; Casasampere, Mireia; Fabrias, Gemma; Futerman, Anthony H; Casas, Josefina

    2017-08-01

    Sphingolipids (SLs) have been extensively investigated in biomedical research due to their role as bioactive molecules in cells. Here, we describe the effect of a SL analog, jaspine B (JB), a cyclic anhydrophytosphingosine found in marine sponges, on the gastric cancer cell line, HGC-27. JB induced alterations in the sphingolipidome, mainly the accumulation of dihydrosphingosine, sphingosine, and their phosphorylated forms due to inhibition of ceramide synthases. Moreover, JB provoked atypical cell death in HGC-27 cells, characterized by the formation of cytoplasmic vacuoles in a time and dose-dependent manner. Vacuoles appeared to originate from macropinocytosis and triggered cytoplasmic disruption. The pan-caspase inhibitor, z-VAD, did not alter either cytotoxicity or vacuole formation, suggesting that JB activates a caspase-independent cell death mechanism. The autophagy inhibitor, wortmannin, did not decrease JB-stimulated LC3-II accumulation. In addition, cell vacuolation induced by JB was characterized by single-membrane vacuoles, which are different from double-membrane autophagosomes. These findings suggest that JB-induced cell vacuolation is not related to autophagy and it is also independent of its action on SL metabolism. Copyright © 2017 by the American Society for Biochemistry and Molecular Biology, Inc.

  14. Detecting Age in Online Chat

    Science.gov (United States)

    2009-09-01

    worried 1.000 2 2 sting 1.000 2 2 today... 1.000 2 2 yes! 1.000 4 4 choice 1.000 4 4 whenever 1.000 2 2 panties 1.000 2 2 pie. 1.000 2 2 baby 1.000...0.995 21 25 panties 1.000 2 2 cough 0.994 6 5 hobo 1.000 3 3 lizzie 0.994 5 6 giggles. 1.000 2 2 snow 0.994 5 6 sam 1.000 3 3 muh 0.994 5 6 uses 1.000...2 to roll 1.000 2 2 hair is 1.000 3 3 beast </post> 1.000 2 2 all girls 1.000 2 2 a waste 1.000 4 4 subject </post> 1.000 2 2 the inside 1.000 3 3

  15. Electrophysiological markers predicting impeding AV-block during ablation of atrioventricular nodal reentry tachycardia.

    Science.gov (United States)

    Fragakis, Nikolaos; Krexi, Lydia; Kyriakou, Panagiota; Sotiriadou, Melani; Lazaridis, Charalambos; Karamanolis, Athanasios; Dalampyras, Panagiotis; Tsakiroglou, Stelios; Skeberis, Vassilios; Tsalikakis, Dimitrios; Vassilikos, Vassilios

    2018-01-01

    Radiofrequency (RF) ablation of the slow pathway (SP) in atrioventricular nodal reentry tachycardia (AVNRT) is occasionally complicated with atrioventricular block (AVB) often predicted by junctional beats (JB) with loss of ventriculo-atrial (VA) conduction. We analyzed retrospectively 153 patients undergoing ablation of SP for typical AVNRT. Patients were divided into two age groups: 127 ≤ 70 years and 26 > 70 years. We analyzed the interval between the atrial electrogram in the His-bundle position and the distal ablation catheter [A(H)-A(RFd)] and between the distal ablation catheter and the proximal coronary sinus catheter [A(RFd)-A(CS)] before RF applications with and without JB. We evaluated if these intervals can be used as predictors of JB incidence and also of JB with loss of VA conduction. We also assessed if age influences the risk of loss of VA conduction. The A(H)-A(RFd) and A(RFd)-A(CS) intervals were significantly shorter in RF applications causing JB than those without JB (33 ± 11 ms vs 39 ± 9 ms, P JB with VA block than those with VA conduction (29 ± 11 ms vs 35 ± 11 ms, P  70 years had shorter intervals (36 ± 11 ms vs 29 ± 8 ms, P  =  0.012, 17 ± 8 ms vs 13 ± 7 ms, P  =  0.027, respectively), while VA block was more common in this age group. The A(H)-A(RFd) and A(RFd)-A(CS) intervals can be used as markers for predicting JB occurrence as well as impending AVB. JB with loss of VA conduction occur more often in older patients possibly due to a higher position of SP. © 2017 Wiley Periodicals, Inc.

  16. Impacts of NOx reducing antioxidant additive on performance and emissions of a multi-cylinder diesel engine fueled with Jatropha biodiesel blends

    International Nuclear Information System (INIS)

    Palash, S.M.; Kalam, M.A.; Masjuki, H.H.; Arbab, M.I.; Masum, B.M.; Sanjid, A.

    2014-01-01

    Highlights: • Environmental benefits of JB blends were found but adverse impact on NO x . • Addition of 0.15% (m) DPPD in JB20, average reduction in NO up to 16.54%. • In some cases, engine power is reduced with DPPD additive. • Emissions of HC and CO for JB blends with DPPD were lower compared to diesel. • Addition of DPPD in JB blends reduction of EGT was found. - Abstract: Energy requirements are increasing rapidly due to fast industrialization and the increased number of vehicles on the road. The use of biodiesel in diesel engines instead of diesel results in the proven reduction of harmful exhaust emissions. However, most researchers have reported that they produce higher NO x emissions compared to diesel, which is a deterrent to the expansion of the market for these fuels. Several proposed pathways try to account for NO x formation during the combustion process. Among them, the Fenimore mechanism explains that fuel radicals formed during the combustion process react with nitrogen from the air to form NO x . It could be proposed that if these radical reactions could be terminated, the NO x formation rate for biodiesel combustion would decrease. An experimental study was conducted on a four-cylinder diesel engine to evaluate the performance and emission characteristics of Jatropha biodiesel blends (JB5, JB10, JB15 and JB20) with and without the addition of N,N′-diphenyl-1,4-phenylenediamine (DPPD) antioxidant. For each tested fuel, the engine performance and emissions were measured at engine speeds 1000–4000 rpm at an interval of 500 rpm under the full throttle condition. The results showed that this antioxidant additive could reduce NO x emissions significantly with a slight penalty in terms of engine power and Brake Specific Fuel Consumption (BSFC) as well as CO and HC emissions. However, when compared to diesel combustion, the emissions of HC and CO with the addition of the DPPD additive were found to be nearly the same or lower. By the

  17. Jaani kirik Peterburis = St. John's Church in St. Petersburg / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-

    2011-01-01

    1860. a. Peterburis avatud Jaani kirikust (arhitekt Harald Julius von Bosse) ja neoromaani stiilis kirikuhoone taastamisest. Maja taastati väliselt oma ajaloolisel kujul, kuid interjöör loodi kaasaegseid vajadusi arvestades. Sisearhitekt Juta Lember, tema selgitused. Tellija: Eesti Kontsert. Projekteerijad: НИИ Спецпроектреставрация, E. J. Merkurjevi Arhitektuuribüroo. Eestis valmistati eritellimusel mööbel,saali valgustid, kirikuinventar. Projekt: 2005-2010, valmis: 2011

  18. Lähme, naised / Tiina Kuuler

    Index Scriptorium Estoniae

    Kuuler, Tiina, 1969-

    2008-01-01

    Muusikasündmustest: "TRE Supershow" 8. veebr. Tartus A Le Coqi Spordimajas, Tõnis Mägi ja Co 6. veebr. Häädemeeste Miikaeli kirikus, Pille Lille Muusikute Toetusfondi Galakontsert 6. veebr. Estonia kontserdisaalis, muusikal "Lumivalgeke ja 7 pöialpoissi" 3. j 10. veebr. Rahvusooperis Estonia, kontsertetendus "Väike Versailles" 2. veebr. ja 3. märtsil Estonias, "Mustlasvanker" 5. veebr. Estonias, Eesti Vabariigi 90. sünnipäevale pühendatud kontsertõhtust 7. veebr. Kuressaare Kultuurikeskuses, kontserdist "Vivaldi "Aastaajad"" 1. veebr. Pärnu Kontserdimajas ja 2. veebr. Jõhvi Kontserdimajas

  19. Lähme, naised / Tiina Kuuler

    Index Scriptorium Estoniae

    Kuuler, Tiina, 1969-

    2008-01-01

    Muusikasündmustest: Jääboileri kontsert 22. veebr. Tartus Genialistide klubis, "EV 90: Palju õnne, Eesti!" (esinevad Kuressaare lauljad ja rahvatantsijad, tantsuks ansambel Anna Minna) 23. veebr. Kuressaare kultuurikeskuses, Metsatöllu sünnipäev 23. veebr. Tallinnas klubis Woodstock, Etnosari: Vägilased 27. veebr. Estonia Talveaias, Zemfira 23. veebr. Eesti Näituste messikeskuses, Winterfest 22. veebr. Tallinnas Kultuurikatlas, Marju Länik 27. veebr. Türi kultuurimajas, Chris Rea 23. veebr. Tallinnas Saku Suurhallis

  20. Bagatellid : maailm / Nele-Eva Steinfeld, Ivo Heinloo

    Index Scriptorium Estoniae

    Steinfeld, Nele-Eva

    2011-01-01

    Muusikasõnumeid maailmast: Helsingis avati uus kultuurikeskus Helsingi Musiikkitalo. Montrealis sain endale uue kontserdimaja La Maison Symphonique de Montreal. Lahkus tenor Salvatore Licitra. James Levine loobus Metropolitan Opera sügishooaja etenduste dirigeerimisest. Iisraeli Filharmoonikute kontsert BBC Promsil häiritud. Deutsche Grammophon kolis Berliini. Siemens loobub Bayereuthi festivali spondeerimisest. Kultuurivahetus Viini Riigiooperi ja La Scala ooperiteatrite vahel. MTV premeeris popimaailma tippe. Hiina tsenseerib Lääne popmuusikuid. uus Grammyde jagamise kord põhjustab pahameelt. Return to Forever taas koos. Chick Corea juubel

  1. Eesti muusikud Pariisis / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2006-01-01

    Mais esines Pariisis Notre-Dame'i kirikus organist Aare-Paul Lattik, juunis oli rahvusvahelisel Saint-Denis' festivalil Paavo Järvi juhatusel esitusel Gustav Mahleri teine sümfoonia "Ülestõusmine" (mida aprillis New Yorgi Riverside'i kirikus juhatas Neeme Järvi), kahel festivali lõpukontserdil esines Eesti Filharmoonia Kammerkoor. 5. juulil toimus Pärnus David Oistrahhi festivalil raames Paavo Järvi juhatusel ERSO kontsert (orkestri kontsertmeistriks külalisena oli viiuldaja Kirsti Kuusk Helsingborgist)

  2. Pop nädal : popuudised. Venemaa MTV.RU edetabel TOP 20

    Index Scriptorium Estoniae

    2002-01-01

    Inglismaa gothic-metal kvintett Paradise Lost annab välja esimese DVD "Evolve" ja uue plaadialbumi. Marc Almond esines 23. juunil Moskvas ja annab 24. juunil välja oma esimese kontsert-DVD "Marc Almond - A Willing Sinner Live In Berlin". 15. juulil saabub müügile Marilyn Mansoni DVD "Guns, God and Government". Ansambel Rammstein 15. juunil Soomes Provinssirockil, 17. juunil Peterburis St. Petrovski staadionil, 19. juunil Moskvas Tushino lennuväljal ja 21. juunil Kiievis

  3. Muusikamaailm : Tipphetked kontserdimajades / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    New Yorgis Carnegie Hallis esinesid Berliini filharmoonikud. Bostoni sümfooniaorkester alustas hooaega dirigent Seiji Ozawa juhatusel. Tokyo Bunka Kaikani saalis andis kontserte Baieri Riigiooper peadirigent Zubin Mehta juhatusel.Amsterdamis Concertgebouws tuli maailmaesiettekandele John Adamsi orkestrioopus. Dresdenis toimusid XV uue muusika päevad. Londonis Barbicani keskuses tutvustai UKs Karlheinz Stockhauseni elektronmuusika retrospektiivi.Ruhrimaa linnades korraldataval a capella koorifestivalil esineb ka Madalmaade Kammerkoor Tõnu Kaljuste juhtimisel.Segovia 32. kammermuusikafestivalil oli sündmuseks 83-aastase itaalia-ameerika viiuldaqja Ruggiero Ricci esinemine. Vilniuses toimunud nüüdismuusika festivalil "Gaida" esineb ka NYYD Ensemble Olari Eltsi juhatusel

  4. Kuidas tähistame TÜ 375. aastapäeva? / Varje Sootak

    Index Scriptorium Estoniae

    Sootak, Varje, 1946-

    2007-01-01

    TÜ 375. aastapäeva tähistamise ürituste seas ka kontserdid: 5. okt. Vanemuise kontserdimajas "Kuningas Gustavi gala" (esinevad ülikoori esinduskoorid koos Vanemuise Sümfooniaorkestriga ja Viljandi Kultuuriakadeemia kultuurikollektiivid, sh. muusikud), 6. okt. AthenasTRÜ ansamblid Rajacas, Rentaablus, Meedium ja Fix, 3. sept. Raekoja platsil uue kooliaasta alguse kontsert, 5. okt. üliõpilasmajas heategevuskontsert, sept. lõpus esitavad ülikoolide koorid Tallinnas ja Pärnus Carl Orffi lavakantaadi "Carmina BUrana"

  5. Pop nädal : Popuudised. Edetabel The Billboard 200 Top 20. Plaadiarvustus : The Jesus and Mary Chain - 21 Singles / Aivar Meos

    Index Scriptorium Estoniae

    Meos, Aivar

    2002-01-01

    8. okt. saabub müügile ansambli Jurassic 5 uus album "Power In Numbers", millel laulab ka Nelly Furtado. Šokk-rokkar Marilyn Manson avaldab peatselt uue kontsert-video/DVD "Guns, God and Government". Intellektuaalset industriaalmuusikat viljelev ansambel Einstürzende Neubauten annab oma Interneti aadressi: http://www.neubauten.org., teatades, et 23. sünnipäeva tähistamiseks peaks 2003. aasta kevadeks valmima bändil uus album. Christina Aguilera uuest singlist "Let's Get Dirty". Ansamblist The Jesus and Mary Chain

  6. 80 aastat tagasi : Juuli-august 1928 / Mati Märtin

    Index Scriptorium Estoniae

    Märtin, Mati

    2008-01-01

    Muusikasündmustest 80 aastat tagasi: 30. juunist 2. juulini toimus IX üldlaulupidu, Tallinna Kaarli kirikus kandis linnade ühendkoor August Topmanni juhatusel ette Händeli oratooriumi "Messias", 1. juulil esines Tallinna Jaani kirkus segakoor Suomen Laulu, 8. juulil Petseri uues lurteri kirikus toimus venekeelne kontsert-jumalateenistus Petseri kloostri- ja maakonna kooride ja 7. jalaväe rügemendi orkestri kaastegevusel, 5. aug. Rapla kirikus esines Johannes Jürgensoni (Juhan Jürme) juhatusel Tallinna Kaarli Lauluselts

  7. Getting Around. Unit I: Public Transportation. Student Lesson #4. English for Living.

    Science.gov (United States)

    New York State Education Dept., Albany. Bureau of Bilingual Education.

    To assist the youthful learner of English as a second language in dealing with handling urban public transportation, a series of dialogs, comprehension questions, readings, and points of discussion are presented. The text is illustrated. (JB)

  8. The Relationship between Expansion in Higher Education and the Labour Market in Norway.

    Science.gov (United States)

    Aamodt, Per O.; Arnesen, Clara A.

    1995-01-01

    This article describes quantitative growth in higher education and overall trends in the Norwegian economy and argues that the policy of expanding the capacity of higher education is being used as a buffer against youth unemployment. (JB)

  9. South African Medical Journal - Vol 94, No 8 (2004)

    African Journals Online (AJOL)

    Imiglucerase low-dose therapy for paediatric Gaucher disease - a long-term cohort study · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. R Heitner, S Arndt, JB Levin ...

  10. Mining Pribram in science and technology. Proceedings of Session U - Mineral raw materials treatment

    International Nuclear Information System (INIS)

    Tomasek, J.; Vetejska, K.

    1987-01-01

    The proceedings of session ''Mineral raw materials treatment'' contain 27 papers of which only one deals with the application of nuclear technology, namely, the effect of fast electrons on the magnetic properties of the polymetallic Rudniany ore. (J.B.)

  11. Household Density and Infant Care in an East African Society

    Science.gov (United States)

    Munroe, Ruth H.; Munroe, Robert L.

    1971-01-01

    A cross-cultural relationship between household density and infant indulgence was investigated among Logoli infants in East Africa. Findings were taken as supportive of the view that socialization practices are influenced by ecological variables. (Author/JB)

  12. The Sphinx's Riddle: Life and Career Cycles.

    Science.gov (United States)

    Burack, Elmer H.

    1984-01-01

    Career cycles should be considered apart from life cycles, even though the two are interrelated. This essay examines five theories about life and career cycles, and offers insights into their limitations and potential uses. (JB)

  13. Research Article (New England Journal of Medicine) Effect of ...

    African Journals Online (AJOL)

    2010-01-28

    Jan 28, 2010 ... assess the efficacy, safety, and immunogenicity of Rotarix. ..... statistical analysis; Y. Guerra and the safety team for management of safety information and C. .... Page NA, de Beer MC, Seheri LM, Dewar JB, Steele AD. The.

  14. Medicines for ADHD

    Science.gov (United States)

    ... nih.gov/pubmed/24571756 . Prince JB, Wilens TE, Spencer TJ, Biederman J. Pharmacotherapy of attention-deficit/hyperactivity ... reviewed by David Zieve, MD, MHA, Medical Director, Brenda Conaway, Editorial Director, and the A.D.A. ...

  15. Genetics Home Reference: vitiligo

    Science.gov (United States)

    ... SA, Fain PR, Ferrara TM, Ben S, Riccardi SL, Cole JB, Gowan K, Holland PJ, Bennett DC, Luiten ... medicine? What is newborn screening? New Pages Lyme disease Fibromyalgia White-Sutton syndrome All New & Updated Pages ...

  16. The Battle of Algiers: A War of Liberation

    Science.gov (United States)

    Carter, Margaret

    1971-01-01

    The author describes the film, The Battle of Algiers," and suggests discussion ideas for a classroom analysis: emotional response; labels, e.g., enemy; responsibility; alternatives; justice; warfare and crime. Learning activities and resources are also suggested. (Author/JB)

  17. Psychiatry in primary care using the three-stage assessment

    African Journals Online (AJOL)

    psychiatrists working in psychiatric institutions. Therefore, the ... may be less dramatic, it would be a mistake to assume that assessing a patient with .... JB feels that the stress in .... flexible and adaptable to the unique needs of each patient.

  18. Genetics Home Reference: Pallister-Hall syndrome

    Science.gov (United States)

    ... Manchester DK, Marcelis C, Mazzanti L, McCann E, McDonald MT, Mendelsohn NJ, Moeschler JB, Moghaddam B, Neri ... 10 All Bulletins Features What is direct-to-consumer genetic testing? What are genome editing and CRISPR- ...

  19. Genetics Home Reference: Greig cephalopolysyndactyly syndrome

    Science.gov (United States)

    ... Manchester DK, Marcelis C, Mazzanti L, McCann E, McDonald MT, Mendelsohn NJ, Moeschler JB, Moghaddam B, Neri ... 10 All Bulletins Features What is direct-to-consumer genetic testing? What are genome editing and CRISPR- ...

  20. Genetics Home Reference: hepatic veno-occlusive disease with immunodeficiency

    Science.gov (United States)

    ... Donald JA, Kirk EP, Ziegler JB, Salzer U, McDonald GB, Wong M, Lindeman R, Buckley MF. Mutations ... 10 All Bulletins Features What is direct-to-consumer genetic testing? What are genome editing and CRISPR- ...

  1. Improving the Work of the School Lenin Museums

    Science.gov (United States)

    Sarafannikova, G. P.

    1970-01-01

    A number of exemplary compositions and uses of School Lenin Museums are mentioned in this article which brings out the important function of these museums in the political-ideological education of youth. (JB)

  2. The Tasks of Educational Psychology in the Light of the Decisions of the Twenty-Fourth Congress of the CPSU

    Science.gov (United States)

    Bozhovich, L. I.; Chudnovsky, V. E.

    1973-01-01

    The task of educational psychology is to create flexible but scientifically substantiated methods of determining personality traits and the degree of their development. Emphasis here is on the need for self discipline as a major objective in child rearing. (JB)

  3. European Economic Integration

    Science.gov (United States)

    Huston, James A.

    1971-01-01

    Recounts the history and problems of European Economic Integration from the first post World War II organization, the OEEC, to the EEC (Common Market) and the EFTA. Suggestions for further reading are included. (JB)

  4. Use of label-free protein chips for proteomics of oncohematological diseases

    Czech Academy of Sciences Publication Activity Database

    Pimková, K.; Suttnar, J.; Bocková, Markéta; Homola, Jiří; Dyr, J. E.

    2012-01-01

    Roč. 58, SUPPL. 2 (2012), 2S84-2S89 ISSN 0042-773X Institutional support: RVO:67985882 Keywords : Oncohematological diseases * Surface plasmon resonance * Proteomics Subject RIV: JB - Sensors, Measurment, Regulation

  5. Disease: H00301 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H00301 Klebsiella infection Klebsiella is a gram-negative bacterium of Enterobacteriaceae...pta N, Limbago BM, Patel JB, Kallen AJ ... TITLE ... Carbapenem-resistant Enterobacteriaceae: epidemiology and

  6. Documentation of the ground for the planned MERO-IKL oil pipeline using the remote sensing technique. Annex P-5: Aerial photographs of the Nelahozeves - national border segment

    International Nuclear Information System (INIS)

    1994-02-01

    The remote sensing method was employed to obtain complete photographic documentation of the planned route for the Ingolstadt-Kralupy-Litvinov pipeline; sites of potentially hazardous sources of soil or water pollution were identified. (J.B.). 83 figs

  7. An introduction to the revised food-based dietary guidelines for ...

    African Journals Online (AJOL)

    2013-04-08

    Apr 8, 2013 ... called upon to provide evidence-based advice to the ... Vorster HH, DSc, Research Professor; Badham JB, MSc, Research Scientist; Venter CS, DSc, Extraordinary ..... At six months, start giving your baby small amounts of.

  8. A novel method to determine new potent angiotensin inhibitor ...

    African Journals Online (AJOL)

    that inhibit the action of angiotensin II by binding directly to the ..... Relatively high plasma protein binding of AZL (>99 .... Ghasemi JB, Zolfonoun E. Application of principal component analysis–multivariate adaptive regression splines for the ...

  9. Influence of plant growth regulators on axillary shoot multiplication ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-12-17

    Dec 17, 2008 ... The iron concentration had a significant effect on chlorophyll content of the leaves. .... developed precociously, which proliferated to form secon- dary and tertiary ..... Thomas P, Mythili JB, Shivashankara KS (2000). Effects of ...

  10. Creative Thinking Package

    Science.gov (United States)

    Jones, Clive

    1972-01-01

    A look at the latest package from a British managment training organization, which explains and demonstrates creative thinking techniques, including brainstorming. The package, designed for groups of twelve or more, consists of tapes, visuals, and associated exercises. (Editor/JB)

  11. Renaissance Paideia: Some Ideals in Italian Humanism and Their Relevance Today

    Science.gov (United States)

    Weakland, John E.

    1973-01-01

    The humanists of the Renaissance developed a philosophy of education which stated that education must always be connected with the active life, must lead to the development of humanity, must be for the benefit of the community. (JB)

  12. Simple Models for Process Control

    Czech Academy of Sciences Publication Activity Database

    Gorez, R.; Klán, Petr

    2011-01-01

    Roč. 22, č. 2 (2011), s. 58-62 ISSN 0929-2268 Institutional research plan: CEZ:AV0Z10300504 Keywords : process model s * PID control * second order dynamics Subject RIV: JB - Sensors, Measurment, Regulation

  13. Reference Ranges & What They Mean

    Science.gov (United States)

    ... htm. Accessed August 2015. Sources Used in Previous Reviews Books: Clinical Diagnosis and Management by Laboratory Methods. 20th ed. Henry JB, ed. New York: Saunders: 2001. Laboratory Medicine: Test Selection and Interpretation. ...

  14. Evaluation of poultry processing practices, related public health laws ...

    African Journals Online (AJOL)

    ADEYEYE

    2015-02-16

    Feb 16, 2015 ... the Meat Law (1968), Food and Drug Act (1974) and Animal Diseases (Control) ... production and processing are coordinated for the benefits and health of the ..... Pp 191-210. ... Ouedraogo JB, Maikano I, Mbah PO, Kremer.

  15. North Carolinians Volunteer for Knee Pain Study

    Science.gov (United States)

    ... is the director of the J.B. Snow Biomechanics Laboratory at Wake Forest University. Addressing a Rising ... people I work with are getting up the stairs better, or they are better able to play ...

  16. Ability of the Multisensory Jawbone UP3 to Quantify and Classify Sleep in Patients With Suspected Central Disorders of Hypersomnolence: A Comparison Against Polysomnography and Actigraphy.

    Science.gov (United States)

    Cook, Jesse D; Prairie, Michael L; Plante, David T

    2018-04-30

    To evaluate the ability of a multisensory fitness tracker, the Jawbone UP3 (JB3), to quantify and classify sleep in patients with suspected central disorders of hypersomnolence. This study included 43 patients who completed polysomnography (PSG) and a Multiple Sleep Latency Test (MSLT) with concurrent wrist-worn JB3 and Actiwatch 2 (AW2) recordings for comparison. Mean differences in nocturnal sleep architecture variables were compared using Bland-Altman analysis. Sensitivity, specificity, and accuracy were derived for both devices relative to PSG. Ability of the JB3 to detect sleep onset rapid eye movement periods (SOREMPs) during MSLT naps was also quantified. JB3 demonstrated a significant overestimation of total sleep time (39.6 min, P device cannot be used as a surrogate for PSG or MSLT in the assessment of patients with suspected central disorders of hypersomnolence. Copyright © 2018 American Academy of Sleep Medicine. All rights reserved.

  17. Cryogenics '88

    International Nuclear Information System (INIS)

    1988-04-01

    The proceedings has four chapters: Processes and apparatus of low-temperature installations, Superconductors and magnets, Gas separators, Helium liquefiers and cryostats. It contains a total of 56 papers of which 4 belong in the INIS scope. (J.B.)

  18. Two-way time transfer via optical fiber providing subpicosecond precision and high temperature stability

    Czech Academy of Sciences Publication Activity Database

    Kodet, J.; Pánek, Petr; Procházka, I.

    2015-01-01

    Roč. 53, č. 1 (2015), s. 18-26 ISSN 0026-1394 Institutional support: RVO:67985882 Keywords : optical fiber * time transfer * TWOTT Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 2.500, year: 2015

  19. Education Reform and Career Education--Deja Vu.

    Science.gov (United States)

    Stock, Barbara

    1984-01-01

    The current outcry for educational reform raises issues that have already long concerned career education. This situation gives career educators the opportunity to provide leadership in attaining common educational goals. (JB)

  20. EMAP Users Manual.

    Science.gov (United States)

    Kotz, Arnold; Redondo, Rory

    Presented is the user's manual for the Educational Manpower Information Sources Project (EMAP), an information file containing approximately 325 document abstracts related to the field of educational planning. (The EMAP file is described in document SP 006 747.) (JB)

  1. Observations on the Study of Crime Causation

    Science.gov (United States)

    Gibbons, Don C.

    1971-01-01

    Although both genetic and situational factors are implicated in criminality, the thesis here is that the latter may well be more important and more frequently encountered than many criminologists have acknowledged to date. (JB)

  2. Before Ethics and Morality

    Science.gov (United States)

    Prescott, James W.

    1972-01-01

    The effects of sensory deprivation in humans is discussed as well as the need for developing a moral education curriculum designed to rear children in an affectional environment of positive reinforcements. (JB)

  3. Certain Forms of Lexical and Stylistic Analysis in Studying Literary Works on Lenin in the School

    Science.gov (United States)

    Podgaetskaia, I. M.

    1970-01-01

    Classroom comparison of the works on Lenin, that are part of the school program, with other literature on him that can play a specific role in heightening student interest and intensifying awareness of words, language and style. (JB)

  4. Lenin's Concern for the Growing Generation

    Science.gov (United States)

    Bibanov, T. P.

    1970-01-01

    Lenin demonstrated his concern for youth and their education by exposing tsarism, initiating numerous plans and programs for improving the system of upbringing and education, and by emphasizing the importance of youth in the revolutionary struggle. (JB)

  5. The Komsomol and the Schools in the Lenin Year

    Science.gov (United States)

    Kutsenko, T.

    1970-01-01

    Describes the cooperative relationship between the Komsomol (All-Union Leninist Communist League of Youth), the Pioneers, and the schools, with specific reference to their mutual responsibilities in the Lenin Year. (JB)

  6. New hematological key for bovine leukemia virus-infected Japanese Black cattle.

    Science.gov (United States)

    Mekata, Hirohisa; Yamamoto, Mari; Kirino, Yumi; Sekiguchi, Satoshi; Konnai, Satoru; Horii, Yoichiro; Norimine, Junzo

    2018-02-20

    The European Community's (EC) Key, which is also called Bendixen's Key, is a well-established bovine leukemia virus (BLV) diagnostic method that classifies cattle according to the absolute lymphocyte count and age. The EC Key was originally designed for dairy cattle and is not necessarily suitable for Japanese Black (JB) beef cattle. This study revealed the lymphocyte counts in the BLV-free and -infected JB cattle were significantly lower than those in the Holstein cattle. Therefore, applying the EC Key to JB cattle could result in a large number of undetected BLV-infected cattle. Our proposed hematological key, which was designed for JB cattle, improves the detection of BLV-infected cattle by approximately 20%. We believe that this study could help promote BLV control.

  7. Global Journal of Educational Research - Vol 11, No 1 (2012)

    African Journals Online (AJOL)

    Teachers' Competence and Students' Academic Performance in Senior Secondary Schools Chemistry: Is There Any Relationship? EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JB Nbina, 15-18 ...

  8. NCBI nr-aa BLAST: CBRC-OCUN-01-0782 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0782 ref|YP_797515.1| Prolipoprotein diacylglyceryltransferase [Leptospira borgpeter...senii serovar Hardjo-bovis L550] ref|YP_801264.1| Prolipoprotein diacylglyceryltransferase [Leptospira borgpeter...senii serovar Hardjo-bovis JB197] gb|ABJ78582.1| Prolipoprotein diacylglyceryltransferase [Leptospira borgpeter...in diacylglyceryltransferase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_797515.1 3.3 35% ...

  9. The Effects of rhBMP-2 Used for Spinal Fusion on Spinal Cord Pathology After Traumatic Injury

    Science.gov (United States)

    2009-07-29

    1219-1224; discussion 1225. Basso DM , Beattie MS, Bresnahan JC (1995) A sensitive and reliable locomotor rating scale for open field testing in rats...usage of rhBMP-2 in the anterior cervical spine. Spine 31:2813-2819. Stuesse SL, Crisp T, McBurney DL, Schechter JB, Lovell JA, Cruce WL (2001...250-256. Stuesse SL, Crisp T, McBurney DL, Schechter JB, Lovell JA, Cruce WL (2001) Neuropathic pain in aged rats: behavioral responses and

  10. Middle Eastern Geographies of World War I

    Science.gov (United States)

    2010-05-21

    and ill-equipped forces. Within this atmosphere of persecution and economic depression caused by the war’s stoppage of religious pilgrimages...St. J.B. Armitage, "T.E. Lawrence: a centennial lecture," Asian Affairs 20, no. 1 (1989): 14. This Turkish offensive severely threatened the...British invade Syria. The Arabs working from Akaba became virtually the 163 St. J.B. Armitage, “Lawrence: a centennial lecture,” 18. 164 Wavell

  11. Development of an in vivo Assay for Mistranslation: Inducing Activity of Pollutants and Characterization of Amino Acid Substitutions.

    Science.gov (United States)

    1983-11-23

    listed as P.1. because of University regulations.) The Ohio State Canine Research Funds, "Immunoprevention of Parvovirus -Induced Diarrhea of the Dog ...Rice, J.B., and Winters, K.A.: Canine parvovirus infection potentiates canine distemper encephalitis attributable to modified live virus vaccine . J...Am. Vet. Med. Assoc., 180:137-139, 1982. Rice, J.B., Krakowka, S., Winters, K.A., and Olsen, R.G.: Comparison of systematic and local immunity in dogs

  12. Reply to Comment by W. R. Peltier, D. F. Argus, and R. Drummond on "An Assessment of the ICE6G_C (VM5a) Glacial Isostatic Adjustment Model"

    Science.gov (United States)

    Purcell, A.; Tregoning, P.; Dehecq, A.

    2018-02-01

    The empirical approximation of Purcell et al. (2011, https://doi.org/10.1029/2011GL048624) has been validated by Peltier et al. (2018, https://doi.org/10.1002/2016JB013844). In their Comment they introduced new results derived from the same ice/rheology models of ICE6G_C (VM5a) but using a different model for Antarctic bathymetry. This has greatly reduced the differences in predicted Antarctic uplift rates relative to those of Purcell et al. (2016, https://doi.org/10.1002/2015JB012742). In fact, with a ˜50% reduction in uplift rate in the Weddell Sea, the results of Peltier et al. (2018, https://doi.org/10.1002/2016JB013844) now agree more closely with the predictions of Purcell et al. (2016, https://doi.org/10.1002/2015JB012742) than with the original ICE6G_C values. Peltier et al. (2018, https://doi.org/10.1002/2016JB013844) state that the high power in their high-frequency spherical harmonic coefficients remains in their new calculations. They also claim that Purcell et al. (2016, https://doi.org/10.1002/2015JB012742) used an inaccurate loading history in deriving their velocity field. In fact, the ice load history was unchanged; to remove any ambiguity, the ice and water load histories used in the CALSEA calculations are provided in the supporting information.

  13. Antioxidant Property of Jobelyn as the Possible Mechanism Underlying its Anti-amnesic Activity in Rodents

    Directory of Open Access Journals (Sweden)

    Solomon Umukoro

    2013-02-01

    Full Text Available Introduction: Amnesia or loss of memory is the cardinal hallmark of Alzheimer’s disease (AD, a progressive neurodegenerative disorder associated with ageing process. Although, AD had been discovered over a century ago, drugs which could cure or halt the progression of the disease are yet to see the light of the day. However, there has been a growing interest in the use of phytomedicines with multipronged mechanisms of action that could target various aspects of the pathologies of AD. Jobelyn (JB is a potent antioxidant African polyherbal formulation with active components that have been acclaimed to show neuroprotection. This investigation was carried out to evaluate whether JB has anti-amnesic and antioxidant activities. Methods: The alteration of alternation behavior in the Y-maze paradigm was utilized as the test for memory function in mice.  The effect of JB on acetylcholinesterase (AChE activity, malondialdehyde (MDA level and the concentrations of glutathione (GSH in the frontal cortex and hippocampus were assessed in rats as means of providing insight into the mechanism underlying its anti-amnesic activity. The animals were given JB (1, 2.5 or 5mg/kg, i.p. daily for 7 days before the biochemical assays or test for memory functions were carried out.  Results: JB was found to produce a signi.cant increase in the level of alternation behavior compared with the control, suggesting anti-amnesic activity. Also, JB reversed the memory impairment induced by scopolamine, which further indicates anti-amnesic property. Furthermore, JB demonstrated a signi.cant inhibition of MDA formation in the frontal cortex and hippocampus of rats, indicating antioxidant property.  In addition, it increased the defense armory of the brain tissues, as it signi.cantly increased the concentrations of GSH in the frontal cortex and hippocampus of rats. However, JB did not demonstrate any inhibitory effect against AChE activity in the frontal cortex and hippocampus

  14. Impact of biodiesel blend on injector deposit formation

    International Nuclear Information System (INIS)

    Liaquat, A.M.; Masjuki, H.H.; Kalam, M.A.; Rizwanul Fattah, I.M.

    2014-01-01

    Continued legislative pressure to reduce exhaust emissions from CI (compression ignition) has resulted in the development of advanced fuel injection equipment. This advanced injection system produces higher temperatures and pressures at the injector tip, where deposit formation is initiated. In this research, an endurance test was carried out for 250 h on 2 fuel samples; DF (diesel fuel) as baseline fuel and JB20 (20% jatropha biodiesel and 80% DF) in a single-cylinder CI engine. The effects of JB20 on injector nozzle deposits, engine lubricating oil, and fuel economy and exhaust emissions were investigated during the endurance test. According to the results of the investigation, visual inspection showed some deposit accumulation on injectors for both fuel samples. SEM (scanning electron microscopy) and EDX (energy dispersive X-ray spectroscopy) analysis showed greater carbon deposits on and around the injector tip for JB20 compared to the engine running with DF. Similarly, lubricating oil analysis presented excessive wear metal concentrations and decreased viscosity values when the engine was fueled with JB20. Finally, fuel economy and emission results during the endurance test showed higher BSFC (brake specific fuel consumption) and NO x emissions, and lower HC (hydrocarbons) and CO (carbon monoxide) emissions, for the JB20 blend compared to DF. - Highlights: • Endurance test for 250 h on 2 fuel samples; diesel fuel and JB20. • Investigation on effects of JB20 on the injector deposits and exhaust emissions. • Lubricating oil analysis during endurance test. • SEM (scanning electron microscopy) analysis. • EDX (energy dispersive X-ray spectroscopy) analysis

  15. Antioxidant Property of Jobelyn as the Possible Mechanism Underlying

    Directory of Open Access Journals (Sweden)

    Solomon Umukoro

    2013-01-01

    Full Text Available   Introduction: Amnesia or loss of memory is the cardinal hallmark of Alzheimer’s disease (AD, a progressive neurodegenerative disorder associated with ageing process. Although, AD had been discovered over a century ago, drugs which could cure or halt the progression of the disease are yet to see the light of the day. However, there has been a growing interest in the use of phytomedicines with multipronged mechanisms of action that could target various aspects of the pathologies of AD. Jobelyn (JB is a potent antioxidant African polyherbal formulation with active components that have been acclaimed to show neuroprotection. T his investigation was carried out to evaluate whether JB has anti-amnesic and antioxidant activities.   Methods: The alteration of alternation behavior in the Y-maze paradigm was utilized as the test for memory function in mice. The effect of JB on a cetylcholinesterase (AChE activity, malondialdehyde (MDA level and the concentrations of glutathione (GSH in the frontal cortex and hippocampus were assessed in rats as means of providing insight into the mechanism underlying its anti-amnesic activity. The animals were given JB (1, 2.5 or 5mg/kg, i.p. daily for 7 days before the biochemical assays or test for memory functions were carried out.   Results: JB was found to produce a significant increase in the level of alternation behavior compared with the control, suggesting anti-amnesic activity. Also, JB reversed the memory impairment induced by scopolamine, which further indicates anti-amnesic property. Furthermore, JB demonstrated a significant inhibition of MDA formation in the frontal cortex and hippocampus of rats, indicating antioxidant property. In addition, it increased the defense armory of the brain tissues, as it significantly increased the concentrations of GSH in the frontal cortex and hippocampus of rats. However, JB did not demonstrate any inhibitory effect against AChE activity in the frontal cortex and

  16. Effects of Streptococcus bovis Isolated from Bovine Rumen on the Fermentation Characteristics and Nutritive Value of Tanzania Grass Silage

    Directory of Open Access Journals (Sweden)

    Anderson de Moura Zanine

    2016-01-01

    Full Text Available This study aimed to evaluate the effects of Streptococcus bovis on the fermentation characteristics and nutritive value of Tanzania grass silage. Tanzania grass was chopped and left untreated (U or treated with Streptococcus bovis JB1 at 1 × 106 colony-forming units per gram (cfu/g of fresh forage or Streptococcus bovis HC5 at 1 × 106 cfu/g of fresh forage and packed into sixtuplicate laboratory silos. The largest number of enterobacteria, molds and yeast (M&Y occurred in untreated silages and the smallest populations of enterobacteria and M&Y and the largest numbers of lactic acid bacteria (LAB, at 9.81 and 9.87 log cfu/g, were observed in Streptococcus bovis JB1 and HC5, respectively (P<0.05. Silages treated with JB1 and HC5 had lower (P<0.05 silage pHs and concentrations of ammoniacal nitrogen (NH3-N than untreated silages. The application of Streptococcus bovis JB1 and HC5 resulted in fewer losses through gases and effluents (P<0.05, which resulted in greater dry matter recovery (DMR and crude protein recovery (CPR (P<0.05. Streptococcus bovis JB1 and HC5 improved the fermentative profile and increased the concentration of crude protein and DMR and CPR in Tanzania grass silage.

  17. Molecular characterization of a new efficiently transducing bacteriophage identified in meticillin-resistant Staphylococcus aureus.

    Science.gov (United States)

    Varga, Marian; Pantůček, Roman; Růžičková, Vladislava; Doškař, Jirˇí

    2016-01-01

    In Staphylococcus aureus, generalized transduction mediated by temperate bacteriophages represents a highly efficient way of transferring antibiotic resistance genes between strains. In the present study, we identified and characterized in detail a new efficiently transducing bacteriophage of the family Siphoviridae, designated ϕJB, which resides as a prophage in the meticillin-resistant S. aureus (MRSA) strain Jevons B. Whole-genome sequencing followed by detailed in silico analysis uncovered a linear dsDNA genome consisting of 43 ,12 bp and comprising 70 ORFs, of which ∼40 encoded proteins with unknown function. A global genome alignment of ϕJB and other efficiently transducing phages ϕ11, ϕ53, ϕ80, ϕ80α and ϕNM4 showed a high degree of homology with ϕNM4 and substantial differences with regard to other phages. Using a model transduction system with a well-defined donor and recipient, ϕJB transferred the tetracycline resistance plasmid pT181 and a penicillinase plasmid with outstanding frequencies, beating most of the above-mentioned phages by an order of magnitude. Moreover, ϕJB demonstrated high frequencies of transferring antibiotic resistance plasmids even upon induction from a lysogenic donor strain. Considering such transducing potential, ϕJB and related bacteriophages may serve as a suitable tool for elucidating the nature of transduction and its contribution to the spread of antibiotic resistance genes in naturally occurring MRSA populations.

  18. Light-quarks Yukawa couplings and new physics in exclusive high-pT Higgs boson +jet and Higgs boson + b -jet events

    Science.gov (United States)

    Cohen, Jonathan; Bar-Shalom, Shaouly; Eilam, Gad; Soni, Amarjit

    2018-03-01

    We suggest that the exclusive Higgs +light (or b)-jet production at the LHC, p p →h +j (jb), is a rather sensitive probe of the light-quarks Yukawa couplings and of other forms of new physics (NP) in the Higgs-gluon h g g and quark-gluon q q g interactions. We study the Higgs pT-distribution in p p →h +j (jb)→γ γ +j (jb), i.e., in h +j (jb) production followed by the Higgs decay h →γ γ , employing the (pT-dependent) signal strength formalism to probe various types of NP which are relevant to these processes and which we parametrize either as scaled Standard Model (SM) couplings (the kappa-framework) and/or through new higher dimensional effective operators (the SMEFT framework). We find that the exclusive h +j (jb) production at the 13 TeV LHC is sensitive to various NP scenarios, with typical scales ranging from a few TeV to O (10 ) TeV , depending on the flavor, chirality and Lorentz structure of the underlying physics.

  19. Modified jailed balloon technique for bifurcation lesions.

    Science.gov (United States)

    Saito, Shigeru; Shishido, Koki; Moriyama, Noriaki; Ochiai, Tomoki; Mizuno, Shingo; Yamanaka, Futoshi; Sugitatsu, Kazuya; Tobita, Kazuki; Matsumi, Junya; Tanaka, Yutaka; Murakami, Masato

    2017-12-04

    We propose a new systematic approach in bifurcation lesions, modified jailed balloon technique (M-JBT), and report the first clinical experience. Side branch occlusion brings with a serious complication and occurs in more than 7.0% of cases during bifurcation stenting. A jailed balloon (JB) is introduced into the side branch (SB), while a stent is placed in the main branch (MB) as crossing SB. The size of the JB is half of the MB stent size. While the proximal end of JB attaching to MB stent, both stent and JB are simultaneously inflated with same pressure. JB is removed and then guidewires are recrossed. Kissing balloon dilatation (KBD) and/or T and protrusion (TAP) stenting are applied as needed. Between February 2015 and February 2016, 233 patients (254 bifurcation lesions including 54 left main trunk disease) underwent percutaneous coronary intervention (PCI) using this technique. Procedure success was achieved in all cases. KBD was performed for 183 lesions and TAP stenting was employed for 31 lesions. Occlusion of SV was not observed in any of the patients. Bench test confirmed less deformity of MB stent in M-JBT compared with conventional-JBT. This is the first report for clinical experiences by using modified jailed balloon technique. This novel M-JBT is safe and effective in the preservation of SB patency during bifurcation stenting. © 2017 Wiley Periodicals, Inc.

  20. Book Reviews

    Directory of Open Access Journals (Sweden)

    Joh. Nobel

    1953-01-01

    Full Text Available - J. Wils, P. Drabbe, Spraakkunst van het Ekagi, Wisselmeren Ned. N. Guinea, XXI + 90 pag., ‘s-Gravenhage, M. Nijhoff 1952. - A. Teeuw, C. Hooykaas, Literatuur in Maleis en Indonesisch, J.B. Wolters, Groningen-Djakarta 1952, 406 ppg. - A. Teeuw, C. Hooykaas, Perintis sastera, terdjemahan Raihoel Amar gl. Datoek Besar; J.B. Wolters, Groningen-Djakarta 1951, 406 pgg. - A. Teeuw, C. Hooykaas, Penjedar sastera, terdjemahan Raihoel Amar gl. Datoek Besar; J.B. Wolters, Groningen-Djakarta 1952, 245 pgg. - C. Hooykaas, Sedjarah Melaju, menurut terbitan Abdullah (ibn Abdulkadir Munsji diselenggarakan kembali dan diberi anotasi oleh T.D. Situmorang dan Prof. Dr A. Teeuw dengan bantuan Amal Hamzah. Penerbit Djambatan. Djakarta/Amsterdam 1952. - J. Gonda, Joh. Nobel, Central Asia: The connecting link between east and west, and other lectures delivered at The International Academy of Indian Culture, Nagpur 1952.

  1. Jobelyn® attenuates inflammatory responses and neurobehavioural deficits associated with complete Freund-adjuvant-induced arthritis in mice.

    Science.gov (United States)

    Omorogbe, Osarume; Ajayi, Abayomi M; Ben-Azu, Benneth; Oghwere, Ejiroghene E; Adebesin, Adaeze; Aderibigbe, Adegbuyi O; Okubena, Olajuwon; Umukoro, Solomon

    2018-02-01

    Rheumatoid arthritis (RA) is a chronic inflammatory disease that affects the physical and psychosocial wellbeing of the patients and a major cause of work disability. Current drugs for its treatment only provide palliative effect, as cure for the disease still remains elusive. Jobelyn ® (JB), a potent anti-oxidant and anti-inflammatory dietary supplement obtained from Sorghum bicolor, has been claimed to relieve arthritic pain. Thus, this study was designed to evaluate its effect on inflammatory and biochemical changes as well as neurobehavioural deficits associated with complete Freund-adjuvant (CFA)-induced arthritis in mice. The effect of JB (50, 100 and 200 mg/kg) on inflammatory oedema, neurobehavioural deficits, levels of biomarkers of oxidative stress and inflammatory cytokines (tumor necrosis factor-alpha and interleukin-6) induced by 0.1 mL of CFA (10 mg/mL) was evaluated in male Swiss mice. Oral administration of JB (100 and 200 mg/kg) reduced inflammatory paw volume and reversed sensorimotor deficits induced by CFA. JB also reduced pain episodes, anxiety and depressive-like symptoms in CFA-mice. The increased level of oxidative stress in the joint and brain tissues of CFA-mice was reduced by JB. It also decreased tumor necrosis factor-alpha and interleukin-6 levels induced by CFA in the joint tissue of mice. These findings suggest that Jobelyn ® attenuates inflammatory responses induced by CFA in mice via inhibition of oxidative stress and release of inflammatory cytokines. The ability of JB to attenuate CFA-induced nociception, sensorimotor deficits and depressive-like symptom suggests it might improve the quality of life of patients with arthritic conditions. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  2. Prevention and management of vascular complications in middle ear and cochlear implant surgery.

    Science.gov (United States)

    Di Lella, Filippo; Falcioni, Maurizio; Piccinini, Silvia; Iaccarino, Ilaria; Bacciu, Andrea; Pasanisi, Enrico; Cerasti, Davide; Vincenti, Vincenzo

    2017-11-01

    The objective of this study is to illustrate prevention strategies and management of vascular complications from the jugular bulb (JB) and internal carotid artery (ICA) during middle ear surgery or cochlear implantation. The study design is retrospective case series. The setting is tertiary referral university hospital. Patients were included if presented pre- or intraoperative evidence of high-risk anatomical anomalies of ICA or JB during middle ear or cochlear implant surgery, intraoperative vascular injury, or revision surgery after the previous iatrogenic vascular lesions. The main outcome measures are surgical outcomes and complications rate. Ten subjects were identified: three underwent cochlear implant surgery and seven underwent middle ear surgery. Among the cochlear implant patients, two presented with anomalies of the JB impeding access to the cochlear lumen and one underwent revision surgery for incorrect positioning of the array in the carotid canal. Subtotal petrosectomy was performed in all cases. Anomalies of the JB were preoperatively identified in two patients with attic and external auditory canal cholesteatoma, respectively. In a patient, a high and dehiscent JB was found during myringoplasty, while another underwent revision surgery after iatrogenic injury of the JB. A dehiscent ICA complicated middle ear effusion in one case, while in another case, a carotid aneurysm determined a cholesterol granuloma. Rupture of a pseudoaneurysm of the ICA occurred in a child during second-stage surgery and required permanent balloon occlusion without neurological complications. Knowledge of normal anatomy and its variants and preoperative imaging are the basis for prevention of vascular complications during middle ear or cochlear implant surgery.

  3. Hemorrhage Control for Major Traumatic Vascular Injuries

    Science.gov (United States)

    2017-10-01

    TJ, Eastridge BJ, Gilani R, Chung KK, DeSantis SM, DuBose JJ , Tomasek TS, Fortuna GR, Sames VG, Todd SR, Podbielski JM, Wade CE, Holcomb JB and the...Eastridge BJ, Gilani R, Chung KK, DeSantis SM, DuBose JJ , Tomasek JS, Fortuna GR, Sams VG, Todd SR, Podbielski JM, Wade CE, Holcomb JB. Multicenter...Kisat M, Morrison JJ , Hashmi ZG, Efron DT, Rasmussen TE, Haider AH. Epidemiology and outcomes of non-compressible torso hemorrhage. J Surg Res. 2013;184

  4. NCBI nr-aa BLAST: CBRC-HSAP-07-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-07-0021 ref|YP_798483.1| hypothetical protein LBL_2137 [Leptospira borgpeter...senii serovar Hardjo-bovis L550] ref|YP_801392.1| hypothetical protein LBJ_2143 [Leptospira borgpeterseni...i serovar Hardjo-bovis JB197] gb|ABJ79550.1| Conserved hypothetical protein [Leptospira borgpetersenii serov...ar Hardjo-bovis L550] gb|ABJ76634.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_798483.1 0.026 28% ...

  5. NCBI nr-aa BLAST: CBRC-OCUN-01-1280 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-1280 ref|YP_798310.1| hypothetical protein LBL_1947 [Leptospira borgpeter...senii serovar Hardjo-bovis L550] ref|YP_801037.1| hypothetical protein LBJ_1728 [Leptospira borgpeterseni...i serovar Hardjo-bovis JB197] gb|ABJ79377.1| Conserved hypothetical protein [Leptospira borgpetersenii serov...ar Hardjo-bovis L550] gb|ABJ76279.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_798310.1 4.1 31% ...

  6. NCBI nr-aa BLAST: CBRC-TSYR-01-0989 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-0989 ref|YP_796828.1| hypothetical protein LBL_0283 [Leptospira borgpeter...senii serovar Hardjo-bovis L550] ref|YP_801953.1| hypothetical protein LBJ_2788 [Leptospira borgpeterseni...i serovar Hardjo-bovis JB197] gb|ABJ77895.1| Hypothetical protein LBL_0283 [Leptospira borgpetersenii serova...r Hardjo-bovis L550] gb|ABJ77195.1| Hypothetical protein LBJ_2788 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_796828.1 4.4 38% ...

  7. Performance, combustion, and emission characteristics of a diesel engine fueled by biodiesel-diesel mixtures with multi-walled carbon nanotubes additives

    International Nuclear Information System (INIS)

    El-Seesy, Ahmed I.; Abdel-Rahman, Ali K.; Bady, Mahmoud; Ookawara, S.

    2017-01-01

    Highlights: • Considerable improvements in the combustion of JB20D50MWCNTs compared to pure JB20D. • p_m_a_x, dp/dθ_m_a_x and dQg/dθ_m_a_x increased by 7%, 4% and 4%, respectively. • Brake specific fuel consumption decreased by 15%. • NO_x, CO, and UHC reduced by 35%, 50%, and 60%, respectively. • Significant enhancement in all engine performance was achieved at a concentration of 40 mg/l. - Abstract: In this work, the effects of adding Multi-Walled Carbon nanotubes (MWCNTs) to Jojoba methyl ester-diesel blended fuel (JB20D) on performance, combustion and emissions characteristics of a compression-ignition engine were experimentally investigated. The JB20D with 10, 20, 30, 40 and 50 mg/l of MWCNTs were examined at different engine loads and speeds. Compared to pure diesel, the use of JB20D without MWCNTs caused a slight decrease in the engine performance and an increase in the engine emissions at most examined conditions. The MWCNTs–B20D blended fuel attained a maximum increase of 16% in the brake thermal efficiency and a decrease of 15% in the brake specific fuel consumption at the dose level of 50 mg/l compared to JB20D. The MWCNTs-JB20D blended fuel also brought about an enhancement in combustion characteristics where the peak cylinder pressure, the maximum rate of pressure rise and the peak heat release rate were increased by 7%, 4%, and 4%, respectively, at the same dose level. According to the measured emissions, a significant reduction of engine emissions was achieved at the dose level of 20 mg/l, where NO_x, CO, and UHC were reduced by 35%, 50%, and 60%, respectively. According to the obtained results, the recommended concentration of MWCNTs in JB20D was concluded to be 40 mg/l, which could give significant improvements in overall the parameters of engine performance and emissions with a good balance between them.

  8. Chemical Characterization of Tribological and Biomaterial Surfaces With Nanoscale Spatial Resolution

    Science.gov (United States)

    2011-02-28

    of Diamond-Like Carbon Film. Springer, New York, 2008. 2. Erdemir A. Eryilmaz O.L. Fenske G., Synthesis of diamondlike carbon films with superlow...and oxidizing environments, Wear 265 (2008) 244-254. 16. J.A. Johnson, J.B. Woodford, X.D. Chen, J. Andersson, A. Erdemir, G.R. Fenske , Insights...Mehta, S. Roy, J.A. Johnson, J.B. Woodford, A. Zinovev, Z. Islam, A. Erdemir, S. Sinha, G.R. Fenske , B. Prorok, X-Ray studies of near-frictionless

  9. OUTREACH

    CERN Multimedia

    David Barney

    The past three months have been very eventful for the CMS Outreach team. The majority of our efforts have concentrated on the update of the public web site at http://www.cern.ch/cmsinfo which was released to the public in time for the first LHC circulating beams. Congratulations in particular to Marzena Lapka and Lizzie Gibney for the excellent job that they have done. The layout of the new site roughly follows that of the main CERN public web site, a decision made long ago so that surfers do not feel lost when they jump from CERN to CMS. Both ALICE and LHCb also made this decision (after us!). The text of the new pages was made after interviewing many CMS collaborators, so has a very human feel to it. The site has been very well received by the community and the public/press alike. This is of course a first version so there will be more to come in the future, and comments are more than welcome. The 10th September is a date that few of us will forget. The world media (represented by nearly 300 journalists!...

  10. A History of the Sonocare CST-100: The First FDA-approved HIFU Device

    Science.gov (United States)

    Muratore, Robert

    2006-05-01

    The Sonocare CST-100 Therapeutic Ultrasound System, designed for the treatment of glaucoma, was developed in the 1980s and became the first high intensity focused ultrasound (HIFU) device to receive Food and Drug Administration approval. The system arose from studies done by F.L. Lizzi, Eng.Sc.D., of Riverside Research Institute and D.J. Coleman, M.D., of Cornell Medical Center/New York Hospital on the safety of ultrasound diagnosis of the eye. As safety limits were probed, therapeutic regimes were discovered. Optimization of operational parameters, clinical experience, and engineering design came together through a spin-off company, Sonocare, Inc., formed to produce and market the ophthalmic device. Various precedents were set during the approval process, including the acceptance by the FDA of radiation momentum imparted to an absorber as a measure of acoustic power. Many devices were sold, but the laser industry, grandfathered into the therapeutic field, eventually out-marketed Sonocare. The CST-100 remains as a model of elegant industrial design, and existing units are used daily in HIFU laboratory experiments.

  11. Focused ultrasound in ophthalmology

    Directory of Open Access Journals (Sweden)

    Silverman RH

    2016-09-01

    Full Text Available Ronald H Silverman1,2 1Department of Ophthalmology, Columbia University Medical Center, 2F.L. Lizzi Center for Biomedical Engineering, Riverside Research, New York, NY, USA Abstract: The use of focused ultrasound to obtain diagnostically significant information about the eye goes back to the 1950s. This review describes the historical and technological development of ophthalmic ultrasound and its clinical application and impact. Ultrasound, like light, can be focused, which is crucial for formation of high-resolution, diagnostically useful images. Focused, single-element, mechanically scanned transducers are most common in ophthalmology. Specially designed transducers have been used to generate focused, high-intensity ultrasound that through thermal effects has been used to treat glaucoma (via cilio-destruction, tumors, and other pathologies. Linear and annular transducer arrays offer synthetic focusing in which precise timing of the excitation of independently addressable array elements allows formation of a converging wavefront to create a focus at one or more programmable depths. Most recently, linear array-based plane-wave ultrasound, in which the array emits an unfocused wavefront and focusing is performed solely on received data, has been demonstrated for imaging ocular anatomy and blood flow. While the history of ophthalmic ultrasound extends back over half-a-century, new and powerful technologic advances continue to be made, offering the prospect of novel diagnostic capabilities. Keywords: ophthalmic ultrasound, ultrasound biomicroscopy (UBM, high-intensity focused ultrasound (HIFU, ultrafast imaging, Doppler imaging 

  12. OUTREACH

    CERN Multimedia

    D. Barney

    The main emphasis for the coming months is clearly the Open Days of April 5th and 6th, in all likelihood the last opportunities that visitors will get to see the LHC underground installations. Tens of thousands of visitors are expected, especially on Sunday 6th - the Open Day for the General Public. As announced recently in a mail to the collaboration, CMS collaborators are encouraged to sign-up to be guides. If you are interested in doing this, please contact Catherine Brandt. In addition to guides, we require introductory talks to be given at point 5 and are looking for volunteers (many thanks to those of you who have already volunteered!). If you are interested, please send an email to outreach@cern.ch stating the languages you prefer and your availability on the 6th between 9am and 7pm. The CMS Outreach team has been significantly strengthened recently with the arrival of journalist Elizabeth "Lizzie" Gibney. One of her main tasks over the coming months will be to interview many of you...

  13. Commentary on: "Comprehensive transcriptional analysis of early-stage urothelial carcinoma." Hedegaard J, Lamy P, Nordentoft I, Algaba F, Høyer S, Ulhøi BP, Vang S, Reinert T, Hermann GG, Mogensen K, Thomsen MB, Nielsen MM, Marquez M, Segersten U, Aine M, Höglund M, Birkenkamp-Demtröder K, Fristrup N, Borre M, Hartmann A, Stöhr R, Wach S, Keck B, Seitz AK, Nawroth R, Maurer T, Tulic C, Simic T, Junker K, Horstmann M, Harving N, Petersen AC, Calle ML, Steyerberg EW, Beukers W, van Kessel KE, Jensen JB, Pedersen JS, Malmström PU, Malats N, Real FX, Zwarthoff EC, Ørntoft TF, Dyrskjøt L. Cancer Cell. 2016 Jul 11;30(1):27-42.

    Science.gov (United States)

    Lee, Byron H

    2017-09-01

    Non-muscle-invasive bladder cancer (NMIBC) is a heterogeneous disease with widely different outcomes. We performed a comprehensive transcriptional analysis of 460 early-stage urothelial carcinomas and showed that NMIBC can be subgrouped into 3 major classes with basal- and luminal-like characteristics and different clinical outcomes. Large differences in biological processes such as the cell cycle, epithelial-mesenchymal transition, and differentiation were observed. Analysis of transcript variants revealed frequent mutations in genes encoding proteins involved in chromatin organization and cytoskeletal functions. Furthermore, mutations in well-known cancer driver genes (e.g., TP53 and ERBB2) were primarily found in high-risk tumors, together with APOBEC-related mutational signatures. The identification of subclasses in NMIBC may offer better prognostication and treatment selection based on subclass assignment. Copyright © 2017 Elsevier Inc. All rights reserved.

  14. Muusika : Kremer tuleb üllatama. Bartokiga Pariisis. Raimo Kangro CD kiitvad arvustused. Festivalikorraldajad ühendavad jõud. EOÜ kolmas tegevusaasta. Jüri Pärg 50 aastat laval. Harri Vasar 75. Ernesaksa nimelised stipendiumid / Heili Vaus-Tamm

    Index Scriptorium Estoniae

    Vaus-Tamm, Heili, 1961-

    2001-01-01

    Tartus ja Tallinnas annab kontserte Gidon Kremer ja tema orkester Kremerata Baltica. 30.XI toimus Pariisis Liszti saalis HonEst Quintette debüütkontsert, kus kanti ette Bela Bartoki kammerloomingut. Saksa muusikaajakirjad Fono Forum ning Piano News arvustavad Raimo Kangro hiljuti välja antud CDd. 11.XII kohtusid kultuuriministeeriumis süvamuusikafestivalide korraldajad. 7.XII tuli EMA orelisaalis kokku Eesti Orelisõprade Ühingu aastakoosolek, juhatuse esimees A.-P. Lattik. Jüri Pärg märkis soolokontserdiga 25.XII Estonia talveaias oma 70. sünnipäeva ja 50 lava-aastat. Estonia talveaias meenutatukse Harri Vasarat, kes saanuks 75. aastaseks. 15.XII antakse TÜ aulas traditsioonilisel jõulukontserdil üle tänavused Gustav Ernesaksa nimelised stipendiumid.

  15. Lähme, naised / Tiina Kuuler

    Index Scriptorium Estoniae

    Kuuler, Tiina, 1969-

    2008-01-01

    Muusikasündmustest: võrokeelse laulu- ja rahvapeo peakontsert "Uma Pido" 31. mail Kubija laululaval, "Türi kevadfest" 30. maist 1. juunini Türil, "Paljassaare RockFest" 31. mail Tallinnas Paljassaare põik 14 sisehoovis, Raplamaa laulu- ja tantsupidu "Mis maa see on" 31. mail ja ansamblite Metsatöll ja Vägilased kontsert 1. juunil Mahtra sõjaväljal, "Vanalinnapäevad" Tallinnas 2.-8. juunil, Lastekaitsepäeva heategevuskontsert 1. juunil Tartus, "Nõmme Kevad" 30. mail Tallinnas Nõmmel Lunastaja kirikus (esinevad Tallinna Muusikakeskkooli kammerkoor ja solistid), Bob Dylan 4. juunil Saku Suurhallis, Punklaulupeo warmup 30. mail Rock Cafes, rocklaulja Sebastian Bach 6. juunil Pirita kloostris

  16. Anneli Remme soovitab : "Peeter!". Ciacinto Scelsi - mees Ida ja Lääne piirilt / Anneli Remme

    Index Scriptorium Estoniae

    Remme, Anneli, 1968-

    2002-01-01

    21. mail ja 1. juunil etendub Kanuti Gildi saalis tragikoomiline ning ühiskonnakriitiline dokumentaalooper "Peeter!", kus Areeni toimetajad Barbi Pilvre ja Tõnu Kaalep toovad avalikkuse ette tõlgenduse toimetaja Kalev Kesküla ja kirjanduskriitik Peeter Künstleri sõpruse tähelepanuväärsetest omadustest. Vastavaid osi esitavad laval Jaan-Villem Sibul ja Indrek Taalmaa. Eesti värskeima multimeediumi juurde kuulub tants ning Andres Maimiku - Jaak Kilmi filmikaadrid mitmete "avalike loomeinimeste" osalusel. Helilooja Toomas Trass. 30. mail toimub Eesti Muusikaakadeemia orelisaalis loeng-kontsert Scelsi muusikast, esinevad Tarmo Johannes (flöödid ja loeng) ning Vambola Krigul (löökpillid)

  17. Future developments and applications of nitrogen-bearing steels ...

    Indian Academy of Sciences (India)

    M. Senthilkumar (Newgen Imaging) 1461 1996 Oct 15 13:05:22

    society in the field of materials and some recalling of basic properties and principles ... Environment-friendly technologies (safety in oil pipelines, oil exploration . ..... Vogt J-B, Ait Saadi B, Foct J 1999 Analysis of the fatigue structures in a duplex ...

  18. Documentation of the ground along the Morava river - Slapanov segment of the Druzba oil pipeline and along the Slapanov - Nove Mesto segment of the petroleum product pipeline with respect to pollution with oil hydrocarbons

    International Nuclear Information System (INIS)

    Kult, L.; Sara, V.

    1993-12-01

    Oil leaks from the Druzba pipeline between the Morava river and the Nove Mesto or Moutnice towns were examined by aerial photographing and soil sampling. The intensity of pollution was found to lie below regulatory limits. Suspect sites with respect to their pollution by oil substances were entered into maps. (J.B.). 3 tabs., 27 figs

  19. (Euph tion an ega vi horbiac nd anti irosa R ceae) sicklin Roxb. e ng

    African Journals Online (AJOL)

    SAM

    serve as ant profile as we aluation of th macromorph yed in phytoc dium metabi atients who normal salin stomataarra tannins, fla e aqueous m s were signi are sugges candidate fo cell disorders onal medical are. ..... Strouse JJ, Lanzkron S, Beach MC, Haywood C, Park H, Witkop C,. Wilson RF, Bass EB, Segal JB (2008).

  20. Browse Title Index

    African Journals Online (AJOL)

    Items 6851 - 6900 of 11090 ... Vol 10, No 27 (2011), Kenaf seed oil from supercritical carbon dioxide fluid extraction shows cytotoxic effects towards various cancer cell lines, Abstract PDF. LS Yazan, JB Foo, KW Chan, PM Tahir, M Ismail. Vol 12, No 48 (2013), Keratinase production by Bacillus megaterium RS1 using the ...

  1. East and Central African Journal of Surgery Volume 10 Number 2 ...

    African Journals Online (AJOL)

    user

    2005-12-02

    Dec 2, 2005 ... Correspondences to: Dr Mchembe MD, Lecturer, Department of Surgery Muhimbili University College ... general or spinal anesthesia, patient was placed .... surgery textbook. J.B. Lippincott. Company Philadelphia 1984; 6-7. 2. Abrams JS: A hard look at colonoscopy. Am J Surg 1977; 133: 111-115. 3.

  2. Communicatie-architectuur PLC’s en Unity

    NARCIS (Netherlands)

    J.L. Scholte

    2017-01-01

    Voor het afronden van de studie Technische Informatica aan de Haagse Hogeschool te Delft is het noodzakelijk om een afstudeeropdracht uit te voeren. In de loop van zeventien weken is deze opdracht uitgevoerd bij het bedrijf JB Systems te Vlaardingen en Delft door de afstudeerder Jordy Scholte. Dit

  3. Case report

    African Journals Online (AJOL)

    ebutamanya

    2015-07-07

    Jul 7, 2015 ... muscle flaps, such as gracillis muscle flap, transverse abdominal muscle flap, and tensor fascia lata flap, and fascia cutaneous flaps, such as medial ... The artificial vagina. Am J Obstet Gynecol. 1967 Dec. 1;99(7):944-51. PubMed | Google Scholar. 2. Mclndoe AH, Banister JB. An operation for the cure of.

  4. Case report

    African Journals Online (AJOL)

    abp

    2013-05-08

    5. PubMed | Google Scholar. 3. Bacal DA, Nelson LB, Zackai EH, Lavrich JB, Kousseff BG,. McDonald-McGinn D. Ankyloblepharon filiforme adnatum in trisomy 18. J Pediatr Ophthalmol Strabismus. 1993 Sep-. Oct;30(5):337-9.

  5. Spatial Resolution of the Medipix-2 as Neutron Pixel Detector

    Czech Academy of Sciences Publication Activity Database

    Jakůbek, J.; Holý, T.; Lehmann, E.; Pospíšil, S.; Uher, J.; Vacík, J.; Vavřík, Daniel

    2005-01-01

    Roč. 546, - (2005), s. 164-169 ISSN 0168-9002. [International Workshop on Radiation Imaging Detectors /6./. Glasgow, Scotland, 25.07.2004-29.07.2004] Institutional research plan: CEZ:AV0Z20710524 Keywords : neutron detection * neutronography * X-ray Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 1.224, year: 2005

  6. Co-encapsulation of human serum albumin and superparamagnetic iron oxide in PLGA nanoparticles: Part I. Effect of process variables on the mean size

    Czech Academy of Sciences Publication Activity Database

    Shubhra, Q. T. H.; Kardos, A. F.; Feczkó, T.; Macková, Hana; Horák, Daniel; Tóth, J.; Dósa, G.; Gyenis, J.

    2014-01-01

    Roč. 31, č. 2 (2014), s. 147-155 ISSN 0265-2048 R&D Projects: GA AV ČR(CZ) KAN401220801 Institutional support: RVO:61389013 Keywords : albumin * encapsulation * PLGA (poly d,l-lactic-co-glycolic acid Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 1.585, year: 2014

  7. Co-encapsulation of human serum albumin and superparamagnetic iron oxide in PLGA nanoparticles: Part II. Effect of process variables on protein model drug encapsulation efficiency

    Czech Academy of Sciences Publication Activity Database

    Shubhra, Q. T. H.; Feczkó, T.; Kardos, A. F.; Tóth, J.; Macková, Hana; Horák, Daniel; Dósa, G.; Gyenis, J.

    2014-01-01

    Roč. 31, č. 2 (2014), s. 156-165 ISSN 0265-2048 R&D Projects: GA AV ČR(CZ) KAN401220801 Institutional support: RVO:61389013 Keywords : encapsulation efficiency * experimental design * human serum albumin Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 1.585, year: 2014

  8. Biisofraxidin on Apoptosis of Human Gastric Cancer BGC-823 Cells

    African Journals Online (AJOL)

    Wu et al. Trop J Pharm Res, October 2015; 14(10): 1803. Tropical Journal of Pharmaceutical Research ... Jian-Tao Wu1,2*, She-Min Lv1, Chun-Hui Lu1, Jun Gong1 and Jian-Bo An3 ..... Zhu AK, Zhou H, Xia JZ, Jin HC, Wang K, Yan J, Zuo JB,.

  9. Inductive Sensor for Lightning Current Measurement, Fitted in Aircraft Windows-Part I: Analysis for a Circular Window

    Czech Academy of Sciences Publication Activity Database

    van Deursen, A.P.J.; Stelmashuk, Vitaliy

    2011-01-01

    Roč. 11, č. 1 (2011), s. 199-204 ISSN 1530-437X Institutional research plan: CEZ:AV0Z20430508 Keywords : Lightning * inductive sensor * aircraft * window * viewport Subject RIV: JB - Sensors , Measurment, Regulation Impact factor: 1.520, year: 2011

  10. The Change Masters.

    Science.gov (United States)

    Kanter, Rosabeth Moss

    1984-01-01

    The change masters are identified as corporate managers who have the resources and the vision to effect an economic renaissance in the United States. Strategies for change should emphasize horizontal as well as vertical communication, and should reward enterprise and innovation at all levels. (JB)

  11. Plumage and ecology of cormorants | Siegfried | African Zoology

    African Journals Online (AJOL)

    Plumage and ecology of cormorants. W.R. Siegfried, A.J. Williams, P.G.H. Frost, J.B. Kinahan. Abstract. The paper draws on data attending the etho-ecology of four species of cormorants (Phalacrocoracidae) in support of an hypothesis for the adaptive significance of the predominantly dark plumage of these birds.

  12. African Journal of Marine Science - Vol 40, No 1 (2018)

    African Journals Online (AJOL)

    Overview and status of estuarine microphytobenthos ecological research in South Africa · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. T Dalu, J.B. Adams, J.C. Taylor, G.C. Bate, M Nunes, P.W. Froneman, R.J. Wasserman, 1-12 ...

  13. Partnership for nuclear power in the Czech Republic

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-09-01

    A catalogue is presented of 27 organizations involved in the Czech nuclear programme. Characteristics and addresses are given of the Czech electrical utility, plant and component manufacturers, the uranium mining company, design and engineering companies, research establishments, and consulting companies. Some foreign companies with activities in the Czech Republic are also dealt with. (J.B.).

  14. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 234 of 234 ... Vol 7, No 1 (2005), Surgical treatment of trochanteric fractures: An Ivorian experience, Abstract PDF. JB Sié Essoh, M Kodo, A Traoré, Y Lambin. Vol 6, No 1-2 (2004), Term quadruplet pregnancy: a case report, Abstract PDF. T Ogunnowo, O Oluwole, CO Aimakhu, AO Ilesanmi, AO Omigbodun.

  15. Detection of bisphenol A using a novel surface plasmon resonance biosensor

    Czech Academy of Sciences Publication Activity Database

    Hegnerová, Kateřina; Piliarik, Marek; Šteinbachová, M.; Flegelová, Z.; Černohorská, H.; Homola, Jiří

    2010-01-01

    Roč. 398, č. 5 (2010), s. 1963-1966 ISSN 1618-2642 R&D Projects: GA AV ČR KAN200670701; GA MŠk OC09058 Institutional research plan: CEZ:AV0Z20670512 Keywords : surface plasmon resonance biosensor * bisphenol A * endocrine disruptor Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.841, year: 2010

  16. Enhanced levels of mitochondrial enzyme 17β-hydroxysteroid dehydrogenase type 10 in patients with Azheimer disease and multiple sclerosis

    Czech Academy of Sciences Publication Activity Database

    Krištofíková, Z.; Bocková, Markéta; Hegnerová, Kateřina; Bartoš, A.; Klaschka, J.; Říčný, J.; Řípová, D.; Homola, Jiří

    2009-01-01

    Roč. 10, č. 5 (2009), s. 1174-1179 ISSN 1742-206X R&D Projects: GA MZd NR9322 Institutional research plan: CEZ:AV0Z20670512 Keywords : 17beta-HSD 10 * Alzheimer disease * SPR sensor Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 4.015, year: 2009

  17. Surface plasmon resonance biosensors for detection of Alzheimer disease biomarkers

    Czech Academy of Sciences Publication Activity Database

    Hegnerová, Kateřina; Bocková, Markéta; Vaisocherová, Hana; Krištofíková, Z.; Říčný, J.; Řípová, D.; Homola, Jiří

    2009-01-01

    Roč. 139, č. 1 (2009), s. 69-73 ISSN 0925-4005 R&D Projects: GA MZd NR9322; GA AV ČR KAN200670701 Institutional research plan: CEZ:AV0Z20670512 Keywords : Alzheimer disease * SPR sensor * 17beta-HSD10 Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.083, year: 2009

  18. Neuroinflammation and Complexes of 17 beta-Hydroxysteroid Dehydrogenase type 10-Amyloid beta in Alzheimer's Disease

    Czech Academy of Sciences Publication Activity Database

    Krištofíková, Z.; Řípová, D.; Bartoš, A.; Bocková, Markéta; Hegnerová, Kateřina; Říčný, J.; Čechová, L.; Vrajová, M.; Homola, Jiří

    2013-01-01

    Roč. 10, č. 2 (2013), s. 165-173 ISSN 1567-2050 R&D Projects: GA MZd(CZ) NT11225 Institutional support: RVO:67985882 Keywords : Amyloid beta * mitochondrial enzyme * Alzheimer 's disease Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.796, year: 2013

  19. Analysis of the complex between amyloid beta peptides and mitochondrial enzyme 17beta-HSD in cerebrospinal fluid

    Czech Academy of Sciences Publication Activity Database

    Krištofíková, Z.; Hegnerová, Kateřina; Bocková, Markéta; Vaisocherová, Hana; Bartoš, A.; Říčný, J.; Řípová, D.; Homola, J.

    2008-01-01

    Roč. 275, podzim (2008), s. 249-249 ISSN 1742-464X. [EUROPTRODE /9./. Dublin, 30.03.2008-02.04.2008] Institutional research plan: CEZ:AV0Z20670512 Keywords : surface plasmon resonance * alzheimer disease * 17beta-HSD10 Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.139, year: 2008

  20. DNA-directed protein immobilization on mixed self-assembled monolayers via a streptavidin bringe

    Czech Academy of Sciences Publication Activity Database

    Ladd, J.; Boozer, C.; Yu, Q.; Chen, S.; Homola, Jiří; Jiang, S.

    2004-01-01

    Roč. 20, č. 19 (2004), s. 8090-8095 ISSN 0743-7463 Grant - others:US FDA(US) FD-U-002250 Institutional research plan: CEZ:AV0Z2067918 Keywords : biosensors * surface plasmon resonance * optical sensors Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.295, year: 2004

  1. DNA directed protein immobilization on mixed ssDNA/oligo /ethylene glycol/ self-assembled monolayers for sensitive biosensors

    Czech Academy of Sciences Publication Activity Database

    Boozer, C.; Ladd, J.; Chen, S.; Yu, Q.; Homola, Jiří; Jiang, S. Y.

    2004-01-01

    Roč. 76, č. 23 (2004), s. 6967-6972 ISSN 0003-2700 Grant - others:US FDA(US) FD-U-002250 Institutional research plan: CEZ:AV0Z2067918 Keywords : arrays * biosensors * surface plasmon resonance * gold Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 5.450, year: 2004

  2. GTD and PTD at DTU

    DEFF Research Database (Denmark)

    Breinbjerg, O.

    2012-01-01

    This paper reviews research in the Geometrical Theory of Diffraction (GTD) and the Physical Theory of Diffraction (PTD) at the Technical University of Denmark (DTU). The year 2012 celebrates the 50th anniversary of the seminal works of J.B. Keller on GTD and P. Ya Ufimtsev on PTD - two closely...

  3. Electric Motors: Technical Terminology Bulletin. Terminotech, Vol. 1, No. 2.

    Science.gov (United States)

    General Electric Co. of Canada, Ltd., Montreal, Quebec.

    This issue of a bulletin of technological terminology is devoted to electric motors. A brief narrative on the subject is included in both French and English. An English-French dictionary of terms comprises the bulk of the document. Explanatory illustrations are appended (JB).

  4. Natural Frequency of Oscillating Gaseous Bubbles in Ventilated Cavitation

    Science.gov (United States)

    Zhang, Yu-Ning

    2017-07-01

    Not Available Supported by the National Natural Science Foundation of China under Grant No 51506051, the Fundamental Research Funds for the Central Universities under Grant No JB2015RCY04, and the Incubation Project for Young Talents of Chinese Society for Electrical Engineering under Grant No JLB-2016-68.

  5. Evoked Brain Activity and Personnel Performance

    Science.gov (United States)

    1987-10-01

    Shucard and Horn (1972), Galbraith, Gliddon, and Busk (1970), and Callaway (1975), the latter using Navy recruits. Callaway’s own work was reported at...G.C., Gliddon, J.B., & Busk , J. (1970). Visual evoked responses in mentally retarded and nonretarded subjects. American Journal of Mental Deficiency

  6. Synthesis and characterization of some metal complexes of a Schiff ...

    African Journals Online (AJOL)

    The chemistry of the reaction of ninhydrin with amino acids has been ..... at 1600 – 1590 cm-1 and a weaker symmetric stretching peak at ~1400 cm-1 [35-38]. ..... Lambert, J.B; Shruvell, H.F.; Verbit, L.; Cooks, R.G.; Stout, G.H. Organic Structural.

  7. Natural superhydrophilicity and photocatalytic properties of sol–gel derived ZnTiO3-ilmenite/r-TiO2 films

    Czech Academy of Sciences Publication Activity Database

    Krylova, G.; Spanhel, L.; Brioude, A.; Soraya, A.G.; Mrázek, Jan

    2010-01-01

    Roč. 12, č. 45 (2010), s. 15101-15110 ISSN 1463-9076 R&D Projects: GA MŠk OC08023 Institutional research plan: CEZ:AV0Z20670512 Keywords : nanomaterial * photocatalyze * optical properties Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.454, year: 2010

  8. Self-referencing SPR imaging for most demanding high-throughput screening applications

    Czech Academy of Sciences Publication Activity Database

    Piliarik, Marek; Homola, Jiří

    2008-01-01

    Roč. 134, č. 2 (2008), s. 353-355 ISSN 0925-4005 R&D Projects: GA AV ČR KAN200670701 Institutional research plan: CEZ:AV0Z20670512 Keywords : surface plasmons * biosensors * detection Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.122, year: 2008

  9. Determination of the separation efficiencies of a single-stage cryogenic distillation setup to remove krypton out of xenon by using a Kr-83m tracer method

    Czech Academy of Sciences Publication Activity Database

    Rosendahl, S.; Brown, E.; Cristescu, I.; Fieguth, A.; Huhmann, C.; Lebeda, Ondřej; Murra, M.; Weinheimer, C.

    2015-01-01

    Roč. 86, č. 11 (2015), s. 115104 ISSN 0034-6748 R&D Projects: GA ČR(CZ) GAP203/12/1896; GA MŠk LM2011019 Institutional support: RVO:61389005 Keywords : Kr-83 * cryogenic destillation * detectors Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 1.336, year: 2015

  10. Hitler's Reich Viewed from 1984

    Science.gov (United States)

    Ward, James E.

    1971-01-01

    Viewed within a context of Orwell's 1984," the author's visit to East Germany, and particularly to the Museum for German History, revealed the efforts of an authoritarian regime to manipulate the thoughts and directions of that society to its own advantage. (JB)

  11. Surface plasmon resonance sensor for detection of bisphenol A in drinking water

    Czech Academy of Sciences Publication Activity Database

    Hegnerová, Kateřina; Homola, Jiří

    2010-01-01

    Roč. 151, č. 1 (2010), s. 177-179 ISSN 0925-4005 R&D Projects: GA AV ČR KAN200670701 Institutional research plan: CEZ:AV0Z20670512 Keywords : surface plasmon resonance biosensor * bisphenol A * drinking water Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.368, year: 2010

  12. Coexistent duodenal ulcer among patients with gastric carcinoma

    African Journals Online (AJOL)

    logic est. 1987; of s, 1987. 210: 990. 1980. ) 1960; ression. 0-year l fusion ontrolled of. Hong. Anterior. 64: one Joint hia: JB r hanical one Joint for the in the e study ... Antrum. Diffuse. Borrmann type. I. 11. III. IV. Early cancer. Metastasis. Successful resection. Diffuse tumour·involving both body and antrum; NS: not significant.

  13. In situ Measurements of Residual Stresses and Elelastic Moduli in Thermal Sprayed Coatings. Part 1: Apparatus and Analysis

    Czech Academy of Sciences Publication Activity Database

    Matějíček, Jiří; Sampath, S.

    2003-01-01

    Roč. 51, č. 3 (2003), s. 863-872 ISSN 1359-6454 Grant - others:NSF(US) DMR9632570 Institutional research plan: CEZ:AV0Z2043910 Keywords : coatings plasma spraying, mechanical properties testing, elastic modulus Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.059, year: 2003

  14. Nonlinear wave propagation through a ferromagnet with damping in ...

    Indian Academy of Sciences (India)

    magnetic waves in a ferromagnet can be reduced to an integro-differential equation. Keywords. Solitons; integro-differential equations; reductive perturbation method. PACS Nos 41.20 Jb; 05.45 Yv; 03.50 De; 78.20 Ls. 1. Introduction. The phenomenon of propagation of electromagnetic waves in ferromagnets are not only.

  15. 6th symposium on photochemical and thermal reactions of coordination compounds (SOPTROCC 6)

    International Nuclear Information System (INIS)

    Sykora, J.; Sima, J.

    1988-01-01

    The proceedings contain 53 papers of which two deal with nuclear topics, viz.: Quenching of Excited States of Lanthanide Complexes by Electron and Energy Transfer Processes and Spin Trapping in the Radiolysis of Phosphate Esters. Some 70 specialists from 12 countries including Japan and the USA attended the conference. (J.B.)

  16. relationship between prostate volume and ipss in african men with ...

    African Journals Online (AJOL)

    Administrator

    Tan JK, Png DJ, Liew LC, Li MK, Wong ML. Prevalence of prostatitis-like symptoms in Singapore: a population- based study. Singapore Medical Journal. 2002;. 43(4):189-193. Ming Yin, Sheldon B, Uma C, Michael JB, Rajiv D. Prevalence of Incidental Prostate Cancer in the General. Population: A Study of Healthy Organ ...

  17. Effects of various forms of lipopolysaccharide on the expression of ...

    African Journals Online (AJOL)

    Jane

    2011-10-05

    Oct 5, 2011 ... Lan-jun Bai1, Wings TY Loo2,3,4*, Yiding Dou4, Min Wang5, Hao Liang5, Mary NB Cheung3,4,6 ... The levels of lactate dehydrogenase (LDH), N-terminal pro ...... Li G-R, Sun H-Y, Chen J-B, Zhou Y, Tse H-F, Lau C-P (2009).

  18. Higher dimensional global monopole in Brans–Dicke theory

    Indian Academy of Sciences (India)

    Keywords. Global monopole; Brans–Dicke theory; higher dimension. PACS Nos 04.20.Jb; 98.80.Bp; 04.50.+h. 1. Introduction. The idea of higher dimensional theory was originated in super string and super gravity the- ories to unify gravity with other fundamental forces in nature. Solutions of Einstein field equations in higher ...

  19. Association of expression levels in skeletal muscle and a SNP in the ...

    Indian Academy of Sciences (India)

    dicted breeding value for rib eye area in two experiments using 100 sires (P ... In the real-time PCR-based analysis, we used skeletal muscle tissues of eight JB .... mediates recruitment of muscle-type creatine kinase (CK) to myosin. Biochem.

  20. Adaptive LQG controller tuning

    Czech Academy of Sciences Publication Activity Database

    Novák, Miroslav; Böhm, Josef; Nedoma, Petr; Tesař, Ludvík

    2003-01-01

    Roč. 150, č. 6 (2003), s. 655-665 ISSN 1350-2379 R&D Projects: GA ČR GA102/02/0204; GA AV ČR IBS1075102 Institutional research plan: CEZ:AV0Z1075907 Keywords : adaptive controller * LQG controller * controller design Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 0.745, year: 2003

  1. The SDF-1-CXCR4 Axis Functions Through p38-MAPK Signaling to Drive Breast Cancer Progression and Metastasis

    Science.gov (United States)

    2009-09-01

    2002). Rubin JB, Kung AL, Klein RS, Chan JA, Sun Y, Schmidt K, Kieran MW, Luster AD, Segal RA.A small-molecule antagonist of CXCR4 inhibits... Melanie H. Howell, Michelle Lacey, Betty Y. Shih, Carol Carter-Wientjes, Thomas E. Cleveland, John A. McLachlan, Thomas E. Wiese, Barbara S. Beckman

  2. Problems of zirconium metal production in Czechoslovakia

    International Nuclear Information System (INIS)

    Vareka, J.; Vaclavik, E.

    1975-01-01

    The problems are summed up of the production and quality control of zirconium sponge. A survey is given of industrial applications of zirconium in form of pure metal or alloys in nuclear power production, ferrous and non-ferrous metallurgy, chemical engineering and electrical engineering. A survey is also presented of the manufacture of zirconium metal in advanced capitalist countries. (J.B.)

  3. Proceedings of the international symposium on safety and reliability systems of PWRs and BWRs

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-05-01

    Out of 33 contributions presented at the conference, 30 were submitted to INIS. The conference programme was divided into three sections: (i) Diagnostics and in-service inspection; (ii) Safety and reliability of NPP operation; (iii) Experience of NPP operation and new approaches to nuclear safety. (J.B.).

  4. Long-term selection experiment with Afrikaner cattle

    African Journals Online (AJOL)

    Mario Beffa

    Long-term selection experiment with Afrikaner cattle. 3. Selection applied and response in calf growth traits. L.M. Beffa. 1,2,3. , J.B. van Wyk. 1# and G.J. Erasmus. 1. 1 University of the Free State, P.O. Box 339, Bloemfontein 9300, South Africa. 2 Matopos Research Station, P. Bag K5137, Bulawayo, Zimbabwe ...

  5. Solar Environmental Disturbances

    Science.gov (United States)

    2007-11-02

    Astronomische Nachrichten 324, 303-304: Design and Development of the Advanced Technology Solar Telescope Keller, C.U., Rimmele, T.R., Hill, F...Keil, S.L., Oschmann, J.M., and the ATST Team 2002, Astronomische Nachrichten 323, 294-298: The Advanced Technology Solar Telescope Mozer, J.B

  6. Effect of dietary vitamin D3 supplementation on meat quality of ...

    African Journals Online (AJOL)

    student

    Karges K, Brooks JC, Gill DR, Breazile JE, Owens FN and Morgan JB. (2001). Effect of ... Vitamin D3 and papaya leaf on meat quality of spent laying hens. Agric. J. 6(4): 197-200 ... Edn. SAS Institute, Inc., North Caroline, USA. Savell JW, Smith ...

  7. Barkhausen noise sensor with direct field control

    Czech Academy of Sciences Publication Activity Database

    Stupakov, Oleksandr

    2013-01-01

    Roč. 11, č. 1 (2013), s. 209-212 ISSN 1546-198X R&D Projects: GA ČR GP102/09/P108 Institutional research plan: CEZ:AV0Z10100520 Keywords : Barkhausen noise * field measurement * magnetic non-destructive testing Subject RIV: JB - Sensor s, Measurment, Regulation Impact factor: 0.558, year: 2013

  8. Quartz crystal microbalance gas sensor with nanocrystalline diamond sensitive layer

    Czech Academy of Sciences Publication Activity Database

    Varga, Marián; Laposa, A.; Kulha, Pavel; Kroutil, J.; Husák, M.; Kromka, Alexander

    2015-01-01

    Roč. 252, č. 11 (2015), s. 2591-2597 ISSN 0370-1972 R&D Projects: GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:68378271 Keywords : gas sensor * nanocrystalline diamond * quartz resonator * thickness shear mode Subject RIV: JB - Sensor s, Measurment, Regulation Impact factor: 1.522, year: 2015

  9. From Homer to Hoke: A Small Step for African American Mankind.

    Science.gov (United States)

    Turner, Patricia A.

    1991-01-01

    Explores links between two films, "Lilies of the Field" (1962) and "Driving Miss Daisy" (1987), their portrayal of African-American men in relationships with White women, and audience and critic responses to the films. Little has changed in the Hollywood perceptions since the earlier film was made. (JB)

  10. Nigerian Veterinary Journal - Vol 36, No 1 (2015)

    African Journals Online (AJOL)

    Evaluation of Healing Intervals of Incisional Skin Wounds of Goats Closed with Three Suture Patterns · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AA Abubakar, U Adamu, JB Adeyanju, ROC Kene, ML Sonfada, AS Yakubu, SM Sahabi, AA Umar, HM Ibrahim, ...

  11. South African Journal of Animal Science - Vol 39, No 3 (2009)

    African Journals Online (AJOL)

    Genetic parameters for subjectively assessed wool and conformation traits in the Tygerhoek Merino flock · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. PA Matebesi, JB van Wyk, SW Cloete. http://dx.doi.org/10.4314/sajas.v39i3.49148 ...

  12. The Question of Our Professional Identity: Reactions to the Barth/Shermis Article

    Science.gov (United States)

    Barr, Robert D.

    1970-01-01

    Discusses the positive value and usefullness of the Barth and Shermis definition of social studies and points out that in spite of circumstances which wmay limit its classroom influence, it should serve to focus attention on the important question of professional identity. Related article SO 500 188. (JB)

  13. Effect of salt on color and warmed over flavor in charqui meat processing

    Directory of Open Access Journals (Sweden)

    Youssef Elza Y.

    2003-01-01

    Full Text Available A combination of salt (NaCl high concentration and curing salt was investigated for their role in warmed-over flavor (WOF and color changes during charqui meats processing. WOF was measured by TBARS method in uncured charqui meat (CH and in cured charqui known in Brazil as Jerked beef (JB. WOF occurred substantially in CH and sodium nitrite was able to inhibit 40-45% (p<0.05 in JB samples stored for 30 days. Color parameters also changed as evaluated by CIELAB system. The a*/b* ratio showed that CH samples presented brown color indicating the formation of metmyoglobin (Fe3+ whilst JB samples presented deep red color an indication of nitrosylmyoglobin (Fe2+ formation. Under cooking, a*/b* ratio indicated the presence of denatured metmyoglobin (Fe3+ in CH and formation of nitrosylmyochromogen (Fe2+ in JB samples. The actual iron state influenced the color of charqui meat and apparently nitrite was able to chelate Fe ions, thus inhibiting development of WOF.

  14. Baikal - neutrino trap

    International Nuclear Information System (INIS)

    Domogatskij, G.

    1984-01-01

    For recording cosmic neutrinos the installation is considered of a detector in the depths of the Baikal lake with a capacity of up to 10 6 m 3 in the shape of a crystalline lattice with photoelectron multipliers placed in its nodes. (J.B.)

  15. Chemistry and the development of research into the structure of matter

    International Nuclear Information System (INIS)

    Coldanskij, V.

    1977-01-01

    Efforts have been made recently to explain the structure of the atomic nucleus and the structure of the electron shell of the atom using a unified quantum mechanics description. The applications are surveyed of the knowledge of the nucleus and electron shell structure in chemistry. Electron paramagnetic resonance, nuclear magnetic resonance and gamma resonance spectrometry are presented as examples. (J.B.)

  16. Importance of nuclear power for chemistry

    International Nuclear Information System (INIS)

    Kolotyrkin, J.

    1982-01-01

    Examples are given of the use of ionizing radiations in nuclear chemistry, in radiation cross-linking of polymers. The possibilities are also indicated of applications in the disinfection of wastes, in fertilizer production and packaging, in the production of cellulose and hydrogen. The implementation of the said technologies depends on the solution of a number organizational problems. (J.B.)

  17. Multi-wall carbon nanotube networks as potential resistive gas sensors for organic vapor detection

    Czech Academy of Sciences Publication Activity Database

    Slobodian, P.; Říha, Pavel; Lengálová, A.; Svoboda, P.; Sáha, P.

    2011-01-01

    Roč. 49, č. 7 (2011), s. 2499-2507 ISSN 0008-6223 Institutional research plan: CEZ:AV0Z20600510 Keywords : carbon nanotube network * KMnO 4 oxidation * electrical resistance * organic vapor detection * adsorption /desorption cycles Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 5.378, year: 2011

  18. Rediscovering Paideia and the Meaning of a Scholarly Career: Rejoinder to "Identifying Research Topic Development in Business and Management Education Research Using Legitimation Code Theory"

    Science.gov (United States)

    Antonacopoulou, Elena P.

    2016-01-01

    In "Identifying Research Topic Development in Business and Management Education Research Using Legitimation Code Theory," authors J.B. Arbaugh, Charles J. Fornaciari, and Alvin Hwang ("Journal of Management Education," December 2016 vol. 40 no. 6 p654-691, see EJ1118407) used citation analysis to track the development of…

  19. Genetics Home Reference: Shprintzen-Goldberg syndrome

    Science.gov (United States)

    ... Carmignac V, Thevenon J, Adès L, Callewaert B, Julia S, Thauvin-Robinet C, Gueneau L, Courcet JB, Lopez E, Holman K, Renard M, Plauchu H, Plessis G, De Backer J, Child A, Arno G, Duplomb L, Callier P, Aral ...

  20. An Approach to Reduce the Sample Consumption for LIBS based Identification of Explosive Materials

    Czech Academy of Sciences Publication Activity Database

    Anubham, S.K.; Junjuri, R.; Myakalwar, A.K.; Gundawar, M.K.

    2017-01-01

    Roč. 67, č. 3 (2017), s. 254-259 ISSN 0011-748X Institutional support: RVO:67985882 Keywords : Laser induced breakdown spectroscopy * K - Nearest neighbour * Synthetic spectra Subject RIV: JB - Sensors, Measurment, Regulation OBOR OECD: Electrical and electronic engineering Impact factor: 0.500, year: 2016

  1. Untitled

    African Journals Online (AJOL)

    Barr, J.B.; Wallon, S.B. J. Appl. Polym. Sci. 1971, 15, 1079. Chuang, I-S; Maciel, G.E. Macromolecules 1984, 17, 1087. Gandini, A. Comprehensive Polymer Science, Pergamon Press: Oxford; 1992. Choura, M. Doctoral Thesis, National Polytechnic Institute, Grenoble, France, 1991. Wewerka, E.M.; Loughran, E.D.; Walters, ...

  2. Sledování pH komorové tekutiny při operaci šedého zákalu (katarakty) pomocí vláknově optického senzoru

    Czech Academy of Sciences Publication Activity Database

    Podrazký, Ondřej; Mrázek, Jan; Proboštová, Jana; Kašík, Ivan; Pitrová, Š.; Pavlíčková, K.

    2017-01-01

    Roč. 62, 11-12 (2017), s. 310-312 ISSN 0447-6441 R&D Projects: GA TA ČR(CZ) TA04011400 Institutional support: RVO:67985882 Keywords : optical sensor s * pH * cataract Subject RIV: JB - Sensor s, Measurment, Regulation OBOR OECD: Electrical and electronic engineering

  3. Fiber-Optic Chemical Sensors and Fiber-Optic Bio-Sensors

    Czech Academy of Sciences Publication Activity Database

    Pospíšilová, M.; Kuncová, Gabriela; Trögl, J.

    2015-01-01

    Roč. 15, č. 10 (2015), s. 25208-25259 ISSN 1424-8220 Institutional support: RVO:67985858 Keywords : fiber-optic sensor * chemical sensors * enzymatic sensor Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 2.033, year: 2015

  4. Upsurge of X-ray astronomy 230-

    International Nuclear Information System (INIS)

    Hudec, D.R.

    1978-01-01

    Instruments are described used for X-ray astronomy, namely X-ray detectors and X-ray telescopes. Unlike telescopes, the detectors do not comprise X-ray optics. A survey is given of the results obtained in solar and stellar X-ray astronomy and hypotheses are submitted on the origin of X radiation in the interstellar space. (J.B.)

  5. Standoff Detection of Explosives at 1 m using Laser Induced Breakdown Spectroscopy

    Czech Academy of Sciences Publication Activity Database

    Junjuri, R.; Myakalwar, A.K.; Gundawar, M.K.

    2017-01-01

    Roč. 67, č. 6 (2017), s. 623-630 ISSN 0011-748X Institutional support: RVO:67985882 Keywords : Laser induced breakdown spectroscopy * Multivariate analysis * Principal component analysis * Explosive detection Subject RIV: JB - Sensors, Measurment, Regulation OBOR OECD: Electrical and electronic engineering Impact factor: 0.500, year: 2016

  6. Animal Production Research Advances - Vol 6, No 3 (2010)

    African Journals Online (AJOL)

    Environmental Impact and Hazards Analysis Critical Control Point (Haccp) Concept in the Production of Tsire at Zaria, Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. IO Abdullahi, VJ Umoh, JB Ameh, M Galadima, 220-225 ...

  7. Hydraulic Turbines: The Francis Turbine. Technical Terminology Bulletin. Terminotech, Vol. 2, No. 2.

    Science.gov (United States)

    General Electric Co. of Canada, Ltd., Montreal, Quebec.

    This issue of a bulletin of technological terminology is devoted to the Francis turbine. A brief narrative on the subject is presented in both French and English. An English-French dictionary of terms comprises the bulk of the document. An explanatory illustration is appended. (JB)

  8. Hydraulic Turbines: The Pelton Turbine. Technical Terminology Bulletin. Terminotech, Vol. 2, No. 3.

    Science.gov (United States)

    General Electric Co. of Canada, Ltd., Montreal, Quebec.

    This issue of a bulletin of technological terminology is devoted to the Pelton turbine. A brief narrative on the subject is presented in both French and English. An English-French dictionary of terms comprises the bulk of the document. Explanatory illustrations are appended. (JB)

  9. Rules, Models, and Self-Reinforcement in Children

    Science.gov (United States)

    Hildebrandt, David E.; And Others

    1973-01-01

    The study found that concordance between a rule and a recent model's behavior was most effective in leading to acceptance of the rule, despite a tendency for the subject's to adopt lenient self-reinforcement criteria when given an opportunity to do so. (JB)

  10. Decree of the Czech Labor Safety Office No. 263/1991 amending the Decree No. 76/1989 on ensuring safety of technical facilities in the nuclear power sector

    International Nuclear Information System (INIS)

    1995-01-01

    Some provisions of the Decree of the Czech Labor Safety Office No. 76/1989 on ensuring safety of technical facilities in the nuclear power sector are amended, particularly in the field of construction activities, assembling, reconstruction and repair of nuclear power facilities. The Decree entered into force on 28 June 1991. (J.B.)

  11. Effective Surface Area of Electrochemical Sensors

    Czech Academy of Sciences Publication Activity Database

    Krejčí, J.; Sajdlová, Z.; Neděla, Vilém; Flodrová, Eva; Šejnohová, R.; Vránová, H.; Plička, R.

    2014-01-01

    Roč. 161, č. 6 (2014), B147-B150 ISSN 0013-4651 R&D Projects: GA MPO FR-TI1/118 Institutional support: RVO:68081731 Keywords : scanning electron microscopy * glassy-carbon electrode * gold electrodes * biosensors Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.266, year: 2014

  12. Surface plasmon resonance sensing of nucleic acids: A review

    Czech Academy of Sciences Publication Activity Database

    Šípová, Hana; Homola, Jiří

    -, č. 773 (2013), s. 9-23 ISSN 0003-2670 R&D Projects: GA MŠk(CZ) LH11102 Institutional support: RVO:67985882 Keywords : Surface plasmon resonance * Nucleic acid * Biosensor Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 4.517, year: 2013

  13. Configuration-controlled Au nanocluster arrays on inverse micelle nano-patterns: versatile platforms for SERS and SPR sensors

    Czech Academy of Sciences Publication Activity Database

    Jang, H.Y.; Chung, K.; Quan, L.N.; Špačková, Barbora; Šípová, Hana; Moon, S.; Cho, W. J.; Shin, H.; Jang, Y.J.; Lee, J.; Kochuveedu, S.T.; Yoon, M.J.; Kim, J.; Yoon, S.; Kim, J. K.; Kim, D.; Homola, Jiří; Kim, D.H.

    2013-01-01

    Roč. 5, č. 24 (2013), s. 1261-1271 ISSN 2040-3364 R&D Projects: GA ČR GBP205/12/G118; GA MŠk(CZ) LH11102 Institutional support: RVO:67985882 Keywords : Surface plasmons * Biosensors Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 6.739, year: 2013

  14. Label-Free Biosensing in Complex Media: A Referencing Approach

    Czech Academy of Sciences Publication Activity Database

    Špringer, Tomáš; Bocková, Markéta; Homola, Jiří

    2013-01-01

    Roč. 85, č. 12 (2013), s. 5637-5640 ISSN 0003-2700 R&D Projects: GA MŠk(CZ) LH11102 Institutional support: RVO:67985882 Keywords : BLOOD-PLASMA * BIOMARKER * PROTEIN Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 5.825, year: 2013

  15. Asynchronous electromotor controlled tuned through CARLA method

    Czech Academy of Sciences Publication Activity Database

    Březina, Tomáš; Turek, M.

    2004-01-01

    Roč. 2004, 8-9 (2004), s. 27-30 ISSN 0033-2089. [Mechatronics 2004. Warsaw, 23.09.2004-25.09.2004] Institutional research plan: CEZ:AV0Z2076919 Keywords : CARLA * control Subject RIV: JB - Sensors, Measurment, Regulation

  16. Bericht 2005 über fazielle und biostratigraphishe Untersuchungen in der Gosau der Neualm bei Russbach am Pass Gschütt auf Blatt 95 St. Wolfgang

    Czech Academy of Sciences Publication Activity Database

    Hradecká, L.; Lobitzer, H.; Svobodová, Marcela; Švábenická, L.

    2006-01-01

    Roč. 146, 1-2 (2006), s. 132-133 ISSN 0016-7800 Institutional research plan: CEZ:AV0Z30130516 Keywords : sedimentology * paleontology * Gosau Fm., * Northern Calcareous Alps, * Austria Subject RIV: DB - Geology ; Mineralogy http://www.geologie.ac.at/filestore/download/JB1461_132_A.pdf

  17. Someone to Count On: Homeless, Male Drug Users and Their Friendship Relations.

    Science.gov (United States)

    Sterk-Elifson, Claire; Elifson, Kirk W.

    1992-01-01

    A study exploring friendship relations of homeless, male drug users (aged between 21 and 50 years) through 27 in-depth interviews in Atlanta (Georgia) found that subjects were engaged in friendship networks that offered social support and that there was a relationship between friendships and patterns of crack cocaine use. (JB)

  18. Central African Journal of Medicine - Vol 60, No 3 (2014)

    African Journals Online (AJOL)

    Prevalence of HIV among people with physical disabilities in Rwanda · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JB Munymana, VRP M'Kumbuzi, HT Mapira, I Nzabanterura, I Uwamariya, E Shema, 62-69 ...

  19. Surface plasmon resonance sensor with dispersionless microfluidics for direct detection of nucleic acids at the low femtomole level

    Czech Academy of Sciences Publication Activity Database

    Špringer, Tomáš; Piliarik, Marek; Homola, Jiří

    2010-01-01

    Roč. 145, č. 1 (2010), s. 588-591 ISSN 0925-4005 R&D Projects: GA AV ČR KAN200670701 Institutional research plan: CEZ:AV0Z20670512 Keywords : microfluidics * surface plasmon resonance * DNA detection Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.368, year: 2010

  20. Spectrum-effect relationships between high performance liquid ...

    African Journals Online (AJOL)

    promoting effect on contractility of intestinal smooth was carried out to ... addition, the equation of spectrum-effect relationships {Y = 3.818 - 1.126X1 + ..... Peng W, Liu YJ, Wu N, Sun T, He XY, Gao YX, Wu CJ. ... Zheng QF, Zhao YL, Wang JB, Liu TT, Zhang B, Gong ... Zhao HY, Han X. Research thoughts and application.

  1. CQ No. 25

    African Journals Online (AJOL)

    SA Crime Quarterly no 34 • December 2010. 41. Johan Burger (JB): One of the many outstanding successes ... section 49 of the Criminal Procedure Act that governs the legal use of deadly force to effect an arrest, and ... research have linked directly to weaknesses in internal command and control. How do you see changing ...

  2. Accuracy of tracer stimulus response experiments in laminar flows

    Czech Academy of Sciences Publication Activity Database

    Chlup, Hynek; Novotný, Pavel; Žitný, R.

    2012-01-01

    Roč. 55, 23-24 (2012), s. 6458-6462 ISSN 0017-9310 Institutional research plan: CEZ:AV0Z20760514 Keywords : residence time distribution * tracer injection * laminar convective dominated flow Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 2.315, year: 2012 http://www.sciencedirect.com/science/article/pii/S001793101200470X

  3. Results of Summer Enrichment Program to Promote High School Students' Interest in Engineering

    Science.gov (United States)

    Hart, Brenda; McAnulty, Kate

    2014-01-01

    For more than thirty years, personnel from the University of Louisville J.B. Speed School of Engineering have presented a summer program targeting high school students historically underrepresented in engineering fields. INSPIRE provides these students with an introduction to careers in engineering and assists the students in planning their…

  4. Renewable Energy Sources Brno '93

    International Nuclear Information System (INIS)

    1993-01-01

    The proceedings contain 27 contributions dealing with unconventional energy sources. The numbers of contributions in the individual classes of topics indicate that interest has mostly concentrated on the direct utilization of solar energy, whereas wind energy, hydroelectric energy and geothermal energy receive less attention and the use of biomass is at the margin of interest. (J.B.)

  5. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 70 ... JO Olusina, JB Olaleye, AS Alademomi, TI Ojie. Vol 3, No 1 (2008), Crushing strength of concrete using maize cob ... IO Famakin, SA Makanjuola, O Adeniyi, TO Oladinrin. Vol 5, No 1 (2010), Implications of Spatial Pattern of Social Infrastructure Stock in the Development of Rural Areas of Akwa Ibom State.

  6. Inkanyiso: Journal of Humanities and Social Sciences - Vol 4, No 1 ...

    African Journals Online (AJOL)

    The effects of alcohol consumption on student life at a rural campus · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JB Dlamini, H Rugbeer, GM Naidoo, RM Metso, P Moodley, 49-57. The stuttering implementation of language policies in the South African education ...

  7. Southern Forests: a Journal of Forest Science - Vol 199 (2003)

    African Journals Online (AJOL)

    African sandalwood (Osyris lanceolata): resource assessment and quality variation among populations in Tanzania: research note · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. PL Mwang'ingo, Z Teklehaimanot, JB Hall, LLL Lulandala, 77-88 ...

  8. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 506 ... PL Mwang'ingo, Z Teklehaimanot, JB Hall, LLL Lulandala. Vol 206 (2006), Age determination of miombo species Brachystegia spiciformis (Leguminosae – Caesalpinoideae) in Zimbabwe using growth rings, Abstract. IM Grundy. Vol 73, No 2 (2011), Air layering and its potential in propagating Uapaca ...

  9. Neutron activation analysis in geological samples containing rare earths, uranium and thorium

    International Nuclear Information System (INIS)

    Vasconcellos, M.B.A.; Figueiredo, A.M.G.; Berretta, J.R.; Soares, J.C.A.C.R.; Fratin, L.; Goncales, O.L.; Botelho, S.

    1990-01-01

    The neutron activation analysis method was used for determination of rare earths, uranium, thorium and other tracks in geological samples, under the geological standard JB-1 (Geological Survey of Japan) and S-8 and S-13 (IAEA). (L.C.J.A.)

  10. Water SA - Vol 28, No 3 (2002)

    African Journals Online (AJOL)

    The importance of the river-estuary interface (REI) zone in estuaries · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. GC Bate, AK Whitfield, JB Adams, P Huizinga, TH Wooldridge, 271-280. http://dx.doi.org/10.4314/wsa.v28i3.4894 ...

  11. Revue de Médecine et de Pharmacie - Vol 3, No 1 (2013)

    African Journals Online (AJOL)

    La corticothérapie dans la prise en charge hospitalière de l'asthme à Yaoundé : Connaissances, Attitudes et Pratiques · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. EA Ze, AAM Kamgueng, G Nguefack-Tsague, J-B Bogne, 254-261 ...

  12. Nutritional status of preschool children in informal settlement areas near Bloemfontein, South Africa.

    Science.gov (United States)

    Dannhauser, A; Bester, C; Joubert, G; Badenhorst, P; Slabber, M; Badenhorst, A; Du Toit, E; Barnard, H; Botha, P; Nogabe, L

    2000-09-01

    To determine the nutritional status and household resources of preschool children. A cross-sectional survey. : Two informal settlement areas, Joe Slovo (JS) and JB Mafora (JBM) in Mangaung, near Bloemfontein, South Africa. Preschool children (poor household situation of the participants. The generally poor nutritional status and environmental conditions emphasize the urgency of intervention for these children.

  13. Improved speed of hydrogen detection by Schottky diodes on InP with electrophoretically deposited Pt nanoparticles and graphite contacts

    Czech Academy of Sciences Publication Activity Database

    Žďánský, Karel; Dickerson, J.H.

    -, č. 184 (2013), s. 295-300 ISSN 0925-4005 R&D Projects: GA MŠk(CZ) OC10021 Institutional support: RVO:67985882 Keywords : Metal nanoparticles * Keyed electrophoresis * Hydrogen sensors Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.840, year: 2013

  14. Action in Ergonomics

    Science.gov (United States)

    Training Officer, 1975

    1975-01-01

    A discussion with James Crowley of British Steel Corporation on the changing face of ergonomics in practice today and yesterday examines the influence of experimental psychology on the method of study and data collection. The broadening scope of ergonomics from only safety concerns to cost effectiveness and the computer are analyzed. (Author/JB)

  15. O(α2L2) radiative corrections to deep inelastic ep scattering for different kinematical variables

    International Nuclear Information System (INIS)

    Bluemlein, J.

    1994-03-01

    The QED radiative corrections are calculated in the leading log approximation up to O(α 2 ) for different definitions of the kinematical variables using jet measurement, the 'mixed' variables, the double angle method, and a measurement based on θ e and y JB . Higher order contributions due to exponentiation of soft radiation are included. (orig.)

  16. Combining surface waves and common methods for shallow geophysical survey

    Czech Academy of Sciences Publication Activity Database

    Gaždová, Renata; Kolínský, Petr; Vilhelm, J.; Valenta, Jan

    2015-01-01

    Roč. 13, č. 1 (2015), s. 19-32 ISSN 1569-4445 R&D Projects: GA SÚJB JC_1/2009 Institutional support: RVO:67985891 Keywords : attenuation curves * inversion * dispersion * velocity * faults Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.232, year: 2015

  17. A label-free and portable multichannel surface plasmon resonance immunosensor for on site analysis of antibiotics in milk samples

    Czech Academy of Sciences Publication Activity Database

    Fernández, F.; Hegnerová, Kateřina; Piliarik, Marek; Sanchez-Baeza, F.; Homola, Jiří; Marko, M.P.

    2010-01-01

    Roč. 26, č. 4 (2010), s. 1231-1238 ISSN 0956-5663 R&D Projects: GA AV ČR KAN200670701 Institutional research plan: CEZ:AV0Z20670512 Keywords : surface plasmon resonance * antibiotic s * milk Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 5.361, year: 2010

  18. El Lenguaje de los Chicanos (The Language of Chicanos). Regional and Social Characteristics of Language Used by Mexican Americans.

    Science.gov (United States)

    Hernandez-Chavez, Eduardo, Ed.; And Others

    The following articles are included in this anthology on Chicano speech: (1) "Mexican Spanish," D.N. Cardenas; (2) "The Archaic and the Modern in the Spanish of New Mexico," J. Ornstein; (3) "Problemas Lexicograficos del Espanol del Sudoeste," A.M. Espinosa, Jr.; (4) "Associative Interference in New Mexican Spanish," J.B. Rael; (5) "Some Aspects…

  19. Armageddon’s Lost Lessons: Combined Arms Operations in Allenby’s Palestine Campaign

    Science.gov (United States)

    2005-02-01

    followed closely behind, allowing air assets to keep pace with the fast-moving cavalry. By 1 October, Dam- ascus was occupied in force, and Allenby yet...Cyril B. Falls, Armageddon: 1918 (Philadelphia; New York: J.B. Lippincott Company, 1964), 62; Sav- age , Allenby of Armageddon, 210–11. 36. Earl Wavell

  20. Model comparisons and genetic and environmental parameter ...

    African Journals Online (AJOL)

    arc

    Model comparisons and genetic and environmental parameter estimates of growth and the ... breeding strategies and for accurate breeding value estimation. The objectives ...... Sci. 23, 72-76. Van Wyk, J.B., Fair, M.D. & Cloete, S.W.P., 2003.

  1. Etude linguistique chez les Baráshi/Banyaambo du Rwanda ...

    African Journals Online (AJOL)

    Among the main African Languages spoken in Rwanda besides Kinyarwaanda: amashí in the South, olucigá in the North and ikiráshi/ikinyaambo in the East, only olucigá has been particularly described: J.-B. Murekezi (1984), F.-X. Bangamwabo (1989); others are just mentioned in global sociolinguistic studies: B.

  2. Pharmacognostic evaluation of the leaves of Dissotis rotundifolia ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-01-05

    Jan 5, 2009 ... Romania, pp.17-25. Evans WC (1996). Trease and Evans Pharmacognosy. WB Saunders. Ltd. London. 14th Ed. 119-159. Harborne JB (1992). Phytochemical methods. A guide to modern technique of plant analysis. Chapman and Hill, London, p. 279. Kokwaro JC (1976). Medicinal plants of East Africa.

  3. Continuity and Discontinuity in the Contemporary Crisis of Meanings

    Science.gov (United States)

    Etzioni, Amitai

    1972-01-01

    A discussion of the main historical roots and the key features of the contemporary crisis of the erosion of legitimation and the loss of meaning. Author traces the course of capitalism from a puritan to a hedonistic ethos and discusses postmodern alternatives of social philosophy. (Author/JB)

  4. Aeromagnetic imaging of the basement morphology in part of the ...

    African Journals Online (AJOL)

    Aeromagnetic imaging of the basement morphology in part of the middle Benue trough, Nigeria. GC Onyedim, MO Awoyemi, EA Ariyibi, JB Arubayi. Abstract. No Abstract. Journal of Mining and Geology Vol. 42 (2) 2006: pp. 157-163. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD ...

  5. 78 FR 14556 - Cheng Yi Liang: Debarment Order

    Science.gov (United States)

    2013-03-06

    .... 1001 and securities fraud, a Federal felony offense under 15 U.S.C. 78j(b) and 78ff. FDA's finding that debarment is appropriate is based on the felony conviction for securities fraud referenced herein for... execution of trades on national securities exchanges, resulting in total profits and losses avoided of $3...

  6. Detection of a milling-induced surface damage by the magnetic Barkhausen noise

    Czech Academy of Sciences Publication Activity Database

    Stupakov, Alexandr; Neslušan, M.; Perevertov, Oleksiy

    2016-01-01

    Roč. 410, Jul (2016), 198-209 ISSN 0304-8853 R&D Projects: GA ČR GB14-36566G; GA ČR GA13-18993S Institutional support: RVO:68378271 Keywords : Barkhausen noise * surface field measurement * magnetization waveformcontrol * hard turning * surface integrity Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 2.630, year: 2016

  7. Workshop 95. Part I

    International Nuclear Information System (INIS)

    1995-12-01

    The proceedings of the seminar contain more than 420 contributions divided into 21 areas of interest. In Part I, 144 contributions are presented from the following fields: mathematics, physics, chemistry, engineering informatics and cybernetics, computer art, and fluid mechanics. For input in INIS, 15 contributions were selected from the physics section and 1 from the chemistry section. (J.B.)

  8. Power Transformers: Technical Terminology Bulletin. Terminotech, Vol.2, No. 6.

    Science.gov (United States)

    General Electric Co. of Canada, Ltd., Montreal, Quebec.

    This issue of a bulletin of technological terminology is devoted to power transformers. A brief narrative on the subject is presented in both French and English. An English-French dictionary of terms comprises the bulk of the document. Explanatory illustrations are appended. (JB)

  9. Preparing the construction of a school reactor

    International Nuclear Information System (INIS)

    Matejka, K.

    1977-01-01

    The possibilities are discussed of teaching and training nuclear reactor operation and control, teaching experimental reactor physics and investigating reactor lattice parameters using a training reactor to be installed at the Faculty of Nuclear Science and Physical Engineering in Prague. Requirements are indicated for the reactor's technical design and the Faculty's possibilities to contribute to its construction. (J.B.)

  10. Impedance spectroscopy on xerogel layer for chemical sensing

    Czech Academy of Sciences Publication Activity Database

    Abdelghani, A.; Cherif, K.; Jaffrezic-Renault, N.; Matějec, Vlastimil

    2006-01-01

    Roč. 26, 2/3 (2006), s. 542-545 ISSN 0928-4931. [MADICA 2004. Tunis, 29.11.2004-01.12.2004] Institutional research plan: CEZ:AV0Z2067918 Keywords : demodulation * chemical sensors * aerogels * spectroscopy * sol-gel processing Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 1.325, year: 2006

  11. A Novel Swine Model for Evaluation of Potential Intravascular Hemostatic Agents

    Science.gov (United States)

    2007-06-01

    bovine polymerized hemoglobin on coagulation in controlled hemorrhagic shock in swine. Shock 24:145–152. 2. Bellamy RF. 1984. The causes of death in...WZ, Pusateri AE, Uscilowicz JM, Delgado AV, Holcomb JB. 2005. Independent contributions of hypothermia and acidosis to coagulopathy in swine. J

  12. Ise Ni Ounise, Mura Si Ise Ore Mi

    African Journals Online (AJOL)

    OHUN TI A BA FARA SISE FUN Whatever we gain one does not work hard to earn. SI KI LO TOJO ... J.B Yeats' (1956) reality: “things fall apart”, the gradual calamitous collapse and tragedy of “the ..... IJA, therefore, asserts that the right thing to.

  13. Mikroradiografie v materiálovém výzkumu

    Czech Academy of Sciences Publication Activity Database

    Vavřík, Daniel; Jakůbek, J.; Jakůbek, M.; Holý, T.

    2008-01-01

    Roč. 58, č. 1 (2008), s. 53-57 ISSN 0009-0700 R&D Projects: GA MŠk(CZ) LC06041; GA MŠk(CZ) 1P04LA211 Institutional research plan: CEZ:AV0Z20710524 Keywords : digital radiography * digital image correlation * ductile fracture mechanics Subject RIV: JB - Sensors, Measurment, Regulation

  14. Trends in Adults Receiving a Recommendation for Exercise or Other Physical Activity from a Physician or Other Health ...

    Science.gov (United States)

    ... U.S. national physical activity plan. J Phys Act Health 6(suppl 2):S211–9. 2009. Weidinger KA, Lovegreen SL, Elliott MB, Hagood L, Haire-Joshu D, Mcgill JB, Brownson RC. How to make exercise counseling more effective: Lessons from rural America. J Fam Pract 57( ...

  15. A Community of Friends and Classmates.

    Science.gov (United States)

    Casanave, Suki

    1991-01-01

    The experience of one handicapped boy and his family at a Concord (New Hampshire) elementary school that practices inclusive education highlights obstacles the parents met with regard to placing their son at the local school, early successes, social and academic progress for the student, and changing attitudes. (JB)

  16. African Americans: Race as a Self-Schema Affecting Physical Activity Choices.

    Science.gov (United States)

    Harrison, Louis Jr.

    1995-01-01

    This paper examines theoretical and empirical contributions to racial differences in spot performance and describes a framework for viewing race as a movement self-schema. The roles of television, modeling, expectation theory, and sociological influences are discussed as possible activators of racial movement self-schemata. (JB)

  17. Detecting the adsorption of dye molecules in homogenous poly(propylene imine) dendrimer monolayers by surface plasmon resonance sensor

    Czech Academy of Sciences Publication Activity Database

    Chen, S.; Yu, Q.; Li, L.; Boozer, C. L.; Homola, Jiří; Yee, S. S.; Jiang, S.

    2002-01-01

    Roč. 124, č. 13 (2002), s. 3395-3401 ISSN 0002-7863 Grant - others:National Science Foundation(US) CTS-0092699; National Science Foundation(US) CTS-9983895 Keywords : biosensors * surface plasmon resonance * optical sensors Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 6.201, year: 2002

  18. Research of human factor in nuclear power plants

    International Nuclear Information System (INIS)

    Nopp, I.

    1983-01-01

    The question is discussed of the study of the human factor with regard to the reliability of nuclear power plant operation. The reliability of the human factor is the result of the functional fitness, motivation, working conditions and working regime of personnel. (J.B.)

  19. Residual stresses in cold-coiled helical compression springs for automotive suspensions measured by neutron diffraction

    Czech Academy of Sciences Publication Activity Database

    Matějíček, Jiří; Brand, P. C.; Drews, A. R.; Krause, A.; Lowe-Ma, C.

    2004-01-01

    Roč. 367, 1-2 (2004), s. 306-311 ISSN 0921-5093 Institutional research plan: CEZ:AV0Z2043910 Keywords : residual stress, automotive springs, neutron diffraction Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 1.445, year: 2004

  20. Face to Face The IGBT and its Creator

    Indian Academy of Sciences (India)

    IAS Admin

    brand name that they now are. What was it like? JB: When I finished high school, ... US, but the IIT brand was not there back then. My philosophy was to get into the top schools or ..... also very successful and we found ourselves years ahead of the rest of the world meaning big companies like Siliconix, Hitachi and Philips.

  1. Přehledný kalkul uzavřených regulačních obvodů

    Czech Academy of Sciences Publication Activity Database

    Klán, Petr

    -, č. 12 (2011), s. 53-55 ISSN 1210-9592 Institutional research plan: CEZ:AV0Z10300504 Keywords : automatické řízení * tříparametrový model * přenos * Laplaceova transformace Subject RIV: JB - Sensors, Measurment, Regulation http://www.odbornecasopisy.cz/res/pdf/45426.pdf

  2. Přehledný kalkul tříparametrových modelů

    Czech Academy of Sciences Publication Activity Database

    Klán, Petr

    -, 8-9 (2011), s. 70-73 ISSN 1210-9592 Institutional research plan: CEZ:AV0Z10300504 Keywords : automatické řízení * uzavřený regulační obvod, * přenos * Laplaceova transformace * PID regulace Subject RIV: JB - Sensors, Measurment, Regulation http://www.odbornecasopisy.cz/res/pdf/44344.pdf

  3. Toward an international standard for PCR-based detection of Escherichia coli O157 - Part 1. Assay development and multi-center validation

    DEFF Research Database (Denmark)

    Abdulmawjood, A.; Bulte, M.; Cook, N.

    2003-01-01

    As part of a major European research project, a diagnostic PCR assay, including an internal amplification control, was developed and validated in a collaborative trial for the detection of Escherichia coli O157. The assay is based on amplification of sequences of the rJbE O157 gene. The collabora...

  4. Natural gas and the generation of electricity in relation to environmental protection regulations in EC member countries

    International Nuclear Information System (INIS)

    Fosenbauer, T.

    1994-01-01

    A brief account is given of regulations governing the use of gas in power plants, of emission limits for some substances such as SO 2 , NO x and dust, and of regulations concerning existing and newly built facilities, specifying the highest permissible emissions of environmental pollutants. (J.B.)

  5. Detection of chlorine in water

    Czech Academy of Sciences Publication Activity Database

    Kašík, Ivan; Mrázek, Jan; Podrazký, Ondřej; Seidl, Miroslav; Aubrecht, Jan; Tobiška, Petr; Pospíšilová, Marie; Matějec, Vlastimil; Kovács, B.; Markovics, A.; Szili, M.

    2009-01-01

    Roč. 139, č. 1 (2009), s. 139-142 ISSN 0925-4005 R&D Projects: GA MŠk(CZ) LC06034; GA ČR(CZ) GA102/05/0948 Institutional research plan: CEZ:AV0Z20670512 Keywords : optical fiber sensor * chlorine Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.083, year: 2009

  6. Author Details

    African Journals Online (AJOL)

    Ahmed, J.B.. Vol 10, No 1 (2017): Special Conference Edition - Articles Analysis of the probability of channel satisfactory state in P2P live streaming systems. Abstract PDF. ISSN: 2006-6996. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's ...

  7. Volumetric Changes in the Components of Left Ventricle ...

    African Journals Online (AJOL)

    Samuel B. Olaleye

    ISSN 1119 – 5096 © Ibadan Biomedical Communications Group. Available online at .... This tissue face was embedded in JB4 resin and six 1.5 µm ... IBM personal computer. All data was .... mediated via the influence of exercise on collagen ...

  8. From Ivy League to NBA: A Great Urban High School Falls through the Hoop.

    Science.gov (United States)

    Carlson, Tucker

    1993-01-01

    Describes the history of education at Dunbar High School in Washington, D.C., the country's first African-American high school founded by ex-slaves in 1870. Argues that today the school emphasizes athletics over academics and that the source of decline has been holding students to lower standards. (JB)

  9. South African Journal of Animal Science - Vol 45, No 2 (2015)

    African Journals Online (AJOL)

    Genetic Prediction Models and Heritability Estimates for Functional Longevity in Dairy Cattle · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. VE Imbayarwo-Chikosi, K Dzama, TE Halimani, JB van Wyk, A Maiwashe, CB Banga, 105-121.

  10. Prevalence and antimicrobial sensitivity of Shiga-toxin-producing ...

    African Journals Online (AJOL)

    Nyambura

    provision of safe water, health education together with improvements in ... available using a sterile well mouthed dry, leak proofs-plastic container .... Esrey, S.A., Potash, J.B., Roberts, L. & Shiff, C. (1991) Effects of improved water supply and.

  11. 232Th, a rigid rotor

    International Nuclear Information System (INIS)

    Singh, M.; Pradeep Kumar; Singh, Y.; Varshney, A.K.; Gupta, D.K.

    2014-01-01

    We undertake the present work to treat 232 Th with a soft rotor formula used recently by C. Bihari et. al for γ-band and modified by J.B. Gupta et. al. It describes energy in terms of moment of inertia and softness parameter

  12. Impact of mitochondrial electric field on modal occupancy in the Frohlich model of cellular electromagnetism

    Czech Academy of Sciences Publication Activity Database

    Šrobár, Fedor

    2013-01-01

    Roč. 32, č. 3 (2013), s. 401-408 ISSN 1536-8378 R&D Projects: GA ČR(CZ) GAP102/11/0649 Institutional support: RVO:67985882 Keywords : bioelectromagnetism * cancer transformation * energy condensation Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 0.769, year: 2013

  13. The Enigmatic Nature of the Israeli Legal System

    African Journals Online (AJOL)

    RV

    independent and shall not be subject to the control or direction of any person or authority". 11 ...... JSC should have a central role in the removal of judges. The JSC ...... Thomas JB Judicial Ethics in Australia (Law Book Company Sydney 1988).

  14. Universal Zero Specular Reflection Curves for MetaMaterials

    Science.gov (United States)

    2012-09-01

    parents, Tony Ting and Li Chin, who always taught me the real values and meaning of life. Finally, I would like to thank my boss, Mr. Tan Ching Eng, and...Negative Refraction Makes a Perfect Lens,” Phys. Rev. Lett., vol. 85, pp. 3966, Imperial College, London, 2000. [10] J.B. Pendry, A.J. Holden, D.J. Robbins

  15. Long-period gratings inscribed in photonic crystal fiber by symmetric CO2 laser irradiation

    Czech Academy of Sciences Publication Activity Database

    Tian, F.; Kaňka, Jiří; Zou, B.; Chiang, K.S.; Du, H.

    2013-01-01

    Roč. 21, č. 11 (2013), s. 13208-13218 ISSN 1094-4087 R&D Projects: GA MŠk(CZ) LH11038 Institutional support: RVO:67985882 Keywords : REFRACTIVE-INDEX * FABRICATION * SENSORS Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.525, year: 2013

  16. Digital bedrock geologic map of the Mount Holly and Ludlow quadrangles, Vermont

    Data.gov (United States)

    Vermont Center for Geographic Information — Digital Data from VG94-229A Walsh, G.J., Ratcliffe, N.M., Dudley, J.B., and Merrifield, T., 1994,�Digital bedrock geologic map of the Mount Holly and Ludlow...

  17. SEROPREVALENCE OF HBsAg AMONG PATIENTS WITH FEBRILE ...

    African Journals Online (AJOL)

    USER

    2015-06-01

    Jun 1, 2015 ... Nigerian journal of parasitology. 29:38–41. Mazie, J.B., Barcus, T.T., Nicholas, J.W., Kantilaras,. J., Schwartz, I.K., Andrew, C. and Baird,. J.K. (2002). Hepatitis B infection and severe plasmodium falciparum malaria in. Vietnamese adults: American journal of tropical medicine and hygiene, 66(2), 140-. 142.

  18. Workshop 95. Part I

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-31

    The proceedings of the seminar contain more than 420 contributions divided into 21 areas of interest. In Part I, 144 contributions are presented from the following fields: mathematics, physics, chemistry, engineering informatics and cybernetics, computer art, and fluid mechanics. For input in INIS, 15 contributions were selected from the physics section and 1 from the chemistry section. (J.B.).

  19. Workshop 93. Part A

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-12-31

    The aim of the seminar was to present and discuss the latest results obtained in research at the Czech Technical University and collaborating institutions. Part A of the Proceedings contains 99 contributions from the following fields: physical electronics and optics, mathematics, informatics and cybernetics, and materials engineering. Two contributions were selected for INIS. (J.B.).

  20. Quantitative and simultaneous detection of four foodborne bacterial pathogens with a multi-channel SPR sensor

    Czech Academy of Sciences Publication Activity Database

    Taylor, A. D.; Ladd, J.; Yu, Q.; Chen, S.; Homola, Jiří; Jiang, S.

    2006-01-01

    Roč. 22, č. 5 (2006), s. 752-758 ISSN 0956-5663 Grant - others:US FDA(US) FD-U-002250 Institutional research plan: CEZ:AV0Z20670512 Keywords : surface plasmon resonance * biosensors * optical sensors Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 4.132, year: 2006

  1. Proceedings of the international symposium on safety and reliability systems of PWRs and BWRs

    International Nuclear Information System (INIS)

    1996-02-01

    Out of 33 contributions presented at the conference, 30 were submitted to INIS. The conference programme was divided into three sections: (i) Diagnostics and in-service inspection; (ii) Safety and reliability of NPP operation; (iii) Experience of NPP operation and new approaches to nuclear safety. (J.B.)

  2. Effect of insecticide treated nets fence in protect- ing cattle against ...

    African Journals Online (AJOL)

    . Negl. Trop. Dis., 5(10), e1343. Byford, R.L., Craig, M.E., and Crosby, B.L. 1982. A Review of on Ectoparasites and. Their Cattle Production' Effect. J. Anim. Sci., 70, 597– 602. Catangui, M.A., Campbell, J.B., Thomas, G.D., Boxler, D.J. 1993.

  3. Partnership for nuclear power in the Czech Republic

    International Nuclear Information System (INIS)

    1995-01-01

    A catalogue is presented of 27 organizations involved in the Czech nuclear programme. Characteristics and addresses are given of the Czech electrical utility, plant and component manufacturers, the uranium mining company, design and engineering companies, research establishments, and consulting companies. Some foreign companies with activities in the Czech Republic are also dealt with. (J.B.)

  4. Digitaria Effusa (Gramineae), a new species from Vietnam

    NARCIS (Netherlands)

    Veldkamp, J.F.

    1999-01-01

    During an agrostological survey in the Lam Dong Province, Vietnam, Mr. J.B. Hacker (St. Lucia, Queensland, Australia) collected a remarkable undescribed species of Digitaria. Among the Asian taxa it is peculiar because of its montane provenance coupled with a combination of an inflorescence with

  5. Calculation of Source and Strucutral Parameters at Regional and Teleseismic Distances

    Science.gov (United States)

    1987-02-28

    Plateau is supported by 500,000 km» of these Late Cretaceous to Paleocene age volcanics ( Auden ,1975). The basalts are believed to be the thickest...191. Auden , J.B. (1975). Seismicity associated with the Koyna Reservoir, Maharashtra, Prepared for the Government of India by the United Nations

  6. Mitochondrial Metabolism - Neglected Link of CancerTransformation and Treatment

    Czech Academy of Sciences Publication Activity Database

    Pokorný, Jiří; Jandová, Anna; Nedbalová, M.; Jelínek, František; Cifra, Michal; Kučera, Ondřej; Havelka, Daniel; Vrba, J.; Vrba, J.; Čoček, A.; Kobilková, J.

    2012-01-01

    Roč. 113, č. 2 (2012), s. 81-94 ISSN 1214-6994 R&D Projects: GA ČR(CZ) GAP102/11/0649 Institutional support: RVO:67985882 Keywords : Electromagnetic fields * Cellular biophysics * Cancer Subject RIV: JB - Sensors, Measurment, Regulation

  7. Surface plasmon resonance biosensor based on engineered proteins for direct detection of interferon-gamma in diluted blood plasma

    Czech Academy of Sciences Publication Activity Database

    Šípová, Hana; Ševců, Veronika; Kuchař, Milan; Ahmad, Jawid Nazir; Mikulecký, Pavel; Osičková, Adriana; Malý, Petr; Homola, Jiří

    2012-01-01

    Roč. 174, č. 11 (2012), s. 306-311 ISSN 0925-4005 R&D Projects: GA AV ČR KAN200670701 Institutional support: RVO:67985882 ; RVO:61388971 ; RVO:86652036 Keywords : Interferon gamma * Surface plasmon resonance * Biosensor Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.535, year: 2012

  8. Documentation of the ground for the planned MERO-IKL oil pipeline using the remote sensing technique

    International Nuclear Information System (INIS)

    Kult, L.; Vavra, J.; Sara, V.

    1994-02-01

    Complete photographic documentation of the planned route for the Ingolstadt-Kralupy-Litvinov pipeline was obtained by remote sensing; the vegetation cover sites and their avitalities were identified and described. The documentation identifies areas of avital plants, and defines potentially hazardous sources of soil or water pollution along the planned route. (J.B.). 1 tab., 17 figs

  9. The impact of acute preoperative beta-blockade on perioperative ...

    African Journals Online (AJOL)

    To determine the impact of acute preoperative β-blockade on the incidence of perioperative cardiovascular morbidity and all- ... Our findings suggest that acute preoperative β-blockade is associated with an increased risk of perioperative cardiac ..... Shammash JB, Trost JC, Gold JM, Berlin JA, Golden MA, Kimmel SE.

  10. Varovné systémy řidiče

    Czech Academy of Sciences Publication Activity Database

    Plíhal, Jiří; Šucha, M.

    2014-01-01

    Roč. 2014, č. 1 (2014), s. 29-32 ISSN 1801-8890 Grant - others:ŠKODA AUTO a.s.(CZ) 6002 Source of funding: N - neverejné zdroje Keywords : Advanced Driver Assistance Systems * Electronic Vehicle Systems * Vehicle Safety Subject RIV: JB - Sensors, Measurment, Regulation http://library.utia.cas.cz/separaty/2014/AS/plihal-0429121.pdf

  11. Research

    African Journals Online (AJOL)

    ebutamanya

    3 mai 2016 ... J Afr Cancer. 2009;1(2):98-. 103. PubMed | Google Scholar. 3. Potter JD, Slattery ML, Bostick RM et al. Colon Cancer: a. Review of the Epidemiology. Epidemiol Rev. 1993;15(2):499-. 545. PubMed | Google Scholar. 4. Tougeron D, Fauquembergue É, Latouche J-B. Immunotherapy for colorectal cancer.

  12. Kinetic study of light-driven processes in photochromic dye-doped polymers used as gate insulators in photoswitchable organic field effect transistors

    Czech Academy of Sciences Publication Activity Database

    Lutsyk, P.; Janus, K.; Sworakowski, J.; Kochalska, Anna; Nešpůrek, Stanislav

    2012-01-01

    Roč. 404, 24 August (2012), s. 22-27 ISSN 0301-0104 R&D Projects: GA MPO FR-TI1/144 Institutional research plan: CEZ:AV0Z40500505 Institutional support: RVO:61389013 Keywords : OFET * switching * photochromism Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 1.957, year: 2012

  13. QA Programme for Radon and its Short-Lived Progeny Measuring Instruments in NRPI Prague

    Czech Academy of Sciences Publication Activity Database

    Jílek, K.; Thomas, J.; Brabec, Marek

    2008-01-01

    Roč. 130, č. 1 (2008), s. 43-47 ISSN 0144-8420 Grant - others:GA SÚJB(CZ) JC_11/2006 Institutional research plan: CEZ:AV0Z10300504 Keywords : calibration * quality assurance * radon daughter products * uncertainty estimation Subject RIV: DI - Air Pollution ; Quality Impact factor: 0.951, year: 2008

  14. Degradation and resi

    African Journals Online (AJOL)

    2011-10-25

    Oct 25, 2011 ... Ingeniería, Universidad Nacional de Mar del Plata, J.B. Justo 4302,. 7600 Mar del Plata, ..... de Mar del Plata, the Consejo Nacional de Investigaciones. Científicas y Técnicas (CONICET) 2010-2011 PIP 00082, the Agencia ...

  15. Analysis of a Delayed Delta Modulator.

    Science.gov (United States)

    1983-05-01

    15% (35). L4J _.4 Research supported by the Air Force Office of Scientific Research Grant No. LL. w F49620-82-C-0009. *Now with D.H. Wagner, Associates...Convergence of Probability Measures. New York: Wiley, 1968. [3] CHAN, H.C. and ANDERSON, J.B., "Adaptivity versus tree-searching in DPCM", IEEE Trans. Comun

  16. Learning and judgment can be affected by predisposed fearfulness in laying hens

    NARCIS (Netherlands)

    Haas, de Elske N.; Lee, Caroline; Rodenburg, Bas

    2017-01-01

    High fearfulness could disrupt learning and likely affects judgment in animals, especially when it is part of an animals' personality, i.e., trait anxiety. Here, we tested whether high fearfulness affects discrimination learning and judgment bias (JB) in laying hens. Based on the response to an open

  17. The effectiveness of different instruction methods for risk and safety management in relation to medical profession and seniority

    NARCIS (Netherlands)

    Navot Pikkel, Dvora

    2017-01-01

    The study, which was guided by Prof.dr J.b. Rijsman as promotor and by Dr. Y.T. Tal as co- promotor, was a comparative interventional study that was designed to evaluate the effectiveness of different teaching & educational strategies of risk management and patient's safety in medicine. Eventually,

  18. Historie a současnost mapování povrchu pevných těles, jednoduché příklady využití kontaktního profiloměru při hodnocení optických povrchů

    Czech Academy of Sciences Publication Activity Database

    Havelková, Martina; Hiklová, Helena

    2013-01-01

    Roč. 58, č. 4 (2013), s. 114-116 ISSN 0447-6441 R&D Projects: GA TA ČR TA01010517 Institutional support: RVO:68378271 Keywords : contact profilometer * solid surfaces topography Subject RIV: JB - Sensors, Measurment, Regulation

  19. A Peptidomimetic Antibiotic Targets Outer Membrane Proteins and Disrupts Selectively the Outer Membrane in Escherichia coli.

    Science.gov (United States)

    Urfer, Matthias; Bogdanovic, Jasmina; Lo Monte, Fabio; Moehle, Kerstin; Zerbe, Katja; Omasits, Ulrich; Ahrens, Christian H; Pessi, Gabriella; Eberl, Leo; Robinson, John A

    2016-01-22

    Increasing antibacterial resistance presents a major challenge in antibiotic discovery. One attractive target in Gram-negative bacteria is the unique asymmetric outer membrane (OM), which acts as a permeability barrier that protects the cell from external stresses, such as the presence of antibiotics. We describe a novel β-hairpin macrocyclic peptide JB-95 with potent antimicrobial activity against Escherichia coli. This peptide exhibits no cellular lytic activity, but electron microscopy and fluorescence studies reveal an ability to selectively disrupt the OM but not the inner membrane of E. coli. The selective targeting of the OM probably occurs through interactions of JB-95 with selected β-barrel OM proteins, including BamA and LptD as shown by photolabeling experiments. Membrane proteomic studies reveal rapid depletion of many β-barrel OM proteins from JB-95-treated E. coli, consistent with induction of a membrane stress response and/or direct inhibition of the Bam folding machine. The results suggest that lethal disruption of the OM by JB-95 occurs through a novel mechanism of action at key interaction sites within clusters of β-barrel proteins in the OM. These findings open new avenues for developing antibiotics that specifically target β-barrel proteins and the integrity of the Gram-negative OM. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.

  20. Soviet supplies of enriched uranium to capitalist countries

    International Nuclear Information System (INIS)

    Valvoda, Z.

    1977-01-01

    The Soviet supplies of enriched uranium to the following capitalist countries are surveyed: Belgium, Finland, France, FRG, Austria, Spain, Sweden, and the United Kingdom. The time period, total supplies, average annual supplies, estimated average price per separation work unit, and the date of the conclusion of the contract are reported. (J.B.)

  1. Water SA - Vol 38, No 2 (2012)

    African Journals Online (AJOL)

    DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. D Kotsedi, JB Adams, GC Snow, 177-190 ... Monetary valuation of salinity impacts and microbial pollution in the Olifants Water Management Area, South Africa · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  2. The Reluctant Professor: Implications for University Management

    Science.gov (United States)

    Schein, Edgar H.

    1973-01-01

    Stating the belief that most analyses of the university fail to deal realistically with the role of the professor, the author's purpose is to show why it is difficult and possible undesirable to involve professors deeply in issues of university government. (Author/JB)

  3. Iron Metallurgy: Technical Terminology Bulletin. Terminotech, Vol. 2, No. 7.

    Science.gov (United States)

    General Electric Co. of Canada, Ltd., Montreal, Quebec.

    This issue of a bulletin of technological terminology is devoted to iron metallurgy. Various aspects of iron production are described in both French and English. An English-French dictionary of terms comprises the bulk of the document. Explanatory illustrations are appended. (JB)

  4. Teaching the Virtues.

    Science.gov (United States)

    Sommers, Christina Hoff

    1993-01-01

    Recommends an approach to the teaching of ethics from the perspective of the philosophy of virtue that begins with the work of the ancient Greek philosopher, Aristotle. Offers guidance on how to prepare and teach such a course based on the author's and other teachers' experiences in the classroom. (JB)

  5. Nuclear medicine. Czech special bulletin. No. 2

    International Nuclear Information System (INIS)

    1991-09-01

    The bulletin contains the article on the first experience with the CERTEC preparation in examination of brain perfusion and the article on the potential for the development and manufacture of radiopharmaceutical kits. Both articles are inputted into INIS. (J.B.)

  6. Comparative Experience Factors among Black, Asian, and Hispanic Americans: Coalitions or Conflicts?

    Science.gov (United States)

    Anderson, Talmadge

    1992-01-01

    Compares the culture, sociology, politics, and economics of African Americans, Hispanic Americans, and Asian Americans in the United States. Describes increased racial-ethnic national pluralism, the increased possibility of conflict between groups, and the need for dialogue and work toward coalition among these groups. (JB)

  7. South African Journal of Animal Science - Vol 23, No 3 (1993)

    African Journals Online (AJOL)

    Non-genetic factors influencing early growth traits in the Elsenburg Dormer sheep stud · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. J.B. van Wyk, G.J. Erasmus, K.V. Konstantinov, 67-71 ...

  8. MINERALIZATION OF THE HERBICIDE 2,3,6-TRICHLOROBENZOIC ACID BY A COCULTURE OF ANAEROBIC AND AEROBIC-BACTERIA

    NARCIS (Netherlands)

    GERRITSE, J; GOTTSCHAL, JC

    1992-01-01

    Bacteria from an anaerobic enrichment reductively removed chlorine from the ortho- position of 2,3,6-trichlorobenzoic acid (2,3,6-TBA) producing 2,5-dichlorobenzoate (2,5-DBA). The strictly aerobic bacterium Pseudomonas aeruginosa JB2 subsequently used 2,5-DBA as a growth substrate in the presence

  9. Mining Pribram in science and technology. Proceedings of Session R - Mechanization of mine operations

    International Nuclear Information System (INIS)

    Kolar, J.; Bernatik, O.

    1987-01-01

    The proceedings contain 30 papers of which two deal with uranium mine problems, viz.: ''Current and prospective orientation of mechanized driving of mines and underground infrastructures'' and ''The operation of rail-less mine mechanization in the Hamr area''. (J.B.)

  10. Hybrid surface platform for the simultaneous detection of proteins and DNA using a surface plasmon resonance (SPR) imaging sensor

    Czech Academy of Sciences Publication Activity Database

    Homola, Jiří; Piliarik, Marek; Ladd, J.; Taylor, A.; Shaoyi, J.

    2008-01-01

    Roč. 80, č. 11 (2008), s. 4231-4236 ISSN 0003-2700 R&D Projects: GA AV ČR KAN200670701 Institutional research plan: CEZ:AV0Z20670512 Keywords : Surface plasmon resonance imaging * DNA-directed immobilization * protein array Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 5.712, year: 2008

  11. Magnetic Barkhausen noise at different magnetization conditions

    Czech Academy of Sciences Publication Activity Database

    Stupakov, Alexandr; Perevertov, Oleksiy; Neslušan, M.

    2015-01-01

    Roč. 66, č. 7 (2015), s. 10-13 ISSN 1335-3632 R&D Projects: GA ČR GA13-18993S Institutional support: RVO:68378271 Keywords : Barkhausen noise * surface magnetic field * magnetization control * magnetic hysteresis * digital feedback loop Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 0.407, year: 2015

  12. Cancer of the cervix: The Uganda guidelines | Kiguli-Malwadde ...

    African Journals Online (AJOL)

    E Kiguli-Malwadde, AM Gakwaya, AJ Robinson, JB Kigula Mugambe, AK Luwaga. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors ...

  13. Studies in Forced Compliance: IX. The Effects of Deception, Commitment, and Incentive on Attitude Change Produced by the Writing of a Counterattitudinal Essay

    Science.gov (United States)

    Hornbeck, Frederick W.

    1971-01-01

    After a review of theoretical work on cognitive dissonance, the present study on Junior High School students is discussed. From the results, it is suggested that attitude change may result from a form of self-persuasion during the process of counterattitudinal role playing under certain experimental conditions. (Author/JB)

  14. UWB Propagation through Walls

    Czech Academy of Sciences Publication Activity Database

    Schejbal, V.; Bezoušek, P.; Čermák, D.; NĚMEC, Z.; Fišer, Ondřej; Hájek, M.

    2006-01-01

    Roč. 15, č. 1 (2006), s. 17-24 ISSN 1210-2512 R&D Projects: GA MPO(CZ) FT-TA2/030 Institutional research plan: CEZ:AV0Z30420517 Keywords : Ultra wide band * UWB antennas * UWB propagation * multipath effects Subject RIV: JB - Sensors, Measurment, Regulation

  15. Dependence of the human skin protection against the UV solar carcinoma radiation on the sunscreens and cosmetics layer thickness

    Czech Academy of Sciences Publication Activity Database

    Stádník, Bohumil; Jirásková, M.

    2000-01-01

    Roč. 45, č. 3 (2000), s. 241-249 ISSN 0001-7043 R&D Projects: GA ČR GA102/99/0548 Institutional research plan: CEZ:AV0Z2067918 Keywords : cancer * fluorescence * patient diagnosis Subject RIV: JB - Sensors, Measurment, Regulation

  16. Evidence for climate change relevant to building design in the UK, 1976-2000

    OpenAIRE

    Wright, A. J.

    2002-01-01

    This work led to the author writing a successful Partners in Innovation (PII) bid, with Prof G Levermore, to analyse building design weather statistics under future climates. This was published as CIBSE Technical Memorandum TM34, ‘Weather Data with Climate Change Scenarios (2004)’, Wright AJ & Parkinson JB, available to CIBSE members on the CIBSE website.

  17. The instrumental resolution of a moire extensometer in light of its recent automatisation

    Czech Academy of Sciences Publication Activity Database

    Rowberry, Matthew David; Kriegner, D.; Holý, V.; Frontera, C.; Llull, M.; Olejník, Kamil; Martí, Xavier

    2016-01-01

    Roč. 91, SEP (2016), s. 258-265 ISSN 0263-2241 R&D Projects: GA MŠk LM2010008 Institutional support: RVO:67985891 ; RVO:68378271 Keywords : geological discontinuity monitoring * mechanical extensometer * moire patterns * instrumental resolution Subject RIV: JB - Sensors, Measurment, Regulation; BM - Solid Matter Physics ; Magnetism (FZU-D) Impact factor: 2.359, year: 2016

  18. Author Details

    African Journals Online (AJOL)

    Chibani, JB. Vol 1, No 5 (2012) - Articles Origins and spreads of Alpha 1 antitrypsin variants in world human populations: a synthetic review. Abstract PDF · Vol 1, No 5 (2012) - Articles Synthetic review on the different anthropological aspects of hemoglobinopathies in Tunisia Abstract PDF. ISSN: 1737-8176. AJOL African ...

  19. Sensing properties of lattice resonances of 2D metal nanoparticle arrays: An analytical model

    Czech Academy of Sciences Publication Activity Database

    Špačková, Barbora; Homola, Jiří

    2013-01-01

    Roč. 21, č. 22 (2013), s. 27490-27502 ISSN 1094-4087 R&D Projects: GA ČR GBP205/12/G118; GA MŠk(CZ) LH11102 Institutional support: RVO:67985882 Keywords : Gold Nanoparticles * Sensing performance * Localized surface plasmon Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.525, year: 2013

  20. African Journal of Environmental Science and Technology - Vol 7 ...

    African Journals Online (AJOL)

    Ecosystem services and drivers of change in Nyando floodplain wetland, Kenya · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. PJK Rongoei, J Kipkemboi, JB Okeyo-Owuor, AA van Dam, 274-291 ...