WorldWideScience

Sample records for links faculties db

  1. Plant DB link - PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods | LSDB Archive [Life Science Database Archive metadata

    Full Text Available List Contact us PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods ...e Site Policy | Contact Us Plant DB link - PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods | LSDB Archive ...

  2. Registered plant list - PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods | LSDB Archive [Life Science Database Archive metadata

    Full Text Available List Contact us PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods ...the Plant DB link list in simple search page) Genome analysis methods Presence or... absence of Genome analysis methods information in this DB (link to the Genome analysis methods information ...base Site Policy | Contact Us Registered plant list - PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods | LSDB Archive ...

  3. License - PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods | LSDB Archive [Life Science Database Archive metadata

    Full Text Available List Contact us PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods ...t list, Marker list, QTL list, Plant DB link & Genome analysis methods © Satoshi ... Policy | Contact Us License - PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods | LSDB Archive ...

  4. Update History of This Database - PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods | LSDB Archive [Life Science Database Archive metadata

    Full Text Available List Contact us PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods ...B link & Genome analysis methods English archive site is opened. 2012/08/08 PGDBj... Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods is opened. About This...ate History of This Database - PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods | LSDB Archive ...

  5. Download - PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods | LSDB Archive [Life Science Database Archive metadata

    Full Text Available List Contact us PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods ...t_db_link_en.zip (36.3 KB) - 6 Genome analysis methods pgdbj_dna_marker_linkage_map_genome_analysis_methods_... of This Database Site Policy | Contact Us Download - PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods | LSDB Archive ...

  6. Database Description - PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods | LSDB Archive [Life Science Database Archive metadata

    Full Text Available List Contact us PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods ... QTL list, Plant DB link & Genome analysis methods Alternative name - DOI 10.18908/lsdba.nbdc01194-01-000 Cr...ers and QTLs are curated manually from the published literature. The marker information includes marker sequences, genotyping methods... Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods | LSDB Archive ...

  7. Marker list - PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods | LSDB Archive [Life Science Database Archive metadata

    Full Text Available List Contact us PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods ...Database Site Policy | Contact Us Marker list - PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods | LSDB Archive ...

  8. QTL list - PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods | LSDB Archive [Life Science Database Archive metadata

    Full Text Available List Contact us PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods ...Policy | Contact Us QTL list - PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods | LSDB Archive ...

  9. Rice DB: an Oryza Information Portal linking annotation, subcellular location, function, expression, regulation, and evolutionary information for rice and Arabidopsis.

    Narsai, Reena; Devenish, James; Castleden, Ian; Narsai, Kabir; Xu, Lin; Shou, Huixia; Whelan, James

    2013-12-01

    Omics research in Oryza sativa (rice) relies on the use of multiple databases to obtain different types of information to define gene function. We present Rice DB, an Oryza information portal that is a functional genomics database, linking gene loci to comprehensive annotations, expression data and the subcellular location of encoded proteins. Rice DB has been designed to integrate the direct comparison of rice with Arabidopsis (Arabidopsis thaliana), based on orthology or 'expressology', thus using and combining available information from two pre-eminent plant models. To establish Rice DB, gene identifiers (more than 40 types) and annotations from a variety of sources were compiled, functional information based on large-scale and individual studies was manually collated, hundreds of microarrays were analysed to generate expression annotations, and the occurrences of potential functional regulatory motifs in promoter regions were calculated. A range of computational subcellular localization predictions were also run for all putative proteins encoded in the rice genome, and experimentally confirmed protein localizations have been collated, curated and linked to functional studies in rice. A single search box allows anything from gene identifiers (for rice and/or Arabidopsis), motif sequences, subcellular location, to keyword searches to be entered, with the capability of Boolean searches (such as AND/OR). To demonstrate the utility of Rice DB, several examples are presented including a rice mitochondrial proteome, which draws on a variety of sources for subcellular location data within Rice DB. Comparisons of subcellular location, functional annotations, as well as transcript expression in parallel with Arabidopsis reveals examples of conservation between rice and Arabidopsis, using Rice DB (http://ricedb.plantenergy.uwa.edu.au). © 2013 The Authors The Plant Journal © 2013 John Wiley & Sons Ltd.

  10. The Use of Collaboration, Authentic Learning, Linking Material to Personal Knowledge, and Technology in the Constructivist Classroom: Interviews with Community College Faculty Members

    Zielinski, Dianne E.

    2017-01-01

    This study explored how faculty members implemented constructivist teaching methods after training. The student-centered teaching methods were interactions and collaborations, authentic learning and real-world experiences, linking material to previously learned information, and using technology in the classroom. Seven faculty members trained in…

  11. Genome analysis methods - PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods | LSDB Archive [Life Science Database Archive metadata

    Full Text Available List Contact us PGDBj Registered plant list, Marker list, QTL list, Plant DB link & Genome analysis methods Genome analysis... methods Data detail Data name Genome analysis methods DOI 10.18908/lsdba.nbdc01194-01-005 De...scription of data contents The current status and related information of the genomic analysis about each org...anism (March, 2014). In the case of organisms carried out genomic analysis, the d...e File name: pgdbj_dna_marker_linkage_map_genome_analysis_methods_en.zip File URL: ftp://ftp.biosciencedbc.j

  12. Looking for a Link : Comparing Faculty Citations Pre and Post Big Deals

    Taylor, Donald

    2007-01-01

    Big Deals expand an institution’s access to scholarly literature, with usage statistics showing that previously unavailable journals receive significant usage. To determine if faculty use these new e-journals in their research, the Simon Fraser University (SFU) Library analyzed SFU citation data to journals from selected Big Deals for two years prior to signing a major Big Deal (1993 and 1998) and for two consecutive years following the Big Deal (2004 and 2005). Pre Big Deal, the percentage o...

  13. The Physical Rehabilitation: a therapeutically field that links the Faculty of Physical Culture with the community

    Deisy Milhet Cruz

    2017-04-01

    Full Text Available The research project stands for a new glance to the integration school-community, this one is aimed at providing the theoretical-practical contents to the rehabilitation of individuals in the territory called Capitán San Luis based on a therapeutically field, it also contributes to the academic process in the faculty by facilitating the unit theory-practice. On behalf of the subjects comprising the discipline physical Culture and prophylactic taught by the members of the project. In this field are duly attended students, professors of the faculty, also members of the community nearby, by using equipment and means showed and validated in some scientific events. In brief this rehabilitation resource improves the quality of life of everyone who undergoes any of the treatments put into practice. Different methods were carried out just as observation, surveys and interviews. The expert criterion based on Delphi method, the pre experiment which means served for the diagnosis and the feasibility confirmation of the research.

  14. FunctSNP: an R package to link SNPs to functional knowledge and dbAutoMaker: a suite of Perl scripts to build SNP databases

    Watson-Haigh Nathan S

    2010-06-01

    Full Text Available Abstract Background Whole genome association studies using highly dense single nucleotide polymorphisms (SNPs are a set of methods to identify DNA markers associated with variation in a particular complex trait of interest. One of the main outcomes from these studies is a subset of statistically significant SNPs. Finding the potential biological functions of such SNPs can be an important step towards further use in human and agricultural populations (e.g., for identifying genes related to susceptibility to complex diseases or genes playing key roles in development or performance. The current challenge is that the information holding the clues to SNP functions is distributed across many different databases. Efficient bioinformatics tools are therefore needed to seamlessly integrate up-to-date functional information on SNPs. Many web services have arisen to meet the challenge but most work only within the framework of human medical research. Although we acknowledge the importance of human research, we identify there is a need for SNP annotation tools for other organisms. Description We introduce an R package called FunctSNP, which is the user interface to custom built species-specific databases. The local relational databases contain SNP data together with functional annotations extracted from online resources. FunctSNP provides a unified bioinformatics resource to link SNPs with functional knowledge (e.g., genes, pathways, ontologies. We also introduce dbAutoMaker, a suite of Perl scripts, which can be scheduled to run periodically to automatically create/update the customised SNP databases. We illustrate the use of FunctSNP with a livestock example, but the approach and software tools presented here can be applied also to human and other organisms. Conclusions Finding the potential functional significance of SNPs is important when further using the outcomes from whole genome association studies. FunctSNP is unique in that it is the only R

  15. Linking medical faculty stress/burnout to willingness to implement medical school curriculum change: a preliminary investigation.

    Arvandi, Zeinab; Emami, Amirhossein; Zarghi, Nazila; Alavinia, Seyed Mohammad; Shirazi, Mandana; Parikh, Sagar V

    2016-02-01

    Balancing administrative demands from the medical school while providing patient support and seeking academic advancement can cause personal hardship that ranges from high stress to clinically recognizable conditions such as burnout. Regarding the importance of clinical faculties' burnout and its effects on different aspects of their professional career, this study was conducted and aimed to evaluate the relationship between willingness to change teaching approaches as characterized by a modified stage-of-change model and measures of stress and burnout. This descriptive analytic study was conducted on 143 clinical faculty members of Tehran University of Medical Sciences in Iran. Participants were asked to complete three questionnaires: a modified stages of change questionnaire the Maslach Burnout Inventory and the General Health Questionnaire. Data were analysed by SPSS: 16 using non-parametric statistical tests such as multiple regression and ICC (intra-class coefficient) and Spearman correlation coefficient test. A significant relationship was found between faculty members' readiness to change teaching approaches and the subscales of occupational burnout. Specifically, participants with low occupational burnout were more likely to be in the action stage, while those with high burnout were in the attitude or intention stage, which could be understood as not being ready to implement change. There was no significant correlation between general health scores and stage of change. We found it feasible to measure stages of change as well as stress/burnout in academic doctors. Occupational burnout directly reduces the readiness to change. To have successful academic reform in medical schools, it therefore would be beneficial to assess and manage occupational burnout among clinical faculty members. © 2015 John Wiley & Sons, Ltd.

  16. Senior Law Faculty Attitudes toward Retirement.

    Day, David S.; And Others

    1991-01-01

    This article examines the retirement plans and personal characteristics of 273 senior law school faculty, focusing on health status, income, job satisfaction, and preferred age of retirement. The study suggests that early retirement incentives and a "senior faculty" alternative to full retirement are positive institutional options. (DB)

  17. Instant InnoDB

    Reid, Matt

    2013-01-01

    This book is a complete reference guide, designed to provide you with answers and solutions to all the common problems you encounter within InnoDB, helping you achieve higher performance and greater stability in your InnoDB databases.The ""InnoDB Quick Reference Guide"" features content for all skill levels of MySQL administrators, developers, and engineers.

  18. Mastering MariaDB

    Razzoli, Federico

    2014-01-01

    This book is intended for intermediate users who want to learn how to administrate a MariaDB server or a set of servers. It is aimed at MariaDB users, and hence working knowledge of MariaDB is a prerequisite.

  19. ToxRefDB - Release user-friendly web-based tool for mining ToxRefDB

    The updated URL link is for a table of NCCT ToxCast public datasets. The next to last row of the table has the link for the US EPA ToxCast ToxRefDB Data Release October 2014. ToxRefDB provides detailed chemical toxicity data in a publically accessible searchable format. ToxRefD...

  20. Elevated Steroid Hormone Production in the db/db Mouse Model of Obesity and Type 2 Diabetes.

    Hofmann, Anja; Peitzsch, Mirko; Brunssen, Coy; Mittag, Jennifer; Jannasch, Annett; Frenzel, Annika; Brown, Nicholas; Weldon, Steven M; Eisenhofer, Graeme; Bornstein, Stefan R; Morawietz, Henning

    2017-01-01

    Obesity and type 2 diabetes have become a major public health problem worldwide. Steroid hormone dysfunction appears to be linked to development of obesity and type 2 diabetes and correction of steroid abnormalities may offer new approaches to therapy. We therefore analyzed plasma steroids in 15-16 week old obese and diabetic db/db mice using liquid chromatography-tandem mass spectrometry. Lean db/+ served as controls. Db/db mice developed obesity, hyperglycemia, hyperleptinemia, and hyperlipidemia. Hepatic triglyceride storage was increased and adiponectin and pancreatic insulin were lowered. Aldosterone, corticosterone, 11-deoxycorticosterone, and progesterone were respectively increased by 3.6-, 2.9-, 3.4, and 1.7-fold in db/db mice compared to controls. Ratios of aldosterone-to-progesterone and corticosterone-to-progesterone were respectively 2.0- and 1.5-fold higher in db/db mice. Genes associated with steroidogenesis were quantified in the adrenal glands and gonadal adipose tissues. In adrenals, Cyp11b2 , Cyp11b1 , Cyp21a1 , Hsd3b1 , Cyp11a1 , and StAR were all significantly increased in db/db mice compared with db/+ controls. In adipose tissue, no Cyp11b2 or Cyp11b1 transcripts were detected and no differences in Cyp21a1 , Hsd3b1 , Cyp11a1 , or StAR expression were found between db/+ and db/db mice. In conclusion, the present study showed an elevated steroid hormone production and adrenal steroidogenesis in the db/db model of obesity and type 2 diabetes. © Georg Thieme Verlag KG Stuttgart · New York.

  1. DBA2J db/db mice are susceptible to early albuminuria and glomerulosclerosis that correlate with systemic insulin resistance.

    Østergaard, Mette V; Pinto, Vanda; Stevenson, Kirsty; Worm, Jesper; Fink, Lisbeth N; Coward, Richard J M

    2017-02-01

    Diabetic nephropathy (DN) is the leading cause of kidney failure in the world. To understand important mechanisms underlying this condition, and to develop new therapies, good animal models are required. In mouse models of type 1 diabetes, the DBA/2J strain has been shown to be more susceptible to develop kidney disease than other common strains. We hypothesized this would also be the case in type 2 diabetes. We studied db/db and wild-type (wt) DBA/2J mice and compared these with the db/db BLKS/J mouse, which is currently the most widely used type 2 DN model. Mice were analyzed from age 6 to 12 wk for systemic insulin resistance, albuminuria, and glomerular histopathological and ultrastructural changes. Body weight and nonfasted blood glucose were increased by 8 wk in both genders, while systemic insulin resistance commenced by 6 wk in female and 8 wk in male db/db DBA/2J mice. The urinary albumin-to-creatinine ratio (ACR) was closely linked to systemic insulin resistance in both sexes and was increased ~50-fold by 12 wk of age in the db/db DBA/2J cohort. Glomerulosclerosis, foot process effacement, and glomerular basement membrane thickening were observed at 12 wk of age in db/db DBA/2J mice. Compared with db/db BLKS/J mice, db/db DBA/2J mice had significantly increased levels of urinary ACR, but similar glomerular histopathological and ultrastructural changes. The db/db DBA/2J mouse is a robust model of early-stage albuminuric DN, and its levels of albuminuria correlate closely with systemic insulin resistance. This mouse model will be helpful in defining early mechanisms of DN and ultimately the development of novel therapies. Copyright © 2017 the American Physiological Society.

  2. Scaling CouchDB

    Holt, Bradley

    2011-01-01

    This practical guide offers a short course on scaling CouchDB to meet the capacity needs of your distributed application. Through a series of scenario-based examples, this book lets you explore several methods for creating a system that can accommodate growth and meet expected demand. In the process, you learn about several tools that can help you with replication, load balancing, clustering, and load testing and monitoring. Apply performance tips for tuning your databaseReplicate data, using Futon and CouchDB's RESTful interfaceDistribute CouchDB's workload through load balancingLearn option

  3. dbSNP

    U.S. Department of Health & Human Services — dbSNP is a database of single nucleotide polymorphisms (SNPs) and multiple small-scale variations that include insertions/deletions, microsatellites, and...

  4. dbVar

    U.S. Department of Health & Human Services — dbVar is a database of genomic structural variation. It accepts data from all species and includes clinical data. It can accept diverse types of events, including...

  5. Scaling MongoDB

    Chodorow, Kristina

    2011-01-01

    Create a MongoDB cluster that will to grow to meet the needs of your application. With this short and concise book, you'll get guidelines for setting up and using clusters to store a large volume of data, and learn how to access the data efficiently. In the process, you'll understand how to make your application work with a distributed database system. Scaling MongoDB will help you: Set up a MongoDB cluster through shardingWork with a cluster to query and update dataOperate, monitor, and backup your clusterPlan your application to deal with outages By following the advice in this book, you'l

  6. XMetDB

    Spjuth, Ola; Rydberg, Patrik; Willighagen, Egon L

    2016-01-01

    Xenobiotic metabolism is an active research topic but the limited amount of openly available high-quality biotransformation data constrains predictive modeling. Current database often default to commonly available information: which enzyme metabolizes a compound, but neither experimental conditions...... nor the atoms that undergo metabolization are captured. We present XMetDB, an open access database for drugs and other xenobiotics and their respective metabolites. The database contains chemical structures of xenobiotic biotransformations with substrate atoms annotated as reaction centra...... is also available. The database is open for data deposition, and a curation scheme is in place for quality control. An extensive guide on how to enter experimental data into is available from the XMetDB wiki. XMetDB formalizes how biotransformation data should be reported, and the openly available...

  7. MELCOR DB Construction for the Severe Accident Analysis DB

    Song, Y. M.; Ahn, K. I.

    2011-01-01

    The Korea Atomic Energy Research Institute (KAERI) has been constructing a severe accident analysis database (DB) under a National Nuclear R and D Program. In particular, an MAAP (commercial code being widely used in industries for integrated severe accident analysis) DB for many scenarios including a station blackout (SBO) has been completed. This paper shows the MELCOR DB construction process with examples of SBO scenarios, and the results will be used for a comparison with the MAAP DB

  8. ProteomicsDB.

    Schmidt, Tobias; Samaras, Patroklos; Frejno, Martin; Gessulat, Siegfried; Barnert, Maximilian; Kienegger, Harald; Krcmar, Helmut; Schlegl, Judith; Ehrlich, Hans-Christian; Aiche, Stephan; Kuster, Bernhard; Wilhelm, Mathias

    2018-01-04

    ProteomicsDB (https://www.ProteomicsDB.org) is a protein-centric in-memory database for the exploration of large collections of quantitative mass spectrometry-based proteomics data. ProteomicsDB was first released in 2014 to enable the interactive exploration of the first draft of the human proteome. To date, it contains quantitative data from 78 projects totalling over 19k LC-MS/MS experiments. A standardized analysis pipeline enables comparisons between multiple datasets to facilitate the exploration of protein expression across hundreds of tissues, body fluids and cell lines. We recently extended the data model to enable the storage and integrated visualization of other quantitative omics data. This includes transcriptomics data from e.g. NCBI GEO, protein-protein interaction information from STRING, functional annotations from KEGG, drug-sensitivity/selectivity data from several public sources and reference mass spectra from the ProteomeTools project. The extended functionality transforms ProteomicsDB into a multi-purpose resource connecting quantification and meta-data for each protein. The rich user interface helps researchers to navigate all data sources in either a protein-centric or multi-protein-centric manner. Several options are available to download data manually, while our application programming interface enables accessing quantitative data systematically. © The Author(s) 2017. Published by Oxford University Press on behalf of Nucleic Acids Research.

  9. MongoDB high availability

    Mehrabani, Afshin

    2014-01-01

    This book has a perfect balance of concepts and their practical implementation along with solutions to make a highly available MongoDB server with clear instructions and guidance. If you are using MongoDB in a production environment and need a solution to make a highly available MongoDB server, this book is ideal for you. Familiarity with MongoDB is expected so that you understand the content of this book.

  10. Resistin production from adipose tissue is decreased in db/db obese mice, and is reversed by rosiglitazone.

    Hongying Ye

    Full Text Available OBJECTIVE: This study was designed to (1 investigate the expression profiles of resistin in db/db mice and its dynamic association with metabolic parameters; and (2 evaluate the effects of Rosiglitazone on production of resistin. METHODS: Db/db mice and their lean litter mates were used for this study. Epididymal fat tissue was excised from mice of different age (from 5 to 12 weeks for ex vivo incubation. Resistin,along with adiponectin,in serum and conditioned culture medium of epididymal fat pads were measured with immunoassays. The gene expression of resistin was determined by real-time PCR. Rosiglitazone or the vehicle (PBS was administered into db/db mice by daily intra-gastric gavage. Differentiated 3T3-L1 adipocytes were used for in vitro evaluation. RESULTS: The secretion of resistin from the fat pads in db/db mice was significantly lower than that in lean mice (P<0.01. The mRNA expression of the resistin gene in fat tissue of db/db mice at the age of 5 weeks was decreased by 60.5% compared to lean controls (p<0.05. Serum levels of resistin were comparable between the obese and lean groups, perhaps due to the increased total fat mass in db/db mice. Correlation analysis showed that serum resistin levels were positively correlated to resistin secretion from fat pads(r = 0.844,P = 0.000, while negatively associated with the body weight (r = -0.515, P = 0.000 and fasting glucose level (r = -0.357, P = 0.002. Notably, treatment with rosiglitazone increased the serum resistin levels by 66.4%(P<0.05in db/db mice. In 3T3-L1 adipocytes, Rosiglitazone (10 uM markedly enhanced the secretion of resistin by 120% (P<0.01 and its gene expression by 78.1% (P<0.05. CONCLUSION: Both resistin gene expression and its secretion from the epididymal adipose tissue were decreased in db/db obese mice, while the insulin-sensitizing drug rosiglitazone increased resistin production. Our results do not support the role of resistin as an

  11. MariaDB cookbook

    Bartholomew, Daniel

    2014-01-01

    A practical cookbook, filled with advanced recipes , and plenty of code and commands used for illustration,which will make your learning curve easy and quick.This book is for anyone who wants to learn more about databases in general or MariaDB in particular. Some familiarity with SQL databases is assumed, but the recipes are approachable to almost anyone with basic database skills.

  12. Database Description - D-HaploDB | LSDB Archive [Life Science Database Archive metadata

    Full Text Available 1-8. External Links: Article title: D-HaploDB: a database of definitive haplotypes determined by genotypin...(5):e1000468. External Links: Article title: A definitive haplotype map as determined by genotyping

  13. Exploring Nurse Faculty Incivility and Resonant Leadership.

    Casale, Katherine R

    The purpose of this quantitative correlational study was to explore the relationship between the frequency of interfaculty incivility among nurses in academia and observed levels of resonant leadership of immediate supervisors. Despite mandates to address incivility in health care, nurse faculty report high levels of horizontal incivility among their peers. No known quantitative research has measured the relationship between nurse faculty-to-faculty incivility and resonant leadership traits of leaders. Nursing faculty from 17 universities (n = 260) were emailed an anonymous link to answer survey questions about horizontal peer incivility and leaders' management styles. There was a significant inverse relationship (Pearson's r, -.560) between the frequency of experienced faculty-to-faculty incivility and the level of observed resonant leadership behaviors of participants' immediate supervisors. Resonant supervisory behaviors inversely correlated with nurse faculty peer incivility, with potential to impact satisfaction, recruitment, and retention.

  14. Resistin production from adipose tissue is decreased in db/db obese mice, and is reversed by rosiglitazone.

    Ye, Hongying; Zhang, Herbert J; Xu, Aimin; Hoo, Ruby L C

    2013-01-01

    This study was designed to (1) investigate the expression profiles of resistin in db/db mice and its dynamic association with metabolic parameters; and (2) evaluate the effects of Rosiglitazone on production of resistin. Db/db mice and their lean litter mates were used for this study. Epididymal fat tissue was excised from mice of different age (from 5 to 12 weeks) for ex vivo incubation. Resistin,along with adiponectin,in serum and conditioned culture medium of epididymal fat pads were measured with immunoassays. The gene expression of resistin was determined by real-time PCR. Rosiglitazone or the vehicle (PBS) was administered into db/db mice by daily intra-gastric gavage. Differentiated 3T3-L1 adipocytes were used for in vitro evaluation. The secretion of resistin from the fat pads in db/db mice was significantly lower than that in lean mice (Plean controls (plean groups, perhaps due to the increased total fat mass in db/db mice. Correlation analysis showed that serum resistin levels were positively correlated to resistin secretion from fat pads(r = 0.844,P = 0.000), while negatively associated with the body weight (r = -0.515, P = 0.000) and fasting glucose level (r = -0.357, P = 0.002). Notably, treatment with rosiglitazone increased the serum resistin levels by 66.4%(Pproduction. Our results do not support the role of resistin as an etiological link between obesity and diabetes.

  15. RavenDB high performance

    Ritchie, Brian

    2013-01-01

    RavenDB High Performance is comprehensive yet concise tutorial that developers can use to.This book is for developers & software architects who are designing systems in order to achieve high performance right from the start. A basic understanding of RavenDB is recommended, but not required. While the book focuses on advanced topics, it does not assume that the reader has a great deal of prior knowledge of working with RavenDB.

  16. Faculty Organizational Commitment and Citizenship

    Lawrence, Janet; Ott, Molly; Bell, Alli

    2012-01-01

    Building on a theoretical framework that links characteristics of individuals and their work settings to organizational commitment (OC) and citizenship behavior, this study considers why faculty may be disengaging from institutional service. Analyses of survey data collected from a state system of higher education suggest that job characteristics,…

  17. Law Schools and Disabled Faculty: Toward a Meaningful Opportunity to Teach.

    Mikochik, Stephen L.

    1991-01-01

    This article briefly reviews prohibitions of the Americans with Disabilities Act concerning discrimination against people with disabilities in employment, suggests reasons why there are few law school faculty with disabilities, and notes the minimal accommodations most faculty with disabilities require. (DB)

  18. MongoDB and PHP

    Francia, Steve

    2012-01-01

    What would happen if you optimized a data store for the operations application developers actually use? You'd arrive at MongoDB, the reliable document-oriented database. With this concise guide, you'll learn how to build elegant database applications with MongoDB and PHP. Written by the Chief Solutions Architect at 10gen-the company that develops and supports this open source database-this book takes you through MongoDB basics such as queries, read-write operations, and administration, and then dives into MapReduce, sharding, and other advanced topics. Get out of the relational database rut,

  19. DB Energie 2020. Implementation of sustainability strategy DB2020; DB Energie 2020. Die Umsetzung der Nachhaltigkeitsstrategie DB2020

    Witschke, Hans-Juergen [DB Energie GmbH, Frankfurt am Main (Germany)

    2013-06-15

    As a worldwide provider of mobility and logistics services and one of the biggest employers in Germany, Deutsche Bahn (DB) bears a special responsibility for customers, its own staff, the environment and society as a whole. In order to meet this responsibility, it has made the consistent implementation of the DB Energie 2020 sustainability concept an essential element of its business strategy. Following this line of business provides DB with good opportunities on the one hand but also carries risks and challenges on the other. (orig.)

  20. What motivates occasional faculty developers to lead faculty development workshops? A qualitative study.

    O'Sullivan, Patricia S; Irby, David M

    2015-11-01

    The demand for faculty development is ongoing, and many medical schools will need to expand their pool of faculty developers to include physicians and scientists whose primary expertise is not education. Insight into what motivates occasional faculty developers can guide recruitment and retention strategies. This study was designed to understand the motivations of faculty developers who occasionally (one to three times each year) lead faculty development workshops. Qualitative data were collected in March and April 2012 from interviews with faculty developers who occasionally taught workshops from 2007 to 2012 in the University of California, San Francisco, School of Medicine's faculty development program. The interviews were audiotaped and transcribed. The authors thematically analyzed the transcripts using a general inductive approach and developed codes sensitized by motivation theories. The authors interviewed 29/30 (97%) occasional faculty developers and identified five themes: mastery (desire to learn and develop professionally), relatedness (enjoyment of working with and learning from others), duty (sense of obligation to give back and be a good academic citizen), purpose (commitment to improving local teaching and ultimately patient care), and satisfaction (fun and enjoyment). Four of the themes the authors found are well addressed in motivation theory literature: mastery, relatedness, duty, and purpose. Whereas these four are motivators for occasional faculty developers, it is the fifth theme-satisfaction-that the authors feel is foundational and links the others together. Armed with this understanding, individuals leading faculty development programs can develop strategies to recruit and retain occasional faculty developers.

  1. New tools for Mendelian disease gene identification: PhenoDB variant analysis module; and GeneMatcher, a web-based tool for linking investigators with an interest in the same gene.

    Sobreira, Nara; Schiettecatte, François; Boehm, Corinne; Valle, David; Hamosh, Ada

    2015-04-01

    Identifying the causative variant from among the thousands identified by whole-exome sequencing or whole-genome sequencing is a formidable challenge. To make this process as efficient and flexible as possible, we have developed a Variant Analysis Module coupled to our previously described Web-based phenotype intake tool, PhenoDB (http://researchphenodb.net and http://phenodb.org). When a small number of candidate-causative variants have been identified in a study of a particular patient or family, a second, more difficult challenge becomes proof of causality for any given variant. One approach to this problem is to find other cases with a similar phenotype and mutations in the same candidate gene. Alternatively, it may be possible to develop biological evidence for causality, an approach that is assisted by making connections to basic scientists studying the gene of interest, often in the setting of a model organism. Both of these strategies benefit from an open access, online site where individual clinicians and investigators could post genes of interest. To this end, we developed GeneMatcher (http://genematcher.org), a freely accessible Website that enables connections between clinicians and researchers across the world who share an interest in the same gene(s). © 2015 WILEY PERIODICALS, INC.

  2. Alkannin Inhibited Hepatic Inflammation in Diabetic Db/Db Mice

    Wenhua Xue

    2018-03-01

    Full Text Available Background/Aims: The current study was designed to investigate the protective role of alkannin (ALK on liver injury in diabetic C57BL/KsJ-db/db mice and explore its potential mechanisms. Methods: An oral glucose tolerance test (OGTT was performed. The levels of insulin, alanine aminotransferase (ALT, aspartate aminotransaminase (AST, total cholesterol (TC and triglyceride (TG were determined by commercial kits. The pro-inflammatory cytokines interleukin (IL-1β, IL-6 and tumour necrosis factor (TNF-α were determined by ELISA. The levels of the ROCK/NF-κB pathway were determined by Western blotting. Results: The contents of pro-inflammatory cytokines interleukin (IL-1β, IL-6 and tumour necrosis factor (TNF-α were inhibited by ALK, metformin or fasudil in diabetic db/db mice. Further, Western blotting analysis showed that the expression of Rho, ROCK1, ROCK2, p-NF-κBp65, and p-IκBα was significantly reversed by ALK treatment. In human hepatic HepG2 cells, the hepatoprotective effects of ALK were further characterized. With response to palmitic acid-challenge, increased amounts of insulin, ALT, AST, TG, and TC were observed, whereas ALK pretreatment significantly inhibited their leakage in HepG2 cells without appreciable cytotoxic effects. The inflammation condition was recovered with ALK treatment as shown by changes of IL-1β, IL-6 and TNF-α. Further, Western blotting analysis also suggested that ALK improves hepatic inflammation in a Rho-kinase pathway. Conclusion: The present study successfully investigated the role of Rho-kinase signalling in diabetic liver injury. ALK exhibited hepatoprotective effects in diabetic db/db mice, and it might act through improving hepatic inflammation through the Rho-kinase pathway.

  3. Nursing Faculty Members' Perspectives of Faculty-to-Faculty Workplace Incivility among Nursing Faculty Members

    Amos, Kimberly S.

    2013-01-01

    In recent years, nursing faculty incivility has been a searing topic of research. Nursing research included studies on incivility among nursing students, incivility between nursing students and nursing faculty, and incivility in the clinical setting. However, literature specifically on nursing faculty incivility was limited. This descriptive,…

  4. The Faculty at Risk.

    Schuster, Jack H.; Bowen, Howard R.

    1985-01-01

    Recent changes in the quality of faculty life were traced, and the consequences of these changes for the future of higher education are assessed. Shifts in the faculty's demographic characteristics, compensation, work environment, status, and morale, and in the quality of new faculty are discussed. (MLW)

  5. MVP and Faculty Evaluation

    Theall, Michael

    2017-01-01

    This chapter considers faculty evaluation and motivational and volitional issues. The focus is on the ways in which faculty evaluation influences not only faculty attitudes and beliefs but also willingness to engage in professional development and instructional improvement programs. Recommendations for effective practice that enhances motivation…

  6. Communication Faculty Internships.

    Gibson, Dirk C.

    2001-01-01

    Offers a first-hand account of a faculty internship at a major international public relations firm. Discusses the internship host and the intern's duties; faculty internship advantages and benefits; and faculty internship disadvantages and limitations. Considers 10 experiential realizations stemming from the author's internship experience. (SR)

  7. Dicty_cDB: SLJ310 [Dicty_cDB

    Full Text Available 5' similar to Arabidopsis thaliana sequence At1g48030 lipoamide dehydrogenase precursor see http://mips... At1g48030 lipoamide dehydrogenase precursor see http://mips.gsf.de/proj/thal/db/index.html, mRNA sequence.

  8. Basalt aquifer identification, correlation and sampling activities. History of Wells DB-8, DB-9, DB-10 and DB-11

    Webster, C.T.

    1979-07-01

    Research core wells have been completed to assist in the characterization of the groundwater regime of the upper confined aquifers found within the basalts of the Hanford Site. These wells were drilled on the Hanford Site for the Long-Term Transuranic Defense Waste Program. They were constructed to assure the Department of Energy that waste management operations will not provide an avenue for offsite migration of radionuclides. This second report details results of confined aquifer drilling activities. The purpose of this report is to document the drilling history of the wells by presenting as-built well construction diagrams and tables listing hole history data, coring records and bit records. Four wells were cored to a maximum depth of 1100 feet and water samples were taken from selected confined aquifers. Full depth was reached on all wells and core recovery was 94% of all formations drilled. Well DB-8 was abandoned after a well screen was destroyed while setting it in the well. Two wells, DB-9 and DB-10 were screened in the Mabton interbed and water was produced from this interval in both wells. Well DB-11 was used to explore for artesian water from the Priest Rapids flow unit on the western edge of the Hanford Site. The water was found at a depth of 1045 feet and now produces makeup water for all Hanford drilling

  9. Analysis of neuron–astrocyte metabolic cooperation in the brain of db/db mice with cognitive decline using 13C NMR spectroscopy

    Zheng, Hong; Zheng, Yongquan; Wang, Dan; Cai, Aimin; Lin, Qiuting; Zhao, Liangcai; Chen, Minjiang; Deng, Mingjie; Ye, Xinjian

    2016-01-01

    Type 2 diabetes has been linked to cognitive impairment, but its potential metabolic mechanism is still unclear. The present study aimed to explore neuron–astrocyte metabolic cooperation in the brain of diabetic (db/db, BKS.Cg-m+/+ Leprdb/J) mice with cognitive decline using 13C NMR technique in combination with intravenous [2-13C]-acetate and [3-13C]-lactate infusions. We found that the 13C-enrichment from [2-13C]-acetate into tricarboxylic acid cycle intermediate, succinate, was significantly decreased in db/db mice with cognitive decline compared with wild-type (WT, C57BLKS/J) mice, while an opposite result was obtained after [3-13C]-lactate infusion. Relative to WT mice, db/db mice with cognitive decline had significantly lower 13C labeling percentages in neurotransmitters including glutamine, glutamate, and γ-aminobutyric acid after [2-13C]-acetate infusion. However, [3-13C]-lactate resulted in increased 13C-enrichments in neurotransmitters in db/db mice with cognitive decline. This may indicate that the disturbance of neurotransmitter metabolism occurred during the development of cognitive decline. In addition, a reduction in 13C-labeling of lactate and an increase in gluconeogenesis were found from both labeled infusions in db/db mice with cognitive decline. Therefore, our results suggest that the development of cognitive decline in type 2 diabetes may be implicated to an unbalanced metabolism in neuron–astrocyte cooperation and an enhancement of gluconeogenesis. PMID:26762505

  10. Analysis of neuron-astrocyte metabolic cooperation in the brain of db/db mice with cognitive decline using 13C NMR spectroscopy.

    Zheng, Hong; Zheng, Yongquan; Wang, Dan; Cai, Aimin; Lin, Qiuting; Zhao, Liangcai; Chen, Minjiang; Deng, Mingjie; Ye, Xinjian; Gao, Hongchang

    2017-01-01

    Type 2 diabetes has been linked to cognitive impairment, but its potential metabolic mechanism is still unclear. The present study aimed to explore neuron-astrocyte metabolic cooperation in the brain of diabetic (db/db, BKS.Cg-m +/+ Leprdb/J) mice with cognitive decline using 13 C NMR technique in combination with intravenous [2- 13 C]-acetate and [3- 13 C]-lactate infusions. We found that the 13 C-enrichment from [2- 13 C]-acetate into tricarboxylic acid cycle intermediate, succinate, was significantly decreased in db/db mice with cognitive decline compared with wild-type (WT, C57BLKS/J) mice, while an opposite result was obtained after [3- 13 C]-lactate infusion. Relative to WT mice, db/db mice with cognitive decline had significantly lower 13 C labeling percentages in neurotransmitters including glutamine, glutamate, and γ-aminobutyric acid after [2- 13 C]-acetate infusion. However, [3- 13 C]-lactate resulted in increased 13 C-enrichments in neurotransmitters in db/db mice with cognitive decline. This may indicate that the disturbance of neurotransmitter metabolism occurred during the development of cognitive decline. In addition, a reduction in 13 C-labeling of lactate and an increase in gluconeogenesis were found from both labeled infusions in db/db mice with cognitive decline. Therefore, our results suggest that the development of cognitive decline in type 2 diabetes may be implicated to an unbalanced metabolism in neuron-astrocyte cooperation and an enhancement of gluconeogenesis. © The Author(s) 2016.

  11. Dicty_cDB: SHA665 [Dicty_cDB

    Full Text Available SH (Link to library) SHA665 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Or...iginal site) - - SHA665Z 676 - - - - Show SHA665 Library SH (Link to library) Clone ID SHA665 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dictycdb.b...TQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTE...ACWNLLEPMHR NYYQPIQFKLPSFPDTSLPITQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICT

  12. Dicty_cDB: SFH450 [Dicty_cDB

    Full Text Available SF (Link to library) SFH450 (Link to dictyBase) - - - Contig-U13857-1 SFH450F (Link... to Original site) SFH450F 623 - - - - - - Show SFH450 Library SF (Link to library) Clone ID SFH450 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13857-1 Original site URL http://dict...IMIIFLCLEATFDQPYHSIGGFIIVCSGYQLGQGIAGGAFSGIIPDVVHPSQSGI ASGWLGVGFSLGLLIGTILFGTLLEVKNVIHTWYLYGATIAFLGISALITICT...GTILFGTLLEVKNVIHTWYLYGATIAFLGISALITICTMHEDSND EWSFDGSLPSFFKSLHLPSSIYFNFYWVLITRFFNTLGIYMIFSFLLYFATDIIGQTNLM T

  13. Dicty_cDB: CHE687 [Dicty_cDB

    Full Text Available CH (Link to library) CHE687 (Link to dictyBase) - - - Contig-U16336-1 - (Link to Or...iginal site) CHE687F 622 - - - - - - Show CHE687 Library CH (Link to library) Clone ID CHE687 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dictycdb.b...KFINQCINEIKEELKGDMQKKTVAVQKLTYIQ MLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICT...LGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIF

  14. Dicty_cDB: SFC488 [Dicty_cDB

    Full Text Available SF (Link to library) SFC488 (Link to dictyBase) - - - Contig-U10843-1 SFC488F (Link... to Original site) SFC488F 556 - - - - - - Show SFC488 Library SF (Link to library) Clone ID SFC488 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10843-1 Original site URL http://dict...ETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFRKE VAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLLLDPMVKLPLITRMRMAKD...yhtht**KTMATQQQQQQQQQQQQQIKARKDIQIQQAQ SASDILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFRKE VAIMSKIFHPNIVLFLGACTSTPGKLMICT

  15. Dicty_cDB: CFH353 [Dicty_cDB

    Full Text Available CF (Link to library) CFH353 (Link to dictyBase) - - - Contig-U16205-1 CFH353Z (Link... to Original site) - - CFH353Z 625 - - - - Show CFH353 Library CF (Link to library) Clone ID CFH353 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16205-1 Original site URL http://dict...RDLYTVSQDVTKLAIQSAEQNGIVFLDEIDKICTSRESIKNGGDASTDGVQRDLLPI VEGCMVSTKYGQIDTSRILFIASGAFHNTKPSDLISELQGRLPIRVELKP...: ---RDLYTVSQDVTKLAIQSAEQNGIVFLDEIDKICTSRESIKNGGDASTDGVQRDLLPI VEGCMVSTKYGQIDTSRILFIASGAFHNTKPSDLISELQGRLPIR

  16. Dicty_cDB: SFF779 [Dicty_cDB

    Full Text Available SF (Link to library) SFF779 (Link to dictyBase) - - - Contig-U16255-1 SFF779Z (Link... to Original site) - - SFF779Z 731 - - - - Show SFF779 Library SF (Link to library) Clone ID SFF779 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...NATCSSLNCNAQQMSCKYVXQACHETSCCPDIPQCQIPATGGGPATGSATGQGTSGG TPGSCDKVNCPNGYICTIVNQLA...DIPQCQIPATGGGPATGSATGQGTSGG TPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSH

  17. Dicty_cDB: SSA423 [Dicty_cDB

    Full Text Available SS (Link to library) SSA423 (Link to dictyBase) - - - - SSA423F (Link to Original s...ite) SSA423F 443 - - - - - - Show SSA423 Library SS (Link to library) Clone ID SSA423 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...FIIGFFLCLTVFLTFVNSSEIDHQYSLTSSINGSSSGVSNSTDNTGCGEYTSCGDCREDK GCVWCGSEGICTEGTFYGTKPLNINGACKDFMWMQCKIQGRWAILIA...VSNSTDNTGCGEYTSCGDCREDK GCVWCGSEGICTEGTFYGTKPLNINGACKDFMWMQCKIQGRWAILIAAGGAFLIIVFFFI CLCCCCCRRKKDKHYHNIQDDET

  18. Dicty_cDB: SHL605 [Dicty_cDB

    Full Text Available SH (Link to library) SHL605 (Link to dictyBase) - - - Contig-U16336-1 - (Link to Or...iginal site) SHL605F 632 - - - - - - Show SHL605 Library SH (Link to library) Clone ID SHL605 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dictycdb.b...VDLIRGIRNHKKNETKFINQCINEIKEELKGDMQKKTVAVQK LTYIQMLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFL SSNQSEAYLALNCLSNICT...KRIGYLAASQSFNEGTDVIVLATHQIRKDFL SSNQSEAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIFLRYPESL RPAFPKLREKLDDPE

  19. Dicty_cDB: CHC347 [Dicty_cDB

    Full Text Available CH (Link to library) CHC347 (Link to dictyBase) - - - - CHC347P (Link to Original s...ite) CHC347F 184 CHC347Z 431 CHC347P 595 - - Show CHC347 Library CH (Link to library) Clone ID CHC347 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.ts...KRNKLIFNYKKK--- ---IGFGCLAXPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPREC NPRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT...KKK--- ---IGFGCLAXPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPREC NPRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT

  20. Dicty_cDB: CHD753 [Dicty_cDB

    Full Text Available CH (Link to library) CHD753 (Link to dictyBase) - - - Contig-U15579-1 - (Link to Or...iginal site) - - CHD753Z 650 - - - - Show CHD753 Library CH (Link to library) Clone ID CHD753 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dictycdb.b...---IQACGPDNNYQCEFVDKICNTTNDKCLVESCEIGFGCLAIPKNCNDNDPCTTDHCDP AIGCYYDKFDNCDACNAVDTCITNDLCFPRECNPRGNPPCLINPINCTSTDPCIFSYCEN GVCIPTYICT...NPRGNPPCLINPINCTSTDPCIFSYCEN GVCIPTYICTPTPSVTPTVTPTVTPTVTPTVTPTVTPTVTPTPTTTPTPSPTTVPPRPTP TPLPADPPPYDLEEGCLV

  1. Dicty_cDB: CHK172 [Dicty_cDB

    Full Text Available CH (Link to library) CHK172 (Link to dictyBase) - - - Contig-U11104-1 - (Link to Or...iginal site) CHK172F 626 - - - - - - Show CHK172 Library CH (Link to library) Clone ID CHK172 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11104-1 Original site URL http://dictycdb.b...HEECKTQGNNYFKQSQYMDAIRCYTQAIELSNGTIA AYYGNRAAAYLAICTKSSLQDSIKDSLKAIELERSFIKGYTRASKAYIHLAQYDQAASII VRGLVFDPRN...KMDHEECKTQGNNYFKQSQYMDAIRCYTQAIELSNGTIA AYYGNRAAAYLAICTKSSLQDSIKDSLKAIELERSFIKGYT

  2. Dicty_cDB: VSD385 [Dicty_cDB

    Full Text Available VS (Link to library) VSD385 (Link to dictyBase) - - - - VSD385E (Link to Original s...ite) VSD385F 523 VSD385Z 639 VSD385P 1162 VSD385E 639 Show VSD385 Library VS (Link to library) Clone ID VSD385 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycd...KTKMNKFIIGFFLCLTVFLTFVNSSEIDHQYSLTSSINGSSSGVSNSTDNTGCGEYTS CGDCREDKGCVWCGSEGICTEGTFYGTKPLNINGACKDFMWMQCKIQGR...ame B: KYKTKMNKFIIGFFLCLTVFLTFVNSSEIDHQYSLTSSINGSSSGVSNSTDNTGCGEYTS CGDCREDKGCVWCGSEGICTEGTFYGTKPLNINGACKDFM

  3. Dicty_cDB: SSA581 [Dicty_cDB

    Full Text Available SS (Link to library) SSA581 (Link to dictyBase) - - - Contig-U12576-1 SSA581Z (Link... to Original site) - - SSA581Z 504 - - - - Show SSA581 Library SS (Link to library) Clone ID SSA581 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12576-1 Original site URL http://dict...SARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT DEDI...QHASARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT D

  4. Dicty_cDB: SFI222 [Dicty_cDB

    Full Text Available SF (Link to library) SFI222 (Link to dictyBase) - - - Contig-U13893-1 - (Link to Or...iginal site) - - SFI222Z 716 - - - - Show SFI222 Library SF (Link to library) Clone ID SFI222 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13893-1 Original site URL http://dictycdb.b...LLSIVQLLMGEIPERNTFS QKQLKIALKPYFHLTEAVRVGDLGSFNQALEQNSDIFKSDQTFTLVQRLRSNVIKAGLKK LNTAYSRISFNDICT...SIVQLLMGEIPERNTFS QKQLKIALKPYFHLTEAVRVGDLGSFNQALEQNSDIFKSDQTFTLVQRLRSNVIKAGLKK LNTAYSRISFNDICT

  5. Dicty_cDB: SLE232 [Dicty_cDB

    Full Text Available SL (Link to library) SLE232 (Link to dictyBase) - - - Contig-U16255-1 SLE232F (Link... to Original site) SLE232F 614 - - - - - - Show SLE232 Library SL (Link to library) Clone ID SLE232 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...PSSGFTDFIPSNATCSSLNCNAQQMSCKYVQQACHETSCCPDIPQC QIPATGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSST ...CHETSCCPDIPQC QIPATGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSST TGSHTTTGGSTTGSHTTTGGSTTGSHTTTGGSA

  6. Dicty_cDB: CHA557 [Dicty_cDB

    Full Text Available CH (Link to library) CHA557 (Link to dictyBase) - - - Contig-U15635-1 - (Link to Or...iginal site) CHA557F 620 - - - - - - Show CHA557 Library CH (Link to library) Clone ID CHA557 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15635-1 Original site URL http://dictycdb.b...HSIEIGKVEILPNSLIGIDEDGVIQHMKSN YEDLKQLEKDVTMICTDNGINEQESVIDMGNKFLIPGFIDTHAHAPQYHNAGTGTDLPLL KWLEKYTFPVESKFKD...EIGKVEILPNSLIGIDEDGVIQHMKSN YEDLKQLEKDVTMICTDNGINEQESVIDMGNKFLIPGFIDTHAHAPQYHNAGT

  7. Dicty_cDB: SLA117 [Dicty_cDB

    Full Text Available SL (Link to library) SLA117 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Or...iginal site) - - SLA117Z 649 - - - - Show SLA117 Library SL (Link to library) Clone ID SLA117 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dictycdb.b...--EPMHRNYYQPIQFKLPSFPDTSLPITQIDDKTGIFDSQRFLAFNNPQAMSKYESYRI YIHPSLGYSGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTE...SYRI YIHPSLGYSGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTEYYQTKSYFSANP HAKGKVLLVKNNILTRVKDGGFTLSLKPMCCSGHNSHIPLYF

  8. Dicty_cDB: VFJ144 [Dicty_cDB

    Full Text Available VF (Link to library) VFJ144 (Link to dictyBase) - - - Contig-U12576-1 - (Link to Or...iginal site) - - VFJ144Z 698 - - - - Show VFJ144 Library VF (Link to library) Clone ID VFJ144 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12576-1 Original site URL http://dictycdb.b...IGIDDELGPQLFKVDPAGVFTGYKATAAGEKEQESTNFLEKK FKSNPQLSKDETIQMAISTLQSVLGADLKPSDLEIGICTMDNRKFVIMTDED Translated A...PQLFKVDPAGVFTGYKATAAGEKEQESTNFLEKK FKSNPQLSKDETIQMAISTLQSVLGADLKPSDLEIGICTMDNRKFVIMTDED Frame B: ---givrkyl*

  9. Diet supplementation with green tea extract epigallocatechin gallate prevents progression to glucose intolerance in db/db mice

    Ortsäter Henrik

    2012-02-01

    Full Text Available Abstract Background Green tea was suggested as a therapeutic agent for the treatment of diabetes more than 70 years ago, but the mechanisms behind its antidiabetic effect remains elusive. In this work, we address this issue by feeding a green tea extract (TEAVIGO™ with a high content of epigallocatechin gallate (EGCG or the thiazolidinedione PPAR-γ agonist rosiglitazone, as positive control, to db/db mice, an animal model for diabetes. Methods Young (7 week-old db/db mice were randomized and assigned to receive diets supplemented with or without EGCG or rosiglitazone for 10 weeks. Fasting blood glucose, body weight and food intake was measured along the treatment. Glucose and insulin levels were determined during an oral glucose tolerance test after 10 weeks of treatment. Pancreata were sampled at the end of the study for blinded histomorphometric analysis. Islets were isolated and their mRNA expression analyzed by quantitative RT-PCR. Results The results show that, in db/db mice, EGCG improves glucose tolerance and increases glucose-stimulated insulin secretion. EGCG supplementation reduces the number of pathologically changed islets of Langerhans, increases the number and the size of islets, and heightens pancreatic endocrine area. These effects occurred in parallel with a reduction in islet endoplasmic reticulum stress markers, possibly linked to the antioxidative capacity of EGCG. Conclusions This study shows that the green tea extract EGCG markedly preserves islet structure and enhances glucose tolerance in genetically diabetic mice. Dietary supplementation with EGCG could potentially contribute to nutritional strategies for the prevention and treatment of type 2 diabetes.

  10. Accounting Faculty Internships

    Jill Christopher

    2013-06-01

    Full Text Available Accounting professionals, business college accrediting bodies, and even accounting academics themselves acknowledge that there is a disconnect between academe and the rigors and requirements of the accounting profession. Among the suggestions proposed in the literature to reduce this gap is the faculty internship, where accounting faculty members work within the field as accountants. Heretofore, individual case studies report benefits of such internships that accrue to a variety of stakeholder groups beyond just the faculty intern and include the academic institution, students, and accounting profession through faculty internships. This research seeks wider support for these benefits. This descriptive study involved surveying a sample of accounting faculty members to get their opinions about the benefits and drawbacks of faculty internships, and to determine the level of use of faculty internships in accounting. In all, 128 usable responses were obtained, representing a 14.6% response rate. The results of this study reveal that although most faculty members acknowledge the benefits cited in the literature, too few take advantage of faculty internships.

  11. The IRPVM-DB database

    Davies, L.M.; Gillemot, F.; Yanko, L.; Lyssakov, V.

    1997-01-01

    The IRPVM-DB (International Reactor Pressure Vessel Material Database) initiated by the IAEA IWG LMNPP is going to collect the available surveillance and research data world-wide on RPV material ageing. This paper presents the purpose of the database; it summarizes the type and the relationship of data included; it gives information about the data access and protection; and finally, it summarizes the state of art of the database. (author). 1 ref., 2 figs

  12. The IRPVM-DB database

    Davies, L M [Davies Consultants, Oxford (United Kingdom); Gillemot, F [Atomic Energy Research Inst., Budapest (Hungary); Yanko, L [Minatom (Russian Federation); Lyssakov, V [International Atomic Energy Agency, Vienna (Austria)

    1997-09-01

    The IRPVM-DB (International Reactor Pressure Vessel Material Database) initiated by the IAEA IWG LMNPP is going to collect the available surveillance and research data world-wide on RPV material ageing. This paper presents the purpose of the database; it summarizes the type and the relationship of data included; it gives information about the data access and protection; and finally, it summarizes the state of art of the database. (author). 1 ref., 2 figs.

  13. Dicty_cDB: VHK220 [Dicty_cDB

    Full Text Available VH (Link to library) VHK220 (Link to dictyBase) - - - - - (Link to Original site) VHK2...20F 530 - - - - - - Show VHK220 Library VH (Link to library) Clone ID VHK220 (Link to dictyBase) Atlas ID... - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2-A/VHK2...20Q.Seq.d/ Representative seq. ID - (Link to Original site) Representative DNA sequence >VHK2...20 (VHK220Q) /CSM/VH/VHK2-A/VHK220Q.Seq.d/ AACTCTCGAGTGCAAAAAAAGTAAAGTACAAAATGGTTAATTTCA

  14. Dicty_cDB: VHK285 [Dicty_cDB

    Full Text Available VH (Link to library) VHK285 (Link to dictyBase) - - - - - (Link to Original site) VHK2...85F 531 - - - - - - Show VHK285 Library VH (Link to library) Clone ID VHK285 (Link to dictyBase) Atlas ID... - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2-D/VHK2...85Q.Seq.d/ Representative seq. ID - (Link to Original site) Representative DNA sequence >VHK2...85 (VHK285Q) /CSM/VH/VHK2-D/VHK285Q.Seq.d/ AACTCTCGAGTGCAAAAAAAGTAAAGTACAAAATGGTTAATTTCA

  15. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB568 (Link to dictyBase) - G23244 DDB0217993 Contig-U02062-1...ary VF (Link to library) Clone ID VFB568 (Link to dictyBase) Atlas ID - NBRP ID G23244 dictyBase ID DDB02179...93 Link to Contig Contig-U02062-1 | Contig-U11831-1 Original site URL http://dict...TELLY NNFYNTAEPITDEIIGFDLRKYLNFELFTYDYILGRELNQYNNSGCSGCSGCSSSSSSSS SSGGDDGRKNNKKYITQFDTILKELIKQLSFNICTNFSDRD...STELLY NNFYNTAEPITDEIIGFDLRKYLNFELFTYDYILGRELNQYNNSGCSGCSGCSSSSSSSS SSGGDDGRKNNKKYITQFDTILKELIKQLSFNICTNFSDR

  16. Dicty_cDB: SLB394 [Dicty_cDB

    Full Text Available SL (Link to library) SLB394 (Link to dictyBase) - G24120 DDB0184167BP Contig-U13982... (Link to library) Clone ID SLB394 (Link to dictyBase) Atlas ID - NBRP ID G24120 dictyBase ID DDB0184167BP L...ink to Contig Contig-U13982-1 Original site URL http://dictycdb.biol.tsukuba.ac.j...2 Translated Amino Acid sequence TDTNPKEPSNVESIITTSEVTPSPPPSTTTSTTTNATTTITTSQPQANIIGGKRSRKDDE IISIQEALNDQLEEEKNLLEEAKEQEQEDWGDESICT...e B: TDTNPKEPSNVESIITTSEVTPSPPPSTTTSTTTNATTTITTSQPQANIIGGKRSRKDDE IISIQEALNDQLEEEKNLLEEAKEQEQEDWGDESICT

  17. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB595 (Link to dictyBase) - - - Contig-U09552-1 VFB595E (Link...) Clone ID VFB595 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09552-1 Ori...KLLKSDNWISTCQNLIQEYEPQ IIAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICTFISGYAENFLEENKTL EDIIKVVDDFCKILPAAYKTDCVA...A: VEGSGECLVCEFISEKIVTYLEANQTETQILQYLDNDCKLLKSDNWISTCQNLIQEYEPQ IIAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICT... Sequences producing significant alignments: (bits) Value N U66367 |U66367.1 Dictyostelium discoideum SapA (

  18. Dicty_cDB: CFG115 [Dicty_cDB

    Full Text Available CF (Link to library) CFG115 (Link to dictyBase) - - - Contig-U03237-1 CFG115E (Link...) Clone ID CFG115 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U03237-1 Ori...k*NNMNGFLKSQLENKTNATTTTTTRYCNNDESCNDENLCTN EMCDPVIGCIYENISCDDDNGCTKDFCDPLTGCFHKRVVCDDNDKCTDNICNPETGTCSF RRRICT...TTTRYCNNDESCNDENLCTN EMCDPVIGCIYENISCDDDNGCTKDFCDPLTGCFHKRVVCDDNDKCTDNICNPETGTCSF RRRICTDNNDCTMDWCNQLTGECVYQ...ng significant alignments: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map 256

  19. Dicty_cDB: SHE365 [Dicty_cDB

    Full Text Available SH (Link to library) SHE365 (Link to dictyBase) - G23163 DDB0185626 Contig-U11298-1...ary SH (Link to library) Clone ID SHE365 (Link to dictyBase) Atlas ID - NBRP ID G23163 dictyBase ID DDB01856...26 Link to Contig Contig-U11298-1 | Contig-U13252-1 Original site URL http://dict...VEIAFSDKTPSIAVEAIRLVSIMSTL DLLDESDVQKICTLYLVDQPEISKAAGGLIFSKYLLSTQTKIDTTLSNIINSTSAASTTS GQHARKKSKTTNLTSADLDE...PSIAVEAIRLVSIMSTL DLLDESDVQKICTLYLVDQPEISKAAGGLIFSKYLLSTQTKIDTTLSNIINSTSAASTTS GQHARKKSKTTNLTSADLDEQQQQQISSQ

  20. Dicty_cDB: VFH641 [Dicty_cDB

    Full Text Available VF (Link to library) VFH641 (Link to dictyBase) - - - Contig-U16151-1 VFH641E (Link... Clone ID VFH641 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16151-1 Original site URL http://dict...KLLGVQTQAKQTRATWKIVVGDGAGAVTFKLATNGGTTEGDFTTTLTSKVLS GSDPKEVGTYYMDVTVPTGTTCTGTNGICT...KLLGVQTQAKQTRATWKIVVGDGAGAVTFKLATNGGTTEGDFTTTLTSKVLS GSDPKEVGTYYMDVTVPTGTTCTGTNGICT...nificant alignments: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum

  1. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB882 (Link to dictyBase) - - - Contig-U13884-1 VFB882E (Link...) Clone ID VFB882 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13884-1 Ori... m_ : 1.00 48.0 %: cytoplasmic 44.0 %: nuclear 4.0 %: mitochondrial 4.0 %: peroxisomal >> predict

  2. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC278 (Link to dictyBase) - - - Contig-U13504-1 VFC278E (Link... Clone ID VFC278 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13504-1 Original site URL http://dict...0.0 %: mitochondrial 4.0 %: plasma membrane >> prediction for VFC278 is cyt 5' end seq. ID VFC278F 5' end se

  3. Faculty Handbook. Regis College.

    Regis Coll., Weston, MA.

    Regis College policies and procedures are described in this 1976 faculty handbook. Chapter 1 covers college organization and governance, including roles of academic officers and committees. Specific faculty data are presented in Chapter 2, such as definition of academic ranks and titles, recruitment and appointment, promotion, tenure, review,…

  4. Supporting Faculty Grassroots Leadership

    Kezar, Adrianna; Lester, Jaime

    2009-01-01

    Various factors are making faculty leadership challenging including the rise in part-time and non-tenure-track faculty, the increasing pressure to publish and teach more courses and adopt new technologies and pedagogies, increasing standards for tenure and promotion, ascension of academic capitalism, and heavy service roles for women and people of…

  5. Faculty Retirement Transitions Revitalized

    Van Ummersen, Claire; Duranleau, Lauren; McLaughlin, Jean

    2013-01-01

    It has been almost ten years since the American Council on Education (ACE) began to raise awareness of the importance of workplace flexibility in faculty careers and to encourage colleges and universities to support faculty in better integrating their professional and personal lives. With the generous support of the Alfred P. Sloan Foundation, ACE…

  6. CBE Faculty and Staff

    About Us Research Staff Edward Arens Fred Bauman Gail Brager Darryl Dickerhoff Ali Ghahramani Partners Facilities Graduate Programs Visiting Scholar Program Careers CBE Faculty and Staff CBE is an performance of buildings. The core research group for CBE includes faculty and research staff members

  7. Dicty_cDB: VFB113 [Dicty_cDB

    Full Text Available VF (Link to library) VFB113 (Link to dictyBase) - - - Contig-U16478-1 VFB113P (Link... to Original site) VFB113F 584 VFB113Z 643 VFB113P 1227 - - Show VFB113 Library VF (Link to library) Clone ID VFB113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16478-1 Original site URL http://dict...rlstttrlptttrlptttrlstttr lptttrlptttrlptttrlptttrlsttrlstttrlstswctswctswictrygswissr llcwynhs*l*t*c*sfkksn...sequence. 42 5e-29 8 U03413 |U03413.1 Dictyostelium discoideum AX2 calcium binding protein mRNA, complete cd

  8. Dicty_cDB: CFE213 [Dicty_cDB

    Full Text Available CF (Link to library) CFE213 (Link to dictyBase) - - - Contig-U16381-1 CFE213F (Link... to Original site) CFE213F 111 - - - - - - Show CFE213 Library CF (Link to library) Clone ID CFE213 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict... E Sequences producing significant alignments: (bits) Value N AC115685 |AC115685.1 Dict...yostelium discoideum chromosome 2 map 4718821-4752388 strain AX4, complete sequence. 80 9e-24 3 X51892 |X51892.1 Dict

  9. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC171 (Link to dictyBase) - - - Contig-U16478-1 VFC171P (Link... to Original site) VFC171F 482 VFC171Z 633 VFC171P 1115 - - Show VFC171 Library VF (Link to library) Clone ID VFC171 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16478-1 Original site URL http://dict...ptttrlptt trlstttrlptttrlptttrlptttrlptttrlsttrlxtttrlstswctswctswictr ygswissrllcwynhs*l*t*c*sfkksnerywyk*i...ologous to C-terminal repeat sequence of rhodopsin and synaptophysin. 88 1e-15 3 X54062 |X54062.1 Dictyostel

  10. Dicty_cDB: VSE812 [Dicty_cDB

    Full Text Available VS (Link to library) VSE812 (Link to dictyBase) - - - Contig-U14773-1 VSE812E (Link... to Original site) - - - - - - VSE812E 721 Show VSE812 Library VS (Link to library) Clone ID VSE812 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14773-1 Original site URL http://dict...re E Sequences producing significant alignments: (bits) Value N L08391 |L08391.1 Dict...9 AF401554_1( AF401554 |pid:none) Ictalurus punctatus ribosomal prot... 132 1e-29 protein update 2009. 7.31

  11. Dicty_cDB: CHN208 [Dicty_cDB

    Full Text Available CH (Link to library) CHN208 (Link to dictyBase) - - - Contig-U11696-1 - (Link to Or...iginal site) CHN208F 157 - - - - - - Show CHN208 Library CH (Link to library) Clone ID CHN208 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11696-1 Original site URL http://dictycdb.b...ces producing significant alignments: (bits) Value N AC149612 |AC149612.1 Ictalurus punctatus clone CH212-98...nuclear 20.0 %: mitochondrial 8.0 %: vacuolar 4.0 %: peroxisomal >> prediction fo

  12. Dicty_cDB: SSD329 [Dicty_cDB

    Full Text Available SS (Link to library) SSD329 (Link to dictyBase) - - - Contig-U16581-1 SSD329F (Link... to Original site) SSD329F 444 - - - - - - Show SSD329 Library SS (Link to library) Clone ID SSD329 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...A Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoide... DNA sequence. 50 0.027 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictal

  13. Dicty_cDB: CFE853 [Dicty_cDB

    Full Text Available CF (Link to library) CFE853 (Link to dictyBase) - - - Contig-U16381-1 CFE853F (Link... to Original site) CFE853F 109 - - - - - - Show CFE853 Library CF (Link to library) Clone ID CFE853 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict...uences producing significant alignments: (bits) Value N X51892 |X51892.1 Dictyost...elium discoideum SP60 gene for spore coat protein. 80 6e-21 2 X52105 |X52105.1 Dictyostelium discoideum SP60

  14. Dicty_cDB: CFH668 [Dicty_cDB

    Full Text Available CF (Link to library) CFH668 (Link to dictyBase) - - - Contig-U13860-1 - (Link to Or...iginal site) - - CFH668Z 651 - - - - Show CFH668 Library CF (Link to library) Clone ID CFH668 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13860-1 Original site URL http://dictycdb.b...s) Value N AC116987 |AC116987.2 Dictyostelium discoideum chromosome 2 map 3527441-3568052 strain AX4, comple...te sequence. 58 1e-11 6 AC116305 |AC116305.2 Dictyostelium discoideum chromosome

  15. Dicty_cDB: AFL826 [Dicty_cDB

    Full Text Available AF (Link to library) AFL826 (Link to dictyBase) - - - - AFL826P (Link to Original s...ite) AFL826F 588 AFL826Z 766 AFL826P 1334 - - Show AFL826 Library AF (Link to library) Clone ID AFL826 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.t... Score E Sequences producing significant alignments: (bits) Value N ( BJ346543 ) Dictyostelium discoideum cD...NA clone:dda24d08, 3' ... 1100 0.0 1 ( BJ341682 ) Dictyostelium discoideum cDNA c

  16. Dicty_cDB: SFD117 [Dicty_cDB

    Full Text Available SF (Link to library) SFD117 (Link to dictyBase) - - - Contig-U16381-1 SFD117F (Link... to Original site) SFD117F 107 - - - - - - Show SFD117 Library SF (Link to library) Clone ID SFD117 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict...s producing significant alignments: (bits) Value N AC115685 |AC115685.1 Dictyoste...lium discoideum chromosome 2 map 4718821-4752388 strain AX4, complete sequence. 80 2e-21 3 X51892 |X51892.1 Dict

  17. Dicty_cDB: AFL289 [Dicty_cDB

    Full Text Available AF (Link to library) AFL289 (Link to dictyBase) - - - - AFL289F (Link to Original s...ite) AFL289F 123 - - - - - - Show AFL289 Library AF (Link to library) Clone ID AFL289 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/... E Sequences producing significant alignments: (bits) Value N X51892 |X51892.1 Dict...yostelium discoideum SP60 gene for spore coat protein. 82 5e-29 2 X52105 |X52105.1 Dictyostelium discoideu

  18. Dicty_cDB: SSG427 [Dicty_cDB

    Full Text Available SS (Link to library) SSG427 (Link to dictyBase) - - - - SSG427Z (Link to Original s...ite) - - SSG427Z 372 - - - - Show SSG427 Library SS (Link to library) Clone ID SSG427 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...E Sequences producing significant alignments: (bits) Value N M77492 |M77492.1 Dictyostelium discoideum glyco....1 Sequence 481 from Patent WO0168912. 48 0.090 1 BE470067 |BE470067.1 IpHdk03092 Head kidney cDNA library Ict

  19. Dicty_cDB: AFK740 [Dicty_cDB

    Full Text Available AF (Link to library) AFK740 (Link to dictyBase) - - - Contig-U16381-1 AFK740F (Link... to Original site) AFK740F 107 - - - - - - Show AFK740 Library AF (Link to library) Clone ID AFK740 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict...es producing significant alignments: (bits) Value N X51892 |X51892.1 Dictyosteliu...m discoideum SP60 gene for spore coat protein. 80 6e-21 2 X52105 |X52105.1 Dictyostelium discoideum SP60 gen

  20. Dicty_cDB: VSG614 [Dicty_cDB

    Full Text Available VS (Link to library) VSG614 (Link to dictyBase) - - - - VSG614F (Link to Original s...ite) VSG614F 56 - - - - - - Show VSG614 Library VS (Link to library) Clone ID VSG614 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/V...M029513.1 IpSkn01547 Skin cDNA library Ictalurus punctatus cDNA 5', mRNA sequence

  1. Dicty_cDB: SLF689 [Dicty_cDB

    Full Text Available SL (Link to library) SLF689 (Link to dictyBase) - - - Contig-U16284-1 SLF689Z (Link... to Original site) - - SLF689Z 320 - - - - Show SLF689 Library SL (Link to library) Clone ID SLF689 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16284-1 Original site URL http://dict...DNA Score E Sequences producing significant alignments: (bits) Value N ( AC116305 ) Dictyostelium discoideum... chromosome 2 map 1005175... 478 e-131 1 ( AU053477 ) Dictyostelium discoideum slug cDNA, clone SLI726. 478 e-131 1 ( AU053102 ) Dict

  2. Dicty_cDB: CFH744 [Dicty_cDB

    Full Text Available CF (Link to library) CFH744 (Link to dictyBase) - - - Contig-U16381-1 - (Link to Or...iginal site) CFH744F 118 - - - - - - Show CFH744 Library CF (Link to library) Clone ID CFH744 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dictycdb.b...ng significant alignments: (bits) Value N X51892 |X51892.1 Dictyostelium discoide...um SP60 gene for spore coat protein. 80 1e-23 3 AC115685 |AC115685.1 Dictyostelium discoideum chromosome 2 m

  3. Dicty_cDB: SSI473 [Dicty_cDB

    Full Text Available SS (Link to library) SSI473 (Link to dictyBase) - - - - SSI473Z (Link to Original s...ite) - - SSI473Z 416 - - - - Show SSI473 Library SS (Link to library) Clone ID SSI473 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...uences producing significant alignments: (bits) Value N M77492 |M77492.1 Dictyost...Hdk03092 Head kidney cDNA library Ictalurus punctatus cDNA 5' similar to Dual specificity phosphatase 10 (DU

  4. Dicty_cDB: CHD152 [Dicty_cDB

    Full Text Available CH (Link to library) CHD152 (Link to dictyBase) - - - - - (Link to Original site) C...HD152F 603 - - - - - - Show CHD152 Library CH (Link to library) Clone ID CHD152 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHD...Score E Sequences producing significant alignments: (bits) Value N U36937 |U36937.1 Dictyostelium discoideum...UF_IpTrk_27_j08 Trunk kidney cDNA library Ictalurus punctatus cDNA 5' similar to

  5. Dicty_cDB: SLH678 [Dicty_cDB

    Full Text Available SL (Link to library) SLH678 (Link to dictyBase) - - - Contig-U04159-1 SLH678E (Link... to Original site) - - - - - - SLH678E 373 Show SLH678 Library SL (Link to library) Clone ID SLH678 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04159-1 Original site URL http://dict... producing significant alignments: (bits) Value N ( AU039970 ) Dictyostelium discoideum slug cDNA, clone SLG...865. 323 e-129 2 ( AU039381 ) Dictyostelium discoideum slug cDNA, clone SLH678. 3

  6. Dicty_cDB: SSF689 [Dicty_cDB

    Full Text Available SS (Link to library) SSF689 (Link to dictyBase) - - - Contig-U16581-1 SSF689F (Link... to Original site) SSF689F 443 - - - - - - Show SSF689 Library SS (Link to library) Clone ID SSF689 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...core E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum ...A sequence. 50 0.027 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictaluru

  7. Dicty_cDB: CFH713 [Dicty_cDB

    Full Text Available CF (Link to library) CFH713 (Link to dictyBase) - - - Contig-U16381-1 - (Link to Or...iginal site) CFH713F 133 - - - - - - Show CFH713 Library CF (Link to library) Clone ID CFH713 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dictycdb.b...ogy vs DNA Score E Sequences producing significant alignments: (bits) Value N X51892 |X51892.1 Dict...yostelium discoideum SP60 gene for spore coat protein. 80 2e-23 3 AC115685 |AC115685.1 Dict

  8. Dicty_cDB: SSC836 [Dicty_cDB

    Full Text Available SS (Link to library) SSC836 (Link to dictyBase) - - - - SSC836E (Link to Original s...ite) - - - - - - SSC836E 502 Show SSC836 Library SS (Link to library) Clone ID SSC836 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...t alignments: (bits) Value N M77492 |M77492.1 Dictyostelium discoideum glycoprotein phosphorylase 2 (glpD) g...ene, complete cds. 779 0.0 1 AC116984 |AC116984.2 Dictyostelium discoideum chromo

  9. Dicty_cDB: CFH518 [Dicty_cDB

    Full Text Available CF (Link to library) CFH518 (Link to dictyBase) - - - Contig-U16381-1 - (Link to Or...iginal site) CFH518F 131 - - - - - - Show CFH518 Library CF (Link to library) Clone ID CFH518 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dictycdb.b...vs DNA Score E Sequences producing significant alignments: (bits) Value N X51892 |X51892.1 Dict...yostelium discoideum SP60 gene for spore coat protein. 80 2e-22 3 AC115685 |AC115685.1 Dictyos

  10. Dicty_cDB: VHI285 [Dicty_cDB

    Full Text Available VH (Link to library) VHI285 (Link to dictyBase) - - - Contig-U16073-1 - (Link to Or...iginal site) VHI285F 136 - - - - - - Show VHI285 Library VH (Link to library) Clone ID VHI285 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16073-1 Original site URL http://dictycdb.b... DNA Score E Sequences producing significant alignments: (bits) Value N ( BJ423035 ) Dict...yostelium discoideum cDNA clone:ddv47i22, 5' ... 72 2e-27 3 ( BJ419916 ) Dictyostelium discoideum cD

  11. Dicty_cDB: CHQ307 [Dicty_cDB

    Full Text Available CH (Link to library) CHQ307 (Link to dictyBase) - - - Contig-U16403-1 CHQ307P (Link... to Original site) CHQ307F 441 CHQ307Z 669 CHQ307P 1090 - - Show CHQ307 Library CH (Link to library) Clone ID CHQ307 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16403-1 Original site URL http://dict...EDPATQLSSLKFESDKEKEQALLWAFLASYLPEDKGS LQKEFVKHVEYTLAQTKSECTDF--- ---fvmplvmkictslvlvlkrstk*rklfmmenshqtldglv...0.0 own update 2004.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N M77492 |M77492.1 Dict

  12. Dicty_cDB: CFI225 [Dicty_cDB

    Full Text Available CF (Link to library) CFI225 (Link to dictyBase) - - - Contig-U16381-1 - (Link to Or...iginal site) CFI225F 133 - - - - - - Show CFI225 Library CF (Link to library) Clone ID CFI225 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dictycdb.b...ogy vs DNA Score E Sequences producing significant alignments: (bits) Value N X51892 |X51892.1 Dict...yostelium discoideum SP60 gene for spore coat protein. 80 2e-23 3 AC115685 |AC115685.1 Dict

  13. Dicty_cDB: AFK156 [Dicty_cDB

    Full Text Available AF (Link to library) AFK156 (Link to dictyBase) - - - - AFK156P (Link to Original s...ite) AFK156F 599 AFK156Z 448 AFK156P 1047 - - Show AFK156 Library AF (Link to library) Clone ID AFK156 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.t...4. 4 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N U36937 |U36937.1 Dict... tolerance against environmental stress. 92 7e-24 3 AY342298 |AY342298.1 Ictaluru

  14. Dicty_cDB: CFH557 [Dicty_cDB

    Full Text Available CF (Link to library) CFH557 (Link to dictyBase) - - - - - (Link to Original site) C...FH557F 132 - - - - - - Show CFH557 Library CF (Link to library) Clone ID CFH557 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFH...roducing significant alignments: (bits) Value N AC115685 |AC115685.1 Dictyosteliu...m discoideum chromosome 2 map 4718821-4752388 strain AX4, complete sequence. 80 3e-28 3 X51892 |X51892.1 Dict

  15. Dicty_cDB: CFI560 [Dicty_cDB

    Full Text Available CF (Link to library) CFI560 (Link to dictyBase) - - - - CFI560P (Link to Original s...ite) CFI560F 593 CFI560Z 259 CFI560P 832 - - Show CFI560 Library CF (Link to library) Clone ID CFI560 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.ts...ences producing significant alignments: (bits) Value N U36937 |U36937.1 Dictyoste...RNA sequence. 42 6e-04 2 AY342298 |AY342298.1 Ictalurus punctatus ER-resident chaperone calreticulin mRNA, c

  16. Dicty_cDB: VFH144 [Dicty_cDB

    Full Text Available VF (Link to library) VFH144 (Link to dictyBase) - - - - VFH144P (Link to Original s...ite) VFH144F 641 VFH144Z 312 VFH144P 953 - - Show VFH144 Library VF (Link to library) Clone ID VFH144 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.ts...nces producing significant alignments: (bits) Value N U36937 |U36937.1 Dictyostel...RNA sequence. 42 8e-04 2 AY342298 |AY342298.1 Ictalurus punctatus ER-resident chaperone calreticulin mRNA, c

  17. Dicty_cDB: SSA564 [Dicty_cDB

    Full Text Available SS (Link to library) SSA564 (Link to dictyBase) - - - - SSA564F (Link to Original s...ite) SSA564F 653 - - - - - - Show SSA564 Library SS (Link to library) Clone ID SSA564 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...NNTLKPKQTTKGFNIGGQPGNPTN*l--- Frame C: tlkfvmplvmkictslvlvlkrstk*rklfmmenshqtldgl...bits) Value N M77492 |M77492.1 Dictyostelium discoideum glycoprotein phosphorylase 2 (glpD) gene, complete c

  18. Dicty_cDB: VHA386 [Dicty_cDB

    Full Text Available VH (Link to library) VHA386 (Link to dictyBase) - - - Contig-U11201-1 - (Link to Or...iginal site) - - VHA386Z 730 - - - - Show VHA386 Library VH (Link to library) Clone ID VHA386 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11201-1 Original site URL http://dictycdb.b...Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N L08646 |L08646.1 Dict...19 1 CX835130 |AF255664_1 major vault protein [Ictalurus punctatus], mRNA sequenc

  19. Dicty_cDB: SLD420 [Dicty_cDB

    Full Text Available SL (Link to library) SLD420 (Link to dictyBase) - - - Contig-U16325-1 SLD420E (Link... to Original site) - - - - - - SLD420E 434 Show SLD420 Library SL (Link to library) Clone ID SLD420 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16325-1 Original site URL http://dict... 7 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( AF066071 ) Dict...yostelium discoideum SP85 (pspB) gene, comple... 860 0.0 1 ( AC117075 ) Dictyostelium

  20. Dicty_cDB: AFE742 [Dicty_cDB

    Full Text Available AF (Link to library) AFE742 (Link to dictyBase) - - - - AFE742F (Link to Original s...ite) AFE742F 585 - - - - - - Show AFE742 Library AF (Link to library) Clone ID AFE742 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...Sequences producing significant alignments: (bits) Value N U36937 |U36937.1 Dictyostelium discoideum calreti...NA clone hj81f04, mRNA sequence. 36 3e-04 3 AY342298 |AY342298.1 Ictalurus puncta

  1. Dicty_cDB: SHI251 [Dicty_cDB

    Full Text Available SH (Link to library) SHI251 (Link to dictyBase) - - - Contig-U11819-1 - (Link to Or...iginal site) SHI251F 125 - - - - - - Show SHI251 Library SH (Link to library) Clone ID SHI251 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11819-1 Original site URL http://dictycdb.b...XX sequence update 2002.10.25 Translated Amino Acid sequence ilfqilkistnk**IKNYYVNRVYEIIIIINICT...YKKK--- Translated Amino Acid sequence (All Frames) Frame A: ilfqilkistnk**IKNYYVNRVYEIIIIINICT

  2. Dicty_cDB: CHA851 [Dicty_cDB

    Full Text Available CH (Link to library) CHA851 (Link to dictyBase) - - - Contig-U16368-1 - (Link to Or...iginal site) CHA851F 614 - - - - - - Show CHA851 Library CH (Link to library) Clone ID CHA851 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Original site URL http://dictycdb.b...TCCXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence VRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNCGPGYICT...nly*skttgttttllnlcraiism*srwn dlysstkqlyqy*ipmlpis--- Frame C: VRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNCGPGYICT

  3. Dicty_cDB: SFF103 [Dicty_cDB

    Full Text Available SF (Link to library) SFF103 (Link to dictyBase) - - - Contig-U11967-1 SFF103Z (Link... to Original site) - - SFF103Z 655 - - - - Show SFF103 Library SF (Link to library) Clone ID SFF103 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11967-1 Original site URL http://dict...nslated Amino Acid sequence ---rgsf*FLKIIITLLAYKIICTPNHMHLTRGNHETTDMNRFYGFQGEVVAKYSEMVFD LFSELFNWFPLAFVLDESF...*rkrlsnr**wfshhcflc skll*siw*swliykynxdkikittxklxtsexppmhsqk Frame C: ---rgsf*FLKIIITLLAYKIICT

  4. Dicty_cDB: SHI867 [Dicty_cDB

    Full Text Available SH (Link to library) SHI867 (Link to dictyBase) - - - Contig-U11503-1 - (Link to Or...iginal site) SHI867F 646 - - - - - - Show SHI867 Library SH (Link to library) Clone ID SHI867 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dictycdb.b...fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGA...l*lsif--- Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICT

  5. Dicty_cDB: VHA622 [Dicty_cDB

    Full Text Available VH (Link to library) VHA622 (Link to dictyBase) - - - Contig-U15767-1 VHA622P (Link... to Original site) VHA622F 458 VHA622Z 778 VHA622P 1216 - - Show VHA622 Library VH (Link to library) Clone ID VHA622 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...HVQVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLP QGNCSNTPVDCGANDEDKCKTWSCDPTKGGCQSTPVVCEDKGKCLVGTCQPSTGQCEYSD...qisnqkmrenlf*lrelsnqilikkkefqf*ivwmpmil*ik rqelvgqmvlsiflxitklviqnlpnlvk--- ---ACNEDEKXITHVQVTCGGCETCSYATGKCEPDSSLCNDNNICT

  6. Dicty_cDB: SLJ344 [Dicty_cDB

    Full Text Available SL (Link to library) SLJ344 (Link to dictyBase) - - - Contig-U16255-1 SLJ344P (Link... to Original site) SLJ344F 253 SLJ344Z 273 SLJ344P 526 - - Show SLJ344 Library SL (Link to library) Clone ID SLJ344 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...Amino Acid sequence GTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTT TGGSTTGSHTTTGGSTTGSHTTTG---...li tilffniqrlykkkkkkkkkknkp*tklkin*kk Frame B: GTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTT

  7. Dicty_cDB: AFJ353 [Dicty_cDB

    Full Text Available AF (Link to library) AFJ353 (Link to dictyBase) - - - Contig-U10972-1 AFJ353P (Link... to Original site) AFJ353F 592 AFJ353Z 580 AFJ353P 1172 - - Show AFJ353 Library AF (Link to library) Clone ID AFJ353 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10972-1 Original site URL http://dict...SISTGLPNLSGGKINTNVYSSLGNIGSGMNGSSTKDDSVSPTKKSTDHQP RKPMTKSVSMSSIGLN--- ---NYLIQSFLKQFSPEVNQFVCDAIMGNIEEICT...TNVYSSLGNIGSGMNGSSTKDDSVSPTKKSTDHQP RKPMTKSVSMSSIGLN--- ---NYLIQSFLKQFSPEVNQFVCDAIMGNIEEICTHKVGCTVVNRCIDNANP

  8. Dicty_cDB: SFA408 [Dicty_cDB

    Full Text Available SF (Link to library) SFA408 (Link to dictyBase) - - - Contig-U10972-1 SFA408P (Link... to Original site) SFA408F 509 SFA408Z 686 SFA408P 1195 - - Show SFA408 Library SF (Link to library) Clone ID SFA408 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10972-1 Original site URL http://dict...YLSXDQVESIIASIKGKVIQLSKDNKGNYLIQSFLKQFSPEVNQFV CDAIMGNIEEICTHKVGCTVVNRCIDNANPEQLEKLVDKITEHSLKLVQDQFGNYVVQHL ...KDNKGNYLIQSFLKQFSPEVNQFV CDAIMGNIEEICTHKVGCTVVNRCIDNANPEQLEKLVDKITEHSLKLVQDQFGNYV

  9. Dicty_cDB: SLG821 [Dicty_cDB

    Full Text Available SL (Link to library) SLG821 (Link to dictyBase) - - - Contig-U15540-1 SLG821P (Link... to Original site) SLG821F 638 SLG821Z 554 SLG821P 1192 - - Show SLG821 Library SL (Link to library) Clone ID SLG821 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dict...MSPSSPICLPESPMGAQHWESGL--- ---IDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGYSGNAKRFKQQPDVNEKALI LDGNVYDGHLNPIYNCKICT...*--- ---IDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGYSGNAKRFKQQPDVNEKALI LDGNVYDGHLNPIYNCKICT

  10. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB866 (Link to dictyBase) - - - Contig-U16349-1 VFB866Z (Link... to Original site) - - VFB866Z 631 - - - - Show VFB866 Library VF (Link to library) Clone ID VFB866 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dict...ce ---SSVDSISNLPTTMQLFAGIKSICTEMAMDGCEKCSGNSPTTTCDVLPVYSSLCMAMP DMSQCANWTKMCSSSGQLYNSQITSDYCVASVADAVPIMRMYFH...RGCLHAIELTCSYALMLVAMTFNVALFFAV Translated Amino Acid sequence (All Frames) Frame A: ---SSVDSISNLPTTMQLFAGIKSICT

  11. Dicty_cDB: CHF177 [Dicty_cDB

    Full Text Available CH (Link to library) CHF177 (Link to dictyBase) - - - Contig-U11892-1 - (Link to Or...iginal site) - - CHF177Z 395 - - - - Show CHF177 Library CH (Link to library) Clone ID CHF177 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11892-1 Original site URL http://dictycdb.b...LLLWDVQGFPCXFAVEG GQCIDPSSLKVGGKYSFIAFSTCRXKFDNQKIHDCDWIIQGPTTPSXCANCGKICTSKCT TNYCDRDXQT Translated Amino A...XKFDNQKIHDCDWIIQGPTTPSXCANCGKICTSKCT TNYCDRDXQT Homology vs CSM-cDNA Score E Sequences producing significant

  12. Dicty_cDB: VHL364 [Dicty_cDB

    Full Text Available VH (Link to library) VHL364 (Link to dictyBase) - - - Contig-U16205-1 - (Link to Or...iginal site) - - VHL364Z 668 - - - - Show VHL364 Library VH (Link to library) Clone ID VHL364 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16205-1 Original site URL http://dictycdb.b...mino Acid sequence ---KKVTIAEAKEIFEKQYRDLYTVSQDVTKLAIQSAEQNGIVFLDEIDKICTSRESIKN GGDASTDGVQRDLLPIVEGCMVSTKYGQ...itwyh*tyrrgykf*lxys*r*nscfrysrh*ktfk Frame B: ---KKVTIAEAKEIFEKQYRDLYTVSQDVTKLAIQSAEQNGIVFLDEIDKICTSRESIKN G

  13. Dicty_cDB: AFF341 [Dicty_cDB

    Full Text Available AF (Link to library) AFF341 (Link to dictyBase) - - - Contig-U15579-1 AFF341P (Link... to Original site) AFF341F 158 AFF341Z 283 AFF341P 441 - - Show AFF341 Library AF (Link to library) Clone ID AFF341 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...GCYYDKFDNCDACNAVDXCITNDLCFPRECNPRGNPPCLINPINCTSTDP CIFSYCENGVCIPTYICTPTPSVTPTVTPXVTXTVT Translated Amino Aci...*fliikkk--- ---DHCDPAIGCYYDKFDNCDACNAVDXCITNDLCFPRECNPRGNPPCLINPINCTSTDP CIFSYCENGVCIPTYICT

  14. Dicty_cDB: VHK472 [Dicty_cDB

    Full Text Available VH (Link to library) VHK472 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHK472Z 392 - - - - Show VHK472 Library VH (Link to library) Clone ID VHK472 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b....10 Translated Amino Acid sequence ---CSSVDSISNLPTXMQLFAGIKSICTEMAMDGCEKCSGNSPTTT...wstlqlsnhirllcrlcc*rrsnhenvlshwylglypl*ilgtk n*psicwfmv Frame B: ---CSSVDSISNLPTXMQLFAGIKSICTEMAMDGCEKCSGNSP

  15. Dicty_cDB: CFJ816 [Dicty_cDB

    Full Text Available CF (Link to library) CFJ816 (Link to dictyBase) - - - Contig-U16255-1 CFJ816P (Link... to Original site) CFJ816F 562 CFJ816Z 721 CFJ816P 1263 - - Show CFJ816 Library CF (Link to library) Clone ID CFJ816 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...ATGSATGQGTSGGTPGSCDKV NCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTTTGGSTTGSHTTT...PATGSATGQGTSGGTPGSCDKV NCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTTTGGSTTGSHTTTG GSTTGSHTTTGGSTTGSHTTTGGS

  16. Dicty_cDB: SSI339 [Dicty_cDB

    Full Text Available SS (Link to library) SSI339 (Link to dictyBase) - - - Contig-U04467-1 SSI339Z (Link... to Original site) - - SSI339Z 563 - - - - Show SSI339 Library SS (Link to library) Clone ID SSI339 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04467-1 Original site URL http://dict...1998. 1.22 Translated Amino Acid sequence ---FTCSNNQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICT...NQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICTTSSGYSCETNQTNGVLKCISPDNSISCIGNQFY

  17. Dicty_cDB: CFF487 [Dicty_cDB

    Full Text Available CF (Link to library) CFF487 (Link to dictyBase) - - - Contig-U15579-1 CFF487P (Link... to Original site) CFF487F 143 CFF487Z 518 CFF487P 661 - - Show CFF487 Library CF (Link to library) Clone ID CFF487 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...CFPRECNPRGNPPCLINPINCTSTDPCIFSYCE NGVCIPTYICTPTPSVTPTVTPTVTPTVTPTVTPTVTPTVTPTPTTTPTPSPTTV Translated Amino A...ESCEIGFGCLAIPKNCNDNDPCTTDHCD PAIGCYYDKFDNCDACNAVDTCITNDLCFPRECNPRGNPPCLINPINCTSTDPCIFSYCE NGVCIPTYICTPTPSVTP

  18. Dicty_cDB: SFC534 [Dicty_cDB

    Full Text Available SF (Link to library) SFC534 (Link to dictyBase) - - - Contig-U15579-1 SFC534P (Link... to Original site) SFC534F 158 SFC534Z 334 SFC534P 492 - - Show SFC534 Library SF (Link to library) Clone ID SFC534 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...fiyl**hymni*klenif*KLENIIKKRNKLIFNYKKK--- ---DPXIGCYYDKFDNCDACNAVDTCITNDLCFPRECNPRGXPPCLINPINCTSTDPCIF SYCENGVCIPTYICT...lfiyl**hymni*klenif*KLENIIKKRNKLIFNYKKK--- ---DPXIGCYYDKFDNCDACNAVDTCITNDLCFPRECNPRGXPPCLINPINCTSTDPCIF SYCENGVCIPTYICT

  19. Dicty_cDB: CHI134 [Dicty_cDB

    Full Text Available CH (Link to library) CHI134 (Link to dictyBase) - - - Contig-U11723-1 CHI134P (Link... to Original site) CHI134F 581 CHI134Z 736 CHI134P 1297 - - Show CHI134 Library CH (Link to library) Clone ID CHI134 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11723-1 Original site URL http://dict...gl*kta*g*IIMESNKSSSHGDVSTSPSFLNNHHQFNNGGDIIPKKKKNRIMHVG SYEVGKTLGNGTFGKVKLGTNICTK...PVIEAPKTRRMSLDSR MLNGDQQSLVEKNQHMASPRTSKGIFKXSTTTTKSPEKTIIELKRSLEESGLFTKKKGPY LXLCFDEDNSVKFQIEIVKICNLDLTGIQLKRLSGDTWKYKDICT

  20. Dicty_cDB: CFI686 [Dicty_cDB

    Full Text Available CF (Link to library) CFI686 (Link to dictyBase) - - - Contig-U15579-1 CFI686P (Link... to Original site) CFI686F 185 CFI686Z 445 CFI686P 610 - - Show CFI686 Library CF (Link to library) Clone ID CFI686 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...CYYDKFDXCXACN XVDTCXXNDLCXXRECNXRGXPPCLINPINCXSXDPCIFSYCENGVCIXTYICTPTPSVT PTVTPT...LVXXCXIGFGCXAIXKNCNXNDPXXXDXCDXXIGCYYDKFDXCXACN XVDTCXXNDLCXXRECNXRGXPPCLINPINCXSXDPCIFSYCENGVCIXTYICTPTPSVT

  1. Dicty_cDB: VFM148 [Dicty_cDB

    Full Text Available VF (Link to library) VFM148 (Link to dictyBase) - - - Contig-U08795-1 VFM148P (Link... to Original site) VFM148F 479 VFM148Z 710 VFM148P 1169 - - Show VFM148 Library VF (Link to library) Clone ID VFM148 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U08795-1 Original site URL http://dict...YYFYYHKMALVLPIFATENTLLVTENDLGRGFS VDDNGANAKKSNVYICTKEDMTTVRSITDSNKLTLINDQESLTSALNVSGELSLSYGLMS GKIMGEYLDTSSS...(All Frames) Frame A: iylflnqk*fv*ITNNYFFYFLKIFCYYYFYYHKMALVLPIFATENTLLVTENDLGRGFS VDDNGANAKKSNVYICTKEDMTTVR

  2. Dicty_cDB: VHA365 [Dicty_cDB

    Full Text Available VH (Link to library) VHA365 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHA365Z 352 - - - - Show VHA365 Library VH (Link to library) Clone ID VHA365 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...TTGGGTACCAAGAACTGACCGTCAATTTGCTGGTTCATGGTTT sequence update 2002. 9.10 Translated Amino Acid sequence ---QLFAGIKSICT...wfmv Frame C: ---QLFAGIKSICTEMAMDGCEKCSGNSPTTTCDVLPVYSSLCMAMPDMSQCANWTKMCS SSGQLY

  3. Dicty_cDB: VFF110 [Dicty_cDB

    Full Text Available VF (Link to library) VFF110 (Link to dictyBase) - - - Contig-U10843-1 VFF110P (Link... to Original site) VFF110F 496 VFF110Z 306 VFF110P 802 - - Show VFF110 Library VF (Link to library) Clone ID VFF110 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10843-1 Original site URL http://dict...AVKVMLKQVDQKTLTDF RKEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLL--- ---XIFKVXXNGGIXXQXIXXPQGKFQXXKSKXXRXKXLITG...VYKGRCRLKDVAVKVMLKQVDQKTLTDF RKEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLL--- ---qflklxxmxvfxxkxfxxpkvnskxxkv

  4. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB590 (Link to dictyBase) - - - Contig-U09552-1 VFB590P (Link... to Original site) VFB590F 225 VFB590Z 118 VFB590P 343 - - Show VFB590 Library VF (Link to library) Clone ID VFB590 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09552-1 Original site URL http://dict...ed Amino Acid sequence IAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICTFISGYAENFLEEXKT...--- ---riyqinkvvmxhxlhn*lxvaxivxlgxvnvkihvexix Frame C: IAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICT

  5. Dicty_cDB: SFE109 [Dicty_cDB

    Full Text Available SF (Link to library) SFE109 (Link to dictyBase) - - - Contig-U10771-1 SFE109P (Link... to Original site) SFE109F 197 SFE109Z 630 SFE109P 827 - - Show SFE109 Library SF (Link to library) Clone ID SFE109 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10771-1 Original site URL http://dict...anslated Amino Acid sequence elnykfhftlnttqiei*inknfllflf*fffyfqi*iqlcfilkllllptiink*INKI FLKKK--- ---VTTSQCESLIQAGVDGLRVGMGVGSICT...fkfnsvsy*nyyyyqpslink*ik ff*kk--- ---VTTSQCESLIQAGVDGLRVGMGVGSICTTQEVMACGRPQATAVFKCALYSSQYNVPI IADGGIRTIGHII

  6. Dicty_cDB: CHC113 [Dicty_cDB

    Full Text Available CH (Link to library) CHC113 (Link to dictyBase) - - - Contig-U15579-1 CHC113P (Link... to Original site) CHC113F 198 CHC113Z 396 CHC113P 574 - - Show CHC113 Library CH (Link to library) Clone ID CHC113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...nif*KLENIIKKRNKLIFNYK KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT...KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICTPTPS

  7. Dicty_cDB: SLE110 [Dicty_cDB

    Full Text Available SL (Link to library) SLE110 (Link to dictyBase) - - - Contig-U16520-1 SLE110E (Link... to Original site) - - - - - - SLE110E 237 Show SLE110 Library SL (Link to library) Clone ID SLE110 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16520-1 Original site URL http://dict...NLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTYXDFKKAKEKVLYR KTAGAPEGLYM*kkknqnq Translated Amino Acid sequence... (All Frames) Frame A: AKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTYXDFKKAKEKVL

  8. Dicty_cDB: SHI777 [Dicty_cDB

    Full Text Available SH (Link to library) SHI777 (Link to dictyBase) - - - Contig-U12085-1 - (Link to Or...iginal site) SHI777F 332 - - - - - - Show SHI777 Library SH (Link to library) Clone ID SHI777 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12085-1 Original site URL http://dictycdb.b...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk

  9. Dicty_cDB: VHH756 [Dicty_cDB

    Full Text Available VH (Link to library) VHH756 (Link to dictyBase) - - - Contig-U15767-1 VHH756P (Link... to Original site) VHH756F 658 VHH756Z 686 VHH756P 1324 - - Show VHH756 Library VH (Link to library) Clone ID VHH756 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...YEYSNSNYFPINGQGF NDVSYPVPRGYVPISGESWTSMSTSTSLKGNNYNFC--- ---DSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCGANDEDKCKTW...*psw*fricqiw*kssnskryrvklewrsi*i**fkllpn*rtrfq *cklssskrlctnfwrildinvnfnfikg**l*fl--- ---DSSLCNDNNICTIDICVHE

  10. Dicty_cDB: SSB322 [Dicty_cDB

    Full Text Available SS (Link to library) SSB322 (Link to dictyBase) - - - Contig-U03539-1 SSB322Z (Link... to Original site) - - SSB322Z 393 - - - - Show SSB322 Library SS (Link to library) Clone ID SSB322 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U03539-1 Original site URL http://dict...KGKXYILQDKQYKERGVGTIRVNKDLEEKXRIIMNAD GSKKNILNVNIFPKMKVTSPNEKTLTFIAFEDDKICTFVLIAKPEEIKNFSTVINKQISS LEVA*nfil...NAD GSKKNILNVNIFPKMKVTSPNEKTLTFIAFEDDKICTFVLIAKPEEIKNFSTVINKQISS LEVA*nfilkkkk Homology vs CSM-cDNA Score E

  11. Dicty_cDB: VHP253 [Dicty_cDB

    Full Text Available VH (Link to library) VHP253 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHP253Z 355 - - - - Show VHP253 Library VH (Link to library) Clone ID VHP253 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...CTTGGGTACCAAGAACTGACCGTCAATTTGCTGGTTCATGGTTTGC sequence update 2002. 9.10 Translated Amino Acid sequence ---MQLFAGIKSICT...VPIMRMYFHTGILDYILFKSWVPRTDRQFAGSWF Translated Amino Acid sequence (All Frames) Frame A: ---MQLFAGIKSICTEMAMD

  12. Dicty_cDB: AHB126 [Dicty_cDB

    Full Text Available AH (Link to library) AHB126 (Link to dictyBase) - - - Contig-U16336-1 AHB126P (Link... to Original site) AHB126F 598 AHB126Z 500 AHB126P 1078 - - Show AHB126 Library AH (Link to library) Clone ID AHB126 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...RGIRNHKKNETKFINQCINEIKEELKGDMQKKTVAVQKLTYIQMLGFDI SWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQSEAYLAL NCLSNICT...KKNETKFINQCINEIKEELKGDMQKKTVAVQKLTYIQMLGFDI SWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQSEAYLAL NCLSNICT

  13. Dicty_cDB: VHB478 [Dicty_cDB

    Full Text Available VH (Link to library) VHB478 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHB478Z 556 - - - - Show VHB478 Library VH (Link to library) Clone ID VHB478 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...cid sequence ---ASGSVVXQCSSVDSISNLPTXMQLFAGIKSICTEMAMDGCEKCSGNSPTTTCDVLPV YSSLCMAMPDMSQCANWTKMCSSSGQLYNSQITT...xxcxlf*trknp*kyfrkkmdsqqkrfxr*xfn*vhlsl sgxy Frame C: ---ASGSVVXQCSSVDSISNLPTXMQLFAGIKSICTEMAMDGCEKCSGNSPTTT

  14. Dicty_cDB: VHC776 [Dicty_cDB

    Full Text Available VH (Link to library) VHC776 (Link to dictyBase) - - - Contig-U15722-1 VHC776P (Link... to Original site) VHC776F 593 VHC776Z 895 VHC776P 1468 - - Show VHC776 Library VH (Link to library) Clone ID VHC776 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...CDNNTGNCTCHNEXFGNSCEFTRCP LDCSTPNGTCDNNXGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCDN...XFGNSCEFTRCP LDCSTPNGTCDNNXGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCDNEHIGN GCEIKFIECKHKCSTKHGICDNDSGNCKCDTQTK

  15. Dicty_cDB: VHP243 [Dicty_cDB

    Full Text Available VH (Link to library) VHP243 (Link to dictyBase) - - - Contig-U16236-1 - (Link to Or...iginal site) VHP243F 134 - - - - - - Show VHP243 Library VH (Link to library) Clone ID VHP243 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16236-1 Original site URL http://dictycdb.b...AXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence CWPTGIXKTTICT...kilsif*ynfkyyqqpkkk--- Frame B: llaywyxqnnnlyqyyyyfyl*kyflsfniilniinnpkk--- Frame C: CWPTGIXKTTICTNTTIISICKN

  16. Dicty_cDB: VHK477 [Dicty_cDB

    Full Text Available VH (Link to library) VHK477 (Link to dictyBase) - - - Contig-U11536-1 VHK477P (Link... to Original site) VHK477F 685 VHK477Z 794 VHK477P 1459 - - Show VHK477 Library VH (Link to library) Clone ID VHK477 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11536-1 Original site URL http://dict...QIGTYSFEGKFIKKAIINGNRIVTINN KLLNENQLNSNSTITKEKDSSNQLSSFISIEIPHYDSNVLLDPSFSVLLDSNESYKNSEN SICTSKKSSKLTTAQIIAI...NQLSSFISIEIPHYDSNVLLDPSFSVLLDSNESYKNSEN SICTSKKSSKLTTAQIIAIVIVSVVFVIILALFIIVKFSKS

  17. Dicty_cDB: SFD793 [Dicty_cDB

    Full Text Available SF (Link to library) SFD793 (Link to dictyBase) - - - Contig-U16255-1 SFD793P (Link... to Original site) SFD793F 660 SFD793Z 689 SFD793P 1349 - - Show SFD793 Library SF (Link to library) Clone ID SFD793 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...ATCSSLNCNAQQMSCKYVQQACHETSC CPDIPQCQIPATGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSS SSSSSSTTGSHTTTGGSTT...TGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSS SSSSSSTTGSHTTTGGSTTGSHTTTGGSTTG

  18. Dicty_cDB: VHI141 [Dicty_cDB

    Full Text Available VH (Link to library) VHI141 (Link to dictyBase) - - - Contig-U15722-1 VHI141P (Link... to Original site) VHI141F 635 VHI141Z 922 VHI141P 1537 - - Show VHI141 Library VH (Link to library) Clone ID VHI141 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...LDCSTPNGTCDNNTGNCTCHNEHFGNSC EFTRCPLDCSTPNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHK...PNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHKCSTKHGICDNDSG

  19. Dicty_cDB: VFL117 [Dicty_cDB

    Full Text Available VF (Link to library) VFL117 (Link to dictyBase) - G22229 DDB0204982 Contig-U10461-1... - (Link to Original site) - - VFL117Z 591 - - - - Show VFL117 Library VF (Link to library) Clone ID VFL117 (Link to dict...yBase) Atlas ID - NBRP ID G22229 dictyBase ID DDB0204982 Link to Contig Contig-U10461-1 Original site URL http://dict...GMALLRSLQNHKKNTPFQHFQDMIFKTK VLITTVSLVFICTVIEEGIYQFAFEEFSTSTSVQSNFITYLIDTTQMIVVMYILANGKFS NYILFRKVKTTSFNSNEK...k**ytkfkynn**hw Frame B: ---TSMLMDIKFGQAVGFLILLAIYCAMVIGFGMALLRSLQNHKKNTPFQHFQDMIFKTK VLITTVSLVFICT

  20. Dicty_cDB: VHC263 [Dicty_cDB

    Full Text Available VH (Link to library) VHC263 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHC263Z 429 - - - - Show VHC263 Library VH (Link to library) Clone ID VHC263 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...ATGG ACTCCCAAC sequence update 2002. 9.10 Translated Amino Acid sequence ---QLFAGIKSICT...kyfrkkmdsq Frame B: ---QLFAGIKSICTXMAMDGCEKCSGNSPTTTCDVLPVYSSLCMAMPDMSQCANWTKMCS

  1. Dicty_cDB: VHO201 [Dicty_cDB

    Full Text Available VH (Link to library) VHO201 (Link to dictyBase) - - - Contig-U12425-1 VHO201P (Link... to Original site) VHO201F 596 VHO201Z 398 VHO201P 974 - - Show VHO201 Library VH (Link to library) Clone ID VHO201 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12425-1 Original site URL http://dict...SGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICTNALYDLFLAASDQINFQQCKENGFEVLKKLINS...CKREXMELRIPTFVSNILNTLFLHSLGVEGLFRISGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICT

  2. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB760 (Link to dictyBase) - - - Contig-U12286-1 VFB760P (Link... to Original site) VFB760F 474 VFB760Z 691 VFB760P 1165 - - Show VFB760 Library VF (Link to library) Clone ID VFB760 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12286-1 Original site URL http://dict...CCACTTAATTCCAGAAGG sequence update 2001. 6. 1 Translated Amino Acid sequence LLAYWNKCQVNSCDKTTGNCKPENLKCPDRSNECLKNTGCDDLTGCKYVSICT...cmfllqsfxnplnsrr Frame C: LLAYWNKCQVNSCDKTTGNCKPENLKCPDRSNECLKNTGCDDLTGCKYVSICTDS

  3. Dicty_cDB: AFI379 [Dicty_cDB

    Full Text Available AF (Link to library) AFI379 (Link to dictyBase) - - - Contig-U08795-1 AFI379P (Link... to Original site) AFI379F 645 AFI379Z 836 AFI379P 1471 - - Show AFI379 Library AF (Link to library) Clone ID AFI379 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U08795-1 Original site URL http://dict...ITNNYFFYFLKIFCYYYFYYHKMALVLPIFATENTLLVTENDL GRGFSVDDNGANAKKSNVYICTKEDMTTVRSITDSNKLTLINDQESLTSALNVSGELSLS YGL...KIFCYYYFYYHKMALVLPIFATENTLLVTENDL GRGFSVDDNGANAKKSNVYICTKEDMTTVRSITDSNKLTLINDQESLTSALNVSGELSLS YGLMSGKIMGEYL

  4. Dicty_cDB: SFH459 [Dicty_cDB

    Full Text Available SF (Link to library) SFH459 (Link to dictyBase) - - - Contig-U16336-1 SFH459P (Link... to Original site) SFH459F 606 SFH459Z 728 SFH459P 1334 - - Show SFH459 Library SF (Link to library) Clone ID SFH459 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...KTVAVQKLTYIQ MLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICTTDLARELANDILTLLSTQKT...TVAVQKLTYIQ MLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICTTDLARELANDILTLLSTQKTH

  5. Dicty_cDB: AFA460 [Dicty_cDB

    Full Text Available AF (Link to library) AFA460 (Link to dictyBase) - - - Contig-U15574-1 AFA460Z (Link... to Original site) - - AFA460Z 170 - - - - Show AFA460 Library AF (Link to library) Clone ID AFA460 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15574-1 Original site URL http://dict...date 2001. 6. 2 Translated Amino Acid sequence ---QIHQTIQVVKITLSSASSSSSSSSSSILNKTRICTYINSNSTHSLXXNIYKYKLPK T...it* Frame B: ---QIHQTIQVVKITLSSASSSSSSSSSSILNKTRICTYINSNSTHSLXXNIYKYKLPK Frame C:

  6. Dicty_cDB: CHR591 [Dicty_cDB

    Full Text Available CH (Link to library) CHR591 (Link to dictyBase) - - - Contig-U11865-1 CHR591P (Link... to Original site) CHR591F 557 CHR591Z 706 CHR591P 1243 - - Show CHR591 Library CH (Link to library) Clone ID CHR591 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11865-1 Original site URL http://dict... IDPYEIQQNKQSNNSNSNSNRNLTPNSSSPTNQRKNKQEDDDDESKLDDESDLNERFQKV VLRFREFPSLDTNLYRLQEICT...DLNERFQKV VLRFREFPSLDTNLYRLQEICTDLLHISQDFIHTVKTYGRIIIEERYLKEKTIQSRSIGG H--- ---RK

  7. Dicty_cDB: SFF125 [Dicty_cDB

    Full Text Available SF (Link to library) SFF125 (Link to dictyBase) - - - Contig-U16368-1 SFF125P (Link... to Original site) SFF125F 540 SFF125Z 608 SFF125P 1148 - - Show SFF125 Library SF (Link to library) Clone ID SFF125 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Original site URL http://dict...RNQHCPHGYSCR VIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNC GPGYICTIINGHPTCIRGDGYLCNQTRCPHDYQC...ACCVPHHDGCGNIQCPWGHYCVNEHGKCRCVPHRPPPRPPVDQCRNQHCPHGYSCR VIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNC GPGYICT

  8. Dicty_cDB: VHM522 [Dicty_cDB

    Full Text Available VH (Link to library) VHM522 (Link to dictyBase) - - - Contig-U15767-1 VHM522P (Link... to Original site) VHM522F 575 VHM522Z 747 VHM522P 1302 - - Show VHM522 Library VH (Link to library) Clone ID VHM522 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...PV--- ---ITHVQVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTP VDCGANDEDKCKTWSCDPTKGGCQSTPVVCEDKGKCLVGTC...rtrf q*cklss--- ---ITHVQVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTP VDCGANDEDKCKTWSCDPTKGGCQSTPVVCE

  9. Dicty_cDB: VHL434 [Dicty_cDB

    Full Text Available VH (Link to library) VHL434 (Link to dictyBase) - - - Contig-U16336-1 VHL434P (Link... to Original site) VHL434F 546 VHL434Z 778 VHL434P 1304 - - Show VHL434 Library VH (Link to library) Clone ID VHL434 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...EVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLS SNQSEAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIFLRYPES-- - --...GFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLS SNQSEAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIFL

  10. Dicty_cDB: VSK196 [Dicty_cDB

    Full Text Available VS (Link to library) VSK196 (Link to dictyBase) - - - Contig-U10274-1 VSK196P (Link... to Original site) VSK196F 423 VSK196Z 453 VSK196P 876 - - Show VSK196 Library VS (Link to library) Clone ID VSK196 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10274-1 Original site URL http://dict...TTATNAACAATTAAAAAAAA sequence update 2001. 3.22 Translated Amino Acid sequence kdgklvslkdfikdqkpivlyfypkdetsict...*NKIX--- ---KLKVGDQAPDFTCPDKDGKLVSLKDFIKDQKPIVLYFYPKDETSICTKEACEFRDKY QKFIEAGADVI

  11. Dicty_cDB: SSB721 [Dicty_cDB

    Full Text Available SS (Link to library) SSB721 (Link to dictyBase) ssb721 G20804 DDB0230090 Contig-U04...594-1 SSB721E (Link to Original site) - - - - - - SSB721E 549 Show SSB721 Library SS (Link to library) Clone ID SSB721 (Link to dict...yBase) Atlas ID ssb721 NBRP ID G20804 dictyBase ID DDB0230090 Link to Contig Contig-...U04594-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSB7-A/SSB72...quence update 1997.11.25 Translated Amino Acid sequence NDINSIVCKANSQCPTSHICTSSNKCIIKYSSKVGEKCTDSPLQCRVFNGEI

  12. Dicty_cDB: VHE138 [Dicty_cDB

    Full Text Available VH (Link to library) VHE138 (Link to dictyBase) - - - Contig-U15767-1 VHE138P (Link... to Original site) VHE138F 569 VHE138Z 621 VHE138P 1170 - - Show VHE138 Library VH (Link to library) Clone ID VHE138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...FVDNQAGDSXSAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQGF NDVSYP--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICT...rsi*i**fkllpn*rtrf q*ckls--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCG ANDEDKCKTWSCDPTKGG

  13. Dicty_cDB: SLG865 [Dicty_cDB

    Full Text Available SL (Link to library) SLG865 (Link to dictyBase) - G22488 DDB0184443 Contig-U04159-1... SLG865E (Link to Original site) - - - - - - SLG865E 373 Show SLG865 Library SL (Link to library) Clone ID SLG865 (Link to dict...yBase) Atlas ID - NBRP ID G22488 dictyBase ID DDB0184443 Link to Contig Contig-U04159-1 O...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLG8-C/SLG865Q.Seq.d/ ...quence update 1998. 6.28 Translated Amino Acid sequence KAQLETDLKNICTLVPSNITMECKF

  14. Dicty_cDB: CHN802 [Dicty_cDB

    Full Text Available CH (Link to library) CHN802 (Link to dictyBase) - - - Contig-U16336-1 CHN802P (Link... to Original site) CHN802F 543 CHN802Z 788 CHN802P 1311 - - Show CHN802 Library CH (Link to library) Clone ID CHN802 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...ASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSN QSEAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIFLRYPESL...NETKFINQCINEIKEELKGDMQKKTVAVQKLTY IQMLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSN QSEAYLALNCLSNICT

  15. Dicty_cDB: SLA340 [Dicty_cDB

    Full Text Available SL (Link to library) SLA340 (Link to dictyBase) - - - Contig-U16510-1 - (Link to Or...iginal site) - - SLA340Z 466 - - - - Show SLA340 Library SL (Link to library) Clone ID SLA340 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16510-1 Original site URL http://dictycdb.b.... 2 Translated Amino Acid sequence ---CGKPSPIPTCTRKLSPISICIIKLCPIFICITKLCSIYICTISICIIFICIICSNYS CNYNCNYSCNYN...qpqlqlqlqlqpqpqlqpqlqpq lplkfnqktffikyhynnffnnnsikk*y*kspffl Frame C: ---CGKPSPIPTCTRKLSPISICIIKLCPIFICITKLCSIYICT

  16. Dicty_cDB: SFL482 [Dicty_cDB

    Full Text Available SF (Link to library) SFL482 (Link to dictyBase) - - - Contig-U15494-1 SFL482P (Link... to Original site) SFL482F 434 SFL482Z 394 SFL482P 828 - - Show SFL482 Library SF (Link to library) Clone ID SFL482 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15494-1 Original site URL http://dict...cftclww*qmcqmcp*qnrscfln*rtknr*nclqeatkrfkt ker*EIIQINVVININHFLLIKKK--- ---ICTHIEKMVQRLTYRRRLSYRTTSNATKIVKTP...KQQK DLKQKKDKKSSK*m Translated Amino Acid sequence (All Frames) Frame A: icthiekmvqrltyrrrlsyrttsnatkivktpgg

  17. Dicty_cDB: VHD652 [Dicty_cDB

    Full Text Available VH (Link to library) VHD652 (Link to dictyBase) - - - Contig-U15722-1 VHD652P (Link... to Original site) VHD652F 573 VHD652Z 707 VHD652P 1260 - - Show VHD652 Library VH (Link to library) Clone ID VHD652 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...NYTIPCGSNSNNVLCGSYHSTVPRKYLSLGFVNGSTHSYSKDGLMITYISQDTTNDNDC KRYTTNV--- ---LVIIILVIVHAIMNILVMVVNSLNAHSIVQPPNGTCDINSGICT...i*vlflql viilflvvvivimycvdhiiqlfhasifhwdllmavhiviaktd***hiyhriqqmimia kdiqqm*--- ---LVIIILVIVHAIMNILVMVVNSLNAHSIVQPPNGTCDINSGICT

  18. Dicty_cDB: SSL592 [Dicty_cDB

    Full Text Available SS (Link to library) SSL592 (Link to dictyBase) - - - Contig-U14332-1 SSL592E (Link... to Original site) - - - - - - SSL592E 244 Show SSL592 Library SS (Link to library) Clone ID SSL592 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14332-1 Original site URL http://dict...ence niyi*IYMFLTLIHLWTSKNTVIIFICTLNGI*ik*nnvkniyi*iyn*kkkkkklkn*h lvdlnktv*lyk*kkliy*k Translated Amino Acid...kqncitl*ikkinllkk Frame C: niyi*IYMFLTLIHLWTSKNTVIIFICTLNGI*ik*nnvkniyi*iyn*kkkkkklkn*h lvdlnktv*lyk*kkliy*k

  19. Dicty_cDB: VHK273 [Dicty_cDB

    Full Text Available VH (Link to library) VHK273 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) VHK2...73F 620 - - - - - - Show VHK273 Library VH (Link to library) Clone ID VHK273 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHK2-D/VHK273Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHK273 (VHK273Q) /CSM/VH/VHK2-D/VHK273Q.Seq.d/ AACTCTCGAGTGCAAAA...27874 ) Dictyostelium discoideum cDNA clone:ddv63k23, 5' ... 1170 0.0 1 ( BJ42787

  20. Dicty_cDB: VHK256 [Dicty_cDB

    Full Text Available VH (Link to library) VHK256 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) VHK2...56F 620 - - - - - - Show VHK256 Library VH (Link to library) Clone ID VHK256 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHK2-C/VHK256Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHK256 (VHK256Q) /CSM/VH/VHK2-C/VHK256Q.Seq.d/ AACTCTCGAGTGCAAAA...27874 ) Dictyostelium discoideum cDNA clone:ddv63k23, 5' ... 1170 0.0 1 ( BJ42787

  1. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB689 (Link to dictyBase) - - - Contig-U16603-1 VFB689P (Link... to Original site) VFB689F 476 VFB689Z 663 VFB689P 1139 - - Show VFB689 Library VF (Link to library) Clone ID VFB689 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16603-1 Original site URL http://dict...mbrane 4.0 %: vesicles of secretory system 4.0 %: peroxisomal >> prediction for VFB689 is cyt 5' end seq. ID

  2. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB603 (Link to dictyBase) - - - Contig-U16505-1 VFB603Z (Link... to Original site) - - VFB603Z 496 - - - - Show VFB603 Library VF (Link to library) Clone ID VFB603 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16505-1 Original site URL http://dict...al 4.0 %: cytoskeletal 4.0 %: vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction for VF

  3. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB670 (Link to dictyBase) - - - Contig-U16447-1 VFB670Z (Link... to Original site) - - VFB670Z 541 - - - - Show VFB670 Library VF (Link to library) Clone ID VFB670 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16447-1 Original site URL http://dict... 0.00 m_ : 1.00 44.0 %: nuclear 28.0 %: cytoplasmic 16.0 %: cytoskeletal 8.0 %: peroxisomal 4.0 %: mitochondrial >> predict

  4. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC221 (Link to dictyBase) - - - Contig-U09438-1 VFC221Z (Link... to Original site) - - VFC221Z 496 - - - - Show VFC221 Library VF (Link to library) Clone ID VFC221 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09438-1 Original site URL http://dict... mitochondrial 8.0 %: peroxisomal 4.0 %: cytoskeletal 4.0 %: Golgi >> prediction for VFC221 is cyt 5' end se

  5. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB614 (Link to dictyBase) - - - Contig-U16382-1 VFB614Z (Link... to Original site) - - VFB614Z 219 - - - - Show VFB614 Library VF (Link to library) Clone ID VFB614 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...ments: (bits) Value N AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 ...tin mRNA ITL-1, 3' end. 339 9e-90 1 AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2234041-2

  6. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB713 (Link to dictyBase) - - - Contig-U16602-1 VFB713F (Link... to Original site) VFB713F 471 - - - - - - Show VFB713 Library VF (Link to library) Clone ID VFB713 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16602-1 Original site URL http://dict...ar 12.0 %: cytoplasmic 8.0 %: vacuolar 8.0 %: mitochondrial 8.0 %: endoplasmic reticulum >> predict

  7. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB714 (Link to dictyBase) - - - Contig-U12859-1 VFB714F (Link... to Original site) VFB714F 545 - - - - - - Show VFB714 Library VF (Link to library) Clone ID VFB714 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12859-1 Original site URL http://dict... Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N U36936 |U36936.1 Dict...Score E Sequences producing significant alignments: (bits) Value U36936_1( U36936 |pid:none) Dictyostelium d

  8. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB830 (Link to dictyBase) - - - Contig-U13825-1 VFB830P (Link... to Original site) VFB830F 566 VFB830Z 634 VFB830P 1200 - - Show VFB830 Library VF (Link to library) Clone ID VFB830 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13825-1 Original site URL http://dict...m3a: 0.00 m3b: 0.00 m_ : 1.00 56.0 %: mitochondrial 28.0 %: cytoplasmic 16.0 %: nuclear >> prediction for VF

  9. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB667 (Link to dictyBase) - - - Contig-U13894-1 VFB667Z (Link... to Original site) - - VFB667Z 633 - - - - Show VFB667 Library VF (Link to library) Clone ID VFB667 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13894-1 Original site URL http://dict... update 2009. 4. 4 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC117075 |AC117075.2 Dict...chondrial 4.0 %: vacuolar 4.0 %: peroxisomal >> prediction for VFB667 is cyt 5' e

  10. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB779 (Link to dictyBase) - - - Contig-U15331-1 VFB779P (Link... to Original site) VFB779F 328 VFB779Z 402 VFB779P 730 - - Show VFB779 Library VF (Link to library) Clone ID VFB779 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15331-1 Original site URL http://dict...cuolar 4.0 %: peroxisomal 4.0 %: endoplasmic reticulum >> prediction for VFB779 i

  11. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC191 (Link to dictyBase) - - - Contig-U16281-1 VFC191F (Link... to Original site) VFC191F 350 - - - - - - Show VFC191 Library VF (Link to library) Clone ID VFC191 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16281-1 Original site URL http://dict...ts) Value N AC116305 |AC116305.2 Dictyostelium discoideum chromosome 2 map 1005175-1418323 strain AX4, compl... 186 3e-46 AC116305_8( AC116305 |pid:none) Dictyostelium discoideum chromosom...

  12. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB893 (Link to dictyBase) - - - Contig-U15009-1 VFB893P (Link... to Original site) VFB893F 337 VFB893Z 727 VFB893P 1064 - - Show VFB893 Library VF (Link to library) Clone ID VFB893 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15009-1 Original site URL http://dict... 4.0 %: cytoskeletal 4.0 %: vesicles of secretory system >> prediction for VFB893

  13. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB776 (Link to dictyBase) - - - Contig-U13978-1 VFB776P (Link... to Original site) VFB776F 513 VFB776Z 602 VFB776P 1115 - - Show VFB776 Library VF (Link to library) Clone ID VFB776 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13978-1 Original site URL http://dict...ences producing significant alignments: (bits) Value N L41839 |L41839.1 Dictyoste....00 48.0 %: cytoplasmic 32.0 %: nuclear 16.0 %: cytoskeletal 4.0 %: peroxisomal >> predict

  14. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB551 (Link to dictyBase) - - - Contig-U16449-1 VFB551P (Link... to Original site) VFB551F 194 VFB551Z 178 VFB551P 372 - - Show VFB551 Library VF (Link to library) Clone ID VFB551 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16449-1 Original site URL http://dict...0 %: cytoplasmic 16.0 %: cytoskeletal 12.0 %: mitochondrial 4.0 %: vacuolar 4.0 %: endoplasmic reticulum >> predict

  15. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB751 (Link to dictyBase) - - - Contig-U16480-1 VFB751P (Link... to Original site) VFB751F 134 VFB751Z 560 VFB751P 694 - - Show VFB751 Library VF (Link to library) Clone ID VFB751 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16480-1 Original site URL http://dict...4.0 %: endoplasmic reticulum >> prediction for VFB751 is cyt 5' end seq. ID VFB751F 5' end seq. >VFB751F.Seq

  16. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB826 (Link to dictyBase) - - - Contig-U16584-1 VFB826F (Link... to Original site) VFB826F 430 - - - - - - Show VFB826 Library VF (Link to library) Clone ID VFB826 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16584-1 Original site URL http://dict... (bits) Value N AC115577 |AC115577.2 Dictyostelium discoideum chromosome 2 map 4657875-4914984 strain AX4, c...vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction for VFB82

  17. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB615 (Link to dictyBase) - - - Contig-U16602-1 VFB615F (Link... to Original site) VFB615F 636 - - - - - - Show VFB615 Library VF (Link to library) Clone ID VFB615 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16602-1 Original site URL http://dict...0 %: vesicles of secretory system 4.0 %: peroxisomal >> prediction for VFB615 is cyt 5' end seq. ID VFB615F

  18. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB490 (Link to dictyBase) - - - Contig-U16603-1 VFB490P (Link... to Original site) VFB490F 588 VFB490Z 683 VFB490P 1271 - - Show VFB490 Library VF (Link to library) Clone ID VFB490 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16603-1 Original site URL http://dict...: extracellular, including cell wall 4.0 %: plasma membrane 4.0 %: vesicles of secretory system 4.0 %: peroxisomal >> predict

  19. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB838 (Link to dictyBase) - - - Contig-U14973-1 VFB838P (Link... to Original site) VFB838F 562 VFB838Z 443 VFB838P 1005 - - Show VFB838 Library VF (Link to library) Clone ID VFB838 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14973-1 Original site URL http://dict...plasmic 12.0 %: Golgi 12.0 %: nuclear 4.0 %: plasma membrane 4.0 %: vesicles of secretory system 4.0 %: peroxisomal >> predict

  20. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB585 (Link to dictyBase) - - - Contig-U09875-1 VFB585Z (Link... to Original site) - - VFB585Z 664 - - - - Show VFB585 Library VF (Link to library) Clone ID VFB585 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09875-1 Original site URL http://dict...Score E Sequences producing significant alignments: (bits) Value N AC116551 |AC116551.2 Dictyostelium discoi...ces producing significant alignments: (bits) Value AC116551_43( AC116551 |pid:none) Dictyostelium discoideum

  1. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB625 (Link to dictyBase) - - - Contig-U13825-1 VFB625P (Link... to Original site) VFB625F 492 VFB625Z 685 VFB625P 1177 - - Show VFB625 Library VF (Link to library) Clone ID VFB625 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13825-1 Original site URL http://dict... %: cytoplasmic 16.0 %: nuclear 4.0 %: cytoskeletal 4.0 %: plasma membrane >> prediction for VFB625 is mit 5

  2. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB742 (Link to dictyBase) - - - Contig-U14919-1 VFB742P (Link... to Original site) VFB742F 590 VFB742Z 468 VFB742P 1058 - - Show VFB742 Library VF (Link to library) Clone ID VFB742 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14919-1 Original site URL http://dict...mbrane 4.0 %: peroxisomal 4.0 %: endoplasmic reticulum >> prediction for VFB742 is cyt 5' end seq. ID VFB742

  3. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB817 (Link to dictyBase) - - - Contig-U16229-1 VFB817P (Link... to Original site) VFB817F 504 VFB817Z 193 VFB817P 697 - - Show VFB817 Library VF (Link to library) Clone ID VFB817 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16229-1 Original site URL http://dict...%: peroxisomal 4.0 %: endoplasmic reticulum >> prediction for VFB817 is cyt 5' end seq. ID VFB817F 5' end se

  4. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB720 (Link to dictyBase) - - - Contig-U16603-1 VFB720P (Link... to Original site) VFB720F 521 VFB720Z 353 VFB720P 874 - - Show VFB720 Library VF (Link to library) Clone ID VFB720 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16603-1 Original site URL http://dict...: cytoskeletal 4.0 %: vacuolar 4.0 %: vesicles of secretory system >> prediction for VFB720 is nuc 5' end se

  5. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB644 (Link to dictyBase) - - - Contig-U10683-1 VFB644F (Link... to Original site) VFB644F 519 - - - - - - Show VFB644 Library VF (Link to library) Clone ID VFB644 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10683-1 Original site URL http://dict...7 9 AC116920 |AC116920.2 Dictyostelium discoideum chromosome 2 map 3879572-407176... %: nuclear 8.0 %: mitochondrial 4.0 %: cytoskeletal 4.0 %: vesicles of secretory system >> predict

  6. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB632 (Link to dictyBase) - - - Contig-U16585-1 VFB632Z (Link... to Original site) - - VFB632Z 181 - - - - Show VFB632 Library VF (Link to library) Clone ID VFB632 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16585-1 Original site URL http://dict...g significant alignments: (bits) Value N AC115577 |AC115577.2 Dictyostelium discoideum chromosome 2 map 4657...%: cytoplasmic 12.0 %: mitochondrial 8.0 %: cytoskeletal 4.0 %: peroxisomal >> prediction for VFB632 is nuc

  7. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB868 (Link to dictyBase) - - - Contig-U15649-1 VFB868F (Link... to Original site) VFB868F 110 - - - - - - Show VFB868 Library VF (Link to library) Clone ID VFB868 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15649-1 Original site URL http://dict...c 4.0 %: cytoskeletal >> prediction for VFB868 is nuc 5' end seq. ID VFB868F 5' end seq. >VFB868F.Seq TATTAA

  8. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC124 (Link to dictyBase) - - - Contig-U12017-1 VFC124Z (Link... to Original site) - - VFC124Z 496 - - - - Show VFC124 Library VF (Link to library) Clone ID VFC124 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12017-1 Original site URL http://dict...e E Sequences producing significant alignments: (bits) Value N AC116957 |AC116957.2 Dictyostelium discoideum... chromosome 2 map 1685067-2090751 strain AX4, complete sequence. 835 0.0 2 U67089 |U67089.1 Dict

  9. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC242 (Link to dictyBase) - - - Contig-U16280-1 VFC242F (Link... to Original site) VFC242F 431 - - - - - - Show VFC242 Library VF (Link to library) Clone ID VFC242 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16280-1 Original site URL http://dict...3( S18663 ) coronin - slime mold (Dictyostelium discoideum) ... 270 1e-71 AY52578...asmic 4.0 %: cytoskeletal 4.0 %: vesicles of secretory system >> prediction for VFC242 is nuc 5' end seq. ID

  10. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB804 (Link to dictyBase) - - - Contig-U13849-1 VFB804P (Link... to Original site) VFB804F 150 VFB804Z 637 VFB804P 787 - - Show VFB804 Library VF (Link to library) Clone ID VFB804 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13849-1 Original site URL http://dict... nuclear 4.0 %: cytoskeletal 4.0 %: vacuolar 4.0 %: plasma membrane 4.0 %: vesicles of secretory system >> predict

  11. Dicty_cDB: AFN878 [Dicty_cDB

    Full Text Available AF (Link to library) AFN878 (Link to dictyBase) - - - Contig-U15540-1 AFN878P (Link... to Original site) AFN878F 592 AFN878Z 531 AFN878P 1123 - - Show AFN878 Library AF (Link to library) Clone ID AFN878 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dict...D VNEKALILDGNVYDGHLNPIYNCKICTEYYQTKSYFSANPHAKGKVLLVKNNILTRVKDG GFTLSLKPMCCSGHNSHIPLYFHFTLTNPLTNEVVLQSLINVNVK...YESYRIYIHPSLGYSGNAKRFKQQPD VNEKALILDGNVYDGHLNPIYNCKICTEYYQTKSYFSANPHAKGKVLLVKNNILTRVKDG GFTLSLKPMCCSGHNSHIPL

  12. Dicty_cDB: VHL663 [Dicty_cDB

    Full Text Available VH (Link to library) VHL663 (Link to dictyBase) - - - Contig-U15767-1 VHL663P (Link... to Original site) VHL663F 574 VHL663Z 702 VHL663P 1256 - - Show VHL663 Library VH (Link to library) Clone ID VHL663 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...WPDGFKYFFVDNQAGDSESAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQG FNDVSYPV--- ---SYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQG...ik rqelvgqmvlsifl*itklviqnlpnlvkifqfkeiss*igmekhmniviqitsqltdkv smm*aiq--- ---SYATGKCEPDSSLCNDNNICTIDICVHEGI

  13. Dicty_cDB: AFL122 [Dicty_cDB

    Full Text Available AF (Link to library) AFL122 (Link to dictyBase) - - - Contig-U11144-1 AFL122P (Link... to Original site) AFL122F 837 AFL122Z 711 AFL122P 1538 - - Show AFL122 Library AF (Link to library) Clone ID AFL122 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11144-1 Original site URL http://dict...GPSVILLDEPTSGLDASTSFYVMSALKKLAKSGRTIICTIHQPRSNIYDM FDNLLLLGDGNTIYYGKANKALEYFNANGYHCSEKTNPADFFLDLINTQVEDQADSD...TLNFYAQLKMPRDVPLKEKLQRVQDIIDEMGLNRCADTLVGTADNKIRGISGGERR RVTISIELLTGPSVILLDEPTSGLDASTSFYVMSALKKLAKSGRTIICT

  14. Dicty_cDB: SHL102 [Dicty_cDB

    Full Text Available SH (Link to library) SHL102 (Link to dictyBase) - - - Contig-U11892-1 - (Link to Or...iginal site) - - SHL102Z 634 - - - - Show SHL102 Library SH (Link to library) Clone ID SHL102 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11892-1 Original site URL http://dictycdb.b...TCRXKFDNQKIHDCDWIIQGPTTPSLCANCGKICTSKCTTNYCDRDCQTVDWQSDHKL ICGLKSFKDR*detpikn*ik*...A FSTCRXKFDNQKIHDCDWIIQGPTTPSLCANCGKICTSKCTTNYCDRDCQTVDWQSDHKL ICGLKSFKDR*detpikn*ik*kkiklnnk Frame C: ---lk

  15. Dicty_cDB: VHH831 [Dicty_cDB

    Full Text Available VH (Link to library) VHH831 (Link to dictyBase) - - - Contig-U15722-1 VHH831P (Link... to Original site) VHH831F 586 VHH831Z 930 VHH831P 1496 - - Show VHH831 Library VH (Link to library) Clone ID VHH831 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...HFGNGCEFTQCPLYCSTPNGTCDINSGICTC DNEHIGNGCEIKFIECKHKCSTKHGICDNDSGNCKCDTQTKGLTCEESRLLIESLDSINS KGGTINIIGYFGNTT...STPNGTCDNNTGNCTCHNEHFGNG CEFTRCPLDCSTPNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTC DNEHIGNGCEIKFIECKHKCST

  16. Dicty_cDB: CFE262 [Dicty_cDB

    Full Text Available CF (Link to library) CFE262 (Link to dictyBase) - - - Contig-U16368-1 CFE262P (Link... to Original site) CFE262F 652 CFE262Z 401 CFE262P 1053 - - Show CFE262 Library CF (Link to library) Clone ID CFE262 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Original site URL http://dict...HRPPPRPPVDQCRNQHCPHGYSC RVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVN CGPGYICTIINGHPTCIRGDGYL...VNEHGKCRCVPHRPPPRPPVDQCRNQHCPHGYSC RVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVN CGPGYICTIING

  17. Dicty_cDB: SLC442 [Dicty_cDB

    Full Text Available SL (Link to library) SLC442 (Link to dictyBase) - - - Contig-U16430-1 SLC442Z (Link... to Original site) - - SLC442Z 467 - - - - Show SLC442 Library SL (Link to library) Clone ID SLC442 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC442Q.Seq.d/ Representative seq. ID SLC44...2Z (Link to Original site) Representative DNA sequence >SLC442 (SLC442Q) /CSM/SL/SLC4-B/SLC442Q.Seq.d/ XXXXX... 4.0 %: extracellular, including cell wall 4.0 %: peroxisomal >> prediction for SLC4

  18. Dicty_cDB: SLC456 [Dicty_cDB

    Full Text Available SL (Link to library) SLC456 (Link to dictyBase) - - - Contig-U16272-1 SLC456Z (Link... to Original site) - - SLC456Z 483 - - - - Show SLC456 Library SL (Link to library) Clone ID SLC456 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC456Q.Seq.d/ Representative seq. ID SLC45...6Z (Link to Original site) Representative DNA sequence >SLC456 (SLC456Q) /CSM/SL/SLC4-C/SLC456Q.Seq.d/ XXXXX...0 %: vacuolar 4.0 %: peroxisomal >> prediction for SLC456 is nuc 5' end seq. ID -

  19. Dicty_cDB: SFH236 [Dicty_cDB

    Full Text Available SF (Link to library) SFH236 (Link to dictyBase) - G00315 DDB0191340 Contig-U16349-1...brary) Clone ID SFH236 (Link to dictyBase) Atlas ID - NBRP ID G00315 dictyBase ID DDB0191340 Link to Contig ...Contig-U16349-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SF/SFH2-...VDCVTNSSDASCTNFQYPLANITADINNL CGSMPYMPVCTIQQSCNQESSTSGICDPFSILGDSCLHDMPGMSG--- ---ASGSVVEQCSSVDSISNLPTTMQLFAGIKSICT...ii yvvaclicqfvpfnnhviknpqqvvfvihsqflvivvfticqa*vv--- ---ASGSVVEQCSSVDSISNLPTTMQLFAGIKSICTEMAMDGCEKCSGNSPTTTC

  20. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC148 (Link to dictyBase) - G00403 DDB0215559 Contig-U08747-1...rary) Clone ID VFC148 (Link to dictyBase) Atlas ID - NBRP ID G00403 dictyBase ID DDB0215559 Link to Contig C...ontig-U08747-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFC1-B...STEITHLAIPSNSNIK IIEGGAYIPANVKHCLLLDGFNQPLEPGFLAPTITHLHICTIKTPLLVGSIPNGVTDLFL HDGFSEPISQDIIPPSVQNLYLCDIKLPFK...it--- ---LMKSXFIIHSKSINXAKKPKRVQFGDKVFTYYNKDENNGIISTEITHLAIPSNSNIK IIEGGAYIPANVKHCLLLDGFNQPLEPGFLAPTITHLHICT

  1. Dicty_cDB: CHR241 [Dicty_cDB

    Full Text Available CH (Link to library) CHR241 (Link to dictyBase) - - - Contig-U10843-1 | Contig-U131... library) Clone ID CHR241 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U108...43-1 | Contig-U13148-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...ilyhtht**KTMATQQQQQQQQQQQQQIKARKDIQIQQ AQSASDILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICT...PPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLVSLLLDPMVKLPLITRM

  2. Dicty_cDB: VHJ417 [Dicty_cDB

    Full Text Available VH (Link to library) VHJ417 (Link to dictyBase) - G23450 DDB0202154 Contig-U12507-1...brary) Clone ID VHJ417 (Link to dictyBase) Atlas ID - NBRP ID G23450 dictyBase ID DDB0202154 Link to Contig ...Contig-U12507-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHJ4-...LLSAVSDSSVQSLSSSI--- ---IDEIKQSVFGATAIIGQSKYIMEGQLSLLKGVVASTKKDLFIYLFKDCIICTEINSN...QSKYIMEGQLSLLKGVVASTKKDLFIYLFKDCIICTEINSN YQKDGSNNNNNNNNNNSNNSNSNSSSNNSGSNNSSNNNSPNNLTPKKQTFKSLSTSSSTP NNLSQ

  3. Dicty_cDB: CHA362 [Dicty_cDB

    Full Text Available CH (Link to library) CHA362 (Link to dictyBase) - - - Contig-U15579-1 | Contig-U156... library) Clone ID CHA362 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U155...79-1 | Contig-U15687-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...XACNAVDTCITNDLCFPRECNPRGNPPCLINPINCTSTDPCIFSYCENGVCI PTYICTPTPSVTPTVTPTVTPTVTPTVT...GNPPCLINPINCTSTDPCIFSYCENGVCI PTYICTPTPSVTPTVTPTVTPTVTPTVTPTVTPTVTPTPTTTPTPSPTTVP

  4. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB533 (Link to dictyBase) - G02515 DDB0218082 Contig-U10369-1...brary) Clone ID VFB533 (Link to dictyBase) Atlas ID - NBRP ID G02515 dictyBase ID DDB0218082 Link to Contig ...Contig-U10369-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFB5-... %: cytoskeletal 4.0 %: extracellular, including cell wall 4.0 %: peroxisomal >> predict

  5. Dicty_cDB: SHE695 [Dicty_cDB

    Full Text Available SH (Link to library) SHE695 (Link to dictyBase) - G22060 DDB0217012 Contig-U12072-1...brary) Clone ID SHE695 (Link to dictyBase) Atlas ID - NBRP ID G22060 dictyBase ID DDB0217012 Link to Contig ...Contig-U12072-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SH/SHE6-...CPISDCSDHGYCDTSIGKC NCDSSHQGAGCEMDLVSCPTSNKAICSGWGTCNNQTGICTCDANRVGSDCSGISCPVPNC NGNGNCDTTVGQCSCDPSHQGANCEMN...IGKC NCDSSHQGAGCEMDLVSCPTSNKAICSGWGTCNNQTGICTCDANRVGSDCSGISCPVPNC NGNGNCDTTVGQCSCDPSHQGANCEMNFVSCPTPNRSVCSGWGTCNNQTGICT

  6. Dicty_cDB: SSB171 [Dicty_cDB

    Full Text Available SS (Link to library) SSB171 (Link to dictyBase) ssb171 - - Contig-U02783-1 SSB171F ...nk to dictyBase) Atlas ID ssb171 NBRP ID - dictyBase ID - Link to Contig Contig-U02783-1 Original site URL h

  7. Dicty_cDB: VSK446 [Dicty_cDB

    Full Text Available VS (Link to library) VSK446 (Link to dictyBase) - - - Contig-U15105-1 VSK446E (Link... Clone ID VSK446 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15105-1 Original site URL http://dict... r... 269 4e-71 AF402813_1( AF402813 |pid:none) Ictalurus punctatus 40S ribosomal ... 269 4e-71 FJ196315_1( ....00 84.0 %: cytoplasmic 12.0 %: mitochondrial 4.0 %: nuclear >> prediction for VSK446 is cyt 5' end seq. ID

  8. Dicty_cDB: VFJ256 [Dicty_cDB

    Full Text Available VF (Link to library) VFJ256 (Link to dictyBase) - - - Contig-U10140-1 VFJ256E (Link...) Clone ID VFJ256 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10140-1 Ori...*nq*fylv*l*vx*KMNKLHLPIKENHHQXIKSIELIKNEFPEILICTDLCLC AYTDHGHCGVLTEEGFIENEKSIIRLG...iiikiih iiyivdmpiqlldhgkvimsf*nln*fiqfllqi*liqklklnpyqdnikfqvi**lnf* dhwlrkd*nq*fylv*l*vx*KMNKLHLPIKENHHQXIKSIELIKNEFPEILICT...pdate 2002.12.18 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( BJ432755 ) Dict

  9. Dicty_cDB: VFB330 [Dicty_cDB

    Full Text Available VF (Link to library) VFB330 (Link to dictyBase) - G22107 DDB0216429 Contig-U02054-1...ary VF (Link to library) Clone ID VFB330 (Link to dictyBase) Atlas ID - NBRP ID G22107 dictyBase ID DDB02164...29 Link to Contig Contig-U02054-1 | Contig-U16357-1 Original site URL http://dict...d Amino Acid sequence *k*k*NKMKLDPKALRYLSKDDFRTLVAVEMGMKNHELVPVSLICTIANLKYGGTKKSIQ TLHKFKLLFHDGRNYDGYKLTYLGY...LRYLSKDDFRTLVAVEMGMKNHELVPVSLICTIANLKYGGTKKSIQ TLHKFKLLFHDGRNYDGYKLTYLGYDFLALKTLVSRGVCSYVGNQIGVGKESDIYIVAND

  10. Dicty_cDB: SHA393 [Dicty_cDB

    Full Text Available SH (Link to library) SHA393 (Link to dictyBase) - - - Contig-U11503-1 SHA393E (Link... Clone ID SHA393 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dict...lated Amino Acid sequence ekqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCG FNNXPICTSLKDAVXRAFLLI...yhcysyfg Translated Amino Acid sequence (All Frames) Frame A: ekqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCG FNNXPICT...Homology vs Protein Score E Sequences producing significant alignments: (bits) Value AF020283_1( AF020283 |pid:none) Dict

  11. Dicty_cDB: SHD573 [Dicty_cDB

    Full Text Available SH (Link to library) SHD573 (Link to dictyBase) - - - Contig-U11503-1 SHD573E (Link...Clone ID SHD573 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dict...LFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCGFNN EPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGALWITSENINNENN NYTI...ststtts ax***d*eyyhcysyfgldl Frame C: fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCGFNN EPICTSLKD...vegicus clone CH230-428C17, WORKING DRAFT SEQUENCE, 3 unordered pieces. 48 3e-12 3 AC116984 |AC116984.2 Dict

  12. Dicty_cDB: SHF448 [Dicty_cDB

    Full Text Available SH (Link to library) SHF448 (Link to dictyBase) - - - Contig-U11503-1 SHF448E (Link...) Clone ID SHF448 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Ori...quence qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKD...mnvnlkimrigltqlxisyrfy Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAV...nts: (bits) Value N AC115680 |AC115680.3 Dictyostelium discoideum chromosome 2 map 4915084-5005461 strain AX

  13. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB593 (Link to dictyBase) - - - Contig-U02438-1 VFB593E (Link...) Clone ID VFB593 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U02438-1 Ori...0.009 6 AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2234041-25...sequence. 46 0.031 2 AC115577 |AC115577.2 Dictyostelium discoideum chromosome 2 m...ap 4657875-4914984 strain AX4, complete sequence. 34 0.051 14 AC116960 |AC116960.2 Dictyostelium discoideum

  14. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB752 (Link to dictyBase) - - - Contig-U14717-1 VFB752E (Link...) Clone ID VFB752 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14717-1 Ori...s: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map 2567470-3108875 strain AX4,... complete sequence. 1215 0.0 11 AC115594 |AC115594.2 Dictyostelium discoideum chr...omosome 2 map 4071862-4101005 strain AX4, complete sequence. 113 3e-47 8 AC116920 |AC116920.2 Dictyostelium

  15. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB676 (Link to dictyBase) - - - Contig-U12091-1 VFB676E (Link...) Clone ID VFB676 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12091-1 Ori...NA, complete cds. 2155 0.0 1 U66525 |U66525.1 Dictyostelium discoideum ORFveg114 ...toplasmic 16.0 %: mitochondrial 4.0 %: cytoskeletal 4.0 %: vesicles of secretory system >> prediction for VF

  16. Dicty_cDB: SLC832 [Dicty_cDB

    Full Text Available SL (Link to library) SLC832 (Link to dictyBase) - - - Contig-U13922-1 SLC832Z (Link... to Original site) - - SLC832Z 638 - - - - Show SLC832 Library SL (Link to library) Clone ID SLC832 (Link to dic..._1( EU565733 |pid:none) Uncultured soil bacterium clone gl... 35 2.4 CP000010_276....1 AP009385_2728( AP009385 |pid:none) Burkholderia multivorans ATCC 1... 33 5.3 A... 20.0 %: nuclear 16.0 %: vesicles of secretory system 12.0 %: mitochondrial 8.0 %: Golgi 8.0 %: endoplasmic reticul

  17. Dicty_cDB: SFC123 [Dicty_cDB

    Full Text Available SF (Link to library) SFC123 (Link to dictyBase) - - - Contig-U16368-1 SFC123E (Link...) Clone ID SFC123 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Ori...CVPHHDGCGNIQCPWGHYCVNEHGKCRCVPHRPPPRPPVDQCRNQHCPH GYSCRVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQIC GSVNCGPGYICT...CRCVPHRPPPRPPVDQCRNQHCPH GYSCRVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQIC GSVNCGPGYICTIINGHPTCIR...(bits) Value N D13973 |D13973.1 Dictyostelium discoideum DNA for Dp87 protein, complete cds. 1643 0.0 5 BJ17

  18. Inauguration of the Faculty of Law at the University of Wollongong.

    Mason, Anthony

    1991-01-01

    The Chief Justice of Australia, on the occasion of inauguration of the Faculty of Law at the University of Wollongong (Australia), examines the purposes and content of academic legal education, notes the increasing numbers of students wanting to study law, and recommends more interdisciplinary studies for students of law. (DB)

  19. Getting started with MariaDB

    Bartholomew, Daniel

    2013-01-01

    A practical, hands-on, beginner-friendly guide to installing and using MariaDB.Getting Started with MariaDB is for anyone who wants to learn more about databases in general or MariaDB in particular. No prior database experience is required. It is assumed that you have basic knowledge of software installation, editing files with a text editor, and using the command line and terminal.

  20. Dicty_cDB: SLH268 [Dicty_cDB

    Full Text Available SL (Link to library) SLH268 (Link to dictyBase) - - - - SLH268Z (Link to Original site) - - SLH2...68Z 640 - - - - Show SLH268 Library SL (Link to library) Clone ID SLH268 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-C/SLH2...68Q.Seq.d/ Representative seq. ID SLH268Z (Link to Original site) R...epresentative DNA sequence >SLH268 (SLH268Q) /CSM/SL/SLH2-C/SLH268Q.Seq.d/ XXXXXXXXXXCTGGTGGTTATATTTCTCGTACT

  1. Dicty_cDB: SLH252 [Dicty_cDB

    Full Text Available SL (Link to library) SLH252 (Link to dictyBase) - - - - SLH252F (Link to Original site) SLH2...52F 158 - - - - - - Show SLH252 Library SL (Link to library) Clone ID SLH252 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-C/SLH2...52Q.Seq.d/ Representative seq. ID SLH252F (Link to Original site) R...epresentative DNA sequence >SLH252 (SLH252Q) /CSM/SL/SLH2-C/SLH252Q.Seq.d/ ACAGAATGGGTAAAGTACATGGTGGTTTGAATC

  2. Dicty_cDB: VSF490 [Dicty_cDB

    Full Text Available VS (Link to library) VSF490 (Link to dictyBase) - G21390 DDB0186133 Contig-U10099-1 VSF4...90E (Link to Original site) VSF490F 504 VSF490Z 674 VSF490P 1178 VSF490E 917 Show VSF490 Library VS (Li...nk to library) Clone ID VSF490 (Link to dictyBase) Atlas ID - NBRP ID G21390 dictyBase ID DDB0186133 Link to... Contig Contig-U10099-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSF4-D/VSF4...90Q.Seq.d/ Representative seq. ID VSF490E (Link to Original site) Representative DNA sequence >VSF490 (VSF4

  3. Dicty_cDB: SLF442 [Dicty_cDB

    Full Text Available SL (Link to library) SLF442 (Link to dictyBase) slf442 - - Contig-U16022-1 SLF442P ...(Link to Original site) SLF442F 294 SLF442Z 570 SLF442P 864 - - Show SLF442 Library SL (Link to library) Clone ID SLF4...42 (Link to dictyBase) Atlas ID slf442 NBRP ID - dictyBase ID - Link to Contig Contig-U16022-1 Ori...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLF4-B/SLF442Q.Seq.d/ Re...presentative seq. ID SLF442P (Link to Original site) Representative DNA sequence >SLF442 (SLF442Q) /CSM/SL/SLF4-B/SLF4

  4. Dicty_cDB: SSM642 [Dicty_cDB

    Full Text Available SS (Link to library) SSM642 (Link to dictyBase) ssm642 G00916 DDB0229937 Contig-U05906-1 SSM6...S (Link to library) Clone ID SSM642 (Link to dictyBase) Atlas ID ssm642 NBRP ID G00916 dictyBase ID DDB02299...42E (Link to Original site) SSM642F 689 SSM642Z 617 SSM642P 1306 SSM642E 907 Show SSM642 Library S...37 Link to Contig Contig-U05906-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSM6-B/SSM6...42Q.Seq.d/ Representative seq. ID SSM642E (Link to Original site) Representative DNA sequence >SSM642 (SSM6

  5. Dicty_cDB: VHK221 [Dicty_cDB

    Full Text Available VH (Link to library) VHK221 (Link to dictyBase) - - - - VHK221P (Link to Original site) VHK221F 603 VHK2...21Z 724 VHK221P 1307 - - Show VHK221 Library VH (Link to library) Clone ID VHK221 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2...-A/VHK221Q.Seq.d/ Representative seq. ID VHK221P (Link to... Original site) Representative DNA sequence >VHK221 (VHK221Q) /CSM/VH/VHK2-A/VHK221Q.Seq.d/ AACTCTCGAGTGCAAA

  6. Dicty_cDB: VHK211 [Dicty_cDB

    Full Text Available VH (Link to library) VHK211 (Link to dictyBase) - - - - VHK211P (Link to Original site) VHK211F 605 VHK2...11Z 118 VHK211P 703 - - Show VHK211 Library VH (Link to library) Clone ID VHK211 (Link ...to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2...-A/VHK211Q.Seq.d/ Representative seq. ID VHK211P (Link to ...Original site) Representative DNA sequence >VHK211 (VHK211Q) /CSM/VH/VHK2-A/VHK211Q.Seq.d/ AACTCTCGAGTGCAAAA

  7. Dicty_cDB: VHK279 [Dicty_cDB

    Full Text Available VH (Link to library) VHK279 (Link to dictyBase) - - - - VHK279P (Link to Original site) VHK279F 619 VHK2...79Z 149 VHK279P 748 - - Show VHK279 Library VH (Link to library) Clone ID VHK279 (Link ...to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2...-D/VHK279Q.Seq.d/ Representative seq. ID VHK279P (Link to ...Original site) Representative DNA sequence >VHK279 (VHK279Q) /CSM/VH/VHK2-D/VHK279Q.Seq.d/ AACTCTCGAGTGCAAAA

  8. Dicty_cDB: SLC460 [Dicty_cDB

    Full Text Available SL (Link to library) SLC460 (Link to dictyBase) - - - - SLC460Z (Link to Original site) - - SLC4...60Z 333 - - - - Show SLC460 Library SL (Link to library) Clone ID SLC460 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC4...60Q.Seq.d/ Representative seq. ID SLC460Z (Link to Original site) R...epresentative DNA sequence >SLC460 (SLC460Q) /CSM/SL/SLC4-C/SLC460Q.Seq.d/ XXXXXXXXXXAATTATTATTGTGTAATTCCTGT

  9. Dicty_cDB: SLC418 [Dicty_cDB

    Full Text Available SL (Link to library) SLC418 (Link to dictyBase) - G01921 DDB0191271 Contig-U15820-1 SLC4...18E (Link to Original site) SLC418F 604 SLC418Z 554 SLC418P 1158 SLC418E 1076 Show SLC418 Library SL (L...ink to library) Clone ID SLC418 (Link to dictyBase) Atlas ID - NBRP ID G01921 dictyBase ID DDB0191271 Link t...o Contig Contig-U15820-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC4...18Q.Seq.d/ Representative seq. ID SLC418E (Link to Original site) Representative DNA sequence >SLC418 (SLC4

  10. Dicty_cDB: SLC496 [Dicty_cDB

    Full Text Available SL (Link to library) SLC496 (Link to dictyBase) - - - - SLC496E (Link to Original site) - - - - - - SLC4...96E 443 Show SLC496 Library SL (Link to library) Clone ID SLC496 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC4...96Q.Seq.d/ Representative seq. ID SLC496E (Link to Original site) R...epresentative DNA sequence >SLC496 (SLC496Q) /CSM/SL/SLC4-D/SLC496Q.Seq.d/ AAGAAATTTGAATCACTCCAAATCATTATCCCA

  11. Dicty_cDB: SLC449 [Dicty_cDB

    Full Text Available SL (Link to library) SLC449 (Link to dictyBase) - - - - SLC449Z (Link to Original site) - - SLC4...49Z 384 - - - - Show SLC449 Library SL (Link to library) Clone ID SLC449 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC4...49Q.Seq.d/ Representative seq. ID SLC449Z (Link to Original site) R...epresentative DNA sequence >SLC449 (SLC449Q) /CSM/SL/SLC4-C/SLC449Q.Seq.d/ XXXXXXXXXXGTAAAAAGGAACACCAAGCCACT

  12. CouchDB the definitive guide

    Anderson, J; Slater, Noah

    2010-01-01

    Three of CouchDB's creators show you how to use this document-oriented database as a standalone application framework or with high-volume, distributed applications. With its simple model for storing, processing, and accessing data, CouchDB is ideal for web applications that handle huge amounts of loosely structured data. That alone would stretch the limits of a relational database, yet CouchDB offers an open source solution that's reliable, scales easily, and responds quickly. CouchDB works with self-contained data that has loose or ad-hoc connections. It's a model that fits many real-world

  13. Recreation and Leisure. DB-LINK Fact Sheet. Revised.

    Lieberman, Lauren

    This brief guide presents principles and suggestions to help individuals who are deaf-blind enjoy and benefit from participation in recreational activities. Some considerations discussed are to: (1) start with the individual and determine what he or she is interested in, focusing on the selection of safe, age-appropriate activities; (2) research…

  14. Exendin-4 improves resistance to Listeria monocytogenes infection in diabetic db/db mice

    Liu, Hsien Yueh; Chung, Chih-Yao; Yang, Wen-Chin; Liang, Chih-Lung; Wang, Chi-Young; Chang, Chih-Yu; Chang, Cicero Lee-Tian

    2012-01-01

    The incidence of diabetes mellitus is increasing among companion animals. This disease has similar characteristics in both humans and animals. Diabetes is frequently identified as an independent risk factor for infections associated with increased mortality. In the present study, homozygous diabetic (db/db) mice were infected with Listeria (L.) monocytogenes and then treated with the anti-diabetic drug exendin-4, a glucagon-like peptide 1 analogue. In aged db/db mice, decreased CD11b+ macroph...

  15. Portulaca oleracea Ameliorates Diabetic Vascular Inflammation and Endothelial Dysfunction in db/db Mice

    Lee, An Sook; Lee, Yun Jung; Lee, So Min; Yoon, Jung Joo; Kim, Jin Sook; Kang, Dae Gill; Lee, Ho Sub

    2012-01-01

    Type 2 diabetes is associated with significantly accelerated rates of micro- and macrovascular complications such as diabetic vascular inflammation and endothelial dysfunction. In the present study, we investigated the protective effect of the aqueous extract of Portulaca oleracea L. (AP), an edible plant used as a folk medicine, on diabetic vascular complications. The db/db mice were treated with AP (300 mg/kg/day, p.o.) for 10 weeks, and AP treatment markedly lowered blood glucose, plasma triglyceride, plasma level of LDL-cholesterol, and systolic blood pressure in diabetic db/db mice. Furthermore, AP significantly increased plasma level of HDL-cholesterol and insulin level. The impairment of ACh- and SNP-induced vascular relaxation of aortic rings were ameliorated by AP treatment in diabetic db/db mice. This study also showed that overexpression of VCAM-1, ICAM-1, E-selectin, MMP-2, and ET-1 were observed in aortic tissues of untreated db/db mice, which were significantly suppressed by treatment with AP. We also found that the insulin immunoreactivity of the pancreatic islets remarkably increased in AP treated db/db mice compared with untreated db/db mice. Taken together, AP suppresses hyperglycemia and diabetic vascular inflammation, and prevents the development of diabetic endothelial dysfunction for the development of diabetes and its vascular complications. PMID:22474522

  16. Dicty_cDB: VHD492 [Dicty_cDB

    Full Text Available VH (Link to library) VHD492 (Link to dictyBase) - - - Contig-U15308-1 - (Link to Original site) - - VHD492...Z 675 - - - - Show VHD492 Library VH (Link to library) Clone ID VHD492 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHD4-D/VHD492Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHD492 (VHD492Q) /CSM/VH/VHD4-D/VHD492Q.Seq.d/ XXXXXXXXXXCTTCATC...xkiipink Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHD492 (VHD492Q) /CSM/VH/VHD4-D/VHD492

  17. Dicty_cDB: SSD492 [Dicty_cDB

    Full Text Available SS (Link to library) SSD492 (Link to dictyBase) - - - Contig-U11368-1 SSD492E (Link... to Original site) - - - - - - SSD492E 768 Show SSD492 Library SS (Link to library) Clone ID SSD492 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSD4-D/SSD492Q.Seq.d/ Representative seq. ID SSD492...E (Link to Original site) Representative DNA sequence >SSD492 (SSD492Q) /CSM/SS/SSD4-D/SSD492Q.Seq.d/ CTGAA...nificant alignments: (bits) Value SSD492 (SSD492Q) /CSM/SS/SSD4-D/SSD492Q.Seq.d/ 1481 0.0 AHH144 (AHH144Q) /

  18. Dicty_cDB: CHD492 [Dicty_cDB

    Full Text Available CH (Link to library) CHD492 (Link to dictyBase) - - - - CHD492P (Link to Original site) CHD492F 531 CHD492...Z 728 CHD492P 1239 - - Show CHD492 Library CH (Link to library) Clone ID CHD492 (Link...sukuba.ac.jp/CSM/CH/CHD4-D/CHD492Q.Seq.d/ Representative seq. ID CHD492P (Link to... Original site) Representative DNA sequence >CHD492 (CHD492Q) /CSM/CH/CHD4-D/CHD492Q.Seq.d/ ATATACAATTTAATTT...A Score E Sequences producing significant alignments: (bits) Value CHD492 (CHD492Q) /CSM/CH/CHD4-D/CHD492

  19. Dicty_cDB: SLH220 [Dicty_cDB

    Full Text Available SL (Link to library) SLH220 (Link to dictyBase) - - - Contig-U15409-1 SLH220F (Link to Original site) SLH2...20F 510 - - - - - - Show SLH220 Library SL (Link to library) Clone ID SLH220 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH220Q.Seq.d/ Representative seq. ID SLH22...0F (Link to Original site) Representative DNA sequence >SLH220 (SLH220Q) /CSM/SL/SLH2-A/SLH220Q.Seq.d/ GAAGA...gnificant alignments: (bits) Value SLH220 (SLH220Q) /CSM/SL/SLH2-A/SLH220Q.Seq.d/

  20. Dicty_cDB: SLH286 [Dicty_cDB

    Full Text Available SL (Link to library) SLH286 (Link to dictyBase) - - - Contig-U16366-1 SLH286Z (Link... to Original site) - - SLH286Z 386 - - - - Show SLH286 Library SL (Link to library) Clone ID SLH286 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH286Q.Seq.d/ Representative seq. ID SLH28...6Z (Link to Original site) Representative DNA sequence >SLH286 (SLH286Q) /CSM/SL/SLH2-D/SLH286Q.Seq.d/ XXXXX...Seq.d/ 646 0.0 SLK513 (SLK513Q) /CSM/SL/SLK5-A/SLK513Q.Seq.d/ 646 0.0 SLI160 (SLI160Q) /CSM/SL/SLI1-C/SLI160Q.Seq.d/ 646 0.0 SLH2

  1. Dicty_cDB: SLH242 [Dicty_cDB

    Full Text Available SL (Link to library) SLH242 (Link to dictyBase) - - - Contig-U16343-1 SLH242Z (Link... to Original site) - - SLH242Z 476 - - - - Show SLH242 Library SL (Link to library) Clone ID SLH242 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH242Q.Seq.d/ Representative seq. ID SLH24...2Z (Link to Original site) Representative DNA sequence >SLH242 (SLH242Q) /CSM/SL/SLH2-B/SLH242Q.Seq.d/ XXXXX...d/ 910 0.0 SLI231 (SLI231Q) /CSM/SL/SLI2-B/SLI231Q.Seq.d/ 910 0.0 SLH242 (SLH242Q) /CSM/SL/SLH2-B/SLH2

  2. Dicty_cDB: SLH226 [Dicty_cDB

    Full Text Available SL (Link to library) SLH226 (Link to dictyBase) - - - Contig-U16444-1 SLH226Z (Link... to Original site) - - SLH226Z 516 - - - - Show SLH226 Library SL (Link to library) Clone ID SLH226 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH226Q.Seq.d/ Representative seq. ID SLH22...6Z (Link to Original site) Representative DNA sequence >SLH226 (SLH226Q) /CSM/SL/SLH2-B/SLH226Q.Seq.d/ XXXXX...4.0 %: peroxisomal >> prediction for SLH226 is cyt 5' end seq. ID - 5' end seq. - Length of 5' end seq. - 3' end seq. ID SLH2

  3. Dicty_cDB: SLH296 [Dicty_cDB

    Full Text Available SL (Link to library) SLH296 (Link to dictyBase) - - - Contig-U16382-1 SLH296F (Link to Original site) SLH2...96F 539 - - - - - - Show SLH296 Library SL (Link to library) Clone ID SLH296 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH296Q.Seq.d/ Representative seq. ID SLH29...6F (Link to Original site) Representative DNA sequence >SLH296 (SLH296Q) /CSM/SL/SLH2-D/SLH296Q.Seq.d/ GGACG...ete cDNA clone:FC-AV1... 1068 0.0 1 ( AU062036 ) Dictyostelium discoideum slug cDNA, clone SLH296. 1068 0.0

  4. Dicty_cDB: SLH224 [Dicty_cDB

    Full Text Available SL (Link to library) SLH224 (Link to dictyBase) - - - Contig-U16287-1 SLH224F (Link to Original site) SLH2...24F 565 - - - - - - Show SLH224 Library SL (Link to library) Clone ID SLH224 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH224Q.Seq.d/ Representative seq. ID SLH22...4F (Link to Original site) Representative DNA sequence >SLH224 (SLH224Q) /CSM/SL/SLH2-A/SLH224Q.Seq.d/ AAAAA.../SS/SSF8-A/SSF805Q.Seq.d/ 1033 0.0 SLH288 (SLH288Q) /CSM/SL/SLH2-D/SLH288Q.Seq.d/ 1033 0.0 SLH224 (SLH224Q) /CSM/SL/SLH2-A/SLH2

  5. Dicty_cDB: SLH287 [Dicty_cDB

    Full Text Available SL (Link to library) SLH287 (Link to dictyBase) - - - Contig-U16243-1 SLH287Z (Link... to Original site) - - SLH287Z 614 - - - - Show SLH287 Library SL (Link to library) Clone ID SLH287 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH287Q.Seq.d/ Representative seq. ID SLH28...7Z (Link to Original site) Representative DNA sequence >SLH287 (SLH287Q) /CSM/SL/SLH2-D/SLH287Q.Seq.d/ XXXXX...6Q) /CSM/SS/SSJ6-B/SSJ636Q.Seq.d/ 1217 0.0 SLH575 (SLH575Q) /CSM/SL/SLH5-D/SLH575Q.Seq.d/ 1217 0.0 SLH287 (SLH287Q) /CSM/SL/SLH2

  6. Dicty_cDB: SLH245 [Dicty_cDB

    Full Text Available SL (Link to library) SLH245 (Link to dictyBase) - - - Contig-U01321-1 SLH245F (Link to Original site) SLH2...45F 294 - - - - - - Show SLH245 Library SL (Link to library) Clone ID SLH245 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH245Q.Seq.d/ Representative seq. ID SLH24...5F (Link to Original site) Representative DNA sequence >SLH245 (SLH245Q) /CSM/SL/SLH2-B/SLH245Q.Seq.d/ CACCA...significant alignments: (bits) Value SLH245 (SLH245Q) /CSM/SL/SLH2-B/SLH245Q.Seq.d/ 513 e-145 SLF841 (SLF841

  7. Dicty_cDB: SLH275 [Dicty_cDB

    Full Text Available SL (Link to library) SLH275 (Link to dictyBase) - - - Contig-U16280-1 SLH275Z (Link... to Original site) - - SLH275Z 543 - - - - Show SLH275 Library SL (Link to library) Clone ID SLH275 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH275Q.Seq.d/ Representative seq. ID SLH27...5Z (Link to Original site) Representative DNA sequence >SLH275 (SLH275Q) /CSM/SL/SLH2-D/SLH275Q.Seq.d/ XXXXX...ignificant alignments: (bits) Value SLH275 (SLH275Q) /CSM/SL/SLH2-D/SLH275Q.Seq.d/ 1076 0.0 SLH850 (SLH850Q)

  8. Dicty_cDB: SLH229 [Dicty_cDB

    Full Text Available SL (Link to library) SLH229 (Link to dictyBase) - - - Contig-U15799-1 SLH229Z (Link... to Original site) - - SLH229Z 269 - - - - Show SLH229 Library SL (Link to library) Clone ID SLH229 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH229Q.Seq.d/ Representative seq. ID SLH22...9Z (Link to Original site) Representative DNA sequence >SLH229 (SLH229Q) /CSM/SL/SLH2-B/SLH229Q.Seq.d/ XXXXX...E Sequences producing significant alignments: (bits) Value SLH229 (SLH229Q) /CSM/SL/SLH2-B/SLH2

  9. Dicty_cDB: SLH247 [Dicty_cDB

    Full Text Available SL (Link to library) SLH247 (Link to dictyBase) - - - Contig-U16280-1 SLH247Z (Link... to Original site) - - SLH247Z 632 - - - - Show SLH247 Library SL (Link to library) Clone ID SLH247 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH247Q.Seq.d/ Representative seq. ID SLH24...7Z (Link to Original site) Representative DNA sequence >SLH247 (SLH247Q) /CSM/SL/SLH2-B/SLH247Q.Seq.d/ XXXXX...ant alignments: (bits) Value SLH247 (SLH247Q) /CSM/SL/SLH2-B/SLH247Q.Seq.d/ 1253 0.0 SLA487 (SLA487Q) /CSM/S

  10. Dicty_cDB: SLH256 [Dicty_cDB

    Full Text Available SL (Link to library) SLH256 (Link to dictyBase) - - - Contig-U12223-1 SLH256F (Link to Original site) SLH2...56F 399 - - - - - - Show SLH256 Library SL (Link to library) Clone ID SLH256 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-C/SLH256Q.Seq.d/ Representative seq. ID SLH25...6F (Link to Original site) Representative DNA sequence >SLH256 (SLH256Q) /CSM/SL/SLH2-C/SLH256Q.Seq.d/ CAGAA...SL/SLJ5-A/SLJ523Q.Seq.d/ 444 e-124 SLH256 (SLH256Q) /CSM/SL/SLH2-C/SLH256Q.Seq.d/ 444 e-124 SSK705 (SSK705Q)

  11. Dicty_cDB: SLH290 [Dicty_cDB

    Full Text Available SL (Link to library) SLH290 (Link to dictyBase) - - - Contig-U16510-1 SLH290Z (Link... to Original site) - - SLH290Z 412 - - - - Show SLH290 Library SL (Link to library) Clone ID SLH290 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH290Q.Seq.d/ Representative seq. ID SLH29...0Z (Link to Original site) Representative DNA sequence >SLH290 (SLH290Q) /CSM/SL/SLH2-D/SLH290Q.Seq.d/ XXXXX...%: peroxisomal >> prediction for SLH290 is mit 5' end seq. ID - 5' end seq. - Length of 5' end seq. - 3' end seq. ID SLH2

  12. Dicty_cDB: SLH234 [Dicty_cDB

    Full Text Available SL (Link to library) SLH234 (Link to dictyBase) - - - Contig-U08154-1 SLH234F (Link to Original site) SLH2...34F 535 - - - - - - Show SLH234 Library SL (Link to library) Clone ID SLH234 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH234Q.Seq.d/ Representative seq. ID SLH23...4F (Link to Original site) Representative DNA sequence >SLH234 (SLH234Q) /CSM/SL/SLH2-B/SLH234Q.Seq.d/ ACAAA...DCTTV--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLH2

  13. Dicty_cDB: SLH211 [Dicty_cDB

    Full Text Available SL (Link to library) SLH211 (Link to dictyBase) - - - Contig-U16162-1 SLH211Z (Link... to Original site) - - SLH211Z 427 - - - - Show SLH211 Library SL (Link to library) Clone ID SLH211 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH211Q.Seq.d/ Representative seq. ID SLH21...1Z (Link to Original site) Representative DNA sequence >SLH211 (SLH211Q) /CSM/SL/SLH2-A/SLH211Q.Seq.d/ XXXXX...equences producing significant alignments: (bits) Value SLI277 (SLI277Q) /CSM/SL/SLI2-D/SLI277Q.Seq.d/ 767 0.0 SLH211 (SLH2

  14. Dicty_cDB: SLH285 [Dicty_cDB

    Full Text Available SL (Link to library) SLH285 (Link to dictyBase) - - - Contig-U16287-1 SLH285F (Link to Original site) SLH2...85F 326 - - - - - - Show SLH285 Library SL (Link to library) Clone ID SLH285 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH285Q.Seq.d/ Representative seq. ID SLH28...5F (Link to Original site) Representative DNA sequence >SLH285 (SLH285Q) /CSM/SL/SLH2-D/SLH285Q.Seq.d/ AAAAA...ue SSF805 (SSF805Q) /CSM/SS/SSF8-A/SSF805Q.Seq.d/ 617 e-176 SLH288 (SLH288Q) /CSM/SL/SLH2-D/SLH288Q.Seq.d/ 617 e-176 SLH285 (SLH2

  15. Dicty_cDB: SLH204 [Dicty_cDB

    Full Text Available SL (Link to library) SLH204 (Link to dictyBase) - - - Contig-U15479-1 SLH204Z (Link... to Original site) - - SLH204Z 657 - - - - Show SLH204 Library SL (Link to library) Clone ID SLH204 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH204Q.Seq.d/ Representative seq. ID SLH20...4Z (Link to Original site) Representative DNA sequence >SLH204 (SLH204Q) /CSM/SL/SLH2-A/SLH204Q.Seq.d/ XXXXX...g significant alignments: (bits) Value N ( AU039226 ) Dictyostelium discoideum slug cDNA, clone SLH204. 930

  16. Dicty_cDB: SLH202 [Dicty_cDB

    Full Text Available SL (Link to library) SLH202 (Link to dictyBase) - - - Contig-U07944-1 SLH202F (Link to Original site) SLH2...02F 172 - - - - - - Show SLH202 Library SL (Link to library) Clone ID SLH202 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH202Q.Seq.d/ Representative seq. ID SLH20...2F (Link to Original site) Representative DNA sequence >SLH202 (SLH202Q) /CSM/SL/SLH2-A/SLH202Q.Seq.d/ CATTC...%: nuclear 12.0 %: mitochondrial 8.0 %: cytoskeletal 4.0 %: peroxisomal >> prediction for SLH202 is cyt 5' end seq. ID SLH2

  17. Dicty_cDB: SLH222 [Dicty_cDB

    Full Text Available SL (Link to library) SLH222 (Link to dictyBase) - - - Contig-U16475-1 SLH222Z (Link... to Original site) - - SLH222Z 433 - - - - Show SLH222 Library SL (Link to library) Clone ID SLH222 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH222Q.Seq.d/ Representative seq. ID SLH22...2Z (Link to Original site) Representative DNA sequence >SLH222 (SLH222Q) /CSM/SL/SLH2-A/SLH222Q.Seq.d/ XXXXX...603Q.Seq.d/ 728 0.0 SLI537 (SLI537Q) /CSM/SL/SLI5-B/SLI537Q.Seq.d/ 728 0.0 SLH222 (SLH222Q) /CSM/SL/SLH2

  18. Dicty_cDB: SLH218 [Dicty_cDB

    Full Text Available SL (Link to library) SLH218 (Link to dictyBase) - - - Contig-U16325-1 SLH218F (Link to Original site) SLH2...18F 419 - - - - - - Show SLH218 Library SL (Link to library) Clone ID SLH218 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH218Q.Seq.d/ Representative seq. ID SLH21...8F (Link to Original site) Representative DNA sequence >SLH218 (SLH218Q) /CSM/SL/SLH2-A/SLH218Q.Seq.d/ CCATG...) /CSM/SL/SLI3-C/SLI370Q.Seq.d/ 831 0.0 SLI170 (SLI170Q) /CSM/SL/SLI1-C/SLI170Q.Seq.d/ 831 0.0 SLH218 (SLH218Q) /CSM/SL/SLH2-A/SLH2

  19. Dicty_cDB: SLH231 [Dicty_cDB

    Full Text Available SL (Link to library) SLH231 (Link to dictyBase) - - - Contig-U16382-1 SLH231F (Link to Original site) SLH2...31F 431 - - - - - - Show SLH231 Library SL (Link to library) Clone ID SLH231 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH231Q.Seq.d/ Representative seq. ID SLH23...1F (Link to Original site) Representative DNA sequence >SLH231 (SLH231Q) /CSM/SL/SLH2-B/SLH231Q.Seq.d/ AAAAA...Score E Sequences producing significant alignments: (bits) Value SLH231 (SLH231Q) /CSM/SL/SLH2-B/SLH231Q.Seq

  20. Dicty_cDB: SLH241 [Dicty_cDB

    Full Text Available SL (Link to library) SLH241 (Link to dictyBase) - - - Contig-U15835-1 SLH241E (Link... to Original site) - - - - - - SLH241E 371 Show SLH241 Library SL (Link to library) Clone ID SLH241 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH241Q.Seq.d/ Representative seq. ID SLH24...1E (Link to Original site) Representative DNA sequence >SLH241 (SLH241Q) /CSM/SL/SLH2-B/SLH241Q.Seq.d/ GAAGT....Seq.d/ 638 0.0 VFE160 (VFE160Q) /CSM/VF/VFE1-C/VFE160Q.Seq.d/ 638 0.0 SLH241 (SLH241Q) /CSM/SL/SLH2-B/SLH24

  1. Dicty_cDB: SLH265 [Dicty_cDB

    Full Text Available SL (Link to library) SLH265 (Link to dictyBase) - - - Contig-U13901-1 SLH265Z (Link... to Original site) - - SLH265Z 631 - - - - Show SLH265 Library SL (Link to library) Clone ID SLH265 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-C/SLH265Q.Seq.d/ Representative seq. ID SLH26...5Z (Link to Original site) Representative DNA sequence >SLH265 (SLH265Q) /CSM/SL/SLH2-C/SLH265Q.Seq.d/ XXXXX... alignments: (bits) Value SLH265 (SLH265Q) /CSM/SL/SLH2-C/SLH265Q.Seq.d/ 1059 0.0 VFL442 (VFL442Q) /CSM/VF/V

  2. Dicty_cDB: SLH278 [Dicty_cDB

    Full Text Available SL (Link to library) SLH278 (Link to dictyBase) - - - Contig-U16382-1 SLH278Z (Link... to Original site) - - SLH278Z 528 - - - - Show SLH278 Library SL (Link to library) Clone ID SLH278 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH278Q.Seq.d/ Representative seq. ID SLH27...8Z (Link to Original site) Representative DNA sequence >SLH278 (SLH278Q) /CSM/SL/SLH2-D/SLH278Q.Seq.d/ XXXXX...75 (SLH375Q) /CSM/SL/SLH3-D/SLH375Q.Seq.d/ 1047 0.0 SLH278 (SLH278Q) /CSM/SL/SLH2-D/SLH278Q.Seq.d/ 1047 0.0

  3. Dicty_cDB: SLH294 [Dicty_cDB

    Full Text Available SL (Link to library) SLH294 (Link to dictyBase) - - - Contig-U16466-1 SLH294E (Link... to Original site) - - - - - - SLH294E 393 Show SLH294 Library SL (Link to library) Clone ID SLH294 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH294Q.Seq.d/ Representative seq. ID SLH29...4E (Link to Original site) Representative DNA sequence >SLH294 (SLH294Q) /CSM/SL/SLH2-D/SLH294Q.Seq.d/ CGATA...stelium discoideum slug cDNA, clone SLH294. 666 0.0 1 ( AU034499 ) Dictyostelium discoideum slug cDNA, clone

  4. Dicty_cDB: SLH214 [Dicty_cDB

    Full Text Available SL (Link to library) SLH214 (Link to dictyBase) - - - Contig-U16455-1 SLH214E (Link... to Original site) - - - - - - SLH214E 308 Show SLH214 Library SL (Link to library) Clone ID SLH214 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH214Q.Seq.d/ Representative seq. ID SLH21...4E (Link to Original site) Representative DNA sequence >SLH214 (SLH214Q) /CSM/SL/SLH2-A/SLH214Q.Seq.d/ GTTGA...a: 0.00 m3b: 0.00 m_ : 1.00 48.0 %: nuclear 28.0 %: mitochondrial 20.0 %: cytoplasmic 4.0 %: peroxisomal >> prediction for SLH2

  5. Dicty_cDB: SLH201 [Dicty_cDB

    Full Text Available SL (Link to library) SLH201 (Link to dictyBase) - - - Contig-U14690-1 SLH201F (Link to Original site) SLH2...01F 395 - - - - - - Show SLH201 Library SL (Link to library) Clone ID SLH201 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH201Q.Seq.d/ Representative seq. ID SLH20...1F (Link to Original site) Representative DNA sequence >SLH201 (SLH201Q) /CSM/SL/SLH2-A/SLH201Q.Seq.d/ CACCA...M/SL/SLH4-C/SLH463Q.Seq.d/ 718 0.0 SLH201 (SLH201Q) /CSM/SL/SLH2-A/SLH201Q.Seq.d/ 718 0.0 SSF514 (SSF514Q) /

  6. Dicty_cDB: SLH264 [Dicty_cDB

    Full Text Available SL (Link to library) SLH264 (Link to dictyBase) - - - Contig-U16382-1 SLH264Z (Link... to Original site) - - SLH264Z 532 - - - - Show SLH264 Library SL (Link to library) Clone ID SLH264 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-C/SLH264Q.Seq.d/ Representative seq. ID SLH26...4Z (Link to Original site) Representative DNA sequence >SLH264 (SLH264Q) /CSM/SL/SLH2-C/SLH264Q.Seq.d/ XXXXX...g significant alignments: (bits) Value N ( AU039244 ) Dictyostelium discoideum slug cDNA, clone SLH2

  7. Dicty_cDB: SLH223 [Dicty_cDB

    Full Text Available SL (Link to library) SLH223 (Link to dictyBase) - - - Contig-U16450-1 SLH223Z (Link... to Original site) - - SLH223Z 404 - - - - Show SLH223 Library SL (Link to library) Clone ID SLH223 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH223Q.Seq.d/ Representative seq. ID SLH22...3Z (Link to Original site) Representative DNA sequence >SLH223 (SLH223Q) /CSM/SL/SLH2-A/SLH223Q.Seq.d/ XXXXX...logy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLH223 (SLH2

  8. Dicty_cDB: SLH221 [Dicty_cDB

    Full Text Available SL (Link to library) SLH221 (Link to dictyBase) - - - Contig-U16381-1 SLH221Z (Link... to Original site) - - SLH221Z 595 - - - - Show SLH221 Library SL (Link to library) Clone ID SLH221 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH221Q.Seq.d/ Representative seq. ID SLH22...1Z (Link to Original site) Representative DNA sequence >SLH221 (SLH221Q) /CSM/SL/SLH2-A/SLH221Q.Seq.d/ XXXXX...LH722 (SLH722Q) /CSM/SL/SLH7-A/SLH722Q.Seq.d/ 559 e-158 SLH221 (SLH221Q) /CSM/SL/SLH2-A/SLH221Q.Seq.d/ 559 e

  9. Dicty_cDB: SLH203 [Dicty_cDB

    Full Text Available SL (Link to library) SLH203 (Link to dictyBase) - - - Contig-U10734-1 SLH203Z (Link... to Original site) - - SLH203Z 683 - - - - Show SLH203 Library SL (Link to library) Clone ID SLH203 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH203Q.Seq.d/ Representative seq. ID SLH20...3Z (Link to Original site) Representative DNA sequence >SLH203 (SLH203Q) /CSM/SL/SLH2-A/SLH203Q.Seq.d/ XXXXX...ing significant alignments: (bits) Value SLH203 (SLH203Q) /CSM/SL/SLH2-A/SLH203Q.

  10. Dicty_cDB: SSJ388 [Dicty_cDB

    Full Text Available SS (Link to library) SSJ388 (Link to dictyBase) - G21078 DDB0216180 - SSJ388E (Link... to Original site) - - - - - - SSJ388E 214 Show SSJ388 Library SS (Link to library) Clone ID SSJ388 (Link to dict...yBase) Atlas ID - NBRP ID G21078 dictyBase ID DDB0216180 Link to Contig - Original site URL http://dict...ieces. 42 3.0 1 CK410479 |CK410479.1 AUF_IpHdk_43_c04 Head kidney cDNA library Ictalurus punctatus cDNA 5' s...0 %: cytoplasmic 28.0 %: nuclear 8.0 %: mitochondrial 4.0 %: peroxisomal >> prediction for SSJ388 is cyt 5'

  11. Dicty_cDB: SSH414 [Dicty_cDB

    Full Text Available SS (Link to library) SSH414 (Link to dictyBase) - - - Contig-U16581-1 SSH414Z (Link... to Original site) - - SSH414Z 448 - - - - Show SSH414 Library SS (Link to library) Clone ID SSH414 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...ogy vs DNA Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium... SAMPLING. 44 1.7 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ict

  12. Dicty_cDB: VFH244 [Dicty_cDB

    Full Text Available VF (Link to library) VFH244 (Link to dictyBase) - - - - VFH244F (Link to Original s...ite) VFH244F 594 - - - - - - Show VFH244 Library VF (Link to library) Clone ID VFH244 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...mology vs DNA Score E Sequences producing significant alignments: (bits) Value N U36937 |U36937.1 Dictyostel...is centranthoides cDNA clone hj81f04, mRNA sequence. 36 3e-04 3 AY342298 |AY342298.1 Ictalurus punctatus ER-

  13. Dicty_cDB: SSF210 [Dicty_cDB

    Full Text Available SS (Link to library) SSF210 (Link to dictyBase) - - - Contig-U16581-1 SSF210P (Link... to Original site) SSF210F 183 SSF210Z 197 SSF210P 380 - - Show SSF210 Library SS (Link to library) Clone ID SSF210 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...nt alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum mRNA. 339...01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ictacalcin, mRNA s

  14. Dicty_cDB: VFI196 [Dicty_cDB

    Full Text Available VF (Link to library) VFI196 (Link to dictyBase) - - - Contig-U16512-1 - (Link to Or...iginal site) - - VFI196Z 168 - - - - Show VFI196 Library VF (Link to library) Clone ID VFI196 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16512-1 Original site URL http://dictycdb.b...ces. 40 8.8 1 CK407044 |CK407044.1 AUF_IfLvr_212_p04 Ictalurus furcatus liver cDNA library Ictalurus furcatu...%: nuclear 36.0 %: mitochondrial 16.0 %: cytoplasmic 4.0 %: cytoskeletal >> prediction for VFI196 is nuc 5'

  15. Dicty_cDB: VHE867 [Dicty_cDB

    Full Text Available VH (Link to library) VHE867 (Link to dictyBase) - G02701 DDB0204977 Contig-U14789-1... - (Link to Original site) VHE867F 383 - - - - - - Show VHE867 Library VH (Link to library) Clone ID VHE867 (Link to dict...yBase) Atlas ID - NBRP ID G02701 dictyBase ID DDB0204977 Link to Contig Contig-U14789-1 Original site URL http://dict...one) Salmo salar clone ssal-rgb2-599-16... 116 2e-25 DQ363469_1( DQ363469 |pid:none) Ict...m_ : 1.00 40.0 %: cytoplasmic 36.0 %: nuclear 12.0 %: cytoskeletal 8.0 %: mitochondrial 4.0 %: peroxisomal >> predict

  16. Dicty_cDB: SSD571 [Dicty_cDB

    Full Text Available SS (Link to library) SSD571 (Link to dictyBase) - - - Contig-U16581-1 SSD571Z (Link... to Original site) - - SSD571Z 415 - - - - Show SSD571 Library SS (Link to library) Clone ID SSD571 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...omology vs DNA Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dict...Brassica oleracea genomic clone BONRK12, DNA sequence. 50 0.025 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ict

  17. Dicty_cDB: AFF681 [Dicty_cDB

    Full Text Available AF (Link to library) AFF681 (Link to dictyBase) - - - - AFF681P (Link to Original s...ite) AFF681F 592 AFF681Z 173 AFF681P 765 - - Show AFF681 Library AF (Link to library) Clone ID AFF681 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.ts....0 own update 2004.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N U36937 |U36937.1 Dict... 36 7e-04 3 AY342298 |AY342298.1 Ictalurus punctatus ER-resident chaperone calreticulin mRNA, complete cds.

  18. Dicty_cDB: VHO349 [Dicty_cDB

    Full Text Available VH (Link to library) VHO349 (Link to dictyBase) - - - Contig-U11939-1 - (Link to Or...iginal site) - - VHO349Z 412 - - - - Show VHO349 Library VH (Link to library) Clone ID VHO349 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11939-1 Original site URL http://dictycdb.b...4 |CK424794.1 AUF_IpSto_12_h11 Stomach cDNA library Ictalurus punctatus cDNA 5', mRNA sequence. 42 6.1 1 dna...ial 8.0 %: Golgi 4.0 %: vesicles of secretory system >> prediction for VHO349 is

  19. Dicty_cDB: SFF154 [Dicty_cDB

    Full Text Available SF (Link to library) SFF154 (Link to dictyBase) - - - Contig-U15074-1 SFF154P (Link... to Original site) SFF154F 132 SFF154Z 514 SFF154P 646 - - Show SFF154 Library SF (Link to library) Clone ID SFF154 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15074-1 Original site URL http://dict...22, genomic survey sequence. 48 3e-09 3 AC116921 |AC116921.2 Dictyostelium discoi...deum chromosome 2 map 4624505-4657775 strain AX4, complete sequence. 44 4e-09 7 BQ096682 |BQ096682.1 IfHdk00151 Ict

  20. Dicty_cDB: CFH521 [Dicty_cDB

    Full Text Available CF (Link to library) CFH521 (Link to dictyBase) - - - Contig-U16381-1 - (Link to Or...iginal site) CFH521F 134 - - - - - - Show CFH521 Library CF (Link to library) Clone ID CFH521 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dictycdb.b...mology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC115685 |AC115685.1 Dict.... 82 2e-29 3 X51892 |X51892.1 Dictyostelium discoideum SP60 gene for spore coat protein. 82 4e-29 2 X52105 |X52105.1 Dict

  1. Dicty_cDB: CFH244 [Dicty_cDB

    Full Text Available CF (Link to library) CFH244 (Link to dictyBase) - - - Contig-U16381-1 CFH244F (Link... to Original site) CFH244F 124 - - - - - - Show CFH244 Library CF (Link to library) Clone ID CFH244 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict...ts) Value N AC115685 |AC115685.1 Dictyostelium discoideum chromosome 2 map 4718821-4752388 strain AX4, compl...ete sequence. 82 2e-29 3 X51892 |X51892.1 Dictyostelium discoideum SP60 gene for spore coat protein. 82 4e-29 2 X52105 |X52105.1 Dict

  2. Dicty_cDB: SSK552 [Dicty_cDB

    Full Text Available SS (Link to library) SSK552 (Link to dictyBase) - - - Contig-U04708-1 SSK552Z (Link... to Original site) - - SSK552Z 713 - - - - Show SSK552 Library SS (Link to library) Clone ID SSK552 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04708-1 Original site URL http://dict...equence. 40 0.26 5 BM029272 |BM029272.1 IpSkn00291 Skin cDNA library Ictalurus pu...0 m3a: 0.00 m3b: 0.00 m_ : 1.00 76.0 %: nuclear 20.0 %: cytoplasmic 4.0 %: plasma membrane >> prediction for

  3. Dicty_cDB: SSG335 [Dicty_cDB

    Full Text Available SS (Link to library) SSG335 (Link to dictyBase) - - - Contig-U16509-1 SSG335F (Link... to Original site) SSG335F 200 - - - - - - Show SSG335 Library SS (Link to library) Clone ID SSG335 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16509-1 Original site URL http://dict...y vs DNA Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium d...iscoideum mRNA. 64 1e-17 2 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Icta

  4. Dicty_cDB: CFE801 [Dicty_cDB

    Full Text Available CF (Link to library) CFE801 (Link to dictyBase) - - - Contig-U12894-1 CFE801Z (Link... to Original site) - - CFE801Z 690 - - - - Show CFE801 Library CF (Link to library) Clone ID CFE801 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12894-1 Original site URL http://dict...6e1 5', mRNA sequence. 36 5.4 2 CK426247 |CK426247.1 AUF_IpTes_24_l09 Testis cDNA library Ict...A26838 )prestalk protein precursor - slime mold (Dictyoste... 66 9e-10 AC117072_6

  5. Dicty_cDB: AFJ817 [Dicty_cDB

    Full Text Available AF (Link to library) AFJ817 (Link to dictyBase) - - - Contig-U15574-1 AFJ817F (Link... to Original site) AFJ817F 172 - - - - - - Show AFJ817 Library AF (Link to library) Clone ID AFJ817 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15574-1 Original site URL http://dict...alue N AC116920 |AC116920.2 Dictyostelium discoideum chromosome 2 map 3879572-4071762 strain AX4, complete s...es. 42 1.1 2 BE213059 |BE213059.1 IpBrn01690 Brain cDNA library Ictalurus punctatus cDNA 5', mRNA sequence.

  6. Dicty_cDB: SSG316 [Dicty_cDB

    Full Text Available SS (Link to library) SSG316 (Link to dictyBase) - - - Contig-U16509-1 SSG316F (Link... to Original site) SSG316F 231 - - - - - - Show SSG316 Library SS (Link to library) Clone ID SSG316 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16509-1 Original site URL http://dict...g significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideu...m mRNA. 64 3e-12 2 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ict

  7. Dicty_cDB: SLB690 [Dicty_cDB

    Full Text Available r Dp87... 45 9e-04 AC117267_7( AC117267 |pid:none) Dictyostelium discoideum chromosom... 40 0.037 AY574051_1( AY574051 |pid:none) Ict...SL (Link to library) SLB690 (Link to dictyBase) - - - Contig-U16325-1 SLB690Z (Link... to Original site) - - SLB690Z 481 - - - - Show SLB690 Library SL (Link to library) Clone ID SLB690 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16325-1 Original site URL http://dict...t alignments: (bits) Value N ( AF066071 ) Dictyostelium discoideum SP85 (pspB) gene, comple... 831 0.0 1 ( AC117075 ) Dict

  8. Dicty_cDB: AFF235 [Dicty_cDB

    Full Text Available AF (Link to library) AFF235 (Link to dictyBase) - - - - AFF235F (Link to Original s...ite) AFF235F 602 - - - - - - Show AFF235 Library AF (Link to library) Clone ID AFF235 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...date 2001.11.24 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N U36937 |U36937.1 Dict... 3 CK420742 |CK420742.1 AUF_IpTrk_27_j08 Trunk kidney cDNA library Ictalurus punctatus cDNA 5' similar to ER

  9. Dicty_cDB: AHA115 [Dicty_cDB

    Full Text Available AH (Link to library) AHA115 (Link to dictyBase) - - - - - (Link to Original site) A...HA115F 669 - - - - - - Show AHA115 Library AH (Link to library) Clone ID AHA115 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AH/AHA...(bits) Value N U36937 |U36937.1 Dictyostelium discoideum calreticulin mRNA, complete cds. 1243 0.0 2 BD24838... 7e-04 1 CK420742 |CK420742.1 AUF_IpTrk_27_j08 Trunk kidney cDNA library Ictalurus punctatus cDNA 5' similar

  10. Dicty_cDB: CHP827 [Dicty_cDB

    Full Text Available CH (Link to library) CHP827 (Link to dictyBase) - - - Contig-U15898-1 - (Link to Or...iginal site) CHP827F 148 - - - - - - Show CHP827 Library CH (Link to library) Clone ID CHP827 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15898-1 Original site URL http://dictycdb.b...ments: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map 2567470-3108875 strain ...18q21 clone:RP11-866E20, WORKING DRAFT SEQUENCE, 18 unordered pieces. 42 0.073 4 CK406764 |CK406764.1 AUF_IfLvr_212_c09 Ict

  11. Dicty_cDB: VFH121 [Dicty_cDB

    Full Text Available VF (Link to library) VFH121 (Link to dictyBase) - - - - VFH121P (Link to Original s...ite) VFH121F 632 VFH121Z 144 VFH121P 776 - - Show VFH121 Library VF (Link to library) Clone ID VFH121 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.ts...nificant alignments: (bits) Value N U36937 |U36937.1 Dictyostelium discoideum calreticulin mRNA, complete cd...es cDNA clone hj81f04, mRNA sequence. 36 7e-04 3 CB937139 |CB937139.1 IpCGJx13_12_E07_23 IpCGJx13 Ictalurus

  12. Dicty_cDB: SSJ546 [Dicty_cDB

    Full Text Available SS (Link to library) SSJ546 (Link to dictyBase) - - - Contig-U16581-1 SSJ546F (Link... to Original site) SSJ546F 445 - - - - - - Show SSJ546 Library SS (Link to library) Clone ID SSJ546 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...DNA Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoi...2, DNA sequence. 50 0.027 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ict

  13. Dicty_cDB: AFI444 [Dicty_cDB

    Full Text Available AF (Link to library) AFI444 (Link to dictyBase) - - - Contig-U16560-1 AFI444Z (Link... to Original site) - - AFI444Z 326 - - - - Show AFI444 Library AF (Link to library) Clone ID AFI444 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16560-1 Original site URL http://dict...e ... 109 2e-36 B27806( B27806 ) ubiquitin (clone lambda229) - slime mold (Dictyo...s... 109 2e-36 A27806( A27806 ) polyubiquitin 5 (clone pLK229) - slime mold (Dict... 109 6e-36 M19666_1( M19

  14. Dicty_cDB: SSE436 [Dicty_cDB

    Full Text Available SS (Link to library) SSE436 (Link to dictyBase) - - - Contig-U16509-1 SSE436P (Link... to Original site) SSE436F 222 SSE436Z 178 SSE436P 400 - - Show SSE436 Library SS (Link to library) Clone ID SSE436 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16509-1 Original site URL http://dict...Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dict...EQUENCING IN PROGRESS ***, 5 unordered pieces. 42 0.13 3 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ict

  15. Dicty_cDB: VFH167 [Dicty_cDB

    Full Text Available VF (Link to library) VFH167 (Link to dictyBase) - - - Contig-U16272-1 VFH167P (Link... to Original site) VFH167F 641 VFH167Z 348 VFH167P 989 - - Show VFH167 Library VF (Link to library) Clone ID VFH167 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...omology vs DNA Score E Sequences producing significant alignments: (bits) Value N L08391 |L08391.1 Dictyoste...) Homo sapiens cDNA FLJ35376 fis, cl... 320 5e-86 AF401554_1( AF401554 |pid:none) Ictalurus punctatus riboso

  16. Dicty_cDB: SSG639 [Dicty_cDB

    Full Text Available SS (Link to library) SSG639 (Link to dictyBase) - - - Contig-U15105-1 SSG639Z (Link... to Original site) - - SSG639Z 636 - - - - Show SSG639 Library SS (Link to library) Clone ID SSG639 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15105-1 Original site URL http://dict...ns c... 262 7e-69 AB291558_1( AB291558 |pid:none) Solea senegalensis rpS5 mRNA for r... 260 2e-68 AF402813_1( AF402813 |pid:none) Ict... 1.00 88.0 %: cytoplasmic 8.0 %: mitochondrial 4.0 %: nuclear >> prediction for SSG639 is cyt 5' end seq. ID

  17. Dicty_cDB: SFJ801 [Dicty_cDB

    Full Text Available SF (Link to library) SFJ801 (Link to dictyBase) - - - - SFJ801P (Link to Original s...ite) SFJ801F 633 SFJ801Z 345 SFJ801P 978 - - Show SFJ801 Library SF (Link to library) Clone ID SFJ801 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.ts...t alignments: (bits) Value N U36937 |U36937.1 Dictyostelium discoideum calreticulin mRNA, complete cds. 1021...IpTrk_27_j08 Trunk kidney cDNA library Ictalurus punctatus cDNA 5' similar to ER-resident chaperone calretic

  18. Dicty_cDB: SFF105 [Dicty_cDB

    Full Text Available SF (Link to library) SFF105 (Link to dictyBase) - - - Contig-U14516-1 SFF105Z (Link... to Original site) - - SFF105Z 217 - - - - Show SFF105 Library SF (Link to library) Clone ID SFF105 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14516-1 Original site URL http://dict...pieces. 44 0.77 1 CF971786 |CF971786.1 AUB_IfLvr00258 Ictalurus furcatus liver cDNA library Ictalurus furcat...endoplasmic reticulum >> prediction for SFF105 is cyt 5' end seq. ID - 5' end seq. - Length of 5' end seq. -

  19. Dicty_cDB: SHK620 [Dicty_cDB

    Full Text Available SH (Link to library) SHK620 (Link to dictyBase) - - - Contig-U13939-1 - (Link to Or...iginal site) SHK620F 395 - - - - - - Show SHK620 Library SH (Link to library) Clone ID SHK620 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13939-1 Original site URL http://dictycdb.b...pdate 2002.12. 9 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AF337815 |AF337815.1 Dict...omene cDNA clone Hm_pupb_01C06 5', mRNA sequence. 48 0.15 1 CK405838 |CK405838.1 AUF_IfSpn_234_g03 Ict

  20. Dicty_cDB: SSF105 [Dicty_cDB

    Full Text Available SS (Link to library) SSF105 (Link to dictyBase) - - - Contig-U16581-1 SSF105F (Link... to Original site) SSF105F 432 - - - - - - Show SSF105 Library SS (Link to library) Clone ID SSF105 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...g significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum mRNA. 387 e-126 3 BZ46365...028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ict

  1. Dicty_cDB: VHH893 [Dicty_cDB

    Full Text Available VH (Link to library) VHH893 (Link to dictyBase) - - - Contig-U15693-1 - (Link to Or...iginal site) - - VHH893Z 385 - - - - Show VHH893 Library VH (Link to library) Clone ID VHH893 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15693-1 Original site URL http://dictycdb.b... Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AF188717 |AF188717.1 Dict...anio rerio alanyl-tRNA synthetase... 48 9e-05 DQ353802_1( DQ353802 |pid:none) Ictalurus punctatus isolate C1

  2. Dicty_cDB: CHE636 [Dicty_cDB

    Full Text Available CH (Link to library) CHE636 (Link to dictyBase) - - - Contig-U11696-1 CHE636P (Link... to Original site) CHE636F 174 CHE636Z 123 CHE636P 277 - - Show CHE636 Library CH (Link to library) Clone ID CHE636 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11696-1 Original site URL http://dict...ne RP11-15H22, WORKING DRAFT SEQUENCE, 23 unordered pieces. 40 0.19 3 AC149612 |AC149612.1 Ictalurus punctat... %: cytoskeletal 4.0 %: mitochondrial >> prediction for CHE636 is nuc 5' end seq. ID CHE636F 5' end seq. >CH

  3. Dicty_cDB: SSG307 [Dicty_cDB

    Full Text Available SS (Link to library) SSG307 (Link to dictyBase) - - - Contig-U16382-1 SSG307Z (Link... to Original site) - - SSG307Z 391 - - - - Show SSG307 Library SS (Link to library) Clone ID SSG307 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...om clone CH211-202E12. 36 0.97 7 CF263546 |CF263546.1 AUA_IpTrk00012 Trunk kidney cDNA library Ictalurus pun...ytoskeletal 4.0 %: vacuolar 4.0 %: vesicles of secretory system >> prediction for SSG307 is nuc 5' end seq.

  4. Dicty_cDB: VSK476 [Dicty_cDB

    Full Text Available VS (Link to library) VSK476 (Link to dictyBase) - - - Contig-U07114-1 VSK476Z (Link... to Original site) - - VSK476Z 291 - - - - Show VSK476 Library VS (Link to library) Clone ID VSK476 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U07114-1 Original site URL http://dict...239C9 in linkage group 3. 46 0.24 1 BM495069 |BM495069.1 IpCGBr1_4_C04_22 Ictalur...us punctatus Brain1 primary library Ictalurus punctatus cDNA clone IpCGBr1_4_C04_22_07Mar00_034 3', mRNA seq

  5. Dicty_cDB: SSI468 [Dicty_cDB

    Full Text Available SS (Link to library) SSI468 (Link to dictyBase) - - - Contig-U16310-1 SSI468Z (Link... to Original site) - - SSI468Z 300 - - - - Show SSI468 Library SS (Link to library) Clone ID SSI468 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16310-1 Original site URL http://dict...gnments: (bits) Value N AC116330 |AC116330.2 Dictyostelium discoideum chromosome 2 map 3191214-3323468 strai...NCING IN PROGRESS ***, 3 unordered pieces. 46 6.0 2 BM029242 |BM029242.1 IpSkn00196 Skin cDNA library Ictalu

  6. Dicty_cDB: SSK129 [Dicty_cDB

    Full Text Available SS (Link to library) SSK129 (Link to dictyBase) - - - Contig-U16021-1 SSK129Z (Link... to Original site) - - SSK129Z 372 - - - - Show SSK129 Library SS (Link to library) Clone ID SSK129 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16021-1 Original site URL http://dict...Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116957 |AC116957.2 Dict...419632 |CK419632.1 AUF_IpOva_21_i24 Ovary cDNA library Ictalurus punctatus cDNA 5', mRNA sequence. 36 0.54 2

  7. Dicty_cDB: SSI527 [Dicty_cDB

    Full Text Available SS (Link to library) SSI527 (Link to dictyBase) - - - Contig-U16209-1 SSI527F (Link... to Original site) SSI527F 685 - - - - - - Show SSI527 Library SS (Link to library) Clone ID SSI527 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16209-1 Original site URL http://dict...N BM438323 |BM438323.1 IpLvr01076 Liver cDNA library Ictalurus punctatus cDNA 5' ...6357825 5' similar to SW:RSP4_CHICK P50890 40S RIBOSOMAL PROTEIN SA ;, mRNA sequence. 46 4e-06 2 BQ096846 |BQ096846.1 IfHdk00487 Ict

  8. Dicty_cDB: SSC474 [Dicty_cDB

    Full Text Available SS (Link to library) SSC474 (Link to dictyBase) - - - Contig-U07719-1 SSC474P (Link... to Original site) SSC474F 368 SSC474Z 238 SSC474P 606 - - Show SSC474 Library SS (Link to library) Clone ID SSC474 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U07719-1 Original site URL http://dict...logy vs DNA Score E Sequences producing significant alignments: (bits) Value N ( AU071762 ) Dictyostelium di...scoideum slug cDNA, clone SSC474. 448 e-121 1 ( AU060185 ) Dictyostelium discoideum slug cDNA, clone SLA535.

  9. Dicty_cDB: AFE557 [Dicty_cDB

    Full Text Available AF (Link to library) AFE557 (Link to dictyBase) - - - - AFE557F (Link to Original s...ite) AFE557F 540 - - - - - - Show AFE557 Library AF (Link to library) Clone ID AFE557 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...ificant alignments: (bits) Value N U36937 |U36937.1 Dictyostelium discoideum calr...|CB937139.1 IpCGJx13_12_E07_23 IpCGJx13 Ictalurus punctatus cDNA clone IpCGJx13_12_E07 5', mRNA sequence. 52

  10. Dicty_cDB: CFC652 [Dicty_cDB

    Full Text Available CF (Link to library) CFC652 (Link to dictyBase) - - - Contig-U02523-1 CFC652Z (Link... to Original site) - - CFC652Z 713 - - - - Show CFC652 Library CF (Link to library) Clone ID CFC652 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U02523-1 Original site URL http://dict... clone DKEY-104M9 in linkage group 19. 46 0.73 1 AC148615 |AC148615.2 Ictalurus punctatus clone CH212-99A22,...luding cell wall 4.0 %: peroxisomal >> prediction for CFC652 is mit 5' end seq. ID - 5' end seq. - Length of

  11. Dicty_cDB: VSK112 [Dicty_cDB

    Full Text Available VS (Link to library) VSK112 (Link to dictyBase) - - - Contig-U16538-1 VSK112P (Link... to Original site) VSK112F 515 VSK112Z 357 VSK112P 872 - - Show VSK112 Library VS (Link to library) Clone ID VSK112 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16538-1 Original site URL http://dict... 2004.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N Y17042 |Y17042.1 Dict...095O23 F, DNA sequence. 36 0.071 2 BM439182 |BM439182.1 IpLvr02248 Liver cDNA library Ict

  12. Dicty_cDB: SSD250 [Dicty_cDB

    Full Text Available SS (Link to library) SSD250 (Link to dictyBase) - - - Contig-U14716-1 SSD250E (Link... to Original site) - - - - - - SSD250E 491 Show SSD250 Library SS (Link to library) Clone ID SSD250 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14716-1 Original site URL http://dict...t alignments: (bits) Value N U20432 |U20432.1 Dictyostelium discoideum TagB (tagB) gene, complete cds. 151 1...cName: Full=Cytochrome b-c1 complex subunit 7; AltNam... 45 0.001 DQ399515_1( DQ399515 |pid:none) Ictalurus

  13. Dicty_cDB: SSG552 [Dicty_cDB

    Full Text Available SS (Link to library) SSG552 (Link to dictyBase) - - - Contig-U16581-1 - (Link to Or...iginal site) SSG552F 449 - - - - - - Show SSG552 Library SS (Link to library) Clone ID SSG552 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dictycdb.b...A Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoide.... 44 1.7 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ictacalc

  14. Dicty_cDB: SHE682 [Dicty_cDB

    Full Text Available SH (Link to library) SHE682 (Link to dictyBase) - - - Contig-U11295-1 - (Link to Or...iginal site) SHE682F 142 - - - - - - Show SHE682 Library SH (Link to library) Clone ID SHE682 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11295-1 Original site URL http://dictycdb.b... 2 CB936849 |CB936849.1 IpCGJx13_9_A11_23 IpCGJx13 Ictalurus punctatus cDNA clone...8.0 %: cytoplasmic 28.0 %: nuclear 4.0 %: cytoskeletal 4.0 %: plasma membrane 4.0

  15. Dicty_cDB: CFH809 [Dicty_cDB

    Full Text Available CF (Link to library) CFH809 (Link to dictyBase) - - - Contig-U16381-1 - (Link to Or...iginal site) CFH809F 135 - - - - - - Show CFH809 Library CF (Link to library) Clone ID CFH809 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dictycdb.b...ce. 82 2e-29 3 X51892 |X51892.1 Dictyostelium discoideum SP60 gene for spore coat protein. 82 5e-29 2 X52105 |X52105.1 Dict...yostelium discoideum SP60 gene for spore coat protein. 80 9e-27 2 AC116977 |AC116977.2 Dict

  16. Dicty_cDB: VFB187 [Dicty_cDB

    Full Text Available VF (Link to library) VFB187 (Link to dictyBase) - - - - VFB187P (Link to Original s...ite) VFB187F 556 VFB187Z 289 VFB187P 845 - - Show VFB187 Library VF (Link to library) Clone ID VFB187 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.ts...25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Val...alar cDNA clone LRR7-f02 5' similar to Calreticulin, mRNA sequence. 56 8e-04 1 CB937139 |CB937139.1 IpCGJx13_12_E07_23 IpCGJx13 Ict

  17. Dicty_cDB: SSF865 [Dicty_cDB

    Full Text Available SS (Link to library) SSF865 (Link to dictyBase) - - - Contig-U16581-1 SSF865Z (Link... to Original site) - - SSF865Z 436 - - - - Show SSF865 Library SS (Link to library) Clone ID SSF865 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...s producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum mRNA. 387 e-115...0.027 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ict

  18. Dicty_cDB: VSH207 [Dicty_cDB

    Full Text Available VS (Link to library) VSH207 (Link to dictyBase) - - - Contig-U12548-1 VSH207P (Link... to Original site) VSH207F 228 VSH207Z 107 VSH207P 335 - - Show VSH207 Library VS (Link to library) Clone ID VSH207 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12548-1 Original site URL http://dict...ents: (bits) Value N ( AU267072 ) Dictyostelium discoideum vegetative cDNA clone:VS... 206 2e-58 2 ( AC116982 ) Dict...yostelium discoideum chromosome 2 map 3622643... 206 4e-49 1 ( AU267073 ) Dict

  19. Dicty_cDB: AFH386 [Dicty_cDB

    Full Text Available AF (Link to library) AFH386 (Link to dictyBase) - - - - AFH386F (Link to Original s...ite) AFH386F 623 - - - - - - Show AFH386 Library AF (Link to library) Clone ID AFH386 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...s producing significant alignments: (bits) Value N U36937 |U36937.1 Dictyostelium discoideum calreticulin mR...is centranthoides cDNA clone hj81f04, mRNA sequence. 36 4e-04 3 AY342298 |AY342298.1 Ictalurus punctatus ER-

  20. Dicty_cDB: SHH247 [Dicty_cDB

    Full Text Available SH (Link to library) SHH247 (Link to dictyBase) - - - Contig-U15693-1 - (Link to Or...iginal site) - - SHH247Z 601 - - - - Show SHH247 Library SH (Link to library) Clone ID SHH247 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15693-1 Original site URL http://dictycdb.b...pdate 2002.12. 6 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AF188717 |AF188717.1 Dict...ogaster SD01519 fu... 56 6e-07 DQ353802_1( DQ353802 |pid:none) Ictalurus punctatu

  1. Dicty_cDB: VFI685 [Dicty_cDB

    Full Text Available VF (Link to library) VFI685 (Link to dictyBase) - - - Contig-U16455-1 - (Link to Or...iginal site) - - VFI685Z 189 - - - - Show VFI685 Library VF (Link to library) Clone ID VFI685 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16455-1 Original site URL http://dictycdb.b...ignments: (bits) Value N ( BJ432495 ) Dictyostelium discoideum cDNA clone:ddv18i22, 3' ... 313 1e-81 1 ( X55...973 ) D. discoideum EF1-I gene for elongation factor 1 al... 305 3e-79 1 ( AU285051 ) Dict

  2. Dicty_cDB: VSK324 [Dicty_cDB

    Full Text Available VS (Link to library) VSK324 (Link to dictyBase) - G24005 DDB0233069 Contig-U15575-1... VSK324F (Link to Original site) VSK324F 364 - - - - - - Show VSK324 Library VS (Link to library) Clone ID VSK324 (Link to dict...yBase) Atlas ID - NBRP ID G24005 dictyBase ID DDB0233069 Link to Contig Contig-U15575-1 O...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSK3-A/VSK324Q.Seq.d/ ...12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC117070 |AC117070.2 Dict

  3. Dicty_cDB: SSF460 [Dicty_cDB

    Full Text Available SS (Link to library) SSF460 (Link to dictyBase) - - - Contig-U03803-1 SSF460Z (Link... to Original site) - - SSF460Z 453 - - - - Show SSF460 Library SS (Link to library) Clone ID SSF460 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSF4-C/SSF460Q.Seq.d/ Representative seq. ID SSF46...0Z (Link to Original site) Representative DNA sequence >SSF460 (SSF460Q) /CSM/SS/SSF4-C/SSF460Q.Seq.d/ XXXXX...s) Value SSM309 (SSM309Q) /CSM/SS/SSM3-A/SSM309Q.Seq.d/ 424 e-118 SSH196 (SSH196Q) /CSM/SS/SSH1-D/SSH196Q.Seq.d/ 424 e-118 SSF4

  4. Dicty_cDB: SSL472 [Dicty_cDB

    Full Text Available SS (Link to library) SSL472 (Link to dictyBase) - - - Contig-U14592-1 SSL472F (Link... to Original site) SSL472F 185 - - - - - - Show SSL472 Library SS (Link to library) Clone ID SSL472 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14592-1 Original site URL http://dict...group) genomic DNA, chromosome 6, PAC clone:P0036F10, WORKING DRAFT SEQUENCE, 1 ordered pieces. 44 0.59 1 AC114263 |AC114263.2 Dict...library Plasmodium falciparum 3D7 cDNA 5' similar to TR:O96129 O96129 PREDICTED MEMBRANE ASSOCIATED PROTEIN.

  5. Dicty_cDB: VHD642 [Dicty_cDB

    Full Text Available VH (Link to library) VHD642 (Link to dictyBase) - - - Contig-U11361-1 - (Link to Or...iginal site) VHD642F 629 - - - - - - Show VHD642 Library VH (Link to library) Clone ID VHD642 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11361-1 Original site URL http://dictycdb.b...us erato cDNA clone He_wd2a1_74D09 5' similar to UniRef90_UPI000051A2A9 Cluster related to UPI000051A2A9; PREDICT...DNA, mRNA sequence. 56 1e-12 4 EE133491 |EE133491.1 SiJWH07ADU Lausanne fire ant library Solenopsis invicta

  6. Dicty_cDB: SFK294 [Dicty_cDB

    Full Text Available SF (Link to library) SFK294 (Link to dictyBase) - - - Contig-U16528-1 SFK294F (Link to Original site) SFK2...94F 643 - - - - - - Show SFK294 Library SF (Link to library) Clone ID SFK294 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SF/SFK2-D/SFK294Q.Seq.d/ Representative seq. ID SFK29...4F (Link to Original site) Representative DNA sequence >SFK294 (SFK294Q) /CSM/SF/SFK2-D/SFK294Q.Seq.d/ AATAA...quences producing significant alignments: (bits) Value SFK294 (SFK294Q) /CSM/SF/SFK2-D/SFK294Q.Seq.d/ 1275 0

  7. Dicty_cDB: AFK258 [Dicty_cDB

    Full Text Available AF (Link to library) AFK258 (Link to dictyBase) - - - Contig-U15883-1 AFK258Z (Link... to Original site) - - AFK258Z 705 - - - - Show AFK258 Library AF (Link to library) Clone ID AFK258 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/AF/AFK2-C/AFK258Q.Seq.d/ Representative seq. ID AFK25...8Z (Link to Original site) Representative DNA sequence >AFK258 (AFK258Q) /CSM/AF/AFK2-C/AFK258Q.Seq.d/ XXXXX...its) Value CFC754 (CFC754Q) /CSM/CF/CFC7-C/CFC754Q.Seq.d/ 656 0.0 AFM846 (AFM846Q) /CSM/AF/AFM8-B/AFM846Q.Seq.d/ 656 0.0 AFK2

  8. Dicty_cDB: VHK278 [Dicty_cDB

    Full Text Available VH (Link to library) VHK278 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) VHK2...78F 533 - - - - - - Show VHK278 Library VH (Link to library) Clone ID VHK278 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHK2-D/VHK278Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHK278 (VHK278Q) /CSM/VH/VHK2-D/VHK278Q.Seq.d/ AACTCTCGAGTGCAAAA...BJ427875 ) Dictyostelium discoideum cDNA clone:ddv63k24, 5' ... 997 0.0 1 ( BJ427874 ) Dictyostelium discoideum cDNA clone:ddv63k2

  9. Dicty_cDB: AFK241 [Dicty_cDB

    Full Text Available AF (Link to library) AFK241 (Link to dictyBase) - - - Contig-U16322-1 AFK241Z (Link... to Original site) - - AFK241Z 753 - - - - Show AFK241 Library AF (Link to library) Clone ID AFK241 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/AF/AFK2-B/AFK241Q.Seq.d/ Representative seq. ID AFK24...1Z (Link to Original site) Representative DNA sequence >AFK241 (AFK241Q) /CSM/AF/AFK2-B/AFK241Q.Seq.d/ XXXXX...llhfsmkilvpfkrkdqpqlvsklkqv lxinkalsqxhhi Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value AFK2

  10. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB789 (Link to dictyBase) - - - Contig-U16455-1 VFB789P (Link... to Original site) VFB789F 468 VFB789Z 735 VFB789P 1203 - - Show VFB789 Library VF (Link to library) Clone ID VFB789 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16455-1 Original site URL http://dict...oideum EF1-II gene for elongation factor 1 alpha. 1338 0.0 2 AF016242 |AF016242.1 Dictyostelium discoideum p...m_ : 1.00 36.0 %: cytoplasmic 36.0 %: nuclear 12.0 %: cytoskeletal 8.0 %: vacuolar 4.0 %: mitochondrial 4.0 %: peroxisomal >> predict

  11. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC154 (Link to dictyBase) - - - Contig-U16363-1 VFC154Z (Link... to Original site) - - VFC154Z 551 - - - - Show VFC154 Library VF (Link to library) Clone ID VFC154 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16363-1 Original site URL http://dict...s: (bits) Value N U82513 |U82513.1 Dictyostelium discoideum random slug cDNA25 protein (rsc25) mRNA, partial...producing significant alignments: (bits) Value U82513_1( U82513 |pid:none) Dictyostelium discoideum random s

  12. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC162 (Link to dictyBase) - - - Contig-U16455-1 VFC162P (Link... to Original site) VFC162F 367 VFC162Z 501 VFC162P 868 - - Show VFC162 Library VF (Link to library) Clone ID VFC162 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16455-1 Original site URL http://dict...elongation factor 1 alpha. 896 0.0 3 AF016242 |AF016242.1 Dictyostelium discoideu... vacuolar 4.0 %: mitochondrial 4.0 %: peroxisomal >> prediction for VFC162 is nuc 5' end seq. ID VFC162F 5'

  13. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB612 (Link to dictyBase) - - - Contig-U16272-1 VFB612P (Link... to Original site) VFB612F 631 VFB612Z 640 VFB612P 1271 - - Show VFB612 Library VF (Link to library) Clone ID VFB612 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...es producing significant alignments: (bits) Value N L08391 |L08391.1 Dictyostelium discoideum ribosomal prot...gi 4.0 %: plasma membrane >> prediction for VFB612 is nuc 5' end seq. ID VFB612F

  14. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC196 (Link to dictyBase) - - - Contig-U13856-1 VFC196P (Link... to Original site) VFC196F 487 VFC196Z 556 VFC196P 1043 - - Show VFC196 Library VF (Link to library) Clone ID VFC196 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13856-1 Original site URL http://dict...te 2004.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N U72746 |U72746.1 Dict...13. 36 0.053 5 AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map 2567470-3108875 strain AX4, co

  15. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC175 (Link to dictyBase) - - - Contig-U16358-1 VFC175F (Link... to Original site) VFC175F 507 - - - - - - Show VFC175 Library VF (Link to library) Clone ID VFC175 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16358-1 Original site URL http://dict...12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC117072 |AC117072.2 Dict...eletal 4.0 %: mitochondrial 4.0 %: vacuolar 4.0 %: vesicles of secretory system >> prediction for VFC175 is

  16. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB856 (Link to dictyBase) - - - Contig-U16605-1 VFB856P (Link... to Original site) VFB856F 552 VFB856Z 535 VFB856P 1087 - - Show VFB856 Library VF (Link to library) Clone ID VFB856 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16605-1 Original site URL http://dict...own update 2004.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N L36204 |L36204.1 Dict...ds. 922 0.0 6 U72746 |U72746.1 Dictyostelium discoideum cysteine proteinase (cprG) mRNA, complete cds. 131 e

  17. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC102 (Link to dictyBase) - - - Contig-U16455-1 VFC102P (Link... to Original site) VFC102F 433 VFC102Z 582 VFC102P 1015 - - Show VFC102 Library VF (Link to library) Clone ID VFC102 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16455-1 Original site URL http://dict...lpha. 1100 0.0 2 X55972 |X55972.1 D. discoideum EF1-II gene for elongation factor 1 alpha. 1059 0.0 2 AF016242 |AF016242.1 Dict....0 %: vacuolar 4.0 %: mitochondrial 4.0 %: peroxisomal >> prediction for VFC102 i

  18. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB611 (Link to dictyBase) - - - Contig-U16239-1 VFB611P (Link... to Original site) VFB611F 650 VFB611Z 704 VFB611P 1354 - - Show VFB611 Library VF (Link to library) Clone ID VFB611 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16239-1 Original site URL http://dict...ant alignments: (bits) Value N AC116989 |AC116989.2 Dictyostelium discoideum chro...mosome 2 map complement(3527391-3470188) strain AX4, complete sequence. 42 5e-10 9 AC116987 |AC116987.2 Dict

  19. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC234 (Link to dictyBase) - - - Contig-U16464-1 VFC234P (Link... to Original site) VFC234F 292 VFC234Z 462 VFC234P 754 - - Show VFC234 Library VF (Link to library) Clone ID VFC234 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16464-1 Original site URL http://dict...2 5e-06 6 AL844509 |AL844509.1 Plasmodium falciparum chromosome 13. 48 4e-04 4 AC117075 |AC117075.2 Dict...brane 4.0 %: Golgi 4.0 %: vesicles of secretory system >> prediction for VFC234 is nuc 5' end seq. ID VFC234

  20. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC241 (Link to dictyBase) - - - Contig-U16272-1 VFC241P (Link... to Original site) VFC241F 369 VFC241Z 514 VFC241P 883 - - Show VFC241 Library VF (Link to library) Clone ID VFC241 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...ments: (bits) Value N L08391 |L08391.1 Dictyostelium discoideum ribosomal protein (L3) gene, complete cds. 6...0 m3a: 0.00 m3b: 0.00 m_ : 1.00 68.0 %: nuclear 20.0 %: cytoplasmic 8.0 %: mitochondrial 4.0 %: peroxisomal >> predict

  1. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB489 (Link to dictyBase) - - - Contig-U16382-1 VFB489P (Link... to Original site) VFB489F 178 VFB489Z 501 VFB489P 679 - - Show VFB489 Library VF (Link to library) Clone ID VFB489 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...: (bits) Value N AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2...e cds. 783 0.0 3 AC115579 |AC115579.2 Dictyostelium discoideum chromosome 2 map 4915084-5005461 strain AX4,

  2. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB847 (Link to dictyBase) - - - Contig-U16272-1 VFB847P (Link... to Original site) VFB847F 528 VFB847Z 749 VFB847P 1277 - - Show VFB847 Library VF (Link to library) Clone ID VFB847 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...core E Sequences producing significant alignments: (bits) Value N L08391 |L08391.1 Dictyostelium discoideum ...ear 24.0 %: cytoplasmic 4.0 %: cytoskeletal 4.0 %: plasma membrane 4.0 %: endoplasmic reticulum >> predictio

  3. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB788 (Link to dictyBase) - - - Contig-U14924-1 VFB788P (Link... to Original site) VFB788F 158 VFB788Z 768 VFB788P 926 - - Show VFB788 Library VF (Link to library) Clone ID VFB788 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14924-1 Original site URL http://dict... (bits) Value N AC115592 |AC115592.2 Dictyostelium discoideum chromosome 2 map 1-...2_6( AC115592 |pid:none) Dictyostelium discoideum chromosom... 520 e-146 CU459003_2449( CU459003 |pid:none)

  4. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB895 (Link to dictyBase) - - - Contig-U10164-1 VFB895P (Link... to Original site) VFB895F 578 VFB895Z 699 VFB895P 1277 - - Show VFB895 Library VF (Link to library) Clone ID VFB895 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10164-1 Original site URL http://dict...ore E Sequences producing significant alignments: (bits) Value N AC115604 |AC115604.2 Dictyostelium discoide...um chromosome 2 map 4354771-4414991 strain AX4, complete sequence. 42 5e-06 9 M18106 |M18106.1 Dictyostelium

  5. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC129 (Link to dictyBase) - - - Contig-U16543-1 VFC129F (Link... to Original site) VFC129F 276 - - - - - - Show VFC129 Library VF (Link to library) Clone ID VFC129 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16543-1 Original site URL http://dict... vs DNA Score E Sequences producing significant alignments: (bits) Value N M91382 |M91382.1 Dictyostelium di...scoideum thioredoxin (TRX2) mRNA, 5' end. 281 2e-96 3 M91384 |M91384.1 Dictyostelium discoideum thioredoxin

  6. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC101 (Link to dictyBase) - - - Contig-U16544-1 VFC101Z (Link... to Original site) - - VFC101Z 556 - - - - Show VFC101 Library VF (Link to library) Clone ID VFC101 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16544-1 Original site URL http://dict...t alignments: (bits) Value N AY164994 |AY164994.1 Dictyostelium discoideum RTNLC (RTNLC) mRNA, complete cds.... 969 0.0 2 AY164656 |AY164656.1 Dictyostelium discoideum RTNLC (RTNLC) gene, complete cds. 565 0.0 3 AL71386

  7. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC280 (Link to dictyBase) - - - Contig-U16349-1 VFC280Z (Link... to Original site) - - VFC280Z 627 - - - - Show VFC280 Library VF (Link to library) Clone ID VFC280 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dict...4. 4 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AJ315489 |AJ315489.1 Dict...: vacuolar 4.0 %: Golgi 4.0 %: nuclear 4.0 %: vesicles of secretory system >> prediction for VFC280 is end 5

  8. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC254 (Link to dictyBase) - - - Contig-U15456-1 VFC254P (Link... to Original site) VFC254F 509 VFC254Z 569 VFC254P 1078 - - Show VFC254 Library VF (Link to library) Clone ID VFC254 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15456-1 Original site URL http://dict...mology vs DNA Score E Sequences producing significant alignments: (bits) Value N Y16962 |Y16962.1 Dictyostel...ium discoideum mRNA for cathepsin D. 910 0.0 3 AJ243946 |AJ243946.1 Dictyostelium

  9. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB645 (Link to dictyBase) - - - Contig-U16382-1 VFB645P (Link... to Original site) VFB645F 619 VFB645Z 413 VFB645P 1032 - - Show VFB645 Library VF (Link to library) Clone ID VFB645 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...mology vs DNA Score E Sequences producing significant alignments: (bits) Value N X03281 |X03281.1 Dictyostel...ium discoideum gene for actin A8. 1174 0.0 2 AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 map

  10. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC187 (Link to dictyBase) - - - Contig-U12289-1 VFC187P (Link... to Original site) VFC187F 411 VFC187Z 678 VFC187P 1089 - - Show VFC187 Library VF (Link to library) Clone ID VFC187 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12289-1 Original site URL http://dict... N AC117176 |AC117176.2 Dictyostelium discoideum chromosome 2 map 5018074-5200947... strain AX4, complete sequence. 36 0.008 12 AC114263 |AC114263.2 Dictyostelium discoideum chromosome 2 map 2

  11. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC204 (Link to dictyBase) - - - - VFC204P (Link to Original s...ite) VFC204F 508 VFC204Z 681 VFC204P 1189 - - Show VFC204 Library VF (Link to library) Clone ID VFC204 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.t...|X55972.1 D. discoideum EF1-II gene for elongation factor 1 alpha. 1245 0.0 2 AF016242 |AF016242.1 Dict... 8.0 %: vacuolar 4.0 %: mitochondrial 4.0 %: peroxisomal >> prediction for VFC204 is cyt 5' end seq. ID VFC2

  12. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC222 (Link to dictyBase) - - - Contig-U16046-1 VFC222Z (Link... to Original site) - - VFC222Z 339 - - - - Show VFC222 Library VF (Link to library) Clone ID VFC222 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16046-1 Original site URL http://dict...pdate 2002.12.15 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116989 |AC116989.2 Dict...etical LO... 88 8e-17 AC115592_28( AC115592 |pid:none) Dictyostelium discoideum c

  13. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB785 (Link to dictyBase) - - - - VFB785P (Link to Original s...ite) VFB785F 511 VFB785Z 723 VFB785P 1234 - - Show VFB785 Library VF (Link to library) Clone ID VFB785 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.t... 1 alpha. 1332 0.0 2 X55972 |X55972.1 D. discoideum EF1-II gene for elongation factor 1 alpha. 1277 0.0 2 AF016242 |AF016242.1 Dict...eletal 8.0 %: vacuolar 4.0 %: mitochondrial 4.0 %: peroxisomal >> prediction for VFB785 is cyt 5' end seq. I

  14. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB877 (Link to dictyBase) - - - Contig-U10748-1 VFB877P (Link... to Original site) VFB877F 220 VFB877Z 725 VFB877P 945 - - Show VFB877 Library VF (Link to library) Clone ID VFB877 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10748-1 Original site URL http://dict... E Sequences producing significant alignments: (bits) Value N AC116956 |AC116956.2 Dict...63 |AL583863.16 Human DNA sequence from clone RP11-118G19 on chromosome 1. 44 0.16 2 AF193811 |AF193811.1 Dict

  15. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB534 (Link to dictyBase) - - - Contig-U15835-1 VFB534P (Link... to Original site) VFB534F 523 VFB534Z 467 VFB534P 990 - - Show VFB534 Library VF (Link to library) Clone ID VFB534 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15835-1 Original site URL http://dict... Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AF025951 |AF025951.1 Dict...yostelium discoideum heat-shock cognate protein 70 (hsc70) mRNA, complete cds. 1037 0.0 3 AC115684 |AC115684.2 Dict

  16. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC231 (Link to dictyBase) - - - Contig-U16593-1 VFC231P (Link... to Original site) VFC231F 428 VFC231Z 202 VFC231P 630 - - Show VFC231 Library VF (Link to library) Clone ID VFC231 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16593-1 Original site URL http://dict...amoeba histolytica genomic, DNA sequence. 48 0.13 1 AC116984 |AC116984.2 Dictyostelium discoideum chromosome...mbrane 4.0 %: vesicles of secretory system 4.0 %: extracellular, including cell wall >> predict

  17. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB552 (Link to dictyBase) - - - Contig-U16480-1 VFB552P (Link... to Original site) VFB552F 529 VFB552Z 562 VFB552P 1091 - - Show VFB552 Library VF (Link to library) Clone ID VFB552 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16480-1 Original site URL http://dict...nce (All Frames) Frame A: kvtv*liiylkiknetficisifdfsyfhcksrlpicfl*iq*iinwwc*rycssfky*w nnikyyi*fyniictkyticc...cuolar 8.0 %: endoplasmic reticulum 4.0 %: cytoplasmic 4.0 %: mitochondrial 4.0 %: Golgi >> prediction for V

  18. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB805 (Link to dictyBase) - - - Contig-U16149-1 VFB805P (Link... to Original site) VFB805F 435 VFB805Z 343 VFB805P 778 - - Show VFB805 Library VF (Link to library) Clone ID VFB805 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16149-1 Original site URL http://dict...12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC114263 |AC114263.2 Dict...quence. 658 0.0 5 X14909 |X14909.1 Dictyolstelium discoideum mRNA for ribosomal protein L7. 579 e-172 3 CD81

  19. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC212 (Link to dictyBase) - - - Contig-U16455-1 VFC212P (Link... to Original site) VFC212F 260 VFC212Z 343 VFC212P 603 - - Show VFC212 Library VF (Link to library) Clone ID VFC212 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16455-1 Original site URL http://dict...actor 1 alpha. 394 0.0 3 X55972 |X55972.1 D. discoideum EF1-II gene for elongation factor 1 alpha. 347 0.0 3...4.0 %: vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction fo

  20. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB837 (Link to dictyBase) - - - Contig-U14985-1 VFB837P (Link... to Original site) VFB837F 606 VFB837Z 689 VFB837P 1295 - - Show VFB837 Library VF (Link to library) Clone ID VFB837 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14985-1 Original site URL http://dict... 13 AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2234041-256737...0 strain AX4, complete sequence. 38 2e-05 15 AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map

  1. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB733 (Link to dictyBase) - - - Contig-U16279-1 VFB733P (Link... to Original site) VFB733F 608 VFB733Z 663 VFB733P 1271 - - Show VFB733 Library VF (Link to library) Clone ID VFB733 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16279-1 Original site URL http://dict...es producing significant alignments: (bits) Value N U23957 |U23957.1 Dictyostelium discoideum P52D mRNA, com...15 e-114 U23957_1( U23957 |pid:none) Dictyostelium discoideum P52D mRNA, co... 41

  2. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB862 (Link to dictyBase) - - - Contig-U16311-1 VFB862P (Link... to Original site) VFB862F 624 VFB862Z 720 VFB862P 1344 - - Show VFB862 Library VF (Link to library) Clone ID VFB862 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16311-1 Original site URL http://dict...s) Value N U72746 |U72746.1 Dictyostelium discoideum cysteine proteinase (cprG) m...RNA, complete cds. 1209 0.0 5 U72745 |U72745.1 Dictyostelium discoideum cysteine proteinase (cprF) mRNA, com

  3. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB736 (Link to dictyBase) - - - Contig-U16272-1 VFB736F (Link... to Original site) VFB736F 628 - - - - - - Show VFB736 Library VF (Link to library) Clone ID VFB736 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict....12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N L08391 |L08391.1 Dict...0.00 m_ : 1.00 68.0 %: nuclear 16.0 %: cytoplasmic 8.0 %: cytoskeletal 4.0 %: mitochondrial 4.0 %: plasma membrane >> predict

  4. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC265 (Link to dictyBase) - - - Contig-U16459-1 VFC265Z (Link... to Original site) - - VFC265Z 278 - - - - Show VFC265 Library VF (Link to library) Clone ID VFC265 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16459-1 Original site URL http://dict...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC123513 |AC123513.1 Dictyos...telium discoideum chromosome 2 map 2779865-2840915 strain AX4, *** SEQUENCING IN PROGRESS ***. 159 9e-77 4 AC117070 |AC117070.2 Dict

  5. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC138 (Link to dictyBase) - - - Contig-U15456-1 VFC138P (Link... to Original site) VFC138F 411 VFC138Z 440 VFC138P 851 - - Show VFC138 Library VF (Link to library) Clone ID VFC138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15456-1 Original site URL http://dict...ducing significant alignments: (bits) Value N Y16962 |Y16962.1 Dictyostelium discoideum mRNA for cathepsin D.... 815 0.0 4 AJ243946 |AJ243946.1 Dictyostelium discoideum ctsD gene for cathepsin D, exons 1 to 2. 815 0.0 5

  6. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB703 (Link to dictyBase) - - - Contig-U14188-1 VFB703Z (Link... to Original site) - - VFB703Z 680 - - - - Show VFB703 Library VF (Link to library) Clone ID VFB703 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14188-1 Original site URL http://dict...ENCE, 18 unordered pieces. 36 0.038 5 AC115680 |AC115680.2 Dictyostelium discoideum chromosome 2 map 4415041...4-226K1, *** SEQUENCING IN PROGRESS ***, 52 unordered pieces. 46 0.31 5 AC116977 |AC116977.2 Dict

  7. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB574 (Link to dictyBase) - - - Contig-U16382-1 VFB574P (Link... to Original site) VFB574F 508 VFB574Z 686 VFB574P 1194 - - Show VFB574 Library VF (Link to library) Clone ID VFB574 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...uences producing significant alignments: (bits) Value N AC116957 |AC116957.2 Dictyostelium discoideum chromo...some 2 map 1685067-2090751 strain AX4, complete sequence. 1352 0.0 4 AC116986 |AC116986.2 Dict

  8. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB509 (Link to dictyBase) - - - Contig-U16272-1 VFB509P (Link... to Original site) VFB509F 537 VFB509Z 670 VFB509P 1207 - - Show VFB509 Library VF (Link to library) Clone ID VFB509 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...4.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N L08391 |L08391.1 Dict...mNt: 0.00 m3a: 0.00 m3b: 0.00 m_ : 1.00 80.0 %: cytoplasmic 16.0 %: mitochondrial 4.0 %: nuclear >> predicti

  9. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC255 (Link to dictyBase) - - - Contig-U16272-1 VFC255P (Link... to Original site) VFC255F 198 VFC255Z 525 VFC255P 723 - - Show VFC255 Library VF (Link to library) Clone ID VFC255 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...oducing significant alignments: (bits) Value N L08391 |L08391.1 Dictyostelium discoideum ribosomal protein (...ic 32.0 %: nuclear 4.0 %: Golgi 4.0 %: mitochondrial >> prediction for VFC255 is cyt 5' end seq. ID VFC255F

  10. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB559 (Link to dictyBase) - - - Contig-U16272-1 VFB559P (Link... to Original site) VFB559F 307 VFB559Z 624 VFB559P 931 - - Show VFB559 Library VF (Link to library) Clone ID VFB559 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...alignments: (bits) Value N L08391 |L08391.1 Dictyostelium discoideum ribosomal pr...toplasmic 16.0 %: mitochondrial 4.0 %: nuclear >> prediction for VFB559 is cyt 5' end seq. ID VFB559F 5' end

  11. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB876 (Link to dictyBase) - - - Contig-U16272-1 VFB876P (Link... to Original site) VFB876F 407 VFB876Z 678 VFB876P 1085 - - Show VFB876 Library VF (Link to library) Clone ID VFB876 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...te 2004.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N L08391 |L08391.1 Dict... 0.00 m3b: 0.00 m_ : 1.00 80.0 %: cytoplasmic 16.0 %: mitochondrial 4.0 %: nuclear >> prediction for VFB876

  12. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB769 (Link to dictyBase) - - - Contig-U15456-1 VFB769P (Link... to Original site) VFB769F 625 VFB769Z 690 VFB769P 1315 - - Show VFB769 Library VF (Link to library) Clone ID VFB769 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15456-1 Original site URL http://dict...roducing significant alignments: (bits) Value N Y16962 |Y16962.1 Dictyostelium discoideum mRNA for cathepsin... D. 1257 0.0 3 AJ243946 |AJ243946.1 Dictyostelium discoideum ctsD gene for cathep

  13. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB524 (Link to dictyBase) - - - Contig-U14169-1 VFB524Z (Link... to Original site) - - VFB524Z 233 - - - - Show VFB524 Library VF (Link to library) Clone ID VFB524 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14169-1 Original site URL http://dict...uences producing significant alignments: (bits) Value N AC116305 |AC116305.2 Dict... cds. 40 0.81 2 Z70204 |Z70204.1 Caenorhabditis elegans cosmid C11G6. 40 2.7 2 AC117176 |AC117176.2 Dictyost

  14. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB843 (Link to dictyBase) - - - Contig-U15729-1 VFB843F (Link... to Original site) VFB843F 566 - - - - - - Show VFB843 Library VF (Link to library) Clone ID VFB843 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15729-1 Original site URL http://dict...roducing significant alignments: (bits) Value N U64830 |U64830.1 Dictyostelium discoideum AX2 protein tyrosi...ne kinase gene, complete cds. 1114 0.0 1 U01064 |U01064.1 Dictyostelium discoideum AX2 protein tyrosine kina

  15. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC161 (Link to dictyBase) - - - Contig-U15456-1 VFC161P (Link... to Original site) VFC161F 564 VFC161Z 562 VFC161P 1126 - - Show VFC161 Library VF (Link to library) Clone ID VFC161 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15456-1 Original site URL http://dict...Value N Y16962 |Y16962.1 Dictyostelium discoideum mRNA for cathepsin D. 1025 0.0 5 AJ243946 |AJ243946.1 Dict...plasma membrane 4.0 %: vesicles of secretory system >> prediction for VFC161 is nuc 5' end seq. ID VFC161F 5

  16. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB702 (Link to dictyBase) - - - Contig-U12284-1 VFB702P (Link... to Original site) VFB702F 478 VFB702Z 615 VFB702P 1093 - - Show VFB702 Library VF (Link to library) Clone ID VFB702 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12284-1 Original site URL http://dict... N G65021 |G65021.1 DH0281 Dictyostelium discoideum ( P.Dear ) Dictyostelium disc...8.0 %: mitochondrial 4.0 %: vacuolar 4.0 %: Golgi >> prediction for VFB702 is nuc 5' end seq. ID VFB702F 5'

  17. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB741 (Link to dictyBase) - - - Contig-U16382-1 VFB741P (Link... to Original site) VFB741F 545 VFB741Z 675 VFB741P 1220 - - Show VFB741 Library VF (Link to library) Clone ID VFB741 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...bits) Value N X03281 |X03281.1 Dictyostelium discoideum gene for actin A8. 1166 0....0 2 AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 map 1685067-2090751 strain AX4, complete seq

  18. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB829 (Link to dictyBase) - - - - VFB829Z (Link to Original s...ite) - - VFB829Z 600 - - - - Show VFB829 Library VF (Link to library) Clone ID VFB829 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/... long chain poly-unsaturated fatty acids. 1189 0.0 1 AB029311 |AB029311.1 Dictyostelium discoideum Dd des5 g...ene for fatty acid desaturase, complete cds. 823 0.0 2 AB022097 |AB022097.1 Dictyostelium discoideum mRNA fo

  19. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB710 (Link to dictyBase) - - - Contig-U16382-1 VFB710P (Link... to Original site) VFB710F 123 VFB710Z 689 VFB710P 812 - - Show VFB710 Library VF (Link to library) Clone ID VFB710 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict... significant alignments: (bits) Value N X03281 |X03281.1 Dictyostelium discoideum... gene for actin A8. 1308 0.0 2 AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 map 1685067-209075

  20. Dicty_cDB: SLC485 [Dicty_cDB

    Full Text Available SL (Link to library) SLC485 (Link to dictyBase) - - - Contig-U16358-1 SLC485Z (Link... to Original site) - - SLC485Z 452 - - - - Show SLC485 Library SL (Link to library) Clone ID SLC485 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC485Q.Seq.d/ Representative seq. ID SLC48...5Z (Link to Original site) Representative DNA sequence >SLC485 (SLC485Q) /CSM/SL/SLC4-D/SLC485Q.Seq.d/ XXXXX... 825 0.0 SLG820 (SLG820Q) /CSM/SL/SLG8-A/SLG820Q.Seq.d/ 825 0.0 SLC485 (SLC485Q) /CSM/SL/SLC4-D/SLC4

  1. Dicty_cDB: SLC420 [Dicty_cDB

    Full Text Available SL (Link to library) SLC420 (Link to dictyBase) - G01085 DDB0205634 Contig-U01169-1 | Contig-U15736-1 SLC4...20P (Link to Original site) SLC420F 333 SLC420Z 423 SLC420P 756 - - Show SLC420 Libra...ry SL (Link to library) Clone ID SLC420 (Link to dictyBase) Atlas ID - NBRP ID G01085 dictyBase ID DDB020563...cdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC420Q.Seq.d/ Representative seq. ID SLC420P (Link to Original site) R...epresentative DNA sequence >SLC420 (SLC420Q) /CSM/SL/SLC4-A/SLC420Q.Seq.d/ GCTAGCACACACATAAATAATACATACACACAT

  2. Dicty_cDB: SLC466 [Dicty_cDB

    Full Text Available SL (Link to library) SLC466 (Link to dictyBase) - - - Contig-U16381-1 SLC466Z (Link... to Original site) - - SLC466Z 427 - - - - Show SLC466 Library SL (Link to library) Clone ID SLC466 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC466Q.Seq.d/ Representative seq. ID SLC46...6Z (Link to Original site) Representative DNA sequence >SLC466 (SLC466Q) /CSM/SL/SLC4-C/SLC466Q.Seq.d/ XXXXX... AU034556 ) Dictyostelium discoideum slug cDNA, clone SLC466. 176 2e-77 2 ( AU033496 ) Dictyostelium discoid

  3. Dicty_cDB: SLC455 [Dicty_cDB

    Full Text Available SL (Link to library) SLC455 (Link to dictyBase) - - - Contig-U16584-1 SLC455Z (Link... to Original site) - - SLC455Z 379 - - - - Show SLC455 Library SL (Link to library) Clone ID SLC455 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC455Q.Seq.d/ Representative seq. ID SLC45...5Z (Link to Original site) Representative DNA sequence >SLC455 (SLC455Q) /CSM/SL/SLC4-C/SLC455Q.Seq.d/ XXXXX...57 ) Dictyostelium discoideum slug cDNA, clone SLC469. 468 e-177 3 ( AU034549 ) Dictyostelium discoideum slug cDNA, clone SLC4

  4. Dicty_cDB: SLC483 [Dicty_cDB

    Full Text Available SL (Link to library) SLC483 (Link to dictyBase) - - - Contig-U16486-1 SLC483F (Link to Original site) SLC4...83F 718 - - - - - - Show SLC483 Library SL (Link to library) Clone ID SLC483 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC483Q.Seq.d/ Representative seq. ID SLC48...3F (Link to Original site) Representative DNA sequence >SLC483 (SLC483Q) /CSM/SL/SLC4-D/SLC483Q.Seq.d/ AAAAA...roducing significant alignments: (bits) Value SLC483 (SLC483Q) /CSM/SL/SLC4-D/SLC483Q.Seq.d/ 1423 0.0 SLE651

  5. Dicty_cDB: SLC431 [Dicty_cDB

    Full Text Available SL (Link to library) SLC431 (Link to dictyBase) - - - Contig-U15865-1 SLC431Z (Link... to Original site) - - SLC431Z 405 - - - - Show SLC431 Library SL (Link to library) Clone ID SLC431 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC431Q.Seq.d/ Representative seq. ID SLC43...1Z (Link to Original site) Representative DNA sequence >SLC431 (SLC431Q) /CSM/SL/SLC4-B/SLC431Q.Seq.d/ XXXXX...omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLC431 (SLC4

  6. Dicty_cDB: SLC461 [Dicty_cDB

    Full Text Available SL (Link to library) SLC461 (Link to dictyBase) - - - Contig-U16382-1 SLC461Z (Link... to Original site) - - SLC461Z 386 - - - - Show SLC461 Library SL (Link to library) Clone ID SLC461 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC461Q.Seq.d/ Representative seq. ID SLC46...1Z (Link to Original site) Representative DNA sequence >SLC461 (SLC461Q) /CSM/SL/SLC4-C/SLC461Q.Seq.d/ XXXXX...e-155 2 ( AU034553 ) Dictyostelium discoideum slug cDNA, clone SLC461. 531 e-155 2 ( AU052473 ) Dictyosteliu

  7. Dicty_cDB: SLC458 [Dicty_cDB

    Full Text Available SL (Link to library) SLC458 (Link to dictyBase) - - - Contig-U16279-1 SLC458Z (Link... to Original site) - - SLC458Z 508 - - - - Show SLC458 Library SL (Link to library) Clone ID SLC458 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC458Q.Seq.d/ Representative seq. ID SLC45...8Z (Link to Original site) Representative DNA sequence >SLC458 (SLC458Q) /CSM/SL/SLC4-C/SLC458Q.Seq.d/ XXXXX...icant alignments: (bits) Value SLC458 (SLC458Q) /CSM/SL/SLC4-C/SLC458Q.Seq.d/ 743

  8. Dicty_cDB: SLC438 [Dicty_cDB

    Full Text Available SL (Link to library) SLC438 (Link to dictyBase) - - - Contig-U10771-1 SLC438Z (Link... to Original site) - - SLC438Z 549 - - - - Show SLC438 Library SL (Link to library) Clone ID SLC438 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC438Q.Seq.d/ Representative seq. ID SLC43...8Z (Link to Original site) Representative DNA sequence >SLC438 (SLC438Q) /CSM/SL/SLC4-B/SLC438Q.Seq.d/ XXXXX...es producing significant alignments: (bits) Value SSM825 (SSM825Q) /CSM/SS/SSM8-B/SSM825Q.Seq.d/ 948 0.0 SLC438 (SLC4

  9. Dicty_cDB: SLC407 [Dicty_cDB

    Full Text Available SL (Link to library) SLC407 (Link to dictyBase) - - - Contig-U16560-1 SLC407Z (Link... to Original site) - - SLC407Z 365 - - - - Show SLC407 Library SL (Link to library) Clone ID SLC407 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC407Q.Seq.d/ Representative seq. ID SLC40...7Z (Link to Original site) Representative DNA sequence >SLC407 (SLC407Q) /CSM/SL/SLC4-A/SLC407Q.Seq.d/ XXXXX...vvtkf*cqt e** Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLC407 (SLC407Q) /CSM/SL/SLC4

  10. Dicty_cDB: SLC451 [Dicty_cDB

    Full Text Available SL (Link to library) SLC451 (Link to dictyBase) - - - Contig-U16260-1 SLC451Z (Link... to Original site) - - SLC451Z 389 - - - - Show SLC451 Library SL (Link to library) Clone ID SLC451 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC451Q.Seq.d/ Representative seq. ID SLC45...1Z (Link to Original site) Representative DNA sequence >SLC451 (SLC451Q) /CSM/SL/SLC4-C/SLC451Q.Seq.d/ XXXXX... producing significant alignments: (bits) Value SLC451 (SLC451Q) /CSM/SL/SLC4-C/SLC4

  11. Dicty_cDB: SLC440 [Dicty_cDB

    Full Text Available SL (Link to library) SLC440 (Link to dictyBase) - G22407 DDB0231506 Contig-U13322-1 | Contig-U16512-1 SLC4...40P (Link to Original site) SLC440F 491 SLC440Z 449 SLC440P 940 - - Show SLC440 Libra...ry SL (Link to library) Clone ID SLC440 (Link to dictyBase) Atlas ID - NBRP ID G22407 dictyBase ID DDB023150...cdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC440Q.Seq.d/ Representative seq. ID SLC440P (Link to Original site) R...epresentative DNA sequence >SLC440 (SLC440Q) /CSM/SL/SLC4-B/SLC440Q.Seq.d/ GGAGATTTCACCACCACCAACAGAACAACACCA

  12. Dicty_cDB: SLC486 [Dicty_cDB

    Full Text Available SL (Link to library) SLC486 (Link to dictyBase) - - - Contig-U16480-1 SLC486E (Link... to Original site) - - - - - - SLC486E 451 Show SLC486 Library SL (Link to library) Clone ID SLC486 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC486Q.Seq.d/ Representative seq. ID SLC48...6E (Link to Original site) Representative DNA sequence >SLC486 (SLC486Q) /CSM/SL/SLC4-D/SLC486Q.Seq.d/ GTCAT...7Q.Seq.d/ 868 0.0 SLD427 (SLD427Q) /CSM/SL/SLD4-B/SLD427Q.Seq.d/ 868 0.0 SLC486 (SLC486Q) /CSM/SL/SLC4-D/SLC4

  13. Dicty_cDB: SLC415 [Dicty_cDB

    Full Text Available SL (Link to library) SLC415 (Link to dictyBase) - - - Contig-U16521-1 SLC415E (Link... to Original site) - - - - - - SLC415E 210 Show SLC415 Library SL (Link to library) Clone ID SLC415 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC415Q.Seq.d/ Representative seq. ID SLC41...5E (Link to Original site) Representative DNA sequence >SLC415 (SLC415Q) /CSM/SL/SLC4-A/SLC415Q.Seq.d/ CCAAC...lkprdpskfqakkllpsk *iilfsl*k Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLC415 (SLC4

  14. Dicty_cDB: SLC419 [Dicty_cDB

    Full Text Available SL (Link to library) SLC419 (Link to dictyBase) - - - Contig-U03801-1 SLC419Z (Link... to Original site) - - SLC419Z 335 - - - - Show SLC419 Library SL (Link to library) Clone ID SLC419 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC419Q.Seq.d/ Representative seq. ID SLC41...9Z (Link to Original site) Representative DNA sequence >SLC419 (SLC419Q) /CSM/SL/SLC4-A/SLC419Q.Seq.d/ XXXXX...I6-A/SSI602Q.Seq.d/ 490 e-138 SSD173 (SSD173Q) /CSM/SS/SSD1-D/SSD173Q.Seq.d/ 490 e-138 SLC419 (SLC4

  15. Dicty_cDB: SLC478 [Dicty_cDB

    Full Text Available SL (Link to library) SLC478 (Link to dictyBase) - - - Contig-U16419-1 SLC478Z (Link... to Original site) - - SLC478Z 400 - - - - Show SLC478 Library SL (Link to library) Clone ID SLC478 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC478Q.Seq.d/ Representative seq. ID SLC47...8Z (Link to Original site) Representative DNA sequence >SLC478 (SLC478Q) /CSM/SL/SLC4-D/SLC478Q.Seq.d/ XXXXX... %: cytoplasmic 28.0 %: nuclear 24.0 %: mitochondrial 12.0 %: cytoskeletal >> prediction for SLC4

  16. Dicty_cDB: SLC429 [Dicty_cDB

    Full Text Available SL (Link to library) SLC429 (Link to dictyBase) - - - Contig-U09691-1 SLC429Z (Link... to Original site) - - SLC429Z 419 - - - - Show SLC429 Library SL (Link to library) Clone ID SLC429 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC429Q.Seq.d/ Representative seq. ID SLC42...9Z (Link to Original site) Representative DNA sequence >SLC429 (SLC429Q) /CSM/SL/SLC4-B/SLC429Q.Seq.d/ XXXXX... significant alignments: (bits) Value SLC429 (SLC429Q) /CSM/SL/SLC4-B/SLC429Q.Seq.d/ 708 0.0 SLC392 (SLC392Q

  17. Dicty_cDB: SLC437 [Dicty_cDB

    Full Text Available SL (Link to library) SLC437 (Link to dictyBase) - - - Contig-U16397-1 SLC437Z (Link... to Original site) - - SLC437Z 622 - - - - Show SLC437 Library SL (Link to library) Clone ID SLC437 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC437Q.Seq.d/ Representative seq. ID SLC43...7Z (Link to Original site) Representative DNA sequence >SLC437 (SLC437Q) /CSM/SL/SLC4-B/SLC437Q.Seq.d/ XXXXX...scoideum slug cDNA, clone SLC437. 1158 0.0 1 ( AU033994 ) Dictyostelium discoideum slug cDNA, clone SLB708.

  18. Dicty_cDB: SLC436 [Dicty_cDB

    Full Text Available SL (Link to library) SLC436 (Link to dictyBase) - - - Contig-U16460-1 SLC436Z (Link... to Original site) - - SLC436Z 344 - - - - Show SLC436 Library SL (Link to library) Clone ID SLC436 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC436Q.Seq.d/ Representative seq. ID SLC43...6Z (Link to Original site) Representative DNA sequence >SLC436 (SLC436Q) /CSM/SL/SLC4-B/SLC436Q.Seq.d/ XXXXX.../CSM/SL/SLE2-C/SLE258Q.Seq.d/ 470 e-132 SLC773 (SLC773Q) /CSM/SL/SLC7-D/SLC773Q.Seq.d/ 470 e-132 SLC4

  19. Dicty_cDB: SLC494 [Dicty_cDB

    Full Text Available SL (Link to library) SLC494 (Link to dictyBase) - - - Contig-U16260-1 SLC494Z (Link... to Original site) - - SLC494Z 451 - - - - Show SLC494 Library SL (Link to library) Clone ID SLC494 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC494Q.Seq.d/ Representative seq. ID SLC49...4Z (Link to Original site) Representative DNA sequence >SLC494 (SLC494Q) /CSM/SL/SLC4-D/SLC494Q.Seq.d/ XXXXX...a: 0.00 m3b: 0.00 m_ : 1.00 52.0 %: cytoplasmic 36.0 %: nuclear 8.0 %: cytoskeletal 4.0 %: mitochondrial >> prediction for SLC4

  20. Dicty_cDB: SLC480 [Dicty_cDB

    Full Text Available SL (Link to library) SLC480 (Link to dictyBase) - - - Contig-U13538-1 SLC480Z (Link... to Original site) - - SLC480Z 455 - - - - Show SLC480 Library SL (Link to library) Clone ID SLC480 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC480Q.Seq.d/ Representative seq. ID SLC48...0Z (Link to Original site) Representative DNA sequence >SLC480 (SLC480Q) /CSM/SL/SLC4-D/SLC480Q.Seq.d/ XXXXX...ial 8.0 %: peroxisomal >> prediction for SLC480 is nuc 5' end seq. ID - 5' end seq. - Length of 5' end seq. - 3' end seq. ID SLC4

  1. Dicty_cDB: SLC411 [Dicty_cDB

    Full Text Available SL (Link to library) SLC411 (Link to dictyBase) - - - Contig-U16272-1 SLC411Z (Link... to Original site) - - SLC411Z 486 - - - - Show SLC411 Library SL (Link to library) Clone ID SLC411 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC411Q.Seq.d/ Representative seq. ID SLC41...1Z (Link to Original site) Representative DNA sequence >SLC411 (SLC411Q) /CSM/SL/SLC4-A/SLC411Q.Seq.d/ XXXXX...vacuolar 4.0 %: peroxisomal >> prediction for SLC411 is nuc 5' end seq. ID - 5' e

  2. Dicty_cDB: SLC434 [Dicty_cDB

    Full Text Available SL (Link to library) SLC434 (Link to dictyBase) - - - Contig-U15434-1 SLC434Z (Link... to Original site) - - SLC434Z 438 - - - - Show SLC434 Library SL (Link to library) Clone ID SLC434 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC434Q.Seq.d/ Representative seq. ID SLC43...4Z (Link to Original site) Representative DNA sequence >SLC434 (SLC434Q) /CSM/SL/SLC4-B/SLC434Q.Seq.d/ XXXXX...logy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLC434 (SLC434Q) /CSM/SL/SLC4-B/SLC4

  3. Dicty_cDB: SLC444 [Dicty_cDB

    Full Text Available SL (Link to library) SLC444 (Link to dictyBase) - - - Contig-U16368-1 SLC444Z (Link... to Original site) - - SLC444Z 462 - - - - Show SLC444 Library SL (Link to library) Clone ID SLC444 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC444Q.Seq.d/ Representative seq. ID SLC44...4Z (Link to Original site) Representative DNA sequence >SLC444 (SLC444Q) /CSM/SL/SLC4-B/SLC444Q.Seq.d/ XXXXX...tochondrial 8.0 %: nuclear 4.0 %: cytoskeletal 4.0 %: cytoplasmic >> prediction for SLC444 is mit 5' end seq

  4. Dicty_cDB: SLC403 [Dicty_cDB

    Full Text Available SL (Link to library) SLC403 (Link to dictyBase) - - - Contig-U16252-1 SLC403Z (Link... to Original site) - - SLC403Z 492 - - - - Show SLC403 Library SL (Link to library) Clone ID SLC403 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC403Q.Seq.d/ Representative seq. ID SLC40...3Z (Link to Original site) Representative DNA sequence >SLC403 (SLC403Q) /CSM/SL/SLC4-A/SLC403Q.Seq.d/ XXXXX...-B/SLE731Q.Seq.d/ 902 0.0 SLC403 (SLC403Q) /CSM/SL/SLC4-A/SLC403Q.Seq.d/ 902 0.0 SLC241 (SLC241Q) /CSM/SL/SL

  5. Dicty_cDB: SLC450 [Dicty_cDB

    Full Text Available SL (Link to library) SLC450 (Link to dictyBase) - - - Contig-U16382-1 SLC450Z (Link... to Original site) - - SLC450Z 416 - - - - Show SLC450 Library SL (Link to library) Clone ID SLC450 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC450Q.Seq.d/ Representative seq. ID SLC45...0Z (Link to Original site) Representative DNA sequence >SLC450 (SLC450Q) /CSM/SL/SLC4-C/SLC450Q.Seq.d/ XXXXX...cant alignments: (bits) Value SLC450 (SLC450Q) /CSM/SL/SLC4-C/SLC450Q.Seq.d/ 678 0.0 VFO858 (VFO858Q) /CSM/V

  6. Dicty_cDB: SLC409 [Dicty_cDB

    Full Text Available SL (Link to library) SLC409 (Link to dictyBase) - - - Contig-U14931-1 SLC409Z (Link... to Original site) - - SLC409Z 483 - - - - Show SLC409 Library SL (Link to library) Clone ID SLC409 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC409Q.Seq.d/ Representative seq. ID SLC40...9Z (Link to Original site) Representative DNA sequence >SLC409 (SLC409Q) /CSM/SL/SLC4-A/SLC409Q.Seq.d/ XXXXX... SLH501 (SLH501Q) /CSM/SL/SLH5-A/SLH501Q.Seq.d/ 858 0.0 SLF191 (SLF191Q) /CSM/SL/SLF1-D/SLF191Q.Seq.d/ 858 0.0 SLC409 (SLC4

  7. Dicty_cDB: SLC490 [Dicty_cDB

    Full Text Available SL (Link to library) SLC490 (Link to dictyBase) - - - Contig-U16444-1 SLC490Z (Link... to Original site) - - SLC490Z 427 - - - - Show SLC490 Library SL (Link to library) Clone ID SLC490 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC490Q.Seq.d/ Representative seq. ID SLC49...0Z (Link to Original site) Representative DNA sequence >SLC490 (SLC490Q) /CSM/SL/SLC4-D/SLC490Q.Seq.d/ XXXXX...itochondrial 24.0 %: cytoplasmic 24.0 %: nuclear 4.0 %: cytoskeletal 4.0 %: plasma membrane 4.0 %: peroxisomal >> prediction for SLC4

  8. Dicty_cDB: SLC474 [Dicty_cDB

    Full Text Available SL (Link to library) SLC474 (Link to dictyBase) - - - Contig-U01121-1 SLC474Z (Link... to Original site) - - SLC474Z 431 - - - - Show SLC474 Library SL (Link to library) Clone ID SLC474 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC474Q.Seq.d/ Representative seq. ID SLC47...4Z (Link to Original site) Representative DNA sequence >SLC474 (SLC474Q) /CSM/SL/SLC4-D/SLC474Q.Seq.d/ XXXXX... Score E Sequences producing significant alignments: (bits) Value SLC474 (SLC474Q) /CSM/SL/SLC4-D/SLC474Q.Se

  9. Dicty_cDB: SLC473 [Dicty_cDB

    Full Text Available SL (Link to library) SLC473 (Link to dictyBase) - - - Contig-U16054-1 SLC473F (Link to Original site) SLC4...73F 698 - - - - - - Show SLC473 Library SL (Link to library) Clone ID SLC473 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC473Q.Seq.d/ Representative seq. ID SLC47...3F (Link to Original site) Representative DNA sequence >SLC473 (SLC473Q) /CSM/SL/SLC4-D/SLC473Q.Seq.d/ AGAAA... CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLC473 (SLC473Q) /CSM/SL/SLC4

  10. Dicty_cDB: SLC470 [Dicty_cDB

    Full Text Available SL (Link to library) SLC470 (Link to dictyBase) - - - Contig-U15735-1 SLC470Z (Link... to Original site) - - SLC470Z 386 - - - - Show SLC470 Library SL (Link to library) Clone ID SLC470 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC470Q.Seq.d/ Representative seq. ID SLC47...0Z (Link to Original site) Representative DNA sequence >SLC470 (SLC470Q) /CSM/SL/SLC4-C/SLC470Q.Seq.d/ XXXXX...Seq.d/ 533 e-151 SLF229 (SLF229Q) /CSM/SL/SLF2-B/SLF229Q.Seq.d/ 533 e-151 SLC470 (SLC470Q) /CSM/SL/SLC4-C/SLC4

  11. Dicty_cDB: SLC448 [Dicty_cDB

    Full Text Available SL (Link to library) SLC448 (Link to dictyBase) - - - Contig-U15118-1 SLC448E (Link... to Original site) - - - - - - SLC448E 245 Show SLC448 Library SL (Link to library) Clone ID SLC448 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC448Q.Seq.d/ Representative seq. ID SLC44...8E (Link to Original site) Representative DNA sequence >SLC448 (SLC448Q) /CSM/SL/SLC4-B/SLC448Q.Seq.d/ GGTAA... %: nuclear 12.0 %: mitochondrial 8.0 %: cytoskeletal 4.0 %: endoplasmic reticulum >> prediction for SLC4

  12. Dicty_cDB: SLC464 [Dicty_cDB

    Full Text Available SL (Link to library) SLC464 (Link to dictyBase) - - - Contig-U00917-1 SLC464Z (Link... to Original site) - - SLC464Z 406 - - - - Show SLC464 Library SL (Link to library) Clone ID SLC464 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC464Q.Seq.d/ Representative seq. ID SLC46...4Z (Link to Original site) Representative DNA sequence >SLC464 (SLC464Q) /CSM/SL/SLC4-C/SLC464Q.Seq.d/ XXXXX... Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLC464 (SLC4

  13. Dicty_cDB: SLC477 [Dicty_cDB

    Full Text Available SL (Link to library) SLC477 (Link to dictyBase) - - - Contig-U16260-1 SLC477Z (Link... to Original site) - - SLC477Z 326 - - - - Show SLC477 Library SL (Link to library) Clone ID SLC477 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC477Q.Seq.d/ Representative seq. ID SLC47...7Z (Link to Original site) Representative DNA sequence >SLC477 (SLC477Q) /CSM/SL/SLC4-D/SLC477Q.Seq.d/ XXXXX...hfefsnivikskkkkkkkkkkkkkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLC477 (SLC4

  14. Dicty_cDB: SLC484 [Dicty_cDB

    Full Text Available SL (Link to library) SLC484 (Link to dictyBase) - - - Contig-U15497-1 SLC484Z (Link... to Original site) - - SLC484Z 462 - - - - Show SLC484 Library SL (Link to library) Clone ID SLC484 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC484Q.Seq.d/ Representative seq. ID SLC48...4Z (Link to Original site) Representative DNA sequence >SLC484 (SLC484Q) /CSM/SL/SLC4-D/SLC484Q.Seq.d/ XXXXX...mic 32.0 %: mitochondrial 16.0 %: nuclear 4.0 %: peroxisomal 4.0 %: endoplasmic reticulum >> prediction for SLC4

  15. Dicty_cDB: SLC425 [Dicty_cDB

    Full Text Available SL (Link to library) SLC425 (Link to dictyBase) - - - Contig-U16276-1 SLC425Z (Link... to Original site) - - SLC425Z 515 - - - - Show SLC425 Library SL (Link to library) Clone ID SLC425 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC425Q.Seq.d/ Representative seq. ID SLC42...5Z (Link to Original site) Representative DNA sequence >SLC425 (SLC425Q) /CSM/SL/SLC4-B/SLC425Q.Seq.d/ XXXXX...producing significant alignments: (bits) Value SLC425 (SLC425Q) /CSM/SL/SLC4-B/SLC4

  16. Dicty_cDB: SLC487 [Dicty_cDB

    Full Text Available SL (Link to library) SLC487 (Link to dictyBase) - - - Contig-U12865-1 SLC487Z (Link... to Original site) - - SLC487Z 404 - - - - Show SLC487 Library SL (Link to library) Clone ID SLC487 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC487Q.Seq.d/ Representative seq. ID SLC48...7Z (Link to Original site) Representative DNA sequence >SLC487 (SLC487Q) /CSM/SL/SLC4-D/SLC487Q.Seq.d/ XXXXX...1 0.0 SSF377 (SSF377Q) /CSM/SS/SSF3-D/SSF377Q.Seq.d/ 801 0.0 SLC492 (SLC492Q) /CSM/SL/SLC4-D/SLC4

  17. Dicty_cDB: SLC433 [Dicty_cDB

    Full Text Available SL (Link to library) SLC433 (Link to dictyBase) - - - Contig-U16397-1 SLC433Z (Link... to Original site) - - SLC433Z 613 - - - - Show SLC433 Library SL (Link to library) Clone ID SLC433 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC433Q.Seq.d/ Representative seq. ID SLC43...3Z (Link to Original site) Representative DNA sequence >SLC433 (SLC433Q) /CSM/SL/SLC4-B/SLC433Q.Seq.d/ XXXXX...tyostelium discoideum slug cDNA, clone SLH872. 1134 0.0 1 ( AU034279 ) Dictyostelium discoideum slug cDNA, clone SLC4

  18. Dicty_cDB: SLC435 [Dicty_cDB

    Full Text Available SL (Link to library) SLC435 (Link to dictyBase) - - - Contig-U16260-1 SLC435E (Link... to Original site) - - - - - - SLC435E 373 Show SLC435 Library SL (Link to library) Clone ID SLC435 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC435Q.Seq.d/ Representative seq. ID SLC43...5E (Link to Original site) Representative DNA sequence >SLC435 (SLC435Q) /CSM/SL/SLC4-B/SLC435Q.Seq.d/ GGAGA...I815Q) /CSM/SL/SLI8-A/SLI815Q.Seq.d/ 694 0.0 SLC435 (SLC435Q) /CSM/SL/SLC4-B/SLC4

  19. Dicty_cDB: SLC481 [Dicty_cDB

    Full Text Available SL (Link to library) SLC481 (Link to dictyBase) - - - Contig-U16358-1 SLC481Z (Link... to Original site) - - SLC481Z 393 - - - - Show SLC481 Library SL (Link to library) Clone ID SLC481 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC481Q.Seq.d/ Representative seq. ID SLC48...1Z (Link to Original site) Representative DNA sequence >SLC481 (SLC481Q) /CSM/SL/SLC4-D/SLC481Q.Seq.d/ XXXXX...SL/SLG8-A/SLG820Q.Seq.d/ 708 0.0 SLC481 (SLC481Q) /CSM/SL/SLC4-D/SLC481Q.Seq.d/ 708 0.0 SLC178 (SLC178Q) /CS

  20. Dicty_cDB: SSB373 [Dicty_cDB

    Full Text Available SS (Link to library) SSB373 (Link to dictyBase) - G00609 DDB0216216 Contig-U04543-1...nk to library) Clone ID SSB373 (Link to dictyBase) Atlas ID - NBRP ID G00609 dictyBase ID DDB0216216 Link to... Contig Contig-U04543-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...Value N AB016728 |AB016728.1 Dictyostelium discoideum sapA mRNA for saposin A, co... 44 7e-04 12 AC116330 |AC116330.2 Dictyostelium discoideum chromosome 2 map 3191214-3323468 strain AX4, comp

  1. Dicty_cDB: AFJ513 [Dicty_cDB

    Full Text Available AF (Link to library) AFJ513 (Link to dictyBase) - G20675 DDB0218542 Contig-U10004-1...brary) Clone ID AFJ513 (Link to dictyBase) Atlas ID - NBRP ID G20675 dictyBase ID DDB0218542 Link to Contig ...Contig-U10004-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFJ5-...LLVNLVV VNDSGDIEPDTIIPLVDG--- ---SCFECSLXAFPPQVSYAICTIANTPRVPEHCIQWALLFGLQDATLEKPFDPKQFDND NPDHMNWLFECAKKRAE...r*r*rll*ti*ncycrfrfnrskkmd*wfis*fsc ck**w*y*trynhsig*ww--- ---SCFECSLXAFPPQVSYAICT

  2. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB668 (Link to dictyBase) - G00394 DDB0168247 Contig-U09555-1...brary) Clone ID VFB668 (Link to dictyBase) Atlas ID - NBRP ID G00394 dictyBase ID DDB0168247 Link to Contig ...Contig-U09555-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFB6-...uences producing significant alignments: (bits) Value N AC117072 |AC117072.2 Dictyostelium discoideum chromo...tein Score E Sequences producing significant alignments: (bits) Value AC117076_25

  3. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB677 (Link to dictyBase) - G02518 DDB0188526 Contig-U02066-1...brary) Clone ID VFB677 (Link to dictyBase) Atlas ID - NBRP ID G02518 dictyBase ID DDB0188526 Link to Contig ...Contig-U02066-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFB6-...nfnytrgccsygdl*wy*gtr*tih*kdr*lwcassfenfndtictit mfnr**sstwfeilskrsih*rgikc*hd*nh..._25( AC116960 |pid:none) Dictyostelium discoideum chromoso... 90 2e-16 CP001276_520( CP001276 |pid:none) The

  4. Antidiabetic and Antiobesity Effects of Artemether in db/db Mice

    Yu Guo

    2018-01-01

    Full Text Available This study is designed to investigate the effect of artemether on type 2 diabetic db/db mice. The experiments consisted of three groups: normal control (NC, db/+, 1% methylcellulose, intragastric administration, diabetic control (DM, db/db, 1% methylcellulose, intragastric administration, and artemether treated (artemether, db/db, 200 mg/kg of artemether, intragastric administration. The treatment lasted for two weeks. The food intake, body weight, and fasting blood glucose of mice were measured every three days. At the start and end of the experiment, the intraperitoneal glucose tolerance test (IPGTT and insulin tolerance test (IPITT were performed. We determined the serum insulin and glucagon levels by ELISA kits and calculated insulin resistance index (HOME-IR. HE staining was used to observe the morphologies of pancreas and liver in mice. The damage of pancreatic beta cells was evaluated by TUNEL staining and immunofluorescence. We found the following: (1 compared with the DM group, the food intake and weight increase rate of artemether group significantly reduced (P<0.05; (2 compared with pretreatment, artemether significantly reduced the fasting blood glucose levels, and the areas under the curves (AUCs of IPGTT were decreased significantly, increasing the tolerance to glucose of db/db mice. (P<0.05; (3 artemether improved hyperinsulinemia and decreased the AUCs of IPITT and HOME-IR, increasing the insulin sensitivity of db/db mice. (4 Artemether significantly ameliorated islet vacuolar degeneration and hepatic steatosis in db/db mice. (5 Artemether reduced the apoptosis of pancreatic beta cells and increased insulin secretion in db/db mice compared with DM group (P<0.05. Our results indicated that artemether significantly improved glucose homeostasis and insulin resistance and had the potential activity to prevent obesity, reduced the severity of fatty liver, and protected pancreatic beta cells, promising to treat type 2 diabetes.

  5. IBM DB2 97 Advanced Administration Cookbook

    Neagu, Adrian

    2012-01-01

    This cookbook has recipes written in a simple, easy to understand format, with lots of screenshots and insightful tips and hints. If you are a DB2 Database Administrator who wants to understand and get hands on with the underlying aspects of database administration, then this book is for you. This book assumes that you have a basic understanding of DB2 database concepts.

  6. Getting started with OrientDB

    Tesoriero, Claudio

    2013-01-01

    A standard tutorial aimed at making you an OrientDB expert, through the use of practical examples, explained in a step-by-step format.Getting Started with OrientDB 1.3.0 is great for database designers, developers, and systems engineers. It is assumed that you are familiar with NoSQL concepts, Java, and networking principles.

  7. Dicty_cDB: VFD492 [Dicty_cDB

    Full Text Available VF (Link to library) VFD492 (Link to dictyBase) - - - Contig-U16603-1 VFD492P (Link to Original site) VFD492...F 516 VFD492Z 653 VFD492P 1169 - - Show VFD492 Library VF (Link to library) Clone ID VFD492...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFD4-D/VFD492Q.Seq.d/ Representative seq. ID VFD492...P (Link to Original site) Representative DNA sequence >VFD492 (VFD492Q) /CSM/VF/VFD4-D/VFD492...al 8.0 %: nuclear >> prediction for VFD492 is exc 5' end seq. ID VFD492F 5' end seq. >VFD492

  8. Dicty_cDB: SLD492 [Dicty_cDB

    Full Text Available SL (Link to library) SLD492 (Link to dictyBase) - - - Contig-U11049-1 SLD492P (Link to Original site) SLD492...F 347 SLD492Z 454 SLD492P 801 - - Show SLD492 Library SL (Link to library) Clone ID SLD492... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLD4-D/SLD492Q.Seq.d/ Representative seq. ID SLD492...P (Link to Original site) Representative DNA sequence >SLD492 (SLD492Q) /CSM/SL/SLD4-D/SLD492...nces producing significant alignments: (bits) Value SLD492 (SLD492Q) /CSM/SL/SLD4-D/SLD492

  9. Dicty_cDB: CFD492 [Dicty_cDB

    Full Text Available CF (Link to library) CFD492 (Link to dictyBase) - - - Contig-U10808-1 CFD492P (Link to Original site) CFD492...F 583 CFD492Z 527 CFD492P 1110 - - Show CFD492 Library CF (Link to library) Clone ID CFD492...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD4-D/CFD492Q.Seq.d/ Representative seq. ID CFD492...P (Link to Original site) Representative DNA sequence >CFD492 (CFD492Q) /CSM/CF/CFD4-D/CFD492...omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD492 (CFD492

  10. Dicty_cDB: SHD492 [Dicty_cDB

    Full Text Available SH (Link to library) SHD492 (Link to dictyBase) - - - Contig-U16471-1 SHD492P (Link to Original site) SHD492...F 121 SHD492Z 819 SHD492P 920 - - Show SHD492 Library SH (Link to library) Clone ID SHD492... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SH/SHD4-D/SHD492Q.Seq.d/ Representative seq. ID SHD492...P (Link to Original site) Representative DNA sequence >SHD492 (SHD492Q) /CSM/SH/SHD4-D/SHD492....Seq.d/ 805 0.0 SHD613 (SHD613Q) /CSM/SH/SHD6-A/SHD613Q.Seq.d/ 805 0.0 SHD492 (SHD492Q) /CSM/SH/SHD4-D/SHD492

  11. Dicty_cDB: SLH292 [Dicty_cDB

    Full Text Available SL (Link to library) SLH292 (Link to dictyBase) - G01986 DDB0185621 Contig-U15046-1 SLH2...92P (Link to Original site) SLH292F 431 SLH292Z 307 SLH292P 738 - - Show SLH292 Library SL (Link to library) Clone ID SLH2...ontig-U15046-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH2...92Q.Seq.d/ Representative seq. ID SLH292P (Link to Original site) Representative DNA sequence >SLH292 (SLH292Q) /CSM/SL/SLH2...-D/SLH292Q.Seq.d/ ATTTTCTATACAAATAAAAAAAAAAAAAAAAAAAAAAAATAAAAATAAAAATAAAAATAA AAATTTAA

  12. Dicty_cDB: SLH284 [Dicty_cDB

    Full Text Available SL (Link to library) SLH284 (Link to dictyBase) - - - Contig-U15748-1 SLH284P (Link to Original site) SLH2...84F 544 SLH284Z 467 SLH284P 1011 - - Show SLH284 Library SL (Link to library) Clone ID SLH2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH284Q.Seq.d/ Representative seq. ID SLH2...84P (Link to Original site) Representative DNA sequence >SLH284 (SLH284Q) /CSM/SL/SLH2-D/SLH2...DNA Score E Sequences producing significant alignments: (bits) Value SLH284 (SLH284Q) /CSM/SL/SLH2-D/SLH284Q

  13. Dicty_cDB: SLH273 [Dicty_cDB

    Full Text Available SL (Link to library) SLH273 (Link to dictyBase) - - - Contig-U16280-1 SLH273P (Link to Original site) SLH2...73F 241 SLH273Z 294 SLH273P 535 - - Show SLH273 Library SL (Link to library) Clone ID SLH2... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH273Q.Seq.d/ Representative seq. ID SLH2...73P (Link to Original site) Representative DNA sequence >SLH273 (SLH273Q) /CSM/SL/SLH2-D/SLH2...ducing significant alignments: (bits) Value SLH273 (SLH273Q) /CSM/SL/SLH2-D/SLH273Q.Seq.d/ 868 0.0 SSK467 (S

  14. Dicty_cDB: SLH243 [Dicty_cDB

    Full Text Available SL (Link to library) SLH243 (Link to dictyBase) - - - Contig-U15469-1 SLH243P (Link to Original site) SLH2...43F 436 SLH243Z 369 SLH243P 805 - - Show SLH243 Library SL (Link to library) Clone ID SLH2... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH243Q.Seq.d/ Representative seq. ID SLH2...43P (Link to Original site) Representative DNA sequence >SLH243 (SLH243Q) /CSM/SL/SLH2-B/SLH2...SA605. 785 0.0 1 ( AU062023 ) Dictyostelium discoideum slug cDNA, clone SLH243. 785 0.0 1 ( BJ416791 ) Dicty

  15. Dicty_cDB: SLH288 [Dicty_cDB

    Full Text Available SL (Link to library) SLH288 (Link to dictyBase) - - - Contig-U16287-1 SLH288P (Link to Original site) SLH2...88F 594 SLH288Z 688 SLH288P 1282 - - Show SLH288 Library SL (Link to library) Clone ID SLH2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH288Q.Seq.d/ Representative seq. ID SLH2...88P (Link to Original site) Representative DNA sequence >SLH288 (SLH288Q) /CSM/SL/SLH2-D/SLH2...hsiikikkkkikkkasiinn*kkkkkkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLH288 (SLH2

  16. Dicty_cDB: SLH239 [Dicty_cDB

    Full Text Available SL (Link to library) SLH239 (Link to dictyBase) - G22492 DDB0190970 Contig-U04169-1 SLH2...39F (Link to Original site) SLH239F 460 - - - - - - Show SLH239 Library SL (Link to library) Clone ID SLH2...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH239Q.Seq.d/ ...Representative seq. ID SLH239F (Link to Original site) Representative DNA sequence >SLH239 (SLH239Q) /CSM/SL/SLH2-B/SLH2...uences producing significant alignments: (bits) Value SLH239 (SLH239Q) /CSM/SL/SLH2-B/SLH239Q.Seq.d/ 640 0.0

  17. Dicty_cDB: SLH282 [Dicty_cDB

    Full Text Available SL (Link to library) SLH282 (Link to dictyBase) - - - Contig-U10985-1 | Contig-U15908-1 SLH2...82P (Link to Original site) SLH282F 506 SLH282Z 455 SLH282P 961 - - Show SLH282 Library SL (Link to library) Clone ID SLH2...85-1 | Contig-U15908-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH2...82Q.Seq.d/ Representative seq. ID SLH282P (Link to Original site) Representative DNA sequence >SLH282 (SLH2...82Q) /CSM/SL/SLH2-D/SLH282Q.Seq.d/ GGTTTTTAAAACTATTGATACTGAAGAGAATGGAATTATATCAATAACACAATTAAGACA

  18. Dicty_cDB: SLH249 [Dicty_cDB

    Full Text Available SL (Link to library) SLH249 (Link to dictyBase) - G24226 DDB0215670 Contig-U04170-1 SLH2...49E (Link to Original site) - - - - - - SLH249E 689 Show SLH249 Library SL (Link to library) Clone ID SLH2...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-C/SLH249Q.Seq.d/ ...Representative seq. ID SLH249E (Link to Original site) Representative DNA sequence >SLH249 (SLH249Q) /CSM/SL/SLH2-C/SLH2...re E Sequences producing significant alignments: (bits) Value SLH249 (SLH249Q) /CSM/SL/SLH2-C/SLH2

  19. Dicty_cDB: SLH295 [Dicty_cDB

    Full Text Available SL (Link to library) SLH295 (Link to dictyBase) - - - Contig-U15436-1 SLH295E (Link to Original site) SLH2...95F 644 SLH295Z 632 SLH295P 1276 SLH295E 1045 Show SLH295 Library SL (Link to library) Clone ID SLH2...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH295Q.Seq.d/ Representative seq. ID SLH2...95E (Link to Original site) Representative DNA sequence >SLH295 (SLH295Q) /CSM/SL/SLH2-D/SLH2...q*wfnpclqiiipinflikiskkkkkkkkkkkkkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLH2

  20. Dicty_cDB: SLH274 [Dicty_cDB

    Full Text Available SL (Link to library) SLH274 (Link to dictyBase) - G22493 DDB0218769 Contig-U04171-1 SLH2...74F (Link to Original site) SLH274F 340 - - - - - - Show SLH274 Library SL (Link to library) Clone ID SLH2...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH274Q.Seq.d/ ...Representative seq. ID SLH274F (Link to Original site) Representative DNA sequence >SLH274 (SLH274Q) /CSM/SL/SLH2-D/SLH2...core E Sequences producing significant alignments: (bits) Value SLH274 (SLH274Q) /CSM/SL/SLH2-D/SLH274Q.Seq.

  1. Dicty_cDB: SLH207 [Dicty_cDB

    Full Text Available SL (Link to library) SLH207 (Link to dictyBase) - - - Contig-U11514-1 SLH207P (Link to Original site) SLH2...07F 689 SLH207Z 675 SLH207P 1364 - - Show SLH207 Library SL (Link to library) Clone ID SLH2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH207Q.Seq.d/ Representative seq. ID SLH2...07P (Link to Original site) Representative DNA sequence >SLH207 (SLH207Q) /CSM/SL/SLH2-A/SLH2...**yi Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLH207 (SLH207Q) /CSM/SL/SLH2-A/SLH2

  2. Dicty_cDB: SLH238 [Dicty_cDB

    Full Text Available SL (Link to library) SLH238 (Link to dictyBase) - G22491 DDB0188118 Contig-U04168-1 SLH2...38F (Link to Original site) SLH238F 383 - - - - - - Show SLH238 Library SL (Link to library) Clone ID SLH2...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH238Q.Seq.d/ ...Representative seq. ID SLH238F (Link to Original site) Representative DNA sequence >SLH238 (SLH238Q) /CSM/SL/SLH2-B/SLH2...e E Sequences producing significant alignments: (bits) Value SLH238 (SLH238Q) /CSM/SL/SLH2-B/SLH2

  3. Dicty_cDB: SLH208 [Dicty_cDB

    Full Text Available SL (Link to library) SLH208 (Link to dictyBase) - - - Contig-U10711-1 SLH208P (Link to Original site) SLH2...08F 517 SLH208Z 692 SLH208P 1209 - - Show SLH208 Library SL (Link to library) Clone ID SLH2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH208Q.Seq.d/ Representative seq. ID SLH2...08P (Link to Original site) Representative DNA sequence >SLH208 (SLH208Q) /CSM/SL/SLH2-A/SLH2...wfr*fpfkimei*llnnstsltlpppplsiihil*lql*ye Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLH2

  4. Dicty_cDB: CHD534 [Dicty_cDB

    Full Text Available CH (Link to library) CHD534 (Link to dictyBase) - - - Contig-U15540-1 CHD534E (Link...) Clone ID CHD534 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Ori...nts: (bits) Value N AC114263 |AC114263.2 Dictyostelium discoideum chromosome 2 ma...p 215673-367476 strain AX4, complete sequence. 40 1e-05 6 AC117081 |AC117081.2 Dictyostelium discoideum chro...mosome 2 map 5862124-6045772 strain AX4, complete sequence. 40 2e-05 5 AJ277590 |AJ277590.1 Dictyostelium di

  5. Dicty_cDB: CHD405 [Dicty_cDB

    Full Text Available CH (Link to library) CHD405 (Link to dictyBase) - - - Contig-U15984-1 CHD405E (Link... Clone ID CHD405 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15984-1 Original site URL http://dict...ts) Value N AC115599 |AC115599.2 Dictyostelium discoideum chromosome 2 map 422909...8-4354721 strain AX4, complete sequence. 42 3e-11 9 AC115598 |AC115598.2 Dictyostelium discoideum chromosome... 2 map 581427-735498 strain AX4, complete sequence. 50 4e-11 11 CK417372 |CK417372.1 AUF_IpInt_56_d19 Intestine cDNA library Ict

  6. Dicty_cDB: VSG286 [Dicty_cDB

    Full Text Available VS (Link to library) VSG286 (Link to dictyBase) - - - Contig-U16209-1 VSG286E (Link... Clone ID VSG286 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16209-1 Original site URL http://dict...846 |BQ096846.1 IfHdk00487 Ictalurus furcatus head kidney cDNA library Ictalurus furcatus cDNA 5' similar to... Ribosomal protein Sa (laminin receptor 1), mRNA sequence. 46 2e-11 4 CK406973 |CK406973.1 AUF_IfLvr_212_m02 Ict...alurus furcatus liver cDNA library Ictalurus furcatus cDNA 5' similar to lami

  7. Dicty_cDB: VHK209 [Dicty_cDB

    Full Text Available VH (Link to library) VHK209 (Link to dictyBase) - - - Contig-U16260-1 VHK209P (Link to Original site) VHK2...09F 573 VHK209Z 765 VHK209P 1318 - - Show VHK209 Library VH (Link to library) Clone ID VHK2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2-A/VHK209Q.Seq.d/ Representative seq. ID VHK2...09P (Link to Original site) Representative DNA sequence >VHK209 (VHK209Q) /CSM/VH/VHK2-A/VHK2...Sequences producing significant alignments: (bits) Value N ( BJ446805 ) Dictyostelium discoideum cDNA clone:ddv63k2

  8. Dicty_cDB: VFK250 [Dicty_cDB

    Full Text Available VF (Link to library) VFK250 (Link to dictyBase) - - - Contig-U13825-1 VFK250P (Link to Original site) VFK2...50F 647 VFK250Z 679 VFK250P 1306 - - Show VFK250 Library VF (Link to library) Clone ID VFK2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFK2-C/VFK250Q.Seq.d/ Representative seq. ID VFK2...50P (Link to Original site) Representative DNA sequence >VFK250 (VFK250Q) /CSM/VF/VFK2-C/VFK2...re E Sequences producing significant alignments: (bits) Value VFK250 (VFK250Q) /CSM/VF/VFK2-C/VFK250Q.Seq.d/

  9. Dicty_cDB: VHK294 [Dicty_cDB

    Full Text Available VH (Link to library) VHK294 (Link to dictyBase) - - - Contig-U15304-1 VHK294P (Link to Original site) VHK2...94F 611 VHK294Z 780 VHK294P 1371 - - Show VHK294 Library VH (Link to library) Clone ID VHK2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2-D/VHK294Q.Seq.d/ Representative seq. ID VHK2...94P (Link to Original site) Representative DNA sequence >VHK294 (VHK294Q) /CSM/VH/VHK2-D/VHK2...yscfyw ns*i*ngsgyf**tfttti Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHK294 (VHK2

  10. Dicty_cDB: VHK296 [Dicty_cDB

    Full Text Available VH (Link to library) VHK296 (Link to dictyBase) - - - Contig-U16260-1 VHK296P (Link to Original site) VHK2...96F 531 VHK296Z 314 VHK296P 825 - - Show VHK296 Library VH (Link to library) Clone ID VHK2... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2-D/VHK296Q.Seq.d/ Representative seq. ID VHK2...96P (Link to Original site) Representative DNA sequence >VHK296 (VHK296Q) /CSM/VH/VHK2-D/VHK2... 5' ... 993 0.0 1 ( BJ427875 ) Dictyostelium discoideum cDNA clone:ddv63k24, 5' ... 993 0.0 1 ( BJ427874 ) D

  11. Dicty_cDB: VHK202 [Dicty_cDB

    Full Text Available VH (Link to library) VHK202 (Link to dictyBase) - - - Contig-U16260-1 VHK202P (Link to Original site) VHK2...02F 618 VHK202Z 741 VHK202P 1339 - - Show VHK202 Library VH (Link to library) Clone ID VHK2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2-A/VHK202Q.Seq.d/ Representative seq. ID VHK2...02P (Link to Original site) Representative DNA sequence >VHK202 (VHK202Q) /CSM/VH/VHK2-A/VHK2...446805 ) Dictyostelium discoideum cDNA clone:ddv63k21, 3' ... 1449 0.0 1 ( BJ446732 ) Dictyostelium discoide

  12. Dicty_cDB: VFK244 [Dicty_cDB

    Full Text Available VF (Link to library) VFK244 (Link to dictyBase) - - - Contig-U16513-1 VFK244E (Link to Original site) VFK2...44F 710 VFK244Z 703 VFK244P 1393 VFK244E 1166 Show VFK244 Library VF (Link to library) Clone ID VFK2...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFK2-B/VFK244Q.Seq.d/ Re...presentative seq. ID VFK244E (Link to Original site) Representative DNA sequence >VFK244 (VFK244Q) /CSM/VF/VFK2-B/VFK2...nsif*nlsnqnklnlfrk*k*ikkkn Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VFK244 (VFK2

  13. Dicty_cDB: VFK242 [Dicty_cDB

    Full Text Available VF (Link to library) VFK242 (Link to dictyBase) - - - Contig-U16260-1 VFK242P (Link to Original site) VFK2...42F 606 VFK242Z 292 VFK242P 878 - - Show VFK242 Library VF (Link to library) Clone ID VFK2... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFK2-B/VFK242Q.Seq.d/ Representative seq. ID VFK2...42P (Link to Original site) Representative DNA sequence >VFK242 (VFK242Q) /CSM/VF/VFK2-B/VFK2...eum cDNA clone:ddv63n23, 5' ... 1142 0.0 1 ( BJ427875 ) Dictyostelium discoideum cDNA clone:ddv63k24, 5' ...

  14. Dicty_cDB: VHK207 [Dicty_cDB

    Full Text Available VH (Link to library) VHK207 (Link to dictyBase) - - - Contig-U16260-1 VHK207P (Link to Original site) VHK2...07F 371 VHK207Z 713 VHK207P 1064 - - Show VHK207 Library VH (Link to library) Clone ID VHK2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2-A/VHK207Q.Seq.d/ Representative seq. ID VHK2...07P (Link to Original site) Representative DNA sequence >VHK207 (VHK207Q) /CSM/VH/VHK2-A/VHK2...ducing significant alignments: (bits) Value N ( BJ446805 ) Dictyostelium discoideum cDNA clone:ddv63k21, 3'

  15. Dicty_cDB: VHK254 [Dicty_cDB

    Full Text Available VH (Link to library) VHK254 (Link to dictyBase) - - - Contig-U16260-1 VHK254P (Link to Original site) VHK2...54F 616 VHK254Z 744 VHK254P 1340 - - Show VHK254 Library VH (Link to library) Clone ID VHK2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2-C/VHK254Q.Seq.d/ Representative seq. ID VHK2...54P (Link to Original site) Representative DNA sequence >VHK254 (VHK254Q) /CSM/VH/VHK2-C/VHK2...BJ446805 ) Dictyostelium discoideum cDNA clone:ddv63k21, 3' ... 1455 0.0 1 ( BJ446732 ) Dictyostelium discoi

  16. Dicty_cDB: VHK246 [Dicty_cDB

    Full Text Available VH (Link to library) VHK246 (Link to dictyBase) - - - Contig-U16440-1 VHK246P (Link to Original site) VHK2...46F 617 VHK246Z 760 VHK246P 1357 - - Show VHK246 Library VH (Link to library) Clone ID VHK2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2-B/VHK246Q.Seq.d/ Representative seq. ID VHK2...46P (Link to Original site) Representative DNA sequence >VHK246 (VHK246Q) /CSM/VH/VHK2-B/VHK2...y vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHK246 (VHK246Q) /CSM/VH/VHK2-B/VHK2

  17. Dicty_cDB: VFK273 [Dicty_cDB

    Full Text Available VF (Link to library) VFK273 (Link to dictyBase) - - - Contig-U16028-1 | Contig-U16311-1 VFK2...73P (Link to Original site) VFK273F 633 VFK273Z 575 VFK273P 1188 - - Show VFK273 Library VF (Link to library) Clone ID VFK2...028-1 | Contig-U16311-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFK2-D/VFK2...73Q.Seq.d/ Representative seq. ID VFK273P (Link to Original site) Representative DNA sequence >VFK273 (VFK2...73Q) /CSM/VF/VFK2-D/VFK273Q.Seq.d/ AAATCTTTATTAATATTTTTCAAAATAAATAAATAAATAAATTAAAAATGAAAGTTTTAT

  18. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB886 (Link to dictyBase) - - - Contig-U16382-1 VFB886E (Link...) Clone ID VFB886 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Ori...t alignments: (bits) Value N X03281 |X03281.1 Dictyostelium discoideum gene for actin A8. 2234 0.0 1 AC116957 |AC116957.2 Dict...4, complete sequence. 2107 0.0 3 M14146 |M14146.1 D.discoideum actin 15 gene, complete cds. 2034 0.0 1 AC115579 |AC115579.2 Dict...4 0.0 2 AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2234041-25

  19. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC115 (Link to dictyBase) - - - Contig-U16382-1 VFC115E (Link...) Clone ID VFC115 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Ori...ant alignments: (bits) Value N X03281 |X03281.1 Dictyostelium discoideum gene for actin A8. 954 0.0 7 AC116957 |AC116957.2 Dict...X4, complete sequence. 906 0.0 9 M14146 |M14146.1 D.discoideum actin 15 gene, complete cds. 890 0.0 7 AC115579 |AC115579.2 Dict...0.0 7 U25660 |U25660.1 Dictyostelium discoideum actin gene, partial cds. 866 0.0

  20. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB606 (Link to dictyBase) - - - Contig-U16382-1 VFB606E (Link...) Clone ID VFB606 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Ori...ucing significant alignments: (bits) Value N X03281 |X03281.1 Dictyostelium discoideum gene for actin A8. 22...28 0.0 1 AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 map 1685067-2...2028 0.0 1 AC115579 |AC115579.2 Dictyostelium discoideum chromosome 2 map 4915084-5005461 strain AX4, comple

  1. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB569 (Link to dictyBase) - - - Contig-U15456-1 VFB569E (Link...) Clone ID VFB569 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15456-1 Ori...7 0.0 own update 2004. 8. 9 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N Y16962 |Y16962.1 Dict...yostelium discoideum mRNA for cathepsin D. 2264 0.0 2 AJ243946 |AJ243946.1 Dictyoste...uclear 8.0 %: cytoplasmic 8.0 %: Golgi 8.0 %: endoplasmic reticulum >> prediction for VFB569 is exc 5' end s

  2. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB770 (Link to dictyBase) - - - Contig-U16382-1 VFB770E (Link...) Clone ID VFB770 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Ori...logy vs DNA Score E Sequences producing significant alignments: (bits) Value N X03281 |X03281.1 Dictyosteliu...m discoideum gene for actin A8. 2230 0.0 1 AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 map 16...deum actin 15 gene, complete cds. 2030 0.0 1 AC115579 |AC115579.2 Dictyostelium discoideum chromosome 2 map

  3. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFB662 (Link to dictyBase) - - - Contig-U15118-1 VFB662E (Link...) Clone ID VFB662 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15118-1 Ori... significant alignments: (bits) Value N AF039211 |AF039211.1 Dictyostelium discoideum ADP/ATP translocase mR...NA, complete cds. 1011 0.0 2 AF100676 |AF100676.1 Dictyostelium discoideum ADP/ATP translocase gene, complet...drial 4.0 %: extracellular, including cell wall 4.0 %: vacuolar 4.0 %: vesicles of secretory system >> predict

  4. Dicty_cDB: SHH233 [Dicty_cDB

    Full Text Available SH (Link to library) SHH233 (Link to dictyBase) - - - Contig-U11264-1 - (Link to Or...c08.g1 Strongyloides ratti whole genome shotgun library (SRAAGSS 004) Strongyloides ratti genomic...iginal site) - - SHH233Z 563 - - - - Show SHH233 Library SH (Link to library) Clone ID SHH233 (Link to dicty...631_5( AY458631 |pid:none) Uncultured marine bacterium 159 cl... 84 3e-15 CU92816...86F1 NIH_MGC_58 Homo sapiens cDNA clone IMAGE:4069772 5', mRNA sequence. 46 0.86 1 AP008210 |AP008210.1 Oryza sativa (japonica culti

  5. Dicty_cDB: CHJ796 [Dicty_cDB

    Full Text Available CH (Link to library) CHJ796 (Link to dictyBase) - - - - - (Link to Original site) -... - CHJ796Z 123 - - - - Show CHJ796 Library CH (Link to library) Clone ID CHJ796 (Link to dictyBase) Atlas ID - NBRP ID - dic...ssues normalized and once-subtracted cDNA library (gcal) clone gcal0009c.b.04, 5prim end (...ed and once-subtracted cDNA library (gcal) clone gcal0009c.b.04, 3prim end (M13F primer). 36 0.47 2 AF239838...0804 |pid:none) Roseiflexus castenholzii DSM 139... 33 2.3 AY714838_16( AY714838 |pid:none) Uncultured archa

  6. Dicty_cDB: SSI485 [Dicty_cDB

    Full Text Available ate cortex cDNA, RIKEN full-length enriched library, clone:A830088K09, 3' end partial sequence. 42 5.7 1 AC068663 |AC068663.4 Mus mu...SS (Link to library) SSI485 (Link to dictyBase) - - - Contig-U14077-1 SSI485F (Link... to Original site) SSI485F 438 - - - - - - Show SSI485 Library SS (Link to library) Clone ID SSI485 (Link to dic...cia MC0-3 ... 115 4e-25 EF100191_35( EF100191 |pid:none) Uncultured marine bacterium HF10_... 115 5e-25 AP00...9385_2657( AP009385 |pid:none) Burkholderia multivorans ATCC 1... 114 1e-24 BC056

  7. Dicty_cDB: SLA529 [Dicty_cDB

    Full Text Available SL (Link to library) SLA529 (Link to dictyBase) - - - Contig-U13922-1 SLA529F (Link... to Original site) SLA529F 670 - - - - - - Show SLA529 Library SL (Link to library) Clone ID SLA529 (Link to dic...1247( FM992688 |pid:none) Candida dubliniensis CD36 chrom... 35 2.6 EU565733_1( EU565733 |pid:none) Uncult...009385_2728( AP009385 |pid:none) Burkholderia multivorans ATCC 1... 33 5.8 AM260479_1383( AM260479 |pid:none...letal 8.0 %: mitochondrial 4.0 %: Golgi 4.0 %: vesicles of secretory system 4.0 %: endoplasmic reticul

  8. Dicty_cDB: SSC534 [Dicty_cDB

    Full Text Available SS (Link to library) SSC534 (Link to dictyBase) - - - Contig-U13922-1 SSC534Z (Link... to Original site) - - SSC534Z 711 - - - - Show SSC534 Library SS (Link to library) Clone ID SSC534 (Link to dic... 1.3 FM992688_1247( FM992688 |pid:none) Candida dubliniensis CD36 chrom... 35 3.0 EU565733_1( EU565733 |pid:none) Unculture... 20.0 %: nuclear 16.0 %: vesicles of secretory system 12.0 %: mitochondrial 8.0 %: Golgi 8.0 %: endoplasmic reticul...kholderia multivorans ATCC 1... 33 6.6 AM260479_1383( AM260479 |pid:none) Ralstonia e

  9. Dicty_cDB: SLI758 [Dicty_cDB

    Full Text Available a strain T4 cDNA library under conditions of nitrogen deprivation. 36 4.4 2 AC109962 |AC109962.4 Rattu...SL (Link to library) SLI758 (Link to dictyBase) - - - Contig-U13922-1 SLI758Z (Link... to Original site) - - SLI758Z 535 - - - - Show SLI758 Library SL (Link to library) Clone ID SLI758 (Link to dic...ida dubliniensis CD36 chrom... 35 1.6 EU565733_1( EU565733 |pid:none) Uncultured soil bacterium clone gl... ...kholderia sp. 383 chromosome... 34 2.8 AP009385_2728( AP009385 |pid:none) Burkholderia multivorans

  10. Dicty_cDB: SSH396 [Dicty_cDB

    Full Text Available SS (Link to library) SSH396 (Link to dictyBase) - - - Contig-U13922-1 SSH396Z (Link... to Original site) - - SSH396Z 473 - - - - Show SSH396 Library SS (Link to library) Clone ID SSH396 (Link to dic...niensis CD36 chrom... 35 1.1 EU565733_1( EU565733 |pid:none) Uncultured soil bacterium clone gl... 35 1.1 CP...kholderia sp. 383 chromosome... 34 1.9 AP009385_2728( AP009385 |pid:none) Burkholderia multivorans ATCC 1.....tory system 12.0 %: mitochondrial 8.0 %: Golgi 8.0 %: endoplasmic reticulum 4.0 %: extracellular, includi

  11. Dicty_cDB: AFK338 [Dicty_cDB

    Full Text Available AF (Link to library) AFK338 (Link to dictyBase) - - - - AFK338P (Link to Original s...ite) AFK338F 659 AFK338Z 221 AFK338P 880 - - Show AFK338 Library AF (Link to library) Clone ID AFK338 (Link to dic...01175_2502( CP001175 |pid:none) Listeria monocytogenes HCC23, c... 40 0.099 AY714838_16( AY714838 |pid:none) Unculture...A sequence. 44 3.0 1 AE006080 |AE006080.1 Pasteurella multocida PM70 section 47 o... 0.003 BX294148_242( BX294148 |pid:none) Rhodopirellula baltica SH 1 comp... 44 0.005 CP000910_1528( CP00091

  12. Dicty_cDB: SSC538 [Dicty_cDB

    Full Text Available SS (Link to library) SSC538 (Link to dictyBase) - - - Contig-U13922-1 SSC538Z (Link... to Original site) - - SSC538Z 712 - - - - Show SSC538 Library SS (Link to library) Clone ID SSC538 (Link to dic...SHR34... 36 1.3 FM992688_1247( FM992688 |pid:none) Candida dubliniensis CD36 chrom... 35 3.0 EU565733_1( EU565733 |pid:none) Uncultur...9385_2728( AP009385 |pid:none) Burkholderia multivorans ATCC 1... 33 6.6 AM260479_1383( AM260479 |pid:none) ... reticulum 4.0 %: extracellular, including cell wall 4.0 %: cytoskeletal 4.0 %: vacu

  13. Dicty_cDB: CHO774 [Dicty_cDB

    Full Text Available m cDNA clone 58915 5', mRNA sequence. 42 13 1 DN493309 |DN493309.1 X077H09.3pR Populus wood cDNA library Populus tremula x Popul...CH (Link to library) CHO774 (Link to dictyBase) - - - Contig-U12145-1 - (Link to Or...iginal site) - - CHO774Z 618 - - - - Show CHO774 Library CH (Link to library) Clone ID CHO774 (Link to dicty...osome 3. 42 13 1 CV435371 |CV435371.1 58915.1 Suspension culture Solanum tuberosu...manei cDNA 5, mRNA sequence. 34 2.1 2 AP004054 |AP004054.3 Oryza sativa (japonica culti

  14. Dicty_cDB: VHC756 [Dicty_cDB

    Full Text Available VH (Link to library) VHC756 (Link to dictyBase) - - - Contig-U16495-1 VHC756P (Link... to Original site) VHC756F 586 VHC756Z 656 VHC756P 1222 - - Show VHC756 Library VH (Link to library) Clone ID VHC756 (Link to dic...016xp13.g2 T.reesei mycelial culture, Version 6 October 2003 Hypocre...uence. 48 0.60 1 EB516459 |EB516459.1 289437 Pigtailed macaque ovary library Macaca nemestrina cDNA 3', mRNA... Sequences producing significant alignments: (bits) Value AP008208_2746( AP008208 |pid:none) Oryza sativa (japonica culti

  15. Dicty_cDB: CHH854 [Dicty_cDB

    Full Text Available 082874.2 Rainbow trout multi-tissues normalized library (tcac) clone tcac0005c.d.21, 5prim end (T7 primer). ...CH (Link to library) CHH854 (Link to dictyBase) - - - - - (Link to Original site) -... - CHH854Z 259 - - - - Show CHH854 Library CH (Link to library) Clone ID CHH854 (Link to dictyBase) Atlas ID - NBRP ID - dic...686 |pid:none) Roseiflexus sp. RS-1, complete ... 50 2e-05 AM913013_1( AM913013 |pid:none) Uncultured bacterium parti...Y458641_15( AY458641 |pid:none) Uncultured marine bacterium 463 c... 45 8e-04 CP000686_4190( CP000686 |pid:n

  16. Dicty_cDB: VHF145 [Dicty_cDB

    Full Text Available VH (Link to library) VHF145 (Link to dictyBase) - - - Contig-U15430-1 VHF145E (Link...) Clone ID VHF145 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15430-1 Ori...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116984 |AC116984.2 Dictyos... theta DNA for complete sequence of nucleomorph chromosome 2. 48 2e-07 2 ES451909 | PREDICTED: similar to PI...al 16.0 %: nuclear 8.0 %: vacuolar 8.0 %: endoplasmic reticulum 4.0 %: cytoskeletal >> prediction for VHF145

  17. Dicty_cDB: SLC443 [Dicty_cDB

    Full Text Available SL (Link to library) SLC443 (Link to dictyBase) - - - Contig-U16518-1 SLC443P (Link to Original site) SLC4...43F 466 SLC443Z 304 SLC443P 770 - - Show SLC443 Library SL (Link to library) Clone ID SLC4... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC443Q.Seq.d/ Representative seq. ID SLC4...43P (Link to Original site) Representative DNA sequence >SLC443 (SLC443Q) /CSM/SL/SLC4-B/SLC4...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLC443 (SLC443Q) /CSM/SL/SLC4-B/SLC4

  18. Dicty_cDB: SLC465 [Dicty_cDB

    Full Text Available SL (Link to library) SLC465 (Link to dictyBase) - G01923 DDB0190872 Contig-U14177-1 SLC4...65P (Link to Original site) SLC465F 725 SLC465Z 393 SLC465P 1118 - - Show SLC465 Library SL (Link to library) Clone ID SLC4...Contig-U14177-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-C/SLC4...65Q.Seq.d/ Representative seq. ID SLC465P (Link to Original site) Representative DNA sequence >SLC465 (SLC465Q) /CSM/SL/SLC4...-C/SLC465Q.Seq.d/ CGTTAACAGATTTTAATATTACTAATATTGTAGAAAATGATTTTAAATAAAGTAGCAAAA TGTTATG

  19. Dicty_cDB: SLC405 [Dicty_cDB

    Full Text Available SL (Link to library) SLC405 (Link to dictyBase) - - - Contig-U11279-1 | Contig-U16243-1 SLC4...05P (Link to Original site) SLC405F 536 SLC405Z 439 SLC405P 975 - - Show SLC405 Library SL (Link to library) Clone ID SLC4...79-1 | Contig-U16243-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC4...05Q.Seq.d/ Representative seq. ID SLC405P (Link to Original site) Representative DNA sequence >SLC405 (SLC4...05Q) /CSM/SL/SLC4-A/SLC405Q.Seq.d/ ATAACTAATAAAATGTCATTCAATTCAAGAATTGAAACTATTTCTCGCCACTTAAGCACT

  20. Dicty_cDB: SLC404 [Dicty_cDB

    Full Text Available SL (Link to library) SLC404 (Link to dictyBase) - G22406 DDB0190371 Contig-U03918-1 SLC4...04E (Link to Original site) - - - - - - SLC404E 229 Show SLC404 Library SL (Link to library) Clone ID SLC4...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC404Q.Seq.d/ ...Representative seq. ID SLC404E (Link to Original site) Representative DNA sequence >SLC404 (SLC404Q) /CSM/SL/SLC4-A/SLC4...y vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLC404 (SLC404Q) /CSM/SL/SLC4-A/SLC4