Final design of the Korean AC/DC converters for the ITER coil power supply system

Energy Technology Data Exchange (ETDEWEB)

Oh, Jong-Seok, E-mail: jsoh@nfri.re.kr [ITER Korea, National Fusion Research Institute, Daejeon 305-806 (Korea, Republic of); Choi, Jungwan; Suh, Jae-Hak; Choi, Jihyun [ITER Korea, National Fusion Research Institute, Daejeon 305-806 (Korea, Republic of); Lee, Lacksang; Kim, Changwoo; Park, Hyungjin; Jo, Seongman; Lee, Seungyun; Hwang, Kwangcheol; Liu, Hyoyol [Dawonsys Corp., Siheung 429-450 (Korea, Republic of); Hong, Ki-Don; Sim, Dong-Joon; Lee, Jang-Soo [Hyosung Corp., Gongdeok-Dong, Seoul 121-720 (Korea, Republic of); Lee, Eui-Jae; Kwon, Yang-Hae; Lee, Dae-Yeol; Ko, Ki-Won; Kim, Jong-Min [Mobiis Corp., Yangjae-dong, Seoul 137-888 (Korea, Republic of); Song, Inho [ITER Organization, Route de Vinon sur Verdon, CS 90 046, 13067 St. Paul Lez Durance Cedex (France); and others

2015-10-15

The final design of the ITER TF, CS, CC and VS AC/DC converters has been completed to implement ITER requirements following the detailed design and refinements of the preliminary design. The number of parallel thyristors and the rating of fuses are coordinated to keep those devices within the explosion limit even under most severe fault conditions. The impedance of the converter transformer has been optimized taking into account the energization inrush current, short circuit current, reactive power consumption and the available DC voltage. To ensure system integrity, AC/DC converters are mechanically divided into transformers, AC busbars, 6-pulse bridges, DC interconnecting busbars and DC reactors, and then all subsystems are decoupled by flexible links. To provide stable real time network communication down to the converters, a one GbE link is deployed between master controllers and local controllers. IEEE 1588 is implemented to the embedded controllers for precision time synchronization. This paper describes the detailed solutions implemented in the final design for the ITER AC/DC converters with R&D results of converter prototypes.

Three-Phase Multistage System (DC-AC-DC-AC for Connecting Solar Cells to the Grid

Directory of Open Access Journals (Sweden)

Mahmudreza Changizian

2017-11-01

Full Text Available Inverter systems that feed electrical power from photovoltaic (PV system into the grid must convert the direct current of the PV array into the alternating current of the grid. In many applications, it is important for a converter to be lightweight, highly reliable, input/output isolated, flexible and operable in a boost mode. These features can be achieved by using a High-Frequency inverter which involves an isolated DC-DC stage and DC-AC section, which provides AC output. This paper proposes a new three phase topology, based on multi stage converter and PV system in order to use in medium and high power applications. The Perturb and Observe (P&O method is used for maximum power point tracking (MPPT control of PV array. The switching control signals for three-phase inverter are provided by hysteresis control method. Also, the comparison between the proposed topology and traditional structures has been conducted and finally the simulation researches are performed in a closed-loop control system by MATLAB/Simulink software to verify the operation of the proposed structure. The results represent better performance of the introduced system over traditional topologies.

Reconfigurable DC Links for Restructuring Existing Medium Voltage AC Distribution Grids

NARCIS (Netherlands)

Shekhar, A.; Ramirez Elizondo, L.M.; Feng, Xianyong; Kontos, E.; Bauer, P.

2018-01-01

While the scientific community recognizes the benefits of DC power transfer, the distribution network operators point out the practical and economic constraints in refurbishing the existing AC network at a medium-voltage level. Some apprehensions like reliability, cost of ownership, and safety in

Reduction of DC-link Capacitor in Case of Cascade Multilevel Converters by means of Reactive Power Control

DEFF Research Database (Denmark)

Gohil, Ghanshyamsinh Vijaysinh; Wang, Huai; Liserre, Marco

2014-01-01

A method to selectively control the amount of dc link voltage ripple by processing desired reactive power by a DC/DC converter in isolated AC/DC or AC/DC/AC system is proposed. The concept can reduce the dc link capacitors used for balancing the input and output power and thereby limiting...... the voltage ripple. It allows the use of smaller dc link capacitor and hence a longer lifetime and at the same time high power density and low cost can be achieved. The isolated DC/DC converter is controlled to process the desired reactive power in addition to the active power. The control system to achieve...

Determination of input/output characteristics of full-bridge AC/DC/DC converter for arc welding

OpenAIRE

Stefanov, Goce; Karadzinov, Ljupco; Sarac, Vasilija; Cingoski, Vlatko; Gelev, Saso

2016-01-01

This paper describes the design and practical implementation of AC/DC/DC converter in mode of arc welding. An analysis of the operation of AC/DC/DC converter and its input/output characteristics are determined with computer simulations. The practical part is consisted of AC/DC/DC converter prototype for arc welding with output power of 3 kW and switching frequency of 64 kHz. The operation of AC/DC/DC converter is validated with experimental measurements.

Distributed Control for Autonomous Operation of a Three-Port AC/DC/DS Hybrid Microgrid

DEFF Research Database (Denmark)

Wang, Peng; Jin, Chi; Zhu, Dexuan

2015-01-01

This paper presents a distributed control scheme for reliable autonomous operation of a hybrid three-port ac/dc/distributed storage (ds) microgrid by means of power sharing in individual network, power exchange between ac and dc networks, and power management among three networks. The proposed...... distributed control scheme includes: 1) a fully decentralized control, which is achieved by local power sharing (LPS) in individual ac or dc network, global power sharing (GPS) throughout ac/dc networks, and storage power sharing (SPS) among distributed storages. Upon fully decentralized control, each power...... module can operate independently without communication links. This would benefit for riding through communication malfunction in multilayer supervision control system; 2) a multilevel power exchange control for scheduling LPS, GPS, and SPS has been developed to reduce unnecessary power exchange between...

Small-Signal Analysis of Single-Phase and Three-phase DC/AC and AC/DC PWM Converters with the Frequency-Shift Technique

DEFF Research Database (Denmark)

Blaabjerg, Frede; Aquila, A. Dell’; Liserre, Marco

2004-01-01

of dc/dc converters via a 50 Hz frequency-shift. The input admittance is calculated and measured for two study examples (a three-phase active rectifier and a single-phase photovoltaic inverter). These examples show that the purpose of a well designed controller for grid-connected converters......A systematic approach to study dc/ac and ac/dc converters without the use of synchronous transformation is proposed. The use of a frequency-shift technique allows a straightforward analysis of single-phase and three-phase systems. The study of dc/ac and of ac/dc converters is reported to the study...... is to minimize the input admittance in order to make the grid converter more robust to grid disturbance....

An Integrated Multifunctional Bidirectional AC/DC and DC/DC Converter for Electric Vehicles Applications

OpenAIRE

Liwen Pan; Chengning Zhang

2016-01-01

This paper presents an on-board vehicular battery charger that integrates bidirectional AC/DC converter and DC/DC converter to achieve high power density for application in electric vehicles (EVs). The integrated charger is able to transfer electrical energy between the battery pack and the electric traction system and to function as an AC/DC battery charger. The integrated charger topology is presented and the design of passive components is discussed. The control schemes are developed for m...

A single-phase embedded Z-source DC-AC inverter.

Science.gov (United States)

Kim, Se-Jin; Lim, Young-Cheol

2014-01-01

In the conventional DC-AC inverter consisting of two DC-DC converters with unipolar output capacitors, the output capacitor voltages of the DC-DC converters must be higher than the DC input voltage. To overcome this weakness, this paper proposes a single-phase DC-AC inverter consisting of two embedded Z-source converters with bipolar output capacitors. The proposed inverter is composed of two embedded Z-source converters with a common DC source and output AC load. Though the output capacitor voltages of the converters are relatively low compared to those of a conventional inverter, an equivalent level of AC output voltages can be obtained. Moreover, by controlling the output capacitor voltages asymmetrically, the AC output voltage of the proposed inverter can be higher than the DC input voltage. To verify the validity of the proposed inverter, experiments were performed with a DC source voltage of 38 V. By controlling the output capacitor voltages of the converters symmetrically or asymmetrically, the proposed inverter can produce sinusoidal AC output voltages. The experiments show that efficiencies of up to 95% and 97% can be achieved with the proposed inverter using symmetric and asymmetric control, respectively.

Interlink Converter with Linear Quadratic Regulator Based Current Control for Hybrid AC/DC Microgrid

Directory of Open Access Journals (Sweden)

Dwi Riana Aryani

2017-11-01

Full Text Available A hybrid alternate current/direct current (AC/DC microgrid consists of an AC subgrid and a DC subgrid, and the subgrids are connected through the interlink bidirectional AC/DC converter. In the stand-alone operation mode, it is desirable that the interlink bidirectional AC/DC converter manages proportional power sharing between the subgrids by transferring power from the under-loaded subgrid to the over-loaded one. In terms of system security, the interlink bidirectional AC/DC converter takes an important role, so proper control strategies need to be established. In addition, it is assumed that a battery energy storage system is installed in one subgrid, and the coordinated control of interlink bidirectional AC/DC converter and battery energy storage system converter is required so that the power sharing scheme between subgrids becomes more efficient. For the purpose of designing a tracking controller for the power sharing by interlink bidirectional AC/DC converter in a hybrid AC/DC microgrid, a droop control method generates a power reference for interlink bidirectional AC/DC converter based on the deviation of the system frequency and voltages first and then interlink bidirectional AC/DC converter needs to transfer the power reference to the over-loaded subgrid. For efficiency of this power transferring, a linear quadratic regulator with exponential weighting for the current regulation of interlink bidirectional AC/DC converter is designed in such a way that the resulting microgrid can operate robustly against various uncertainties and the power sharing is carried out quickly. Simulation results show that the proposed interlink bidirectional AC/DC converter control strategy provides robust and efficient power sharing scheme between the subgrids without deteriorating the secure system operation.

Overmodulation of n-level three-leg DC-AC diode-clamped converters with comprehensive capacitor voltage balance

DEFF Research Database (Denmark)

Busquets-Monge, S.; Maheshwari, Ram Krishan; Munk-Nielsen, Stig

2013-01-01

This paper presents a novel PWM strategy for nlevel three-leg semiconductor-clamped dc-ac converters in the overmodulation region, with dc-link capacitor voltage balance in every switching cycle. The strategy is based on the virtual-vector concept. Suitable reference vector trajectories are selec......This paper presents a novel PWM strategy for nlevel three-leg semiconductor-clamped dc-ac converters in the overmodulation region, with dc-link capacitor voltage balance in every switching cycle. The strategy is based on the virtual-vector concept. Suitable reference vector trajectories...

Nonlinear control of voltage source converters in AC-DC power system.

Science.gov (United States)

Dash, P K; Nayak, N

2014-07-01

This paper presents the design of a robust nonlinear controller for a parallel AC-DC power system using a Lyapunov function-based sliding mode control (LYPSMC) strategy. The inputs for the proposed control scheme are the DC voltage and reactive power errors at the converter station and the active and reactive power errors at the inverter station of the voltage-source converter-based high voltage direct current transmission (VSC-HVDC) link. The stability and robust tracking of the system parameters are ensured by applying the Lyapunov direct method. Also the gains of the sliding mode control (SMC) are made adaptive using the stability conditions of the Lyapunov function. The proposed control strategy offers invariant stability to a class of systems having modeling uncertainties due to parameter changes and exogenous inputs. Comprehensive computer simulations are carried out to verify the proposed control scheme under several system disturbances like changes in short-circuit ratio, converter parametric changes, and faults on the converter and inverter buses for single generating system connected to the power grid in a single machine infinite-bus AC-DC network and also for a 3-machine two-area power system. Furthermore, a second order super twisting sliding mode control scheme has been presented in this paper that provides a higher degree of nonlinearity than the LYPSMC and damps faster the converter and inverter voltage and power oscillations. Copyright © 2014 ISA. Published by Elsevier Ltd. All rights reserved.

IGBT Based DC/DC Converter

Directory of Open Access Journals (Sweden)

M. Akherraz

1997-12-01

Full Text Available This paper presents an in-depth analytical and experimental investigation of an indirect DC-DC converter. The DC-AC conversion is a full bridge based on IGBT power modules, and the AC-DC conversion is done via a high  frequency AC link and a first diode bridge. The AC link, which consists of snubbing capacitors and a variable air-gap transformer, is analytically designed to fulfill Zero Voltage commutation requirement. The proposed converter is simulated using PSPICE and a prototype is designed built and tested in the laboratory. PSPICE simulation and experimental results are presented and compared.

An Integrated Multifunctional Bidirectional AC/DC and DC/DC Converter for Electric Vehicles Applications

Directory of Open Access Journals (Sweden)

Liwen Pan

2016-06-01

Full Text Available This paper presents an on-board vehicular battery charger that integrates bidirectional AC/DC converter and DC/DC converter to achieve high power density for application in electric vehicles (EVs. The integrated charger is able to transfer electrical energy between the battery pack and the electric traction system and to function as an AC/DC battery charger. The integrated charger topology is presented and the design of passive components is discussed. The control schemes are developed for motor drive system and battery-charging system with a power pulsation reduction circuit. Simulation results in MATLAB/Simulink and experiments on a 30-kW motor drive and 3.3-kW AC/DC charging prototype validate the performance of the proposed technology. In addition, power losses, efficiency comparison and thermal stress for the integrated charger are illustrated. The results of the analyses show the validity of the advanced integrated charger for electric vehicles.

A Dual-Buck–Boost AC/DC Converter for DC Nanogrid With Three Terminal Outputs

DEFF Research Database (Denmark)

Wu, Weimin; Wang, Houqing; Liu, Yuan

2017-01-01

Due to the widely used dc characterized loads and more distributed power generation sources, the dc nanogrid becomes more and more popular, and it is seen as an alternative to the ac grid. For safety considerations, the dc nanogrid should provide reliable grounding for the residential loads...... such as the low-voltage ac power system. There are three typical grounding configurations for a dc nanogrid: the united grounding, the unidirectional grounding, and the virtual isolated grounding. Each grounding configuration has its own specifications to ac/dc converters. In this paper, a dual-buck-boost ac/dc...... converter for use in the united-grounding-configuration-based dc nanogrid with three terminal outputs is proposed. The working principle of this converter is presented in detail through analyzing the equivalent circuits. Experiments are carried out to verify the theoretical analysis....

Ac-dc converter firing error detection

International Nuclear Information System (INIS)

Gould, O.L.

1996-01-01

Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

DC Link Current Estimation in Wind-Double Feed Induction Generator Power Conditioning System

Directory of Open Access Journals (Sweden)

MARIAN GAICEANU

2010-12-01

Full Text Available In this paper the implementation of the DC link current estimator in power conditioning system of the variable speed wind turbine is shown. The wind turbine is connected to double feed induction generator (DFIG. The variable electrical energy parameters delivered by DFIG are fitted with the electrical grid parameters through back-to-back power converter. The bidirectional AC-AC power converter covers a wide speed range from subsynchronous to supersynchronous speeds. The modern control of back-to-back power converter involves power balance concept, therefore its load power should be known in any instant. By using the power balance control, the DC link voltage variation at the load changes can be reduced. In this paper the load power is estimated from the dc link, indirectly, through a second order DC link current estimator. The load current estimator is based on the DC link voltage and on the dc link input current of the rotor side converter. This method presents certain advantages instead of using measured method, which requires a low pass filter: no time delay, the feedforward current component has no ripple, no additional hardware, and more fast control response. Through the numerical simulation the performances of the proposed DC link output current estimator scheme are demonstrated.

Impute DC link (IDCL) cell based power converters and control thereof

Science.gov (United States)

Divan, Deepakraj M.; Prasai, Anish; Hernendez, Jorge; Moghe, Rohit; Iyer, Amrit; Kandula, Rajendra Prasad

2016-04-26

Power flow controllers based on Imputed DC Link (IDCL) cells are provided. The IDCL cell is a self-contained power electronic building block (PEBB). The IDCL cell may be stacked in series and parallel to achieve power flow control at higher voltage and current levels. Each IDCL cell may comprise a gate drive, a voltage sharing module, and a thermal management component in order to facilitate easy integration of the cell into a variety of applications. By providing direct AC conversion, the IDCL cell based AC/AC converters reduce device count, eliminate the use of electrolytic capacitors that have life and reliability issues, and improve system efficiency compared with similarly rated back-to-back inverter system.

Advanced DC/AC inverters applications in renewable energy

CERN Document Server

Luo, Fang Lin

2013-01-01

DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

A THREE-PHASE BOOST DC-AC CONVERTER

African Journals Online (AJOL)

dc-ac converter (inverter) based on the dc-dc boost converters. ... Sliding mode controllers are designed to perform a robust control for the ... Computer simulations and spectral analysis demon- ... the conventional three-phase buck inverter,.

Theoretical and experimental analysis of inverter fed induction motor system under DC link capacitor failure

Directory of Open Access Journals (Sweden)

Hadeed A. Sher

2017-04-01

Full Text Available In this paper theoretical and experimental analysis of an AC–DC–AC inverter under DC link capacitor failure is presented. The failure study conducted for this paper is the open circuit of the DC link capacitor. The presented analysis incorporates the results for both single and three phase AC input. It has been observed that the higher ripple frequency provides better ride through capability for this fault. Furthermore, the effects of this fault on electrical characteristics of AC–DC–AC inverter and mechanical properties of the induction motor are also presented. Moreover, the effect of pulsating torque as a result of an open circuited DC link capacitor is also taken into consideration. Theoretical analysis is supported by computer aided simulation as well as with a real time experimental prototype.

Study of Power Flow Algorithm of AC/DC Distribution System including VSC-MTDC

Directory of Open Access Journals (Sweden)

Haifeng Liang

2015-08-01

Full Text Available In recent years, distributed generation and a large number of sensitive AC and DC loads have been connected to distribution networks, which introduce a series of challenges to distribution network operators (DNOs. In addition, the advantages of DC distribution networks, such as the energy conservation and emission reduction, mean that the voltage source converter based multi-terminal direct current (VSC-MTDC for AC/DC distribution systems demonstrates a great potential, hence drawing growing research interest. In this paper, considering losses of the reactor, the filter and the converter, a mathematical model of VSC-HVDC for the load flow analysis is derived. An AC/DC distribution network architecture has been built, based on which the differences in modified equations of the VSC-MTDC-based network under different control modes are analyzed. In addition, corresponding interface functions under five control modes are provided, and a back/forward iterative algorithm which is applied to power flow calculation of the AC/DC distribution system including VSC-MTDC is proposed. Finally, by calculating the power flow of the modified IEEE14 AC/DC distribution network, the efficiency and validity of the model and algorithm are evaluated. With various distributed generations connected to the network at appropriate locations, power flow results show that network losses and utilization of transmission networks are effectively reduced.

Electrical properties of a piezoelectric transformer for an AC-DC converter

International Nuclear Information System (INIS)

Park, Yong-Wook

2010-01-01

The electrical properties of a ring/dot piezoelectric transformer were analyzed for applications as an AC-DC converter using the step-down behavior of a piezoelectric transformer. The ring/dot piezoelectric transformer was prepared using Pb(Mn 1/3 Nb 2/3 )O 3 and Pb(Zn 1/3 Nb 2/3 )O 3 modified Pb(Zr,Ti)O 3 ceramics sintered at a relatively low temperature of 930 .deg. C for 90 min. When the transformer was matched with a load resistance of 1000 Ω, it transferred a maximum power of 27 W. The maximum power was produced at a dc output voltage of 30 V and a matching load resistance of 1000 Ω. While the manufactured ring/dot piezoelectric transformer released the maximum power at a resonance frequency of 71 kHz, the available frequency bandwidth was about 1 kHz at most due to strong frequency dependence of the piezoelectric transformer. The output dc current was highly improved up to 905 mA because no anisotropy of poling direction existed in the ring/dot piezoelectric transformer. Under a commercial input of 220 V ac , AC-DC converter successfully produced 27 W at 30 V dc and 905 mA.

AC power supply systems

International Nuclear Information System (INIS)

Law, H.

1987-01-01

An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

Impedance-based Analysis of DC Link Control in Voltage Source Rectifiers

DEFF Research Database (Denmark)

Lu, Dapeng; Wang, Xiongfei; Blaabjerg, Frede

2018-01-01

This paper analyzes the dynamics influences of the outer dc link control in the voltage source rectifiers based on the impedance model. The ac-dc interactions are firstly presented by means of full order small signal model in dq frame, which shows the input voltage and load condition are the two...

Development of AC-DC power system simulator

International Nuclear Information System (INIS)

Ichikawa, Tatsumi; Ueda, Kiyotaka; Inoue, Toshio

1984-01-01

A modeling and realization technique is described for realtime plant dynamics simulation of nuclear power generating unit in AC-DC power system simulator. Dynamic behavior of reactor system and steam system is important for investigation a further adequate unit control and protection system to system faults in AC and DC power system. Each unit of two nuclear power generating unit in the power system simulator consists of micro generator, DC motors, flywheels and process computer. The DC motor and flywheel simulates dynamic characteristics of steam turbine, and process computer simulates plant dynamics by digital simulation. We have realized real-time plant dynamics simulation by utilizing a high speed process I/O and a high speed digital differential analyzing processor (DDA) in which we builted a newly developed simple plant model. (author)

Modelling and Control Design of a Dual Buck-Boost AC/DC Converter Used in the DC Nano-Grid

DEFF Research Database (Denmark)

Wu, Weimin; Liu, Yuan; Wang, Houqing

2016-01-01

Due to widely used DC characterized loads and more distributed power generation sources, the DC Nano-grid becomes more and more popular and seen as an alternative to the AC-grid in future. For the safety considerations, the DC Nano-grid should provide reliable grounding for the residential loads...... like the low voltage AC power system. In this paper, a dual Buck-Boost AC/DC converter for use in the united grounding configuration based DC Nano-grid with three terminal outputs is proposed. It will be much easy to construct an efficient DC Nano-grid based on the existing low AC power system by using...

Coordination Control Strategy for AC/DC Hybrid Microgrids in Stand-Alone Mode

Directory of Open Access Journals (Sweden)

Dwi Riana Aryani

2016-06-01

Full Text Available Interest in DC microgrids is rapidly increasing along with the improvement of DC power technology because of its advantages. To support the integration process of DC microgrids with the existing AC utility grids, the form of hybrid AC/DC microgrids is considered for higher power conversion efficiency, lower component cost and better power quality. In the system, AC and DC portions are connected through interlink bidirectional AC/DC converters (IC with a proper control system and power management. In the stand-alone operation mode of AC/DC hybrid microgrids, the control of power injection through the IC is crucial in order to maintain the system security. This paper mainly deals with a coordination control strategy of IC and a battery energy storage system (BESS converter under stand-alone operation. A coordinated control strategy for the IC, which considers the state of charge (SOC level of BESS and the load shedding scheme as the last resort, is proposed to obtain better power sharing between AC and DC subgrids. The scheme will be tested with a hybrid AC/DC microgrid, using the tool of the PSCAD/EMTDC software.

Security analysis of interconnected AC/DC systems

DEFF Research Database (Denmark)

Eriksson, Robert

2015-01-01

This paper analyses N-1 security in an interconnected ac/dc transmission system using power transfer distribution factors (PTDFs). In the case of a dc converter outage the power needs to be redistributed among the remaining converter to maintain power balance and operation of the dc grid...... any line or transformer limits. Simulations were performed in a model of the Nordic power system where a dc grid is placed on top. The simulation supports the method as a tool to consider transfer limits in the grid to avoid violate the same and increase the security after a converter outage........ The redistribution of power has a sudden effect on the power-flow in the interconnected ac system. This may cause overloading of lines and transformers resulting in disconnection of equipment, and as a consequence cascading failure. The PTDF is used as a method to analyze and avoid violating limits by in the dc...

DC injection into low voltage AC networks

Energy Technology Data Exchange (ETDEWEB)

NONE

2005-07-01

This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

Hybrid AC-High Voltage DC Grid Stability and Controls

Science.gov (United States)

Yu, Jicheng

The growth of energy demands in recent years has been increasing faster than the expansion of transmission facility construction. This tendency cooperating with the continuous investing on the renewable energy resources drives the research, development, and construction of HVDC projects to create a more reliable, affordable, and environmentally friendly power grid. Constructing the hybrid AC-HVDC grid is a significant move in the development of the HVDC techniques; the form of dc system is evolving from the point-to-point stand-alone dc links to the embedded HVDC system and the multi-terminal HVDC (MTDC) system. The MTDC is a solution for the renewable energy interconnections, and the MTDC grids can improve the power system reliability, flexibility in economic dispatches, and converter/cable utilizing efficiencies. The dissertation reviews the HVDC technologies, discusses the stability issues regarding the ac and HVDC connections, proposes a novel power oscillation control strategy to improve system stability, and develops a nonlinear voltage droop control strategy for the MTDC grid. To verify the effectiveness the proposed power oscillation control strategy, a long distance paralleled AC-HVDC transmission test system is employed. Based on the PSCAD/EMTDC platform simulation results, the proposed power oscillation control strategy can improve the system dynamic performance and attenuate the power oscillations effectively. To validate the nonlinear voltage droop control strategy, three droop controls schemes are designed according to the proposed nonlinear voltage droop control design procedures. These control schemes are tested in a hybrid AC-MTDC system. The hybrid AC-MTDC system, which is first proposed in this dissertation, consists of two ac grids, two wind farms and a five-terminal HVDC grid connecting them. Simulation studies are performed in the PSCAD/EMTDC platform. According to the simulation results, all the three design schemes have their unique salient

Calculation of single phase AC and monopolar DC hybrid corona effects

International Nuclear Information System (INIS)

Zhao, T.; Sebo, S.A.; Kasten, D.G.

1996-01-01

Operating a hybrid HVac and HVdc line is an option for increasing the efficiency of power transmission and overcoming the difficulties in obtaining a new right-of-way. This paper proposes a new calculation method for the study of hybrid line corona. The proposed method can be used to calculate dc corona losses and corona currents in dc or ac conductors for single phase ac and monopolar dc hybrid lines. Profiles of electric field strength and ion current density at ground level can be estimated. The effects of the presence of an energized ac conductor on dc conductor corona and dc voltage on ac conductor corona are included in the method. Full-scale and reduced-scale experiments were utilized to investigate the hybrid line corona effects. Verification of the proposed calculation method is given

Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

DEFF Research Database (Denmark)

Chiang Loh, Poh; Li, Ding; Kang Chai, Yi

2013-01-01

sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment.......This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...

Coordinated control of three-phase AC and DC type EV–ESSs for efficient hybrid microgrid operations

International Nuclear Information System (INIS)

Rahman, Md Shamiur; Hossain, M.J.; Lu, Junwei

2016-01-01

Highlights: • A coordinated control is proposed for three-phase AC and DC type electric vehicles. • A four-quadrant interlinking converter is designed for hybrid microgrid operations. • Concurrent real irradiation data and commercial load profile are used for testing. • Unbalanced scenario due to single-phase electric vehicle charging is considered. • Improved AC and DC bus voltages and frequency regulations are achieved. - Abstract: This paper presents a three-layered coordinated control to incorporate three-phase (3P) alternating current (AC) and direct current (DC) type electric vehicle energy storage systems (EV–ESSs) for improved hybrid AC/DC microgrid operations. The first layer of the algorithm ensures DC subgrid management by regulating the DC bus voltage and DC side power management. The second and third layer manages AC subgrid by regulating the AC bus voltage and the frequency by managing reactive and active power respectively. The multi-layered coordination is embedded into the microgrid central controller (MGCC) which controls the interlinking controller in between AC and DC microgrid and the interfacing controllers of the participating electric vehicles (EVs) and distributed generation (DG) units. The whole system is designed in MATLAB/SIMULINK® environment resembling the under construction microgrid at Griffith University, Australia. Extensive case studies are performed using real life irradiation data and commercial loads of the campus buildings. Impacts of homogeneous and heterogeneous single-phase EV charging are investigated to observe both balanced and unbalanced scenarios. Synchronization during the transition from the islanded to grid-tied mode is tested considering a contingency situation. From the comparative simulation results it is evident that the proposed controller exhibits effective, reliable and robust performance for all the cases.

International comparison of AC-DC current transfer standards

Science.gov (United States)

Heine, G.; Garcocz, M.; Waldmann, W.

2017-01-01

The measurements of the international comparison of ac-dc current transfer standards identified as EURAMET.EM-K12 started in June 2012 and were completed in December 2014. Twenty NMIs in the EURAMET region and one NMI in the AFRIMET region took part: BEV (Austria), CMI (Czech Republic), PTB (Germany), METAS (Switzerland), JV (Norway), UME (Turkey), GUM (Poland), IPQ (Portugal), CEM (Spain), INRIM (Italy), SP (Sweden), DANIAmet-MI-Trescal (Denmark), BIM (Bulgaria), MKEH (Hungary), SIQ (Slovenia), LNE (France), NSAI NML (Ireland), VSL (The Netherlands), NPL (United Kingdom), Metrosert (Estonia), NIS (Egypt). The comparison was proposed to link the National Metrology Institutes organised in EURAMET to the key comparison CCEM-K12. The ac-dc current transfer difference of each travelling standard had been measured at its nominal current 10 mA and 5 A at the following frequencies: 10 Hz, 55 Hz, 1 kHz, 10 kHz, 20 kHz, 50 kHz, 100 kHz. The test points were selected to link the results with the equivalent CCEM Key Comparison (CCEM-K12), through five NMIs participating in both EURAMET and CCEM key comparisons (PTB, JV, NPL, SP and BEV). The report shows the degree of equivalence in the EURAMET region and also the degree of equivalence with the corresponding CCEM reference value. Main text To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by the CCEM, according to the provisions of the CIPM Mutual Recognition Arrangement (CIPM MRA).

Interior point algorithm-based power flow optimisation of a combined AC and DC multi-terminal grid

Directory of Open Access Journals (Sweden)

Farhan Beg

2015-01-01

Full Text Available The high cost of power electronic equipment, lower reliability and poor power handling capacity of the semiconductor devices had stalled the deployment of systems based on DC (multi-terminal direct current system (MTDC networks. The introduction of voltage source converters (VSCs for transmission has renewed the interest in the development of large interconnected grids based on both alternate current (AC and DC transmission networks. Such a grid platform also realises the added advantage of integrating the renewable energy sources into the grid. Thus a grid based on DC MTDC network is a possible solution to improve energy security and check the increasing supply demand gap. An optimal power solution for combined AC and DC grids obtained by the solution of the interior point algorithm is proposed in this study. Multi-terminal HVDC grids lie at the heart of various suggested transmission capacity increases. A significant difference is observed when MTDC grids are solved for power flows in place of conventional AC grids. This study deals with the power flow problem of a combined MTDC and an AC grid. The AC side is modelled with the full power flow equations and the VSCs are modelled using a connecting line, two generators and an AC node. The VSC and the DC losses are also considered. The optimisation focuses on several different goals. Three different scenarios are presented in an arbitrary grid network with ten AC nodes and five converter stations.

Comparative methods to assess harmonic response of nonlinear piezoelectric energy harvesters interfaced with AC and DC circuits

Science.gov (United States)

Lan, Chunbo; Tang, Lihua; Harne, Ryan L.

2018-05-01

Nonlinear piezoelectric energy harvester (PEH) has been widely investigated during the past few years. Among the majority of these researches, a pure resistive load is used to evaluate power output. To power conventional electronics in practical application, the alternating current (AC) generated by nonlinear PEH needs to be transformed into a direct current (DC) and rectifying circuits are required to interface the device and electronic load. This paper aims at exploring the critical influences of AC and DC interface circuits on nonlinear PEH. As a representative nonlinear PEH, we fabricate and evaluate a monostable PEH in terms of generated power and useful operating bandwidth when it is connected to AC and DC interface circuits. Firstly, the harmonic balance analysis and equivalent circuit representation method are utilized to tackle the modeling of nonlinear energy harvesters connected to AC and DC interface circuits. The performances of the monostable PEH connected to these interface circuits are then analyzed and compared, focusing on the influences of the varying load, excitation and electromechanical coupling strength on the nonlinear dynamics, bandwidth and harvested power. Subsequently, the behaviors of the monostable PEH with AC and DC interface circuits are verified by experiment. Results indicate that both AC and DC interface circuits have a peculiar influence on the power peak shifting and operational bandwidth of the monostable PEH, which is quite different from that on the linear PEH.

Using PBL to Improve Educational Outcomes and Student Satisfaction in the Teaching of DC/DC and DC/AC Converters

Science.gov (United States)

Martinez-Rodrigo, Fernando; Herrero-De Lucas, Luis Carlos; de Pablo, Santiago; Rey-Boue, Alexis B.

2017-01-01

This paper examines the question of how to use project-based learning to increase student performance and satisfaction in a power electronics course addressing the topics of dc/dc and dc/ac converters, the assembly of a dc/dc converter, and the use of a commercial speed drive. A detailed presentation of the methodology is shown, and the results…

Autonomous Operation of a Hybrid AC/DC Microgrid with Multiple Interlinking Converters

DEFF Research Database (Denmark)

Peyghami, Saeed; Mokhtari, Hossein; Blaabjerg, Frede

2018-01-01

Applying conventional dc-voltage based droop approaches for hybrid ac/dc microgrids interconnected by a single interlinking converter (IC) can properly manage the power flow among ac and dc subgrids. However, due to the effect of line resistances, these approaches may create a circulating power a...

Reliability of capacitors for DC-link applications - An overview

DEFF Research Database (Denmark)

Wang, Huai; Blaabjerg, Frede

2013-01-01

DC-link capacitors are an important part in the majority of power electronic converters which contribute to cost, size and failure rate on a considerable scale. From capacitor users' viewpoint, this paper presents a review on the improvement of reliability of DC-link in power electronic converters...... from two aspects: 1) reliability-oriented DC-link design solutions; 2) conditioning monitoring of DC-link capacitors during operation. Failure mechanisms, failure modes and lifetime models of capacitors suitable for the applications are also discussed as a basis to understand the physics......-of-failure. This review serves to provide a clear picture of the state-of-the-art research in this area and to identify the corresponding challenges and future research directions for capacitors and their DC-link applications....

Space Charge Modulated Electrical Breakdown of Oil Impregnated Paper Insulation Subjected to AC-DC Combined Voltages

Directory of Open Access Journals (Sweden)

Yuanwei Zhu

2018-06-01

Full Text Available Based on the existing acknowledgment that space charge modulates AC and DC breakdown of insulating materials, this investigation promotes the related investigation into the situations of more complex electrical stress, i.e., AC-DC combined voltages. Experimentally, the AC-DC breakdown characteristics of oil impregnated paper insulation were systematically investigated. The effects of pre-applied voltage waveform, AC component ratio, and sample thickness on AC-DC breakdown characteristics were analyzed. After that, based on an improved bipolar charge transport model, the space charge profiles and the space charge induced electric field distortion during AC-DC breakdown were numerically simulated to explain the differences in breakdown characteristics between the pre-applied AC and pre-applied DC methods under AC-DC combined voltages. It is concluded that large amounts of homo-charges are accumulated during AC-DC breakdown, which results in significantly distorted inner electric field, leading to variations of breakdown characteristics of oil impregnated paper insulation. Therefore, space charges under AC-DC combined voltages must be considered in the design of converter transformers. In addition, this investigation could provide supporting breakdown data for insulation design of converter transformers and could promote better understanding on the breakdown mechanism of insulating materials subjected to AC-DC combined voltages.

DC and AC biasing of a transition edge sensor microcalorimeter

International Nuclear Information System (INIS)

Cunningham, M.F.; Ullom, J.N.; Miyazaki, T.; Drury, O.; Loshak, A.; Berg, M.L. van den; Labov, S.E.

2002-01-01

We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions

Autonomous Operation of Hybrid Microgrid with AC and DC Sub-Grids

DEFF Research Database (Denmark)

Loh, Poh Chiang; Blaabjerg, Frede

2011-01-01

the power flow among all the sources distributed throughout the two types of sub-grids, which certainly is tougher than previous efforts developed for only either ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc...... sources, ac sources and interlinking converters. Suitable control and normalization schemes are therefore developed for controlling them with results presented for showing the overall performance of the hybrid microgrid.......This paper investigates on the active and reactive power sharing of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac sub-grids, interconnected by power electronic interfaces. The main challenge here is to manage...

A New parallel Resonant DC-Link Inverter for Soft Switched PWM

Energy Technology Data Exchange (ETDEWEB)

Cho, J G; Kim, H S; Cho, G H [Korea Advanced Energy Research Inst., Daeduk-Danji (Korea, Republic of). Korea Nuclear Safety Center

1993-03-01

A novel soft switching PWM converter for high frequency AC/DC power conversion is presented by using a new parallel resonant dc-link(PRDCL) and by adopting single phase soft switching(SPSS) technique. The new PRDCL provides variable link pulse position as well as variable link pulse width, which is quite different feature from the other resonant dc-links and thus the PWM capability can be remarkably increased. The SPSS technique is also adopted for further enhancement of PWM capability. Moderate combination of two soft switching operations enables the conventional space vector PWM technique to be used. Due to distinctive advantages including true PWM capability, minimum device voltage stresses(all Vs) and reasonable additional device count(3 devices), the proposed converter can be operated in a wide power range(20-200 KW). Operational principles, analyses and the realization of a space vector PWM of the proposed converter are presented. Simulation results are also shown to verify the operational principle. (author). 15 refs., 14 figs.

Large Signal Stabilization of Hybrid AC/DC Micro-Grids Using Nonlinear Robust Controller

Directory of Open Access Journals (Sweden)

Reza Pejmanfar

2017-12-01

Full Text Available This paper presents a robust nonlinear integrated controller to improve stability of hybrid AC/DC micro-grids under islanding mode. The proposed controller includes two independent controllers where each one is responsible to control one part of the system. First controller will improve the stability of input DC/DC converter. Using this controller, the voltage of DC bus is fully stabilized such that when a large disturbance occurs, its voltage will become constant without any significant dynamic. The necessity of DC bus regulation which has not been considered in previous studies, is imminent as it not only improves voltage stability of the micro-grid but also protects consumers which are directly connected to the DC bus, against voltage variations. Frequency stability of the micro-grid is provided by the second proposed controller which is applied to output DC/AC converter of the micro-grid. Adaptive method is used to make the controllers proposed in this paper, robust. Duty cycle of converters switches are adjusted such that voltage and frequency of the micro-grid are set on the desired value in minimum possible time under transient disturbances and uncertainty of the loads as well as micro-sources characteristics.

Electrorotation of novel electroactive polymer composites in uniform DC and AC electric fields

International Nuclear Information System (INIS)

Zrinyi, Miklós; Nakano, Masami; Tsujita, Teppei

2012-01-01

Novel electroactive polymer composites have been developed that could spin in uniform DC and AC electric fields. The angular displacement as well as rotation of polymer disks around an axis that is perpendicular to the direction of the applied electric field was studied. It was found that the dynamics of the polymer rotor is very complex. Depending on the strength of the static DC field, three regimes have been observed: no rotation occurs below a critical threshold field intensity, oscillatory motion takes place just above this value and continuous rotation can be observed above the critical threshold field intensity. It was also found that low frequency AC fields could also induce angular deformation. (paper)

Experimental Investigation of the Corona Discharge in Electrical Transmission due to AC/DC Electric Fields

Directory of Open Access Journals (Sweden)

Fuangpian Phanupong

2016-01-01

Full Text Available Nowadays, using of High Voltage Direct Current (HVDC transmission to maximize the transmission efficiency, bulk power transmission, connection of renewable power source from wind farm to the grid is of prime concern for the utility. However, due to the high electric field stress from Direct Current (DC line, the corona discharge can easily be occurred at the conductor surface leading to transmission loss. Therefore, the polarity effect of DC lines on corona inception and breakdown voltage should be investigated. In this work, the effect of DC polarity and Alternating Current (AC field stress on corona inception voltage and corona discharge is investigated on various test objects, such as High Voltage (HV needle, needle at ground plane, internal defect, surface discharge, underground cable without cable termination, cable termination with simulated defect and bare overhead conductor. The corona discharge is measured by partial discharge measurement device with high-frequency current transformer. Finally, the relationship between supply voltage and discharge intensity on each DC polarity and AC field stress can be successfully determined.

DC-link Voltage Control to Compensate Voltage Deviation for PV–BESSs Integrated System in Low-Voltage (LV Networks

Directory of Open Access Journals (Sweden)

Lee Gyu-sub

2016-01-01

Full Text Available The exhaustion of fossil fuel and the greenhouse gas emission are one of the most significant energy and environmental issues, respectively. Photovoltaic (PV generators and battery energy storage systems (BESSs have been significantly increased for recent years. The BESSs are mainly used for smoothing active power fluctuation of the PV. In this paper, PV–BESSs integration of two DC/DC converters and one AC/DC converter is investigated and DC-link voltage control to compensate the AC voltage deviation is proposed for the PV‒BESS system in low-voltage (LV networks.

Enhancing the Capacity of the AC Distribution System Using DC Interlinks - A Step Towards Future DC Grid

DEFF Research Database (Denmark)

Chaudhary, Sanjay; Guerrero, Josep M.; Teodorescu, Remus

2015-01-01

The development of distributed generation system and electric vehicles is bound to strain the distribution network. A typical radial distribution feeder suffers from the voltage fluctuation and feeder overload in the presence of a large amount of variable renewable generation. This paper presents...... a concept of enhancing the power handling capacity of distribution networks using dc grid interconnections. Control of both the active and reactive power exchange between the ac feeder and the interconnecting power converter has been proposed for the voltage regulation at the ac feeder terminal. Besides......, the dc grid interconnection also allows the introduction of a common storage system which can be shared by the connected ac feeders, and the dc grid connection to other renewable energy resources. The increased power handling capacity and improved voltage profile of the ac distribution feeder using...

Transmission Technologies and Operational Characteristic Analysis of Hybrid UHV AC/DC Power Grids in China

Science.gov (United States)

Tian, Zhang; Yanfeng, Gong

2017-05-01

In order to solve the contradiction between demand and distribution range of primary energy resource, Ultra High Voltage (UHV) power grids should be developed rapidly to meet development of energy bases and accessing of large-scale renewable energy. This paper reviewed the latest research processes of AC/DC transmission technologies, summarized the characteristics of AC/DC power grids, concluded that China’s power grids certainly enter a new period of large -scale hybrid UHV AC/DC power grids and characteristics of “strong DC and weak AC” becomes increasingly pro minent; possible problems in operation of AC/DC power grids was discussed, and interaction or effect between AC/DC power grids was made an intensive study of; according to above problems in operation of power grids, preliminary scheme is summarized as fo llows: strengthening backbone structures, enhancing AC/DC transmission technologies, promoting protection measures of clean energ y accessing grids, and taking actions to solve stability problems of voltage and frequency etc. It’s valuable for making hybrid UHV AC/DC power grids adapt to operating mode of large power grids, thus guaranteeing security and stability of power system.

Bi-Directional DC-DC Converter for PHEV Applications

Energy Technology Data Exchange (ETDEWEB)

Abas Goodarzi

2011-01-31

Plug-In Hybrid Electric Vehicles (PHEV) require high power density energy storage system (ESS) for hybrid operation and high energy density ESS for Electric Vehicle (EV) mode range. However, ESS technologies to maximize power density and energy density simultaneously are not commercially feasible. The use of bi-directional DC-DC converter allows use of multiple energy storage, and the flexible DC-link voltages can enhance the system efficiency and reduce component sizing. This will improve fuel consumption, increase the EV mode range, reduce the total weight, reduce battery initial and life cycle cost, and provide flexibility in system design.

Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

Science.gov (United States)

Reitan, D. K.

1973-01-01

Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network

Science.gov (United States)

Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.

2017-05-01

Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.

AC/DC current ratio in a current superimposition variable flux reluctance machine

Science.gov (United States)

Kohara, Akira; Hirata, Katsuhiro; Niguchi, Noboru; Takahara, Kazuaki

2018-05-01

We have proposed a current superimposition variable flux reluctance machine for traction motors. The torque-speed characteristics of this machine can be controlled by increasing or decreasing the DC current. In this paper, we discuss an AC/DC current ratio in the current superimposition variable flux reluctance machine. The structure and control method are described, and the characteristics are computed using FEA in several AC/DC ratios.

Equivalence of Primary Control Strategies for AC and DC Microgrids

Directory of Open Access Journals (Sweden)

Eneko Unamuno

2017-01-01

Full Text Available Microgrid frequency and voltage regulation is a challenging task, as classical generators with rotational inertia are usually replaced by converter-interfaced systems that inherently do not provide any inertial response. The aim of this paper is to analyse and compare autonomous primary control techniques for alternating current (AC and direct current (DC microgrids that improve this transient behaviour. In this context, a virtual synchronous machine (VSM technique is investigated for AC microgrids, and its behaviour for different values of emulated inertia and droop slopes is tested. Regarding DC microgrids, a virtual-impedance-based algorithm inspired by the operation concept of VSMs is proposed. The results demonstrate that the proposed strategy can be configured to have an analogous behaviour to VSM techniques by varying the control parameters of the integrated virtual-impedances. This means that the steady-state and transient behaviour of converters employing these strategies can be configured independently. As shown in the simulations, this is an interesting feature that could be, for instance, employed for the integration of different dynamic generation or storage systems, such as batteries or supercapacitors.

Analysis and Assessment of Operation Risk for Hybrid AC/DC Power System based on the Monte Carlo Method

Science.gov (United States)

Hu, Xiaojing; Li, Qiang; Zhang, Hao; Guo, Ziming; Zhao, Kun; Li, Xinpeng

2018-06-01

Based on the Monte Carlo method, an improved risk assessment method for hybrid AC/DC power system with VSC station considering the operation status of generators, converter stations, AC lines and DC lines is proposed. According to the sequential AC/DC power flow algorithm, node voltage and line active power are solved, and then the operation risk indices of node voltage over-limit and line active power over-limit are calculated. Finally, an improved two-area IEEE RTS-96 system is taken as a case to analyze and assessment its operation risk. The results show that the proposed model and method can intuitively and directly reflect the weak nodes and weak lines of the system, which can provide some reference for the dispatching department.

Analysis and Assessment of Operation Risk for Hybrid AC/DC Power System based on the Monte Carlo Method

Directory of Open Access Journals (Sweden)

Hu Xiaojing

2018-01-01

Full Text Available Based on the Monte Carlo method, an improved risk assessment method for hybrid AC/DC power system with VSC station considering the operation status of generators, converter stations, AC lines and DC lines is proposed. According to the sequential AC/DC power flow algorithm, node voltage and line active power are solved, and then the operation risk indices of node voltage over-limit and line active power over-limit are calculated. Finally, an improved two-area IEEE RTS-96 system is taken as a case to analyze and assessment its operation risk. The results show that the proposed model and method can intuitively and directly reflect the weak nodes and weak lines of the system, which can provide some reference for the dispatching department.

Design and implementation of co-operative control strategy for hybrid AC/DC microgrids

Science.gov (United States)

Mahmud, Rasel

This thesis is mainly divided in two major sections: 1) Modeling and control of AC microgrid, DC microgrid, Hybrid AC/DC microgrid using distributed co-operative control, and 2) Development of a four bus laboratory prototype of an AC microgrid system. At first, a distributed cooperative control (DCC) for a DC microgrid considering the state-of-charge (SoC) of the batteries in a typical plug-in-electric-vehicle (PEV) is developed. In DC microgrids, this methodology is developed to assist the load sharing amongst the distributed generation units (DGs), according to their ratings with improved voltage regulation. Subsequently, a DCC based control algorithm for AC microgrid is also investigated to improve the performance of AC microgrid in terms of power sharing among the DGs, voltage regulation and frequency deviation. The results validate the advantages of the proposed methodology as compared to traditional droop control of AC microgrid. The DCC-based control methodology for AC microgrid and DC microgrid are further expanded to develop a DCC-based power management algorithm for hybrid AC/DC microgrid. The developed algorithm for hybrid microgrid controls the power flow through the interfacing converter (IC) between the AC and DC microgrids. This will facilitate the power sharing between the DGs according to their power ratings. Moreover, it enables the fixed scheduled power delivery at different operating conditions, while maintaining good voltage regulation and improved frequency profile. The second section provides a detailed explanation and step-by-step design and development of an AC/DC microgrid testbed. Controllers for the three-phase inverters are designed and tested on different generation units along with their corresponding inductor-capacitor-inductor (LCL) filters to eliminate the switching frequency harmonics. Electric power distribution line models are developed to form the microgrid network topology. Voltage and current sensors are placed in the proper

Combined operation of AC and DC distribution system with distributed generation units

International Nuclear Information System (INIS)

Noroozian, R.; Abedi, M.; Gharehpetian, G.

2010-01-01

This paper presents a DC distribution system which has been supplied by external AC systems as well as local DG units in order to demonstrate an overall solution to power quality issue. In this paper, the proposed operation method is demonstrated by simulation of power transfer between external AC systems, DG units, AC and DC loads. The power flow control in DC distribution system has been achieved by network converters and DG converters. Also, the mathematical model of the network, DG and load converters are obtained by using the average technique, which allows converter systems accurately simulated and control strategies for this converters is achieved. A suitable control strategy for network converters has been proposed that involves DC voltage droop regulator and novel instantaneous power regulation scheme. Also, a novel control technique has been proposed for DG converters. In this paper, a novel control system based on stationary and synchronously rotating reference frame has been proposed for load converters for supplying AC loads connected to the DC bus by balanced voltages. The several case studies have been studied based on proposed methods. The simulation results show that DC distribution systems including DG units can improve the power quality at the point of common coupling (PCC) in the power distribution system or industrial power system. (authors)

Coordinating Flexibility under Uncertainty in Multi-Area AC and DC Grids

DEFF Research Database (Denmark)

Halilbasic, Lejla; Chatzivasileiadis, Spyros; Pinson, Pierre

2017-01-01

In the future, mixed AC and DC grids, spanning multiple areas operated by different transmission system operators (TSO), are expected to offer the necessary controllability for integrating large amounts of intermittent renewable generation. This is facilitated by high voltage direct current...... transmission based on voltage source converter technology that can offer recourse actions in the form of preventive and corrective control of both active and reactive power. Market-clearing procedures, based on optimal power flow algorithms, need to be revised to account for DC transmission, flexibility...... and privacy requirements. To this end, we propose a decentralized two-stage stochastic market-clearing algorithm that incorporates meshed DC grids and allows the sharing of flexibility resources between areas. The benefit of this approach lies in its pricing mechanism, used for coordinating the different area...

Introduction of hvdc transmission into a predominantly ac network

Energy Technology Data Exchange (ETDEWEB)

Casson, W; Last, F H; Huddart, K W

1966-02-01

Methods for reinforcing the supply network, including systems employing dc links, without introducing a new primary network are briefly described. The arrangement for dc links is outlined and the application to an existing ac system is considered. The economics of ac and dc for reinforcement schemes are briefly mentioned.

Use of an AC/DC/AC Electrochemical Technique to Assess the Durability of Protection Systems for Magnesium Alloys

Science.gov (United States)

Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming

One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.

AC, DC or EC motor? What type of engine for what purpose?; AC-, DC- oder EC-Motor? Welche Motorausfuehrung fuer welchen Zweck

Energy Technology Data Exchange (ETDEWEB)

Zeiff, Andreas; Homburg, Dietrich

2009-01-15

Electronics is the key technology in control engineering, but even the best control system requires reliable modules to transmit signals. Modern electric motors have become indispensable here. There are nearly as many motor types as there are applications. Electromagnetic conversion of electric into mechanical power is directly related to motor design. There are AC and DC motors, one-speed motors and variable-speed motors. Rotary momentum and synchronisation can be optimized by selecting the appropriate motor type, as can dynamics and detent torque. Correct selection of the electric motor therefore is essential for an optimal drive concept. (orig.)

Electrical actuation of electrically conducting and insulating droplets using ac and dc voltages

International Nuclear Information System (INIS)

Kumari, N; Bahadur, V; Garimella, S V

2008-01-01

Electrical actuation of liquid droplets at the microscale offers promising applications in the fields of microfluidics and lab-on-chip devices. Much prior research has targeted the electrical actuation of electrically conducting liquid droplets using dc voltages (classical electrowetting). Electrical actuation of conducting droplets using ac voltages and the actuation of insulating droplets (using dc or ac voltages) has remained relatively unexplored. This paper utilizes an energy-minimization-based analytical framework to study the electrical actuation of a liquid droplet (electrically conducting or insulating) under ac actuation. It is shown that the electromechanical regimes of classical electrowetting, electrowetting under ac actuation and insulating droplet actuation can be extracted from the generic electromechanical actuation framework, depending on the electrical properties of the droplet, the underlying dielectric layer and the frequency of the actuation voltage. This paper also presents experiments which quantify the influence of the ac frequency and the electrical properties of the droplet on its velocity under electrical actuation. The velocities of droplets moving between two parallel plates under ac actuation are experimentally measured; these velocities are then related to the actuation force on the droplet which is predicted by the electromechanical model developed in this work. It is seen that the droplet velocities are strongly dependent on the frequency of the ac actuation voltage; the cut-off ac frequency, above which the droplet fails to actuate, is experimentally determined and related to the electrical conductivity of the liquid. This paper then analyzes and directly compares the various electromechanical regimes for the actuation of droplets in microfluidic applications

Reliability of Capacitors for DC-Link Applications in Power Electronic Converters

DEFF Research Database (Denmark)

Wang, Huai; Blaabjerg, Frede

2014-01-01

DC-link capacitors are an important part in the majority of power electronic converters which contribute to cost, size and failure rate on a considerable scale. From capacitor users' viewpoint, this paper presents a review on the improvement of reliability of dc link in power electronic converters...... from two aspects: 1) reliability-oriented dc-link design solutions; 2) conditioning monitoring of dc-link capacitors during operation. Failure mechanisms, failure modes and lifetime models of capacitors suitable for the applications are also discussed as a basis to understand the physics......-of-failure. This review serves to provide a clear picture of the state-of-the-art research in this area and to identify the corresponding challenges and future research directions for capacitors and their dc-link applications....

A new DC/AC boost transformerless converter in application of photovoltaic power generation

DEFF Research Database (Denmark)

Wei, Mo; Loh, Poh Chiang; Blaabjerg, Frede

2011-01-01

This paper presents a new DC/AC boost transformerless converter in the applications of photovoltaic (PV) power generation. A new circuit topology of single phase full bridge power inverter with additional DC/DC boost stage is proposed. The proposed topology overcomes two commonly existing......, and then converts the DC into AC to supply the load. A special modulation technique is proposed to eliminate the leakage current which is commonly presents in PV transformerless power generation, helps to increase the system efficiency and output performance....

DC Vs AC - War Of Currents For Future Power Systems A HVDC Technology Overview

Directory of Open Access Journals (Sweden)

Anil K. Rai

2015-08-01

Full Text Available DC vs AC discussion began in 1880s with development of first commercial power transmission in Wall Street New York. Later when AC technology came into notice by efforts of inventor and researcher Sir Nicola Tesla soon the advantages of AC transmission and AC devices overtook the DC technology. It was hoped that DC technology had lost battle of currents. Today with researches going on FACTS devices and bulk power transmission HVDC has again gained a reputation in power sector. Solution of this centuries old debate is to develop HVDC systems that assists HVAC systems for better performance stability and control

A CMOS AC/DC charge pump for a wireless sensor network

International Nuclear Information System (INIS)

Zhang Qiang; Ni Weining; Shi Yin; Yu Yude

2012-01-01

An AC/DC charge pump implemented with MOS FETs has been presented for wireless sensor network applications. The proposed AC/DC charge pump can generate a stable output with low power dissipation and high pumping efficiency, which has been implemented in 0.13 μm CMOS technology. The proposed charge pump employs MOSFET diodes with low thresholds, and improves the conversion efficiency. The analytical model of the voltage multiplier, the simulation results, and the chip testing results are presented.

Robust backstepping control of an interlink converter in a hybrid AC/DC microgrid based on feedback linearisation method

Science.gov (United States)

Dehkordi, N. Mahdian; Sadati, N.; Hamzeh, M.

2017-09-01

This paper presents a robust dc-link voltage as well as a current control strategy for a bidirectional interlink converter (BIC) in a hybrid ac/dc microgrid. To enhance the dc-bus voltage control, conventional methods strive to measure and feedforward the load or source power in the dc-bus control scheme. However, the conventional feedforward-based approaches require remote measurement with communications. Moreover, conventional methods suffer from stability and performance issues, mainly due to the use of the small-signal-based control design method. To overcome these issues, in this paper, the power from DG units of the dc subgrid imposed on the BIC is considered an unmeasurable disturbance signal. In the proposed method, in contrast to existing methods, using the nonlinear model of BIC, a robust controller that does not need the remote measurement with communications effectively rejects the impact of the disturbance signal imposed on the BIC's dc-link voltage. To avoid communication links, the robust controller has a plug-and-play feature that makes it possible to add a DG/load to or remove it from the dc subgrid without distorting the hybrid microgrid stability. Finally, Monte Carlo simulations are conducted to confirm the effectiveness of the proposed control strategy in MATLAB/SimPowerSystems software environment.

A novel wireless power and data transmission AC to DC converter for an implantable device.

Science.gov (United States)

Liu, Jhao-Yan; Tang, Kea-Tiong

2013-01-01

This article presents a novel AC to DC converter implemented by standard CMOS technology, applied for wireless power transmission. This circuit combines the functions of the rectifier and DC to DC converter, rather than using the rectifier to convert AC to DC and then supplying the required voltage with regulator as in the transitional method. This modification can reduce the power consumption and the area of the circuit. This circuit also transfers the loading condition back to the external circuit by the load shift keying(LSK), determining if the input power is not enough or excessive, which increases the efficiency of the total system. The AC to DC converter is fabricated with the TSMC 90nm CMOS process. The circuit area is 0.071mm(2). The circuit can produce a 1V DC voltage with maximum output current of 10mA from an AC input ranging from 1.5V to 2V, at 1MHz to 10MHz.

Real-Time Energy Management System for a Hybrid AC/DC Residential Microgrid

DEFF Research Database (Denmark)

Diaz, Enrique Rodriguez; Palacios-Garcia, Emilio J.; Anvari-Moghaddam, Amjad

2017-01-01

This paper proposes real-time Energy Management System (EMS) for a residential hybrid ac/dc microgrid. The residential microgrid is organized in two different distribution systems. A dc distribution bus which interconnect the renewable energy sources (RES), energy storage systems (ESS...... buildings. This architecture increases the overall efficiency of the distribution by interconnecting the RES and ESS thorough a dc distribution bus, and therefore avoiding unnecessary dc/ac conversion stages. The real-time EMS performs an 24 hours ahead optimization in order to schedule the charge...... setup. The results shown how the operational costs of the system are effectively decreased by 28%, even with non-accurate estimation of the RES generation or building parameters....

Direct AC–AC grid interface converter for ocean wave energy system

International Nuclear Information System (INIS)

Tsang, K.M.; Chan, W.L.

2015-01-01

Highlights: • Novel power grid interface converter for ocean wave energy system. • Unlike conventional approach, generator output is directly converted into fixed frequency AC for synchronous connection. • High conversion efficient and power quality could be achieved. - Abstract: Ocean wave energy is very promising. However, existing systems are using rectifying circuits to convert variable voltage and variable frequency output of electric generator into DC voltage and then use grid-tied inverter to connect to the power grid. Such arrangement will not only reduce the overall efficient but also increase the cost of the system. A direct AC–AC converter is a desirable solution. In this paper, a six-switch AC–AC converter has been proposed as a single phase grid-connected interface. New switching scheme has been derived for the converter such that the virtual input AC–DC conversion and the output DC–AC conversion can be decoupled. State-space averaging model and pulse width modulation scheme have been derived for the converter. As the input and the output operations can be decoupled, two independent controllers have been designed to handle the input AC–DC regulation and the output DC–AC regulation. The proposed scheme demands for two separate duty ratios and novel switching scheme has been derived to realize the combined duty ratios in one switching cycle. Power regulation, harmonics elimination and power factor correction control algorithms have also been derived for the converter when it is connected to the supply grid. Experimental results of a small scale model are included to demonstrate the effectiveness of the proposed switching and control schemes

Isolated PDM and PWM DC-AC SICAMs[Pulse Density Modulated; Pulse Width Modulated

Energy Technology Data Exchange (ETDEWEB)

Ljusev, P.

2004-03-15

In this report a class of isolated PDM and PWM DC-AC SICAMs is described, which introduce the audio reference only in the output stage. AC-DC power supply is implemented in its simplest form: diode rectifier followed by a medium-size charge-storage capacitor. Isolation from the AC mains is achieved using a high frequency (HF) transformer, receiving the HF voltage pulses from the input 'inverter' stage and transferring them to the output 'rectifier+inverter' stage, which can use either PDM or PWM. The latter stage is then interfaced to the load using an output low-pass filter. Each of the dedicated stages is discussed in detail. Measurements on the master/slave PWM DC-AC SICAM prototype are presented to help benchmarking the performance of this class of SICAMs and identify the advantages and drawbacks. (au)

A Direct Power Conversion Topology for Grid Integration of Hybrid AC/DC Energy Resources

DEFF Research Database (Denmark)

Liu, Xiong; Loh, Poh Chiang; Wang, Peng

2013-01-01

This paper proposes a multiple-input versatile matrix converter (VMC) for integrating hybrid ac/dc energy resources and storages to the power grid. The VMC is developed from the traditional indirect matrix converter but operates in the reverse-boost mode rather than in the forward-buck mode....... The reverse-boost mode is more relevant here since most renewable sources and energy storages have lower voltages than the grid. The eventual VMC developed uses an alternative nine-switch converter, rather than usual six-switch voltage-source converter, for providing six input terminals in total. One three...

Hierarchical Control of Parallel AC-DC Converter Interfaces for Hybrid Microgrids

DEFF Research Database (Denmark)

Lu, Xiaonan; Guerrero, Josep M.; Sun, Kai

2014-01-01

In this paper, a hierarchical control system for parallel power electronics interfaces between ac bus and dc bus in a hybrid microgrid is presented. Both standalone and grid-connected operation modes in the dc side of the microgrid are analyzed. Concretely, a three-level hierarchical control system...... equal or proportional dc load current sharing. The common secondary control level is designed to eliminate the dc bus voltage deviation produced by the droop control, with dc bus voltage in the hybrid microgrid boosted to an acceptable range. After guaranteeing the performance of the dc side standalone...

Optimization Control of Bidirectional Cascaded DC-AC Converter Systems

DEFF Research Database (Denmark)

Tian, Yanjun

in bidirectional cascaded converter. This research work analyses the control strategies based on the topology of dual active bridges converter cascaded with a three phase inverter. It firstly proposed a dc link voltage and active power coordinative control method for this cascaded topology, and it can reduce dc....... The connections of the renewable energy sources to the power system are mostly through the power electronic converters. Moreover, for high controllability and flexibility, power electronic devices are gradually acting as the interface between different networks in power systems, promoting conventional power...... the bidirectional power flow in the distribution level of power systems. Therefore direct contact of converters introduces significant uncertainties to power system, especially for the stability and reliability. This dissertation studies the optimization control of the two stages directly connected converters...

Artificial Neural Network based DC-link Capacitance Estimation in a Diode-bridge Front-end Inverter System

DEFF Research Database (Denmark)

Soliman, Hammam Abdelaal Hammam; Abdelsalam, Ibrahim; Wang, Huai

2017-01-01

, a proposed software condition monitoring methodology based on Artificial Neural Network (ANN) algorithm is presented. Matlab software is used to train and generate the proposed ANN. The proposed methodology estimates the capacitance of the DC-link capacitor in a three phase front-end diode bridge AC......In modern design of power electronic converters, reliability of DC-link capacitors is an essential aspect to be considered. The industrial field have been attracted to the monitoring of their health condition and the estimation of their ageing process status. The existing condition monitoring...

Fuzzy Controlled Parallel AC-DC Converter for PFC

Directory of Open Access Journals (Sweden)

M Subba Rao

2011-01-01

Full Text Available Paralleling of converter modules is a well-known technique that is often used in medium-power applications to achieve the desired output power by using smaller size of high frequency transformers and inductors. In this paper, a parallel-connected single-phase PFC topology using flyback and forward converters is proposed to improve the output voltage regulation with simultaneous input power factor correction (PFC and control. The goal of the control is to stabilize the output voltage of the converter against the load variations. The paper presents the derivation of fuzzy control rules for the dc/dc converter circuit and control algorithm for regulating the dc/dc converter. This paper presents a design example and circuit analysis for 200 W power supply. The proposed approach offers cost effective, compact and efficient AC/DC converter by the use of parallel power processing. MATLAB/SIMULINK is used for implementation and simulation results show the performance improvement.

Coordinated Control Scheme for Ancillary Services from Offshore Wind Power Plants to AC and DC Grids

DEFF Research Database (Denmark)

Sakamuri, Jayachandra N.; Altin, Müfit; Hansen, Anca Daniela

2016-01-01

This paper proposes a new approach of providing ancillary services to AC and DC grids from offshore wind power plants (OWPPs), connected through multi-terminal HVDC network. A coordinated control scheme where OWPP’s AC grid frequency modulated according to DC grid voltage variations is used...... to detect and provide the ancillary service requirements of both AC and DC grids, is proposed in this paper. In particular, control strategies for onshore frequency control, fault ridethrough support in the onshore grid, and DC grid voltage control are considered. The proposed control scheme involves only...

Hysteresis losses in MgB{sub 2} superconductors exposed to combinations of low AC and high DC magnetic fields and transport currents

Energy Technology Data Exchange (ETDEWEB)

Magnusson, N., E-mail: niklas.magnusson@sintef.no [SINTEF Energy Research, NO-7465 Trondheim (Norway); Abrahamsen, A.B. [DTU Wind Energy, Technical University of Denmark, DK-4000 Roskilde (Denmark); Liu, D. [Electrical Power Processing Group, TU Delft, Mekelweg 4, NL-2628 CD Delft (Netherlands); Runde, M. [SINTEF Energy Research, NO-7465 Trondheim (Norway); Polinder, H. [Electrical Power Processing Group, TU Delft, Mekelweg 4, NL-2628 CD Delft (Netherlands)

2014-11-15

Highlights: • A method for calculating hysteresis losses in the low AC – high DC magnetic field and transport current range has been shown. • The method can be used in the design of wind turbine generators for calculating the losses in the generator DC rotor. • First estimates indicate tolerable current ripple in the 0.1% range for a 4 T DC MgB{sub 2} generator rotor coil. - Abstract: MgB{sub 2} superconductors are considered for generator field coils for direct drive wind turbine generators. In such coils, the losses generated by AC magnetic fields may generate excessive local heating and add to the thermal load, which must be removed by the cooling system. These losses must be evaluated in the design of the generator to ensure a sufficient overall efficiency. A major loss component is the hysteresis losses in the superconductor itself. In the high DC – low AC current and magnetic field region experimental results still lack for MgB{sub 2} conductors. In this article we reason towards a simplified theoretical treatment of the hysteresis losses based on available models in the literature with the aim of setting the basis for estimation of the allowable magnetic fields and current ripples in superconducting generator coils intended for large wind turbine direct drive generators. The resulting equations use the DC in-field critical current, the geometry of the superconductor and the magnitude of the AC magnetic field component as parameters. This simplified approach can be valuable in the design of MgB{sub 2} DC coils in the 1–4 T range with low AC magnetic field and current ripples.

An improved power control strategy for hybrid AC-DC microgrids

DEFF Research Database (Denmark)

Baharizadeh, Mehdi; Karshenas, Hamid Reza; Guerrero, Josep M.

2018-01-01

This paper presents a new droop-based control strategy for hybrid microgrids (HMG) with improved power sharing. When ac microgrids (AC-MG) and dc microgrids (DC-MG) are present in a distribution grid, there is an opportunity to interconnect them via an interlinking converter (IC) and form a HMG......, the possibility of participation of IC in AC-MG reactive power adds some complexity to a HMG control system. In this paper, a new decentralized control strategy is presented for a HMG which relies on regulating the voltage magnitude of a common bus in each microgrid. In this regard, new droop characteristics...... for sources across both microgrids as well as IC are proposed. The proposed droop characteristics result in better active/reactive power sharing across both microgrids and at the same time results in better voltage regulation. The derivation of new droop characteristics is thoroughly discussed in this paper...

DC and AC linear magnetic field sensor based on glass coated amorphous microwires with Giant Magnetoimpedance

International Nuclear Information System (INIS)

García-Chocano, Víctor Manuel; García-Miquel, Héctor

2015-01-01

Giant Magnetoimpedance (GMI) effect has been studied in amorphous glass-coated microwires of composition (Fe 6 Co 94 ) 72.5 Si 12.5 B 15 . The impedance of a 1.5 cm length sample has been characterized by using constant AC currents in the range of 400 µA–4 mA at frequencies from 7 to 15 MHz and DC magnetic fields from −900 to 900 A/m. Double peak responses have been obtained, showing GMI ratios up to 107%. A linear magnetic field sensor for DC and AC field has been designed, using two microwires connected in series with a magnetic bias of 400 A/m with opposite direction in each microwire in order to obtain a linear response from ±70 (A/m) rms for AC magnetic field, and ±100 A/m for DC magnetic field. A closed loop feedback circuit has been implemented to extend the linear range to ±1 kA/m for DC magnetic field. - Highlights: • Giant Magneto Impedance phenomenon has been studied in amorphous microwires. • A combination of two microwires with a bias field has been developed to get a linear response. • An electronic circuit has been developed to obtain a sensor with a linear response. • A feedback coil have been added to increase the measurable range of the sensor

Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

DEFF Research Database (Denmark)

Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin

2009-01-01

This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...

Water calorimetry with thermistor bridge operated in DC and AC mode: comparative results

International Nuclear Information System (INIS)

Guerra, A.S.; Laitano, R.F.; Petrocchi, A.

1997-01-01

An experimental study was carried out to find out the optimal conditions for measuring the output signal in a water calorimeter. To this end the thermistor bridge of the calorimeter was operated in AC and in DC mode, respectively. A comparative analysis of these two alternative methods was the made. In the AC mode measurement a lock-in amplifier based experimental assembly was used and compared to the more conventional system based on a high-sensitivty DC amplifier. The AC system resulted to be preferable as far as the short term and long term reproducibility is concerned. (orig.)

Water calorimetry with thermistor bridge operated in DC and AC mode: comparative results

Energy Technology Data Exchange (ETDEWEB)

Guerra, A S; Laitano, R F; Petrocchi, A [Ist. Nazionale di Metrologia delle Radiazioni Ionizzanti, ENEA, Roma (Italy)

1997-09-01

An experimental study was carried out to find out the optimal conditions for measuring the output signal in a water calorimeter. To this end the thermistor bridge of the calorimeter was operated in AC and in DC mode, respectively. A comparative analysis of these two alternative methods was the made. In the AC mode measurement a lock-in amplifier based experimental assembly was used and compared to the more conventional system based on a high-sensitivty DC amplifier. The AC system resulted to be preferable as far as the short term and long term reproducibility is concerned. (orig.)

Protection of AC and DC Microgrids

DEFF Research Database (Denmark)

Beheshtaein, Siavash; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez

2015-01-01

and DC microgrids, and then investigates the existing and promising solutions for the corresponding challenges. To the authors’ knowledge, three parts of smart grids are required to be developed to facilitate implementation of protection scheme in microgrids. The main requirements and open issues......In future, distributed energy resources (RESs) will be utilized at consumption points. As a consequence, power flow and fault current would be bidirectional and topologydependent; and hence the conventional protection strategies would be inefficient. This paper categorizes the main challenges in AC...

Mixed Inter Second Order Cone Programming Taking Appropriate Approximation for the Unit Commitment in Hybrid AC-DC Grid

DEFF Research Database (Denmark)

Zhou, Bo; Ai, Xiaomeng; Fang, Jiakun

2017-01-01

With the rapid development and deployment of voltage source converter (VSC) based HVDC, the traditional power system is evolving to the hybrid AC-DC grid. New optimization methods are urgently needed for these hybrid AC-DC power systems. In this paper, mixed-integer second order cone programming...... (MISOCP) for the hybrid AC-DC power systems is proposed. The second order cone (SOC) relaxation is adopted to transform the AC and DC power flow constraints to MISOCP. Several IEEE test systems are used to validate the proposed MISCOP formulation of the optimal power flow (OPF) and unit commitment (UC...

The AC photovoltaic module is here!

Science.gov (United States)

Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.

1997-02-01

This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).

Fixed switching frequency applied in single-phase boost AC to DC converter

International Nuclear Information System (INIS)

Chen, T.-C.; Ren, T.-J.; Ou, J.-C.

2009-01-01

The fixed switching frequency control for a single-phase boost AC to DC converter to achieve a sinusoidal line current and unity power factor is proposed in this paper. The relation between the line current error and the fixed switching frequency was developed. For a limit line current error, the minimum switching frequency for a boost AC to DC converter can be achieved. The proposed scheme was implemented using a 32-bit digital signal processor TMS320C32. Simulations and experimental results demonstrate the feasibility and fast dynamic response of the proposed control strategy.

A Secondary Voltage Control Method for an AC/DC Coupled Transmission System Based on Model Predictive Control

DEFF Research Database (Denmark)

Xu, Fengda; Guo, Qinglai; Sun, Hongbin

2015-01-01

For an AC/DC coupled transmission system, the change of transmission power on the DC lines will significantly influence the AC systems’ voltage. This paper describes a method to coordinated control the reactive power of power plants and shunt capacitors at DC converter stations nearby, in order t...

A Coordinated Control for Photovoltaic Generators and Energy Storages in Low-Voltage AC/DC Hybrid Microgrids under Islanded Mode

Directory of Open Access Journals (Sweden)

Yao Liu

2016-08-01

Full Text Available The increasing penetration of renewable generators can be a significant challenge due to the fluctuation of their power generation. Energy storage (ES units are one solution to improve power supply quality and guarantee system stability. In this paper, a hybrid microgrid is built based on photovoltaic (PV generator and ES; and coordinated control is proposed and developed to achieve power management in a decentralized manner. This control scheme contains three different droop strategies according to characteristics of PV and ES. First, the modified droop control is proposed for PV, which can take full utilization of renewable energy and avoid regulating output active power frequently. Second, to maintain the direct current (DC bus voltage stability, a novel droop control incorporating a constant power band is presented for DC-side ES. Third, a cascade droop control is designed for alternating current (AC-side ES. Thus, the ES lifetime is prolonged. Moreover, interlinking converters (ICs provide a bridge between AC/DC buses in a hybrid microgrid. The power control of IC is enabled when the AC- or DC-side suffer from active power demand shortage. In particular, if the AC microgrid does not satisfy the reactive power demand, IC then acts as a static synchronous compensator (STATCOM. The effectiveness of the proposed strategies is verified by simulations.

Influence of Load Modes on Voltage Stability of Receiving Network at DC/AC System

Directory of Open Access Journals (Sweden)

Mao Chizu

2016-01-01

Full Text Available This paper analyses influence of load modes on DC/AC system. Because of widespread use of HVDC, DC/AC system become more complex than before and the present modes used in dispatch and planning departments are not fit in simulation anymore. So it is necessary to find load modes accurately reflecting characteristics of the system. For the sake of the voltage stability, commutation failure, etc. the practical example of the receiving network in a large DC/AC system in China is simulated with BPA, and the influence of Classical Load Mode (CLM and Synthesis load model (SLM on simulation results is studies. Furthermore, some important parameters of SLM are varied respectively among an interval to analyse how they affect the system. According to this practical examples, the result is closely related to load modes and their parameters, and SLM is more conservative but more reasonable than the present modes. The consequences indicate that at critical states, micro variation in parameters may give rise to change in simulation results radically. Thus, correct mode and parameters are important to enhance simulation accuracy of DC/AC system and researches on how they affect the system make senses.

MOEA based design of decentralized controllers for LFC of interconnected power systems with nonlinearities, AC-DC parallel tie-lines and SMES units

International Nuclear Information System (INIS)

Ganapathy, S.; Velusami, S.

2010-01-01

A new design of Multi-Objective Evolutionary Algorithm based decentralized controllers for load-frequency control of interconnected power systems with Governor Dead Band and Generation Rate Constraint nonlinearities, AC-DC parallel tie-lines and Superconducting Magnetic Energy Storage (SMES) units, is proposed in this paper. The HVDC link is used as system interconnection in parallel with AC tie-line to effectively damp the frequency oscillations of AC system while the SMES unit provides bulk energy storage and release, thereby achieving combined benefits. The proposed controller satisfies two main objectives, namely, minimum Integral Squared Error of the system output and maximum closed-loop stability of the system. Simulation studies are conducted on a two area interconnected power system with nonlinearities, AC-DC tie-lines and SMES units. Results indicate that the proposed controller improves the transient responses and guarantees the closed-loop stability of the overall system even in the presence of system nonlinearities and with parameter changes.

Linking DC together with TRSL

DEFF Research Database (Denmark)

Haxthausen, Anne; Yong, Xia

1999-01-01

In this talk we present a method for linking the Duration Calculus together with the Timed RAISE Specification Language. Duration Calculus (DC) [ZHR91] is an interval-based real time logic, which can be used naturally in capturing and eliciting users' real time requirements in the form of constra......In this talk we present a method for linking the Duration Calculus together with the Timed RAISE Specification Language. Duration Calculus (DC) [ZHR91] is an interval-based real time logic, which can be used naturally in capturing and eliciting users' real time requirements in the form.......TRSL is a real-time extension of the RAISE Specification Language (RSL) [Rlg92] which together with its associated method [Rmg95]and tools has shown to be very useful in the industrial development of software systems. Therefore, a promising approach for the development of real-time systemscould be to use DC...... for high-level specifications of real-time requirementsand TRSL for specifying real-time implementations in the form of timed communicating concurrent processes.In order to link DC and TRSL together in a well-founded way, we formally define what it means for a TRSL process to satisfy a DC requirement...

Research & Implementation of AC - DC Converter with High Power Factor & High Efficiency

Directory of Open Access Journals (Sweden)

Hsiou-Hsian Nien

2014-05-01

Full Text Available In this paper, we design and develop a high power factor, high efficiency two-stage AC - DC power converter. This paper proposes a two-stage AC - DC power converter. The first stage is boost active power factor correction circuit. The latter stage is near constant frequency LLC resonant converter. In addition to traditional LLC high efficiency advantages, light-load conversion efficiency of this power converter can be improved. And it possesses high power factor and near constant frequency operating characteristics, can significantly reduce the electromagnetic interference. This paper first discusses the main structure and control manner of power factor correction circuit. And then by the LLC resonant converter equivalent model proceed to circuit analysis to determine the important parameters of the converter circuit elements. Then design a variable frequency resonant tank. The resonant frequency can change automatically on the basis of the load to reach near constant frequency operation and a purpose of high efficiency. Finally, actually design and produce an AC – DC power converter with output of 190W to verify the characteristics and feasibility of this converter. The experimental results show that in a very light load (9.5 W the efficiency is as high as 81%, the highest efficiency of 88% (90 W. Full load efficiency is 87%. At 19 W ~ 190 W power changes, the operating frequency change is only 0.4 kHz (AC 110 V and 0.3 kHz (AC 220 V.

Ac and dc motor flooding times

International Nuclear Information System (INIS)

Crowley, D.A.; Hinton, J.H.

1988-01-01

Reactor safety studies, such as the emergency cooling system (ECS) limits analyses and the probabilistic risk assessment, require that the flood-out times be calculated for the ac and dc motors at the -40 foot level. New calculations are needed because dams of an improved design have been installed between the pump room and motor room, and because updated leak rate calculations have shown that the maximum possible leak rate is larger than that which had been previously calculated. The methodology for calculating the motor flood-out times has also been improved. A computer program has been written to calculate flood-out times for various leak rates and sump pump operabilities. For ECS limits analyses, the worst case dc motor flood-out times are 161 and 297 seconds in LKC and P-areas, respectively. These times are for a 135,468 gpm leak that first flows to the motor room and all of the sump pumps are off

Multilevel DC link inverter

Science.gov (United States)

Su, Gui-Jia

2003-06-10

A multilevel DC link inverter and method for improving torque response and current regulation in permanent magnet motors and switched reluctance motors having a low inductance includes a plurality of voltage controlled cells connected in series for applying a resulting dc voltage comprised of one or more incremental dc voltages. The cells are provided with switches for increasing the resulting applied dc voltage as speed and back EMF increase, while limiting the voltage that is applied to the commutation switches to perform PWM or dc voltage stepping functions, so as to limit current ripple in the stator windings below an acceptable level, typically 5%. Several embodiments are disclosed including inverters using IGBT's, inverters using thyristors. All of the inverters are operable in both motoring and regenerating modes.

A Novel Multilevel DC - AC Converter from Green Energy Power Generators Using Step-Square Waving and PWM Technique

Science.gov (United States)

Fajingbesi, F. E.; Midi, N. S.; Khan, S.

2017-06-01

Green energy sources or renewable energy system generally utilize modular approach in their design. This sort of power sources are generally in DC form or in single cases AC. Due to high fluctuation in the natural origin of this energy (wind & solar) source they are stored as DC. DC power however are difficult to transfer over long distances hence DC to AC converters and storage system are very important in green energy system design. In this work we have designed a novel multilevel DC to AC converter that takes into account the modular design of green energy systems. A power conversion efficiency of 99% with reduced total harmonic distortion (THD) was recorded from our simulated system design.

Distributed Coordination Control Based on State-of-Charge for Bidirectional Power Converters in a Hybrid AC/DC Microgrid

Directory of Open Access Journals (Sweden)

Zeyan Lv

2018-04-01

Full Text Available This paper proposes a distributed coordination control for multiple bidirectional power converters (BPCs in a hybrid AC/DC microgrid with consideration of state-of-charge (SOC of storages. The researched hybrid AC/DC microgrid is composed of both AC and DC subgrids connected by multiple parallel BPCs. In the literature, the storages of a hybrid microgrid are considered to allocate in only the AC subgrid or DC subgrid, which reduces the reliability of the whole system, especially during the islanded mode. Besides, the SOC management has not been considered in BPCs’ operating strategy. This paper considers a hybrid microgrid topology which has energy storages in both AC side and DC side. This ensures the reliability while increasing the complexity of the control strategy at the same time. Further, a distributed coordination control method for multiple BPCs based on SOC was proposed to enhance the reliability of hybrid microgrid. Finally, the performance of the proposed control methods was verified by real-time hardware-in-loop (HIL tests.

Direct Current as an Integrating Platform for ZNE Buildings with EVs and Storage: DC Direct Systems – A Bridge to a Low Carbon Future?

Energy Technology Data Exchange (ETDEWEB)

Johnson, Karl [California Inst. for Energy and the Environment, Berkeley, CA (United States); Vossos, Vagelis [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Kloss, Margarita [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Robinson, Gerald [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Brown, Rich [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

2016-09-01

Cost effective zero net energy (ZNE) schemes exist for many types of residential and commercial buildings. Yet, today’s alternating current (AC) based ZNE designs may be as much as 10% to 20% less efficient, more costly, and more complicated than a design based on direct current (DC) technologies. An increasing number of research organizations and manufacturers are just starting the process of developing products and conducting research and development (R&D) efforts. These early R&D efforts indicate that the use of DC technologies may deliver many energy and non-energy benefits relative to AC-based typologies. DC ZNE schemes may provide for an ideal integrating platform for natively DC-based onsite generation, storage, electric vehicle (EV) charging and end-use loads. Emerging empirical data suggest that DC end-use appliances are more efficient, simpler, more durable, and lower cost. DC technologies appear to provide ratepayers a lower cost pathway to achieve resilient ZNE buildings, and simultaneously yield a plethora of benefits. This paper draws from the current research effort entitled "Direct Current as an Integrating and Enabling Platform," co-led by the Lawrence Berkeley National Laboratory (LBNL), the California Institute for Energy and the Environment (CIEE), the Electric Power Research Institute (EPRI) and funded under the California Energy Commission’s Energy Program Investment Charge (CEC EPIC). The first phase of this EPIC research is focused on assembling and summarizing known global performance information on DC and DC-AC hybrid end-use appliances and power systems. This paper summarizes the information and insights gained from this research effort.

Data-Driven Control for Interlinked AC/DC Microgrids via Model-Free Adaptive Control and Dual-Droop Control

DEFF Research Database (Denmark)

Zhang, Huaguang; Zhou, Jianguo; Sun, Qiuye

2017-01-01

This paper investigates the coordinated power sharing issues of interlinked ac/dc microgrids. An appropriate control strategy is developed to control the interlinking converter (IC) to realize proportional power sharing between ac and dc microgrids. The proposed strategy mainly includes two parts...

NO removal characteristics of a corona radical shower system under DC and AC/DC superimposed operations

NARCIS (Netherlands)

Yan, K.; Yamamoto, T.; Kanazawa, S.; Ohkubo, T.; Nomoto, Y.; Chang, Jen-Shih

2001-01-01

In this paper, the effects of the applied voltage modes on the positive corona discharge morphology and NO removal characteristics from air streams are experimentally investigated. By using a DC superimposed high frequency AC power supply (10-60 kHz), a uniform streamer corona can be generated,

Modeling and real time simulation of an HVDC inverter feeding a weak AC system based on commutation failure study.

Science.gov (United States)

Mankour, Mohamed; Khiat, Mounir; Ghomri, Leila; Chaker, Abdelkader; Bessalah, Mourad

2018-06-01

This paper presents modeling and study of 12-pulse HVDC (High Voltage Direct Current) based on real time simulation where the HVDC inverter is connected to a weak AC system. In goal to study the dynamic performance of the HVDC link, two serious kind of disturbance are applied at HVDC converters where the first one is the single phase to ground AC fault and the second one is the DC link to ground fault. The study is based on two different mode of analysis, which the first is to test the performance of the DC control and the second is focalized to study the effect of the protection function on the system behavior. This real time simulation considers the strength of the AC system to witch is connected and his relativity with the capacity of the DC link. The results obtained are validated by means of RT-lab platform using digital Real time simulator Hypersim (OP-5600), the results carried out show the effect of the DC control and the influence of the protection function to reduce the probability of commutation failures and also for helping inverter to take out from commutation failure even while the DC control fails to eliminate them. Copyright © 2018 ISA. Published by Elsevier Ltd. All rights reserved.

Power Management of the DC Bus Connected Converters in a Hybrid AC/DC Microgrid Tied to the Main Grid

Directory of Open Access Journals (Sweden)

Robert Antonio Salas-Puente

2018-03-01

Full Text Available In this paper, a centralized control strategy for the efficient power management of power converters composing a hybrid AC/DC microgrid is explained. The study is focused on the converters connected to the DC bus. The proposed power management algorithm is implemented in a microgrid central processor which is based on assigning several operation functions to each of the generators, loads and energy storage systems in the microgrid. The power flows between the DC and AC buses are studied in several operational scenarios to verify the proposed control. Experimental and simulation results demonstrate that the algorithm allows control of the power dispatch inside the microgrid properly by performing the following tasks: communication among power converters, the grid operator and loads; connection and disconnection of loads; control of the power exchange between the distributed generators and the energy storage system and, finally, supervision of the power dispatch limit set by the grid operator.

High benefits approach for electrical energy conversion in electric vehicles from DC to PWM-AC without any generated harmonic

International Nuclear Information System (INIS)

Fathabadi, Hassan

2014-01-01

Highlights: • Novel hybrid power source including AC feature for using in electric/hybrid vehicles. • Minimizing the energy loss in electric/hybrid vehicles by using the proposed system. • Suitable AC wave form for braking/accelerating purposes in electric/hybrid vehicles. • A novelty is that the harmonic generated by the added AC feature is really zero. • Another novelty is the capability of choosing arbitrary frequency for AC feature. - Abstract: This paper presents a novel hybrid power source, including a Li-ion battery together with an interface, which generates simultaneously electrical energy with the forms of both DC and AC for electric vehicles. A novel and high benefits approach is applied to convert the electrical energy of the Li-ion battery from DC form to single-phase symmetric pulse-width modulation (PWM)-AC form. Harmonic generation is one of the important problems when electrical energy is converted from DC to AC but there are not any generated harmonic during the DC/AC conversion using the proposed technique. The proposed system will be widely used in electric/hybrid vehicles because it has many benefits. Minimizing the energy loss (saving energy), no generated harmonic (it is really zero), the capability of arbitrary/necessary frequency selection for output AC voltage and the ability of long distance energy transmission are some novelties and advantages of the proposed system. The proposed hybrid power source including DC/AC PWM inverter is simulated in Proteus 6 software environment and a laboratory-based prototype of the hybrid power source is constructed to validate the theoretical and simulation results. Simulation and experimental results are presented to prove the superiority of the proposed hybrid power supply

Progress on advanced dc and ac induction drives for electric vehicles

Science.gov (United States)

Schwartz, H. J.

1982-01-01

Progress is reported in the development of complete electric vehicle propulsion systems, and the results of tests on the Road Load Simulator of two such systems representative of advanced dc and ac drive technology are presented. One is the system used in the DOE's ETV-1 integrated test vehicle which consists of a shunt wound dc traction motor under microprocessor control using a transistorized controller. The motor drives the vehicle through a fixed ratio transmission. The second system uses an ac induction motor controlled by transistorized pulse width modulated inverter which drives through a two speed automatically shifted transmission. The inverter and transmission both operate under the control of a microprocessor. The characteristics of these systems are also compared with the propulsion system technology available in vehicles being manufactured at the inception of the DOE program and with an advanced, highly integrated propulsion system upon which technology development was recently initiated.

A Control Strategy of DC Building Microgrid Connected to the Neighborhood and AC Power Network

Directory of Open Access Journals (Sweden)

Thi Thuong Huyen Ma

2017-05-01

Full Text Available Recently, the use of DC microgrid distribution system has become more attractive than traditional AC systems due to their energy efficiency and ability to easily integrate with renewable energy sources and batteries. This paper proposes a 500 V DC microgrid which consists of a 20 kWp photovoltaic panel, batteries, and DC loads. A hierarchical control strategy to ensure balance power of the DC microgrid and the maintenance of common DC bus voltage is presented. The capability of exchanging power energy of the microgrid with the power system of neighborhood buildings is also considered. Typical operation modes are simulated in the Matlab/simulink environment to confirm the good performance of the controllers and the efficiency of appropriately controlling the charge–discharge of the battery system. This research is expected to bring benefits to the design and operation of the system, such as reducing the capacity of batteries, increasing the self-supply of buildings, and decreasing the electricity demand from the AC grid.

Design of AC-DC Grid Connected Converter using Multi-Objective Optimization

Directory of Open Access Journals (Sweden)

Piasecki Szymon

2014-05-01

Full Text Available Power electronic circuits, in particular AC-DC converters are complex systems, many different parameters and objectives have to be taken into account during the design process. Implementation of Multi-Objective Optimization (MOO seems to be attractive idea, which used as designer supporting tool gives possibility for better analysis of the designed system. This paper presents a short introduction to the MOO applied in the field of power electronics. Short introduction to the subject is given in section I. Then, optimization process and its elements are briefly described in section II. Design procedure with proposed optimization parameters and performance indices for AC-DC Grid Connected Converter (GCC interfacing distributed systems is introduced in section III. Some preliminary optimization results, achieved on the basis of analytical and simulation study, are shown at each stage of designing process. Described optimization parameters and performance indices are part of developed global optimization method dedicated for ACDC GCC introduced in section IV. Described optimization method is under development and only short introduction and basic assumptions are presented. In section V laboratory prototype of high efficient and compact 14 kVA AC-DC converter is introduced. The converter is elaborated based on performed designing and optimization procedure with the use of silicon carbide (SiC power semiconductors. Finally, the paper is summarized and concluded in section VI. In presented work theoretical research are conducted in parallel with laboratory prototyping e.g. all theoretical ideas are verified in laboratory using modern DSP microcontrollers and prototypes of the ACDC GCC.

Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters

DEFF Research Database (Denmark)

Qin, Zian

. The approaches for improving their performance, in terms of the voltage stress, efficiency, power density, cost, loss distribution, and temperature, will be studied. The structure of the thesis is as follows, Chapter 1 presents the introduction and motivation of the whole project as well as the background...... becomes a emerging challenge. Accordingly, installation of sustainable power generators like wind turbines and solar panels has experienced a large increase during the last decades. Meanwhile, power electronics converters, as interfaces in electrical system, are delivering approximately 80 % electricity...... back-to-back, and meanwhile improve the harmonics, control flexibility, and thermal distribution between the switches. Afterwards, active power decoupling methods for single-phase inverters or rectifiers that are similar to the single-phase ac-dc-ac converter, are studied in Chapter 4...

Nb46, 5wt% Ti Eb-melting for AC and DC superconducting applications

International Nuclear Information System (INIS)

Bormio, C.; Ramos, M.J.; Pinatti, D.G.

1990-01-01

This paper reports on the superconductor alloy Nb46, 5wt % Ti which presents the best superconducting and mechanical properties for the systems Nb-Ti. The greatest difficulty in obtaining this alloy is related to the difference between the raw materials melting temperatures, which is about 700 degrees C. As a result the alloy homogeneity as well as Ti desired content, turn to be hard to control. The authors choose an electrode sandwich type, where Nb and Ti sheets are interposed. The electrode dimensions calculation is based on the Ti evaporation rate, energy balance and superficial tension of liquid titanium between Nb sheets. The ingots were electron beam melted. Herein, we present the following ingot results: Ti, intersticial and trace contents compared to international manufactures as well as its mechanical workability. This alloy will be used in NbTi wire production for AC and DC applications. The AC and DC wires are produced by coswaging and codrawing of NbTi bars and C u Ni-tubes for AC wires and Cu-tubes for DC wires. High area reductions of about 2 x 10 8 are reached without intermediate heat treatment, and they are essential since they are precursors of collective pinning centers, responsible for high critical current densities

AC and DC electrical behavior of MWCNT/epoxy nanocomposite near percolation threshold: Equivalent circuits and percolation limits

Science.gov (United States)

Alizadeh Sahraei, Abolfazl; Ayati, Moosa; Baniassadi, Majid; Rodrigue, Denis; Baghani, Mostafa; Abdi, Yaser

2018-03-01

This study attempts to comprehensively investigate the effects of multi-walled carbon nanotubes (MWCNTs) on the AC and DC electrical conductivity of epoxy nanocomposites. The samples (0.2, 0.3, and 0.5 wt. % MWCNT) were produced using a combination of ultrason and shear mixing methods. DC measurements were performed by continuous measurement of the current-voltage response and the results were analyzed via a numerical percolation approach, while for the AC behavior, the frequency response was studied by analyzing phase difference and impedance in the 10 Hz to 0.2 MHz frequency range. The results showed that the dielectric parameters, including relative permittivity, impedance phase, and magnitude, present completely different behaviors for the frequency range and MWCNT weight fractions studied. To better understand the nanocomposites electrical behavior, equivalent electric circuits were also built for both DC and AC modes. The DC equivalent networks were developed based on the current-voltage curves, while the AC equivalent circuits were proposed by using an optimization problem according to the impedance magnitude and phase at different frequencies. The obtained equivalent electrical circuits were found to be highly useful tools to understand the physical mechanisms involved in MWCNT filled polymer nanocomposites.

Ac system interruption analysis of an orthogonal-core type dc-ac converter. Koryu keito shadanji no chokko jishinkei dc-ac renkeiyo henkanki no dosa kaiseki

Energy Technology Data Exchange (ETDEWEB)

Sato, K; Ichinokura, O; Jinzenji, T [Tohoku Univ., Sendai (Japan). Faculty of Engineering; Tajima, K [Akita University, Akita (Japan). Mining College

1991-04-30

This paper reports on a numerical analysis of transient response of an orthogonal-core type dc-ac converter that takes place when the external ac system connected is cut off from it. A model of magnetic circuit of the orthogonal core is presented, which has magnetic inductances to represent effects produced by hysteresis that are connected in series with magnetic reluctances, thereby making it possible to divide each of primary and secondary winding current into magnetization current associated with magnetic reluctances and iron-loss current due to hysteresis. Moreover, a numerical model of the orthogonal core is derived from expressions for non-linear characteristics of these reluctances and inductances to make use of it for analyses employing the circuit simulator SPICE. Transient response of the present converter, namely time variation of both voltage and current in its every part, to the sudden change in condition that is caused by switching off the ac system connected to its secondary side is calculated, while applying square-wave voltage to its primary side. It is noted that calculated wave forms of both secondary winding current and open-circuit voltage are fairly in good agreement with those obtained by an experiment performed on the same condition. 4 refs., 9 figs., 1 tab.

Comparative evaluation of soft-switching, bidirectional, isolated AC/DC converter topologies

NARCIS (Netherlands)

Everts, J.; Krismer, F.; Van den Keybus, J.; Driesen, Johan; Kolar, J.W.

2012-01-01

For realizing bidirectional and isolated AC/DC converters, soft-switching techniques/topologies seem to be a favourable choice as they enable a further loss and volume reduction of the system. Contrary to the traditional dual-stage approach, using a power factor corrector (PFC) stage in series with

Power Flow Analysis for Low-Voltage AC and DC Microgrids Considering Droop Control and Virtual Impedance

DEFF Research Database (Denmark)

Li, Chendan; Chaudhary, Sanjay Kumar; Savaghebi, Mehdi

2017-01-01

In the low-voltage (LV) ac microgrids (MGs), with a relatively high R/X ratio, virtual impedance is usually adopted to improve the performance of droop control applied to distributed generators (DGs). At the same time, LV dc MG using virtual impedance as droop control is emerging without adequate...... power flow studies. In this paper, power flow analyses for both ac and dc MGs are formulated and implemented. The mathematical models for both types of MGs considering the concept of virtual impedance are used to be in conformity with the practical control of the DGs. As a result, calculation accuracy...... is improved for both ac and dc MG power flow analyses, comparing with previous methods without considering virtual impedance. Case studies are conducted to verify the proposed power flow analyses in terms of convergence and accuracy. Investigation of the impact to the system of internal control parameters...

Application of DC-AC Hybrid Grid and Solar Photovoltaic Generation with Battery Storage Using Smart Grid

Directory of Open Access Journals (Sweden)

Shoaib Rauf

2017-01-01

Full Text Available Smart grid for the past few years has been the prime focus of research in power systems. The aim is to eliminate load shedding and problematic blackout conditions, further offering cheap and continuous supply of electricity for both large and small consumers. Another benefit is to integrate renewable energy resources with existing dump grid in more efficient and cost-effective manner. In past few years, growing demand for sustainable energy increases the consumption of solar PV. Since generation from solar PV is in DC and most of the appliances at home could be operated on DC, AC-DC hybrid distribution system with energy management system is proposed in this paper. EMS helps to shift or control the auxiliary load and compel the users to operate specific load at certain time slots. These techniques further help to manage the excessive load during peak and off peak hours. It demonstrates the practical implementation of DC-AC network with integration of solar PV and battery storage with existing infrastructure. The results show a remarkable improvement using hybrid AC-DC framework in terms of reliability and efficiency. All this functioning together enhances the overall efficiency; hence, a secure, economical, reliable, and intelligent system leads to a smart grid.

Distribution System Augmented by DC Links for Increasing the Hosting Capacity of PV Generation

DEFF Research Database (Denmark)

Chaudhary, Sanjay; Demirok, Erhan; Teodorescu, Remus

2012-01-01

This paper presents a concept of enhancing the photovoltaic (PV) power generation hosting capacity of distribution networks. Distribution network serving electrical energy to farm settlements was selected as an example for their large roof area available for PV installation. Further, they are cha......This paper presents a concept of enhancing the photovoltaic (PV) power generation hosting capacity of distribution networks. Distribution network serving electrical energy to farm settlements was selected as an example for their large roof area available for PV installation. Further......, they are characterized by long radial feeders. Such feeders suffer from voltage rise and transformer overloading problems as the total number and capacity of the PV installations increase. The distribution network can be augmented by dc distribution links with power electronic converter interfaces to the traditional ac...... distribution systems. It is shown here that the dc links can be used to interconnect the different radial feeders and the excess power thus could be transferred to the nearby industrial load-center....

New three-phase ac-ac converter incorporating three-phase boost integrated ZVT bridge and single-phase HF link

International Nuclear Information System (INIS)

Abdelhamid, Tamer H.; Sabzali, Ahmad J.

2008-01-01

This paper presents a new zero voltage transition (ZVT), power factor corrected three phase ac-ac converter with single phase high frequency (HF) link. It is a two stage converter; the first stage is a boost integrated bridge converter (combination of a 3 ph boost converter and a bridge converter) operated at fixed frequency and that operates in two modes at ZVT for all switches and establishes a 1 ph square wave HF link. The second stage is a bi-directional pulse width modulation (PWM) 3 ph bridge that converts the 1 ph HF link to a 3 ph voltage using a novel switching strategy. The converter modes of operation and key equations are outlined. Simulation of the overall system is conducted using Simulink. The switching strategy and its corresponding control circuit are clearly described. Experimental verification of the simulation is conducted for a prototype of 100 V, 500 W at 10 kHz link frequency

Linking DC together with TRSL

DEFF Research Database (Denmark)

Haxthausen, Anne Elisabeth; Yong, X.

2000-01-01

in a method for real-time developments. An operational semantics with behavior is specified for TRSL. It is defined what its means for a TRSL process to satisfy a DC requirement, and a method for verifying whether the satisfaction relation holds or not is provided. Our contribution also demonstrates a general......Duration Calculus (DC) is an interval-based real-time logic, which can be used in capturing and eliciting users' real-time requirements. The Timed RAISE Specification Language (TRSL) is an extension of the RAISE Specification Language with real-time features. This paper links DC and TRSL together...

Passive AC network supplying the integration of CCC-HVDC and VSC-HVDC systems

OpenAIRE

BIDADFAR, Ali; ABEDI, Mehrdad; KARRARI, Mehdi

2014-01-01

The integration of a capacitor-commutated converter (CCC) high-voltage direct current (HVDC) (CCC-HVDC) and voltage source converter (VSC) HVDC (VSC-HVDC) is proposed in this paper to supply entirely passive AC networks. The key point of this integration is the flat characteristic of the DC voltage of the CCC-HVDC, which provides the condition for the VSC to connect to the CCC DC link via a current regulator. The advantages of the proposed combined infeeding system are the requirement o...

New perspectives on the dynamics of AC and DC plasma arcs exposed to cross-fields

International Nuclear Information System (INIS)

Abdo, Youssef; Rohani, Vandad; Cauneau, François; Fulcheri, Laurent

2017-01-01

Interactions between an arc and external fields are crucially important for the design and the optimization of modern plasma torches. Multiple studies have been conducted to help better understand the behavior of DC and AC current arcs exposed to external and ‘ self-induced ’ magnetic fields, but the theoretical foundations remain very poorly explored. An analytical investigation has therefore been carried out in order to study the general behavior of DC and AC arcs under the effect of random cross-fields. A simple differential equation describing the general behavior of a planar DC or AC arc has been obtained. Several dimensionless numbers that depend primarily on arc and field parameters and the main arc characteristics (temperature, electric field strength) have also been determined. Their magnitude indicates the general tendency pattern of the arc evolution. The analytical results for many case studies have been validated using an MHD numerical model. The main purpose of this investigation was deriving a practical analytical model for the electric arc, rendering possible its stabilization and control, and the enhancement of the plasma torch power. (paper)

New perspectives on the dynamics of AC and DC plasma arcs exposed to cross-fields

Science.gov (United States)

Abdo, Youssef; Rohani, Vandad; Cauneau, François; Fulcheri, Laurent

2017-02-01

Interactions between an arc and external fields are crucially important for the design and the optimization of modern plasma torches. Multiple studies have been conducted to help better understand the behavior of DC and AC current arcs exposed to external and ‘self-induced’ magnetic fields, but the theoretical foundations remain very poorly explored. An analytical investigation has therefore been carried out in order to study the general behavior of DC and AC arcs under the effect of random cross-fields. A simple differential equation describing the general behavior of a planar DC or AC arc has been obtained. Several dimensionless numbers that depend primarily on arc and field parameters and the main arc characteristics (temperature, electric field strength) have also been determined. Their magnitude indicates the general tendency pattern of the arc evolution. The analytical results for many case studies have been validated using an MHD numerical model. The main purpose of this investigation was deriving a practical analytical model for the electric arc, rendering possible its stabilization and control, and the enhancement of the plasma torch power.

Simulation comparison of proportional integral derivative and fuzzy logic in controlling AC-DC buck boost converter

Science.gov (United States)

Faisal, A.; Hasan, S.; Suherman

2018-03-01

AC-DC converter is widely used in the commercial industry even for daily purposes. The AC-DC converter is used to convert AC voltage into DC. In order to obtain the desired output voltage, the converter usually has a controllable regulator. This paper discusses buck boost regulator with a power MOSFET as switching component which is adjusted based on the duty cycle of pulse width modulation (PWM). The main problems of the buck boost converter at start up are the high overshoot, the long peak time and rise time. This paper compares the effectiveness of two control techniques: proportional integral derivative (PID) and fuzzy logic control in controlling the buck boost converter through simulations. The results show that the PID is more sensitive to voltage change than fuzzy logic. However, PID generates higher overshoot, long peak time and rise time. On the other hand, fuzzy logic generates no overshoot and shorter rise time.

Interaction between MHD generator and DC-AC power conversion system

International Nuclear Information System (INIS)

Tanaka, D.

1982-01-01

Transient characteristics of an MHD power generating system including a DC-AC inverter are analyzed using a time-dependent quasi-one-dimensional approximation. The generator model considered is Faraday type of U-25 class with heavy-oil and air combustion gas. It is found that a short-circuited fault of the invertor may become more serious than an open-circuited fault, resulting in significant gas velocity reduction. An open-circuited fault, if retained for more than 5-8 ms, can substantially increase the gas velocity at the upstream end of the fault region. A protection system composed of a fast-acting DC circuit-breaker and an emergency load resistance is proposed. The switching speed of the DC breaker must be about 500 microsec to stop a pressure increase, resulting, for example, from the short-circuiting of 20 electrode pairs, before it reaches 120% of the initial level

DC response of dust to low frequency AC signals

Science.gov (United States)

McKinlay, Michael; Konopka, Uwe; Thomas, Edward

2017-10-01

Macroscopic changes in the shape and equilibrium position of clouds of charged microparticles suspended in a plasma have been observed in response to low frequency AC signals. In these experiments, dusty plasmas consisting of 2-micron diameter silica microspheres suspended between an anode and cathode in an argon, DC glow discharge plasma are produced in a grounded, 6-way cross vacuum chamber. An AC signal, produced by a function generator and amplified by a bipolar op-amp, is superimposed onto the potential from the cathode. The frequencies of the applied AC signals, ranging from tens to hundreds of kHz, are comparable to the ion-neutral collision frequency; well below the ion/electron plasma frequencies, but also considerably higher than the dust plasma frequency. This presentation will detail the experimental setup, present documentation and categorization of observations of the dust response, and present an initial model of the response. This work is supported by funding from the US Dept. of Energy, Grant Number DE-SC0016330, and by the National Science Foundation, Grant Number PHY-1613087.

A.c. susceptibility measurements in the presence of d.c. magnetic fields for Nd-Ba-Cu-O superconductors

International Nuclear Information System (INIS)

Watahiki, M.; Murakami, M.; Yoo, S.I.

1997-01-01

We report the temperature and magnetic field dependence of the complex a.c. susceptibility with bias d.c. magnetic fields for melt-processed Nd-Ba-Cu-O superconductor. The onset temperature (T onset ) of the real part of a.c. susceptibility shifted to a lower temperature with increasing d.c. magnetic field. The superconducting transition temperature (T c ) determined by d.c. magnetization measurements did not shift appreciably to a lower-temperature region with increasing d.c. magnetic field. The distinction between T onset and T c indicates that the a.c. susceptibility measurements detect the energy dissipation generated by the motion of flux lines. We have also measured flux profiles and found that there was no appreciable change in flux penetration below and above the peak field, which suggests that the peak effect in Nd-Ba-Cu-O is not due to the phase transition in the flux line lattice. (author)

DC-link Voltage Coordinative-Proportional Control in Cascaded Converter Systems

DEFF Research Database (Denmark)

Tian, Yanjun; Loh, Poh Chiang; Deng, Fujin

2015-01-01

PI controllers are frequently implemented in cascaded converter system to control the DC-link voltage, because they can achieve zero steady state error. However the PI controller adds a pole at the origin point and a zero on the left half plane, and it increases the control system type number......, and then the system is more difficult to control. This paper proposed a DC-link control method for the two stages cascaded converter, and it uses proportional controller for the DC-link voltage control. This control method can achieve zero steady state error on the DC-link voltage; reduce the control system type...

Model, Characterization, and Analysis of Steady-State Security Region in AC/DC Power System with a Large Amount of Renewable Energy

Directory of Open Access Journals (Sweden)

Zhong Chen

2017-08-01

Full Text Available A conventional steady-state power flow security check only implements point-by-point assessment, which cannot provide a security margin for system operation. The concept of a steady-state security region is proposed to effectively tackle this problem. Considering that the commissioning of the increasing number of HVDC (High Voltage Direct Current and the fluctuation of renewable energy have significantly affected the operation and control of a conventional AC system, the definition of the steady-state security region of the AC/DC power system is proposed in this paper based on the AC/DC power flow calculation model including LCC/VSC (Line Commutated Converter/Voltage Sourced Converter-HVDC transmission and various AC/DC constraints, and hence the application of the security region is extended. In order to ensure that the proposed security region can accurately provide global security information of the power system under the fluctuations of renewable energy, this paper presents four methods (i.e., a screening method of effective boundary surfaces, a fitting method of boundary surfaces, a safety judging method, and a calculation method of distances and corrected distance between the steady-state operating point and the effective boundary surfaces based on the relation analysis between the steady-state security region geometry and constraints. Also, the physical meaning and probability analysis of the corrected distance are presented. Finally, a case study is demonstrated to test the feasibility of the proposed methods.

Energy efficient direct current distribution in commercially used buildings with smart power link to the AC distribution grid; Energieeffiziente Gleichstromverteilung in kommerziell genutzten Gebaeuden mit intelligenter Kopplung zum Niederspannungsnetz

Energy Technology Data Exchange (ETDEWEB)

Weiss, Roland [Siemens AG, Erlangen (Germany); Boeke, Ulrich [Philips Group Innovation-Research, Eindhoven (Netherlands); Maurer, Wilhelm [Infineon Technologies AG, Neubiberg (Germany); Zeltner, Stefan [Fraunhofer-Inst. fuer Integrierte Systeme und Bauelementetechnologie (IISB), Erlangen (Germany)

2012-07-01

The joint undertaking ''Direct Current Components and Grid'' (DCC+G) takes on the strategic challenge to reduce energy consumption and thus the reduction of CO{sub 2} emission caused by commercially used buildings through research in the fields of Direct Current distribution at a voltage level of {+-} 380 V. The major energy consumers in commercially used buildings, ready for the ''net-zero-energy'' goal of the European Union, are heat pumps for heating, ventilation systems, air conditioning units, cooling units (HVAC), lighting systems and information technology. All these components and subsystems have in common, that the most efficient versions would benefit from a direct current supply. Additionally the local producers of electric energy like photovoltaic systems usually generate DC-current. A Direct Current distribution grid within buildings would avoid the repeating conversion from DC and AC an vice versa and therefore reduce conversion losses. Important components of a direct current distribution grid are central, smart, high efficient, bidirectional rectifiers replacing the large number of small, less efficient rectifiers used today. Such large central rectifiers units could additionally be used to actively improve the power quality of the smart local AC distribution grid. One major part of the described activities is to show energy savings of about 5 % of electrical energy with a 2-phase direct current distribution grid using a voltage level of {+-} 380 V. (orig.)

Optimizing Energy Savings from Direct-DC in U.S. Residential Buildings

Energy Technology Data Exchange (ETDEWEB)

Garbesi, Karina; Vossos, Vagelis; Sanstad, Alan; Burch, Gabriel

2011-10-13

An increasing number of energy efficient appliances operate on direct current (DC) internally, offering the potential to use DC from renewable energy systems directly and avoiding the losses inherent in converting power to alternating current (AC) and back. This paper investigates that potential for net-metered residences with on-site photovoltaics (PV) by modeling the net power draw of the ‘direct-DC house’ with respect to today’s typical configuration, assuming identical DC-internal loads. Power draws were modeled for houses in 14 U.S. cities, using hourly, simulated PV-system output and residential loads. The latter were adjusted to reflect a 33% load reduction, representative of the most efficient DC-internal technology, based on an analysis of 32 electricity end-uses. The model tested the effect of climate, electric vehicle (EV) loads, electricity storage, and load shifting on electricity savings; a sensitivity analysis was conducted to determine how future changes in the efficiencies of power system components might affect savings potential. Based on this work, we estimate that net-metered PV residences could save 5% of their total electricity load for houses without storage and 14% for houses with storage. Based on residential PV penetration projections for year 2035 obtained from the National Energy Modeling System (2.7% for the reference case and 11.2% for the extended policy case), direct-DC could save the nation 10 trillion Btu (without storage) or 40 trillion Btu (with storage). Shifting the cooling load by two hours earlier in the day (pre-cooling) has negligible benefits for energy savings. Direct-DC provides no energy savings benefits for EV charging, to the extent that charging occurs at night. However, if charging occurred during the day, for example with employees charging while at work, the benefits would be large. Direct-DC energy savings are sensitive to power system and appliance conversion efficiencies but are not significantly

Analysis of genomic DNA of DcACS1, a 1-aminocyclopropane-1-carboxylate synthase gene, expressed in senescing petals of carnation (Dianthus caryophyllus) and its orthologous genes in D. superbus var. longicalycinus.

Science.gov (United States)

Harada, Taro; Murakoshi, Yuino; Torii, Yuka; Tanase, Koji; Onozaki, Takashi; Morita, Shigeto; Masumura, Takehiro; Satoh, Shigeru

2011-04-01

Carnation (Dianthus caryophyllus) flowers exhibit climacteric ethylene production followed by petal wilting, a senescence symptom. DcACS1, which encodes 1-aminocyclopropane-1-carboxylate synthase (ACS), is a gene involved in this phenomenon. We determined the genomic DNA structure of DcACS1 by genomic PCR. In the genome of 'Light Pink Barbara', we found two distinct nucleotide sequences: one corresponding to the gene previously shown as DcACS1, designated here as DcACS1a, and the other novel one designated as DcACS1b. It was revealed that both DcACS1a and DcACS1b have five exons and four introns. These two genes had almost identical nucleotide sequences in exons, but not in some introns and 3'-UTR. Analysis of transcript accumulation revealed that DcACS1b is expressed in senescing petals as well as DcACS1a. Genomic PCR analysis of 32 carnation cultivars showed that most cultivars have only DcACS1a and some have both DcACS1a and DcACS1b. Moreover, we found two DcACS1 orthologous genes with different nucleotide sequences from D. superbus var. longicalycinus, and designated them as DsuACS1a and DsuACS1b. Petals of D. superbus var. longicalycinus produced ethylene in response to exogenous ethylene, accompanying accumulation of DsuACS1 transcripts. These data suggest that climacteric ethylene production in flowers was genetically established before the cultivation of carnation.

Impact of DC link control strategies on the power-flow convergence of integrated AC–DC systems

Directory of Open Access Journals (Sweden)

Shagufta Khan

2016-03-01

Full Text Available For the power-flow solution of integrated AC–DC systems, five quantities are required to be solved per converter, against three independent equations available. These three equations consist of two basic converter equations and one DC network equation, corresponding to each converter. Thus, for solution, two additional equations are required. These two equations are derived from the control specifications adopted for the DC link. Depending on the application, several combinations of valid control specifications are possible. A set of valid control specifications constitutes a control strategy. It is observed that the control strategy adopted for the DC link strongly affects the power-flow convergence of integrated AC–DC systems. This paper investigates how different control strategies affect the power flow convergence of integrated AC–DC systems. Sequential method is used to solve the DC variables in the Newton Raphson (NR power flow model. Seven typical control strategies have been taken into consideration. This is validated by numerous case studies carried out with multiple DC links incorporated in the IEEE 118-bus and 300-bus test systems.

Using super-capacitors in combination with Bi-directional DC/DC converters for active load management in residential fuel cell applications

Energy Technology Data Exchange (ETDEWEB)

Cacciato, M.; Giulii Capponi, F. [Rome Univ., ' La Sapienza' , Dept. of Electrical Engineering (Italy)

2004-07-01

Among innovative conversion systems for alternative energy, Fuel Cells (FCs) are ideal in applications as distributed power generation or automotive. The connection of FCs to domestic or industrial loads requires a DC/AC converter also acting as a energy buffer to match the different dynamics of FCs and loads. In the last years, a new type of electrolytic capacitors called Super- Capacitors (SCs), has been designed using double layers technology. Such components are able to store more energy than electrolytic capacitors maintaining the capability to swap it at high power levels. Firstly, different solution used to connect SCs to a FC based conversion system are considered. Then, a comparison of bi-directional DC/DC converters designed to manage SCs energy is performed. Finally, the converter design and a laboratory prototype of the adopted solution are reported. (authors)

Isolated PWM DC-AC SICAM with an active capacitive voltage clamp[Pulse Density Modulated; Pulse Width Modulation

Energy Technology Data Exchange (ETDEWEB)

Ljusev, P.

2004-03-15

In this report an isolated PWM DC-AC SICAM with an active capacitive voltage clamp is presented. AC-DC power supply is implemented in its simplest form: diode rectifier followed by a medium-size charge-storage capacitors and possibly with an EMC filter on the mains entrance. Isolation from the AC mains is achieved using a high frequency (HF) transformer, whose voltages are not audio-modulated. The latter simplifies the design and is expected to have many advantages over the approach where the transformer voltages are modulated in regards to the audio signal reference. Input stage is built as a DC-AC inverter (push-pull, half-bridge or a full-bridge) and operated with 50% duty cycle, with all the challenges to avoid transformer saturation and obtain symmetrical operation. On the secondary side the output section is implemented as rectifier+inverter AC-AC stage, i.e. a true bidirectional bridge, which operation is aimed towards amplification of the audio signal. In order to solve the problem with the commutation of the load current, a dead time between the incoming and outgoing bidirectional switch is implemented, while a capacitive voltage clamp is used to keep the induced overvoltage to reasonable levels. The energy stored in the clamping capacitor is not wasted as in the dissipative clamps, but is rather transferred back to the primary side for further processing using an auxiliary isolated single-switch converter, i.e. an active clamping technique is used. (au)

Research on the Inductance/Capacitance Switch Model for an LCC-HVDC Converter in an AC/DC Hybrid Grid

Directory of Open Access Journals (Sweden)

Yangyang He

2018-03-01

Full Text Available In order to improve the simulation speed of the AC/DC hybrid grid, the inductance/capacitance (L/C switch model for line-commutated converter of high-voltage direct current (LCC-HVDC is presented in this study. The time domain modeling method is used to analyze the circuit of L/C switch model for the six-pulse system in LCC-HVDC in a switching period. A parameter setting method of L/C switch model is proposed considering the transient response, the steady state performance, switching losses and simulation error of the switch. The inductance/capacitance (L/C switch model for LCC-HVDC has the advantage of keeping the admittance matrix unchanged regardless of the change of switching state, which improves the simulation efficiency. Finally, the validity of the parameter setting method is verified. Compared with the test results of PSCAD/EMTDC, the accuracy of the proposed LCC-HVDC simulation model is proved. The model is suitable for real-time or offline simulation of AC/DC hybrid grid.

Directly coupled YBCO dc SQUID magnetometers

International Nuclear Information System (INIS)

Petersen, P.R.E.; Shen, Y.Q.; Holst, T.; Larsen, B.H.; Sager, M.P.; Bindslev Hansen, J.

1999-01-01

YBa 2 Cu 3 O 7- x magnetometers have been made on 10mmx10mm MgO substrates by directly coupling the magnetometer pick-up loop to a dc SQUID with narrow strip lines. The dc SQUIDs were made with YBa 2 Cu 3 O 7-x step-edge Josephson junctions. The layout of the magnetometer pick-up loop was chosen as a compromise between maximizing the loop effective area and minimizing the loop inductance. The SQUID was designed to have L S ∼100 pH in order to obtain β L =2I 0 L S /Φ 0 approx.= 1 with the single-junction critical current I 0 ∼10 μA. We have made magnetometers with white noise levels down to 55 fT Hz -1/2 and a 1/f knee at 1 Hz (ac biased). Noise measurements were made on a field-cooled magnetometer. The noise measured at 1 Hz when cooled in 'zero field' was 175 fT Hz -1/2 . When cooled in magnetic fields of B = 50 μT and B = 100 μT we measured the noise at 1 Hz to be 430 fT Hz -1 2 and 1.3 pT Hz -1/2 , respectively. (author)

Single stage buck-boost DC-AC neutral point clamped inverter

DEFF Research Database (Denmark)

Mo, Wei; Loh, Poh Chiang; Andrew, A.

2012-01-01

This paper proposes a new single stage buck-boost DC-AC neutral point clamped inverter topology which integrates the cascaded configurations of recently introduced inductor-capacitor-capacitor-transformer impedance source network (by Adamowicz) and classic NPC configuration. As a consequence......, it has enhanced buck-boost functionality and low output voltage distortions compared to the traditional Z-source inverter; it has continuous input current which reduces the source stress and inverter noise; it also contains two built-in capacitors which can block the DC current in the transformer...... windings thus preventing the core from saturation; lowers the voltage stresses and power losses of inverter switches and reduces the sizes of filtering devices and as well as obtains better output performance compared to the original two-level Z-source inverters. A phase disposition pulse width modulation...

Performance of an X-ray single pixel TES microcalorimeter under DC and AC biasing

International Nuclear Information System (INIS)

Gottardi, L.; Kuur, J. van der; Korte, P. A. J. de; Den Hartog, R.; Dirks, B.; Popescu, M.; Hoevers, H. F. C.; Bruijn, M.; Borderias, M. Parra; Takei, Y.

2009-01-01

We are developing Frequency Domain Multiplexing (FDM) for the read-out of TES imaging microcalorimeter arrays for future X-ray missions like IXO. In the FDM configuration the TES is AC voltage biased at a well defined frequencies (between 0.3 to 10 MHz) and acts as an AM modulating element. In this paper we will present a full comparison of the performance of a TES microcalorimeter under DC bias and AC bias at a frequency of 370 kHz. In both cases we measured the current-to-voltage characteristics, the complex impedance, the noise, the X-ray responsivity, and energy resolution. The behaviour is very similar in both cases, but deviations in performances are observed for detector working points low in the superconducting transition (R/R N <0.5). The measured energy resolution at 5.89 keV is 2.7 eV for DC bias and 3.7 eV for AC bias, while the baseline resolution is 2.8 eV and 3.3 eV, respectively.

Design Criteria for DC Link Filters in a Synchronous Generator-Phase Controlled Rectifier-Filter-Load System

National Research Council Canada - National Science Library

Greseth, Gregory

1999-01-01

.... The proposed Navy DC Zonal Electrical Distribution System (DC ZEDS) being designed for the new DD-21 utilizes a rectified ac generator output which is filtered and stepped to usable voltages by local dc-dc converters...

Operation of AC Adapters Visualized Using Light-Emitting Diodes

Science.gov (United States)

Regester, Jeffrey

2016-01-01

A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

The Use of AC-DC-AC Methods in Assessing Corrosion Resistance Performance of Coating Systems for Magnesium Alloys

Science.gov (United States)

McCune, Robert C.; Upadhyay, Vinod; Wang, Yar-Ming; Battocchi, Dante

The potential utility of AC-DC-AC electrochemical methods in comparative measures of corrosion-resisting coating system performance for magnesium alloys under consideration for the USAMP "Magnesium Front End Research and Development" project was previously shown in this forum [1]. Additional studies of this approach using statistically-designed experiments have been conducted with focus on alloy types, pretreatment, topcoat material and topcoat thickness as the variables. Additionally, sample coupons made for these designed experiments were also subjected to a typical automotive cyclic corrosion test cycle (SAE J2334) as well as ASTM B117 for comparison of relative performance. Results of these studies are presented along with advantages and limitations of the proposed methodology.

Low Offset AC Correlator.

Science.gov (United States)

This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)

Review of the system compatibility and ride-through options for AC and DC drives including multilevel inverters

Energy Technology Data Exchange (ETDEWEB)

Jouanne, A. von [Power Electronics Lab. - Elect. and Compt. Engineering Dept. - Oregon State Univ., Corvallis, OR (United States); Ben Banerjee, B. [Electric Power Research Inst. - Power Electronics, Energy Delivery, Palo Alto, CA (United States)

2000-07-01

Adjustable speed drive (ASD) compatibility and ride-through issues have caused increased concerns due to the susceptibility of AC and DC drives to power disturbances, and the costly results of process disruptions. These losses can be avoided for critical production processes by using ASDs with ride-through capabilities. This paper assesses industrial ride-through requirements and application issues for AC and DC drives, including medium voltage (2300/4160 V) multi-level inverter topologies. Ride-through alternatives are evaluated based on design, implementation and cost considerations in order to determine the most suitable solutions for various kVA ratings and time duration requirements. (orig.)

DC-Link Protection and Control in Modular Uninterruptible Power Supply

DEFF Research Database (Denmark)

Lu, Jinghang; Savaghebi, Mehdi; Guan, Yajuan

2018-01-01

In this paper, a DC-link voltage protection (DCVP) control method is proposed to address the DC-link overvoltage issue due to power back-feeding in parallel Uninterruptible Power Supply (UPS) system. The proposed control method is able to protect the inverter against the excessive DC-link voltage...... by the line impedance mismatching or power back-feeding issue in the UPS system. In addition, an improved consensus-based distributed controller is proposed to alleviate the overshoot issue during the transient process in voltage amplitude and frequency restoration. Finally, the feasibility of the proposed...

75 FR 61989 - Airworthiness Directives; McDonnell Douglas Corporation Model DC-8-31, DC-8-32, DC-8-33, DC-8-41...

Science.gov (United States)

2010-10-07

... Airworthiness Directives; McDonnell Douglas Corporation Model DC- 8-31, DC-8-32, DC-8-33, DC-8-41, DC-8-42, and... to all of the McDonnell Douglas Corporation airplanes identified above. The existing AD currently... the following new airworthiness directive (AD): 2010-21-03 McDonnell Douglas Corporation: Amendment 39...

Analysis of an AC-DC full-controlled converter supplying two DC-Series-Motor loads

International Nuclear Information System (INIS)

Al-Hindawi, Mohammed M.; Al-Turki, Yusuf A.; Al-Subaie, Obaid T.

2000-01-01

Phase-controlled converters are widely used because these converters are simple, less expensive, reliable, and do not require any communication circuit. Series motors are extensively used in many applications that require both high starting torque and essentially constant horse power. This paper is concerned with the detailed study of the performance characteristics of an AC-DC full-controlled converter supplying two DC-series-motor loads. The converter loads combination is simulated on a digital computer. Different modes of operation (continuous and discontinuous converter currents) are considered. The critical firing angle at which the mode of operation changes from one mode to another is deduced. The performance characteristics such input power factor, supply current distortion factor, supply current fundamental power factor, torque speed, and motor current ripple factor have been derived and studied for both constant firing angle and constant load factor have been derived and studied for both constant firing angle and constant load power of one motor. Waveforms for each load current and converter current are investigated for different modes of operation. (author)

Large-Signal Lyapunov-Based Stability Analysis of DC/AC Inverters and Inverter-Based Microgrids

Science.gov (United States)

Kabalan, Mahmoud

Microgrid stability studies have been largely based on small-signal linearization techniques. However, the validity and magnitude of the linearization domain is limited to small perturbations. Thus, there is a need to examine microgrids with large-signal nonlinear techniques to fully understand and examine their stability. Large-signal stability analysis can be accomplished by Lyapunov-based mathematical methods. These Lyapunov methods estimate the domain of asymptotic stability of the studied system. A survey of Lyapunov-based large-signal stability studies showed that few large-signal studies have been completed on either individual systems (dc/ac inverters, dc/dc rectifiers, etc.) or microgrids. The research presented in this thesis addresses the large-signal stability of droop-controlled dc/ac inverters and inverter-based microgrids. Dc/ac power electronic inverters allow microgrids to be technically feasible. Thus, as a prelude to examining the stability of microgrids, the research presented in Chapter 3 analyzes the stability of inverters. First, the 13 th order large-signal nonlinear model of a droop-controlled dc/ac inverter connected to an infinite bus is presented. The singular perturbation method is used to decompose the nonlinear model into 11th, 9th, 7th, 5th, 3rd and 1st order models. Each model ignores certain control or structural components of the full order model. The aim of the study is to understand the accuracy and validity of the reduced order models in replicating the performance of the full order nonlinear model. The performance of each model is studied in three different areas: time domain simulations, Lyapunov's indirect method and domain of attraction estimation. The work aims to present the best model to use in each of the three domains of study. Results show that certain reduced order models are capable of accurately reproducing the performance of the full order model while others can be used to gain insights into those three areas of

Dc to ac field conversion due to leaky-wave excitation in a plasma slab behind an ionization front

International Nuclear Information System (INIS)

Kostin, V A; Vvedenskii, N V

2015-01-01

We present a way for generating coherent tunable electromagnetic radiation through dc to ac field conversion by an ionization front. The conversion is caused by the excitation of leaky waves behind the transversely limited ionization front propagating in a uniform electrostatic field. This differs significantly from the well-known dc-to-ac-radiation-converter models which consider Doppler-like frequency conversion by a transversely unlimited ionization front propagating in a spatially periodic electric field. We explore the dispersion properties and excitation of these leaky waves radiated through the transverse plasma boundary at the Cherenkov angle to the direction of propagation of a superluminal ionization front as dependent on the parameters of the plasma produced and on the speed of the ionization front. It is shown that not only the center frequency but also the duration and waveform of the generated pulse may significantly depend on the speed of the ionization front. The results indicate the possibility of using such converters based on planar photoconductive antennas to create sources of microwave and terahertz radiation with controllable waveforms that are transformed from video to radio pulse when the angle of incident ionizing radiation is tuned. (paper)

75 FR 63040 - Airworthiness Directives; McDonnell Douglas Corporation Model DC-10-10, DC-10-10F, DC-10-30, DC...

Science.gov (United States)

2010-10-14

... Airworthiness Directives; McDonnell Douglas Corporation Model DC- 10-10, DC-10-10F, DC-10-30, DC-10-30F (KDC-10... following new airworthiness directive (AD): 2010-21-13 McDonnell Douglas Corporation: Amendment 39-16473... November 18, 2010. Affected ADs (b) None. Applicability (c) This AD applies to McDonnell Douglas...

Feed-Forward Control in Resonant DC Link Inverter

OpenAIRE

Apinan Aurasopon; Worawat Sa-ngiavibool

2008-01-01

This paper proposes a feed-forward control in resonant dc link inverter. The feed-forward control configuration is based on synchronous sigma-delta modulation. The simulation results showing the proposed technique can reject non-ideal dc bus improving the total harmonic distortion.

Strong mechanically induced effects in DC current-biased suspended Josephson junctions

Science.gov (United States)

McDermott, Thomas; Deng, Hai-Yao; Isacsson, Andreas; Mariani, Eros

2018-01-01

Superconductivity is a result of quantum coherence at macroscopic scales. Two superconductors separated by a metallic or insulating weak link exhibit the AC Josephson effect: the conversion of a DC voltage bias into an AC supercurrent. This current may be used to activate mechanical oscillations in a suspended weak link. As the DC-voltage bias condition is remarkably difficult to achieve in experiments, here we analyze theoretically how the Josephson effect can be exploited to activate and detect mechanical oscillations in the experimentally relevant condition with purely DC current bias. We unveil how changing the strength of the electromechanical coupling results in two qualitatively different regimes showing dramatic effects of the oscillations on the DC-voltage characteristic of the device. These include the appearance of Shapiro-type plateaus for weak coupling and a sudden mechanically induced retrapping for strong coupling. Our predictions, measurable in state-of-the-art experimental setups, allow the determination of the frequency and quality factor of the resonator using DC only techniques.

Study on emergency power control strategy for AC/DC hybrid power system containing VSC-HVDC

Science.gov (United States)

Liu, Lin; Hu, Zhenda; Ye, Rong; Lin, Zhangsui; Yang, Xiaodong; Yi, Yang

2018-04-01

This paper presents a comprehensive emergency power control strategy for AC/DC hybrid power systems containing VSC-HVDC. Firstly, the paper analyzes the power support of the VSC-HVDC to the AC lines using the Power Transferring Relativity Factor (PTRF). Then the power adjustment of the VSC-HVDC in several different circumstances are calculated. Finally, the online power control strategies of VSC-HVDC are designed, which could rapidly control the power of the VSC-HVDC, keeping the power flow of AC lines below the upper limit. Furthermore, the strategy is proven to be effective by the simulations with EMTDC/PSCAD.

Adapting AC Lines to DC Grids for Large-Scale Renewable Power Transmission

Directory of Open Access Journals (Sweden)

D. Marene Larruskain

2014-10-01

Full Text Available All over the world, governments of different countries are nowadays promoting the use of clean energies in order to achieve sustainable energy systems. In this scenario, since the installed capacity is continuously increasing, renewable sources can play an important role. Notwithstanding that, some important problems may appear when connecting these sources to the grid, being the overload of distribution lines one of the most relevant. In fact, renewable generation is usually connected to the nearest AC grid, although this HV system may not have been designed considering distributed generation. In the particular case of large wind farms, the electrical grid has to transmit all the power generated by wind energy and, as a consequence, the AC system may get overloaded. It is therefore necessary to determine the impact of wind power transmission so that appropriate measures can be taken. Not only are these measures influenced by the amount of power transmitted, but also by the quality of the transmitted power, due to the output voltage fluctuation caused by the highly variable nature of wind. When designing a power grid, although AC systems are usually the most economical solution because of its highly proven technology, HVDC may arise in some cases (e.g. offshore wind farms as an interesting alternative, offering some added values such as lower losses and better controllability. This way, HVDC technology can solve most of the aforementioned problems and has a good potential for future use. Additionally, the fast development of power electronics based on new and powerful semiconductor devices allow the spread of innovative technologies, such as VSC-HVDC, which can be applied to create DC grids. This paper focuses on the main aspects involved in adapting the existing overhead AC lines to DC grids, with the objective of improving the transmission of distributed renewable energy to the centers of consumption.

Application of Multi-Objective Human Learning Optimization Method to Solve AC/DC Multi-Objective Optimal Power Flow Problem

Science.gov (United States)

Cao, Jia; Yan, Zheng; He, Guangyu

2016-06-01

This paper introduces an efficient algorithm, multi-objective human learning optimization method (MOHLO), to solve AC/DC multi-objective optimal power flow problem (MOPF). Firstly, the model of AC/DC MOPF including wind farms is constructed, where includes three objective functions, operating cost, power loss, and pollutant emission. Combining the non-dominated sorting technique and the crowding distance index, the MOHLO method can be derived, which involves individual learning operator, social learning operator, random exploration learning operator and adaptive strategies. Both the proposed MOHLO method and non-dominated sorting genetic algorithm II (NSGAII) are tested on an improved IEEE 30-bus AC/DC hybrid system. Simulation results show that MOHLO method has excellent search efficiency and the powerful ability of searching optimal. Above all, MOHLO method can obtain more complete pareto front than that by NSGAII method. However, how to choose the optimal solution from pareto front depends mainly on the decision makers who stand from the economic point of view or from the energy saving and emission reduction point of view.

Hierarchical Control of Droop-Controlled DC and AC Microgrids - A General Approach Towards Standardization

DEFF Research Database (Denmark)

Guerrero, Josep M.; Vásquez, Juan V.; Teodorescu, Remus

2009-01-01

DC and AC Microgrids are key elements to integrate renewable and distributed energy resources as well as distributed energy storage systems. In the last years, efforts toward the standardization of these Microgrids have been made. In this sense, this paper present the hierarchical control derived...

75 FR 23571 - Airworthiness Directives; McDonnell Douglas Corporation Model DC-10-10, DC-10-10F, DC-10-15, DC...

Science.gov (United States)

2010-05-04

... Airworthiness Directives; McDonnell Douglas Corporation Model DC- 10-10, DC-10-10F, DC-10-15, DC-10-30, DC-10... amends Sec. 39.13 by adding the following new AD: 2010-09-12 McDonnell Douglas Corporation: Amendment 39... to McDonnell Douglas Corporation Model DC- 10-10, DC-10-10F, DC-10-15, DC-10-30, DC-10-30F (KC-10A...

Converter DC/AC Multilevel of Three Cells: Modeling and Simulation

Directory of Open Access Journals (Sweden)

Julián Peláez-Restrepo

2013-11-01

Full Text Available This paper presents a three-cell converter DC / AC. Multilevel topologies are attracting attention in the industry, obtained as a ripple on the state variables much smaller, and reduces stress on the switching devices. The topology used in this work is known in the technical literature as floating capacitor multilevel inverter, which imposes the challenge of balancing the voltage across each cell switching using floating capacitors, besides obtaining a sinusoidal signal regulated. The paper presents the averaged model of the inverter, and results obtained through simulation.

Distributed Primary and Secondary Power Sharing in a Droop-Controlled LVDC Microgrid with Merged AC and DC Characteristics

DEFF Research Database (Denmark)

Peyghami, Saeed; Mokhtari, Hossein; Loh, Poh Chiang

2018-01-01

In an ac microgrid, a common frequency exists for coordinating active power sharing among droop-controlled sources. A common frequency is absent in a dc microgrid, leaving only the dc source voltages for coordinating active power sharing. That causes sharing error and poorer voltage regulation in...

A Switched Capacitor Based AC/DC Resonant Converter for High Frequency AC Power Generation

Directory of Open Access Journals (Sweden)

Cuidong Xu

2015-09-01

Full Text Available A switched capacitor based AC-DC resonant power converter is proposed for high frequency power generation output conversion. This converter is suitable for small scale, high frequency wind power generation. It has a high conversion ratio to provide a step down from high voltage to low voltage for easy use. The voltage conversion ratio of conventional switched capacitor power converters is fixed to n, 1/n or −1/n (n is the switched capacitor cell. In this paper, A circuit which can provide n, 1/n and 2n/m of the voltage conversion ratio is presented (n is stepping up the switched capacitor cell, m is stepping down the switching capacitor cell. The conversion ratio can be changed greatly by using only two switches. A resonant tank is used to assist in zero current switching, and hence the current spike, which usually exists in a classical switching switched capacitor converter, can be eliminated. Both easy operation and efficiency are possible. Principles of operation, computer simulations and experimental results of the proposed circuit are presented. General analysis and design methods are given. The experimental result verifies the theoretical analysis of high frequency AC power generation.

Photovoltaic system with improved DC connections and method of making same

Energy Technology Data Exchange (ETDEWEB)

Cioffi, Philip Michael; Todorovic, Maja Harfman; Herzog, Michael Scott; Korman, Charles Steven; Doherty, Donald M.; Johnson, Neil Anthony

2017-06-20

A micro-inverter assembly includes a housing having an opening formed in a bottom surface thereof, and a direct current (DC)-to-alternating current (AC) micro-inverter disposed within the housing at a position adjacent to the opening. The micro-inverter assembly further includes a micro-inverter DC connector electrically coupled to the DC-to-AC micro-inverter and positioned within the opening of the housing, the micro-inverter DC connector having a plurality of exposed electrical contacts.

Converter Power Density Increase using Low Inductive Integrated DC-link Capacitor/Bus

DEFF Research Database (Denmark)

Trintis, Ionut; Franke, Toke; Rannested, Bjørn

2015-01-01

The power losses in switching devices have a direct effect on the maximum converter power. For a voltage source converter, the DC-link bus has a major influence on the power loss and safe operating area of the power devices. The Power Ring Film CapacitorTM integrated with an optimized bus structu...

Modeling of HVDC System to Improve Estimation of Transient DC Current and Voltages for AC Line-to-Ground Fault—An Actual Case Study in Korea

Directory of Open Access Journals (Sweden)

Dohoon Kwon

2017-10-01

Full Text Available A new modeling method for high voltage direct current (HVDC systems and associated controllers is presented for the power system simulator for engineering (PSS/E simulation environment. The aim is to improve the estimation of the transient DC voltage and current in the event of an AC line-to-ground fault. The proposed method consists primary of three interconnected modules for (a equation conversion; (b control-mode selection; and (c DC-line modeling. Simulation case studies were carried out using PSS/E and a power systems computer aided design/electromagnetic transients including DC (PSCAD/EMTDC model of the Jeju– Haenam HVDC system in Korea. The simulation results are compared with actual operational data and the PSCAD/EMTDC simulation results for an HVDC system during single-phase and three-phase line-to-ground faults, respectively. These comparisons show that the proposed PSS/E modeling method results in the improved estimation of the dynamic variation in the DC voltage and current in the event of an AC network fault, with significant gains in computational efficiency, making it suitable for real-time analysis of HVDC systems.

75 FR 75872 - Airworthiness Directives; McDonnell Douglas Corporation Model DC-9-30, DC-9-40, and DC-9-50...

Science.gov (United States)

2010-12-07

... Airworthiness Directives; McDonnell Douglas Corporation Model DC- 9-30, DC-9-40, and DC-9-50 Series Airplanes...: We are adopting a new airworthiness directive (AD) for the McDonnell Douglas Corporation airplanes... to include an airworthiness directive (AD) that would apply to certain McDonnell Douglas Model DC-9...

Nonlinear Magnus-induced dynamics and Shapiro spikes for ac and dc driven skyrmions on periodic quasi-one-dimensional substrates

Science.gov (United States)

Reichhardt, Charles; Reichhardt, Cynthia J. Olson

We numerically examine skyrmions interacting with a periodic quasi-one-dimensional substrate. When we drive the skyrmions perpendicular to the substrate periodicity direction, a rich variety of nonlinear Magnus-induced effects arise, in contrast to an overdamped system that shows only a linear velocity-force curve for this geometry. The skyrmion velocity-force curve is strongly nonlinear and we observe a Magnus-induced speed-up effect when the pinning causes the Magnus velocity response to align with the dissipative response. At higher applied drives these components decouple, resulting in strong negative differential conductivity. For skyrmions under combined ac and dc driving, we find a new class of phase locking phenomena in which the velocity-force curves contain a series of what we call Shapiro spikes, distinct from the Shapiro steps observed in overdamped systems. There are also regimes in which the skyrmion moves in the direction opposite to the applied dc drive to give negative mobility.

Lowest of AC-DC power output for electrostrictive polymers energy harvesting systems

Science.gov (United States)

Meddad, Mounir; Eddiai, Adil; Hajjaji, Abdelowahed; Guyomar, Daniel; Belkhiat, Saad; Boughaleb, Yahia; Chérif, Aida

2013-11-01

Advances in technology led to the development of electronic circuits and sensors with extremely low electricity consumption. At the same time, structural health monitoring, technology and intelligent integrated systems created a need for wireless sensors in hard to reach places in aerospace vehicles and large civil engineering structures. Powering sensors with energy harvesters eliminates the need to replace batteries on a regular basis. Scientists have been forced to search for new power source that are able to harvested energy from their surrounding environment (sunlight, temperature gradients etc.). Electrostrictive polymer belonging to the family of electro-active polymers, offer unique properties for the electromechanical transducer technology has been of particular interest over the last few years in order to replace conventional techniques such as those based on piezoelectric or electromagnetic, these materials are highly attractive for their low-density, with large strain capability that can be as high as two orders of magnitude greater than the striction-limited, rigid and fragile electroactive ceramics. Electrostrictive polymers sensors respond to vibration with an ac output signal, one of the most important objectives of the electronic interface is to realize the required AC-DC conversion. The goal of this paper is to design an active, high efficiency power doubler converter for electrostrictive polymers exclusively uses a fraction of the harvested energy to supply its active devices. The simulation results show that it is possible to obtain a maximum efficiency of the AC-DC converter equal to 80%. Premiliminary experimental measurements were performed and the results obtained are in good agreement with simulations.

75 FR 27401 - Airworthiness Directives; McDonnell Douglas Corporation Model DC-9-30, DC-9-40, and DC-9-50...

Science.gov (United States)

2010-05-17

... Airworthiness Directives; McDonnell Douglas Corporation Model DC- 9-30, DC-9-40, and DC-9-50 Series Airplanes... airworthiness directive (AD) for certain Model DC-9-30, DC-9-40, and DC-9-50 series airplanes. This AD requires... this AD to detect and correct the potential for an arc/spark condition to occur within the fuel boost...

DC-DC Type High-Frequency Link DC for Improved Power Quality of Cascaded Multilevel Inverter

Science.gov (United States)

Sadikin, Muhammad; Senjyu, Tomonobu; Yona, Atsushi

2013-06-01

Multilevel inverters are emerging as a new breed of power converter options for power system applications. Recent advances in power switching devices enabled the suitability of multilevel inverters for high voltage and high power applications because they are connecting several devices in series without the need of component matching. Usually, a transformerless battery energy storage system, based on a cascaded multilevel inverter, is used as a measure for voltage and frequency deviations. System can be reduced in size, weight, and cost of energy storage system. High-frequency link circuit topology is advantageous in realizing compact and light-weight power converters for uninterruptible power supply systems, new energy systems using photovoltaic-cells, fuel-cells and so on. This paper presents a DC-DC type high-frequency link DC (HFLDC) cascaded multilevel inverter. Each converter cell is implemented a control strategy for two H-bridge inverters that are controlled with the same multicarrier pulse width modulation (PWM) technique. The proposed cascaded multilevel inverter generates lower voltage total harmonic distortion (THD) in comparison with conventional cascaded multilevel inverter. Digital simulations are carried out using PSCAD/EMTDC to validate the performance of the proposed cascaded multilevel inverter.

Loss optimizing low power 50 Hz transformers intended for AC/DC standby power supplies

DEFF Research Database (Denmark)

Nielsen, Nils

2004-01-01

This paper presents the measured efficiency on selected low power conventional 50 Hz/230 V-AC transformers. The small transformers are intended for use in 1 W@5 V-DC series- or buck-regulated power supplies for standby purposes. The measured efficiency is compared for cheap off-the-self transformer...

Investigating degradation behavior of InGaZnO thin-film transistors induced by charge-trapping effect under DC and AC gate bias stress

International Nuclear Information System (INIS)

Hsieh, Tien-Yu; Chang, Ting-Chang; Chen, Te-Chih; Tsai, Ming-Yen; Chen, Yu-Te

2013-01-01

This paper investigates the degradation mechanism of amorphous InGaZnO thin-film transistors under DC and AC gate bias stress. Comparing the degradation behavior at equal accumulated effective stress time, more pronounced threshold voltage shift under AC positive gate bias stress in comparison with DC stress indicates extra electron-trapping phenomenon that occurs in the duration of rising/falling time in pulse. Contrarily, illuminated AC negative gate bias stress exhibits much less threshold voltage shift than DC stress, suggesting that the photo-generated hole does not have sufficient time to drift to the interface of IGZO/gate insulator and causes hole-trapping under AC operation. Since the evolution of threshold voltage fits the stretched-exponential equation well, the different degradation tendencies under DC/AC stress can be attributed to the different electron- and hole-trapping efficiencies, and this is further verified by varying pulse waveform. - Highlights: ► Static and dynamic gate bias stresses are imposed on InGaZnO TFTs. ► Dynamic positive gate bias induces more pronounced threshold voltage shift. ► Static negative-bias illumination stress induces more severe threshold voltage shift. ► Evolution of threshold voltage fits the stretched-exponential equation well

Effect of short circuited DC link capacitor of an AC–DC–AC inverter on the performance of induction motor

Directory of Open Access Journals (Sweden)

Hadeed Ahmed Sher

2016-07-01

Full Text Available Induction motors are widely used in industrial power plants due to their robustness, reliability and high performance under variable operating conditions in the electrical power system. Modern industrial progress is dependent on these ruggedly constructed induction motors. Almost every sophisticated process of the industry is based on induction motors. Most of these motors are controlled by means of inverters that change the line frequency. The change in parameters of inverter makes it possible to control the motor according to the design requirements. The reliability of inverter based motor control is an important issue for industrial applications and therefore, it becomes very vital for design engineers to have comprehensive analysis of the inverter fed induction machine. This paper investigates one of the faults that may occur on the DC link of an inverter fed induction motor. The effect of the capacitor short circuit is presented in this paper. It also deals with the effects of short circuited capacitor on freewheeling diode. DC link capacitors are well designed and even the probability of capacitor failure is high, it is always a rare case if they puncture, however this analysis will add to the reliability of the induction machine under variable operating condition.

New definitions of pointing stability - ac and dc effects. [constant and time-dependent pointing error effects on image sensor performance

Science.gov (United States)

Lucke, Robert L.; Sirlin, Samuel W.; San Martin, A. M.

1992-01-01

For most imaging sensors, a constant (dc) pointing error is unimportant (unless large), but time-dependent (ac) errors degrade performance by either distorting or smearing the image. When properly quantified, the separation of the root-mean-square effects of random line-of-sight motions into dc and ac components can be used to obtain the minimum necessary line-of-sight stability specifications. The relation between stability requirements and sensor resolution is discussed, with a view to improving communication between the data analyst and the control systems engineer.

Analysis of dc-Link Voltage Switching Ripple in Three-Phase PWM Inverters

Directory of Open Access Journals (Sweden)

Marija Vujacic

2018-02-01

Full Text Available The three-phase voltage source inverter (VSI is de facto standard in power conversion systems. To realize high power density systems, one of the items to be correctly addressed is the design and selection of the dc-link capacitor in relation to the voltage switching ripple. In this paper, effective formulas for designing the dc-link capacitor as a function of the switching voltage ripple amplitude are obtained, considering the operating conditions such as the modulation index and the output current amplitude. The calculations are obtained considering the requirements and restrictions referring to the high (switching-frequency dc-link voltage ripple component. Analyses have been performed considering the dc source impedance (non-ideal dc voltage source at the switching frequency and a balanced load. Analytical expressions are derived for the dc-link voltage switching ripple amplitude and its maximum value over the fundamental period. Different values of modulation index and output phase angle have been considered and different diagrams are presented. Analytical results were validated both by simulations and comprehensive experimental tests.

Pemodelan Konverter AC – DC Tiga Fasa Dua Arah pada Sepeda Listrik Menggunakan Metode SPWM

OpenAIRE

Putri, Hellga Afdilah; Hamzah, Amir

2017-01-01

This study is aimed to design and analyze bidirectional converter three phase by using method SPWM on electric bike. This study discusses the three-phase inverter with Sine Pulse WidthModulation (SPWM) method as a three-phase induction motor drive and also the rectifier which has function to convert the AC voltage of the source of three-phase AC into DC voltage that ismodeled by using Matlab / Simulink. The purpose of this study is to get the design of the threephase inverter SPWM as a three-...

A voltage control method for an active capacitive DC-link module with series-connected circuit

DEFF Research Database (Denmark)

Wang, Haoran; Wang, Huai; Blaabjerg, Frede

2017-01-01

Many efforts have been made to improve the performance of power electronic systems with active capacitive DC-link module in terms of power density as well as reliability. One of the attractive solution is an active capacitive DC-link with the series-connected circuit because of handling small......-rated power. However, in the existing control method of this circuit, the DC-link current of the backward-stage or forward-stage need to be sensed for extracting the ripple components, which limits the flexibility of the active DC-link module. Thus, in this paper, a voltage control method of an active...... capacitive DC-link module is proposed. Current sensor at the DC-link will be cancel from the circuit. The controller of the series-connected circuit requires internal voltage signals of the DC-link module only, making it possible to be fully independent without any additional connection to the main circuit...

75 FR 60602 - Airworthiness Directives; McDonnell Douglas Corporation Model DC-10-10, DC-10-10F, DC-10-15, DC...

Science.gov (United States)

2010-10-01

... Airworthiness Directives; McDonnell Douglas Corporation Model DC- 10-10, DC-10-10F, DC-10-15, DC-10-30, DC-10... adding the following new AD: 2010-20-14 McDonnell Douglas Corporation: Amendment 39-16449. Docket No. FAA... the airplanes identified in paragraphs (c)(1) and (c)(2) of this AD. (1) McDonnell Douglas Corporation...

75 FR 38943 - Airworthiness Directives; McDonnell Douglas Corporation Model DC-10-10, DC-10-10F, DC-10-30, DC...

Science.gov (United States)

2010-07-07

...-0672; Directorate Identifier 2010-NM-047-AD] RIN 2120-AA64 Airworthiness Directives; McDonnell Douglas...: McDonnell Douglas Corporation: Docket No. FAA-2010-0672; Directorate Identifier 2010-NM-047-AD. Comments Due... applies to McDonnell Douglas Corporation Model DC- 10-10, DC-10-10F, DC-10-30, DC-10-30F (KDC-10), DC-10...

Y-source impedance-network-based isolated boost DC/DC converter

DEFF Research Database (Denmark)

Siwakoti, Yam P.; Town, Graham; Loh, Poh Chiang

2014-01-01

A dc-dc converter with very high voltage gain is proposed in this paper for any medium-power application requiring a high voltage boost with galvanic isolation. The proposed converter topology can be realized using only two switches. With this topology a very high voltage boost can be achieved even...... with a relatively low duty cycle of the switches, and the gain obtainable is presently not matched by any existing impedance network based converter operated at the same duty ratio. The proposed converter has a Y-source impedance network to boost the voltage at the intermediate dc-link side and a push......-pull transformer for square-wave AC inversion and isolation. The voltage-doubler rectifier provides a constant dc voltage at the output stage. A theoretical analysis of the converter is presented, supported by simulation and experimental results. A 250 W down-scaled prototype was implemented in the laboratory...

A moving pole-placement compensation design method to increase the bandwidth of RC-damper-based dual “Buck-Boost” AC/DC converter

DEFF Research Database (Denmark)

Wu, Weimin; Qin, Weibo; Wang, Houqin

2017-01-01

the “Buck” mode, the control-to-grid current transfer function of this dual “Buck-Boost” AC/DC converter has a movable zero, which is related to the input power and the output DC voltage. When the input power increases, the movable zero will slide to the lower frequency range. And then, the gain between...... the cut-off frequency point and the resonant frequency of LCL filter will swell up, resulting in reduced amplitude margin and suppressed bandwidth of system. Based on the theoretical analysis, a new dynamic pole placement compensation control design method is proposed for this dual AC/DC converter...

Stability analysis of a three-phase grid-connected DC power supply with small DC-link capacitor and voltage feed-forward compensation

DEFF Research Database (Denmark)

Török, Lajos; Mathe, L.

2017-01-01

The purpose of this work was to investigate effect of the DC-link voltage feed-forward compensation on the stability of the three-phase-grid connected DC power supply, used for electrolysis application, equipped with small DC link capacitor. In case of weak grid condition, the system...

An overview of power electronics applications in fuel cell systems: DC and AC converters.

Science.gov (United States)

Ali, M S; Kamarudin, S K; Masdar, M S; Mohamed, A

2014-01-01

Power electronics and fuel cell technologies play an important role in the field of renewable energy. The demand for fuel cells will increase as fuel cells become the main power source for portable applications. In this application, a high-efficiency converter is an essential requirement and a key parameter of the overall system. This is because the size, cost, efficiency, and reliability of the overall system for portable applications primarily depend on the converter. Therefore, the selection of an appropriate converter topology is an important and fundamental aspect of designing a fuel cell system for portable applications as the converter alone plays a major role in determining the overall performance of the system. This paper presents a review of power electronics applications in fuel cell systems, which include various topology combinations of DC converters and AC inverters and which are primarily used in fuel cell systems for portable or stand-alone applications. This paper also reviews the switching techniques used in power conditioning for fuel cell systems. Finally, this paper addresses the current problem encountered with DC converters and AC inverter.

Performance Evaluation of the Single-Phase Split-Source Inverter Using an Alternative DC-AC Configuration

DEFF Research Database (Denmark)

Abdelhakim, Ahmed; Mattavelli, Paolo; Davari, Pooya

2018-01-01

This paper investigates and evaluates the performance of a single-phase split-source inverter (SSI), where an alternative unidirectional dc-ac configuration is used. Such configuration is utilized in order to use two common-cathode diodes in a single-device instead of using two separate diodes, r...

A Robust Suboptimal Current Control of an Interlink Converter for a Hybrid AC/DC Microgrid

Directory of Open Access Journals (Sweden)

Ismi Rosyiana Fitri

2018-05-01

Full Text Available A hybrid AC/DC microgrid is established with the aim of exploiting numerous types of renewable energy to meet the needs of different loads. The microgrid is decomposed by AC DC sub-grids which are connected by an interlink converter (IC. To maintain the security and reliability of the microgrid, an automatic controller for the interlink converter is needed. In this paper, we propose a Linear Matrix Inequalities (LMI-based current control method for the interlink converter. As the main features here, the interlink converter permits bidirectional power exchange between both sub-grids when a power–demand imbalance occurs in one sub-grid regardless of the converter system parameters. Simulations with various filter parameters are performed using the Matlab/Simulink software to validate the effectiveness of the proposed controller. In comparison with the existing Linear Quadratic Regulator (LQR-based current control, the proposed method is more robust against unknown system parameters and high load perturbation.

75 FR 6160 - Airworthiness Directives; McDonnell Douglas Corporation Model DC-10-10, DC-10-10F, DC-10-15, DC...

Science.gov (United States)

2010-02-08

...-0032; Directorate Identifier 2009-NM-213-AD] RIN 2120-AA64 Airworthiness Directives; McDonnell Douglas...: McDonnell Douglas Corporation: Docket No. FAA-2010-0032; Directorate Identifier 2009-NM-213-AD. Comments Due... applies to McDonnell Douglas Corporation Model DC- 10-10, DC-10-10F, DC-10-15, DC-10-30, DC-10-30F (KC-10A...

Lifetime Benchmarking of Two DC-link Passive Filtering Configurations in Adjustable Speed Drives

DEFF Research Database (Denmark)

Wang, Haoran; Davari, Pooya; Wang, Huai

2018-01-01

Electrolytic capacitors with a DC-side inductor, and the slim DC-link capacitor are two typical filtering configurations in Adjustable Speed Drives (ASDs). The reliability performance of these capacitive DC-link solutions is an essential aspect to be considered, which depends on both component in...

KEY COMPARISONS: Final report: SIM regional comparison of ac-dc voltage transfer difference (SIM.EM.K6a, SIM.EM-K9 and SIM.EM-K11)

Science.gov (United States)

Campos, Sara; Filipski, Piotr; Izquierdo, Daniel; Afonso, Edson; Landim, Régis P.; Di Lillo, Lucas; Lipe, Thomas

2009-01-01

Three comparisons of ac-dc voltage transfer difference held from January to December 2004 are reported. Six NMIs in the SIM region took part: NRC (Canada), NIST (United States of America), CENAM (Mexico), INTI (Argentina), UTE (Uruguay) and INMETRO (Brazil). The comparisons were proposed to assess the measurement capabilities in ac-dc voltage transfer difference of the NMIs in the SIM region. The test points were selected to link the results with the equivalent CCEM Key Comparisons, through three NMIs participating in both SIM and CCEM key comparisons. Additionally, a SIM.EM-Supplementary comparison was proposed, in support of the SIM NMIs' power/energy meter calibration capabilities. One technical protocol and one travelling standard were used, to economize on time and resources. The report shows the degree of equivalence in the SIM region and also the degree of equivalence with the corresponding CCEM reference value. The results of all participants support the values and uncertainties of the applicable CMC entries for ac-dc voltage transfer difference in the Key Comparison Database held at the BIPM. Main text. To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by the CCEM, according to the provisions of the CIPM Mutual Recognition Arrangement (MRA).

AC Transmission Emulation Control Strategies for the BTB VSC HVDC System in the Metropolitan Area of Seoul

Directory of Open Access Journals (Sweden)

Sungyoon Song

2017-08-01

Full Text Available In the Korean power system, growing power loads have recently created the problems of voltage instability and fault current in the Seoul Capital Area (SCA. Accordingly, the back-to-back (BTB voltage source converter (VSC high-voltage direct-current (HVDC system is emerging to resolve such problems with grid segmentation. However, non-convergence problems occur in this metropolitan area, due to the large change of power flow in some contingencies. Therefore, this paper proposes two kinds of AC transmission emulation control (ATEC strategies to improve the metropolitan transient stability, and to resolve the non-convergence problem. The proposed ATEC strategies are able to mitigate possible overloading of adjacent AC transmission, and maintain power balance between metropolitan regions. The first ATEC strategy uses a monitoring system that permits the reverse power flow of AC transmission, and thus effectively improves the grid stability based on the power transfer equation. The second ATEC strategy emulates AC transmission with DC link capacitors in a permissible DC-link voltage range according to angle difference, and securely improves the gird stability, without requiring grid operator schedule decisions. This paper compares two kinds of ATEC schemes: it demonstrates the first ATEC strategy with specific fault scenario with PSS/E (Power Transmission System Planning Software, and evaluates the second ATEC strategy with internal controller performance with PSCAD/EMTDC (Power System Electromagnetic Transients Simulation Software.

Electricity market design requirements for DC distribution systems

NARCIS (Netherlands)

Piao, L.; de Weerdt, M.M.; de Vries, L.J.

2017-01-01

DC distribution systems (DCDS) connect local generators and loads directly. By avoiding unnecessary losses in AC-DC conversion, DCDS offers higher energy efficiency. Since different parties in a DCDS may have conflicting goals, matching between power supply and demand should be done with carefully

Multi-Agent-Based Controller for Voltage Enhancement in AC/DC Hybrid Microgrid Using Energy Storages

Directory of Open Access Journals (Sweden)

Ahmadali Khatibzadeh

2017-02-01

Full Text Available Development of renewable energies and DC loads have led microgrids toward the creation of DC networks. The predictions show that the hybrid microgrids will be used widely in the future. This article has studied the voltage stability in the presence of sources of energy storage in AC/DC hybrid networks. However, because the different dynamics of hybrid networks applying centralized and distributed controllers will be faced with different problems, in this study, a multi-agent control for the microgrid has been used. A new structure referred to here as an event-driven microgrid control management (EDMCM has been developed to control the microgrid. This method increases response speed and accuracy of decision making. Hybrid Network Simulation results confirm the validity of the developed model.

75 FR 68246 - Airworthiness Directives; McDonnell Douglas Corporation Model DC-10-10, DC-10-10F, DC-10-15, DC...

Science.gov (United States)

2010-11-05

...-1044; Directorate Identifier 2010-NM-033-AD] RIN 2120-AA64 Airworthiness Directives; McDonnell Douglas..., 2007) and adding the following new AD: McDonnell Douglas Corporation: Docket No. FAA-2010-1044.... Applicability (c) This AD applies to all McDonnell Douglas Corporation Model DC-10-10, DC-10-10F, DC-10-15, DC...

A Circulating-Current Suppression Method for Parallel-Connected Voltage-Source Inverters With Common DC and AC Buses

DEFF Research Database (Denmark)

Wei, Baoze; Guerrero, Josep M.; Quintero, Juan Carlos Vasquez

2017-01-01

This paper presents a theoretical study with experimental validation of a circulating-current suppression method for parallel operation of three-phase voltage source inverters (VSI), which may be suitable for modular parallel uninterruptible power supply systems or hybrid AC/DC microgrid applicat......This paper presents a theoretical study with experimental validation of a circulating-current suppression method for parallel operation of three-phase voltage source inverters (VSI), which may be suitable for modular parallel uninterruptible power supply systems or hybrid AC/DC microgrid......, and added into the conventional droop plus virtual impedance control. In the control architecture, the reference voltages of the inverters are generated by the primary control loop which consists of a droop control and a virtual impedance. The secondary control is used to compensate the voltage drop...

single-phase dc phase dc-ac boost converter ac boost converter

African Journals Online (AJOL)

User

systems, need to step-up the DC input voltage. increase the ... design also makes for extra parts, greater system and weight, [1-3]. ... proposes a new design for high performance sin ... SYSTEM ANALYSIS. 2. ..... from the simulation study.

Improved Battery Charger Circuit Utilizing Reduced DC-link Capacitors

Directory of Open Access Journals (Sweden)

Vencislav Valchev

2017-11-01

Full Text Available The article presents a comparison of advantages and disadvantages of a battery charger circuit with and without the use of DC-link capacitors in it. The specific application requirements, namely ultra-light electric vehicles, are set as lightness, efficiency and robustness of the design. Prove of greater reliability and improvement on maintenance costs without significant decrease in the quality of charging process with the removal of DC-link capacitors in rectifier and boost converter circuits is accomplished. The proposed circuit parameters are analyzed by carried out simulations.

Chapter 5: Modeling and Control of Three-Phase AC/DC Converter Including Phase-Locked Loop

DEFF Research Database (Denmark)

Zhou, Dao; Song, Yipeng; Blaabjerg, Frede

2018-01-01

In this chapter, a mathematical model of the power circuit of a three-phase AC/DC converter is developed in the stationary and synchronous reference frames. Then, the operation principle of the phasor locked loop is addressed to exact the angle information of the power grid to realize the accurat...

AC-DC integrated load flow calculation for variable speed offshore wind farms

DEFF Research Database (Denmark)

Zhao, Menghua; Chen, Zhe; Blaabjerg, Frede

2005-01-01

This paper proposes a sequential AC-DC integrated load flow algorithm for variable speed offshore wind farms. In this algorithm, the variable frequency and the control strategy of variable speed wind turbine systems are considered. In addition, the losses of wind turbine systems and the losses...... of converters are also integrated into the load flow algorithm. As a general algorithm, it can be applied to different types of wind farm configurations, and the load flow is related to the wind speed....

Frequency tuning allows flow direction control in microfluidic networks with passive features.

Science.gov (United States)

Jain, Rahil; Lutz, Barry

2017-05-02

Frequency tuning has emerged as an attractive alternative to conventional pumping techniques in microfluidics. Oscillating (AC) flow driven through a passive valve can be rectified to create steady (DC) flow, and tuning the excitation frequency to the characteristic (resonance) frequency of the underlying microfluidic network allows control of flow magnitude using simple hardware, such as an on-chip piezo buzzer. In this paper, we report that frequency tuning can also be used to control the direction (forward or backward) of the rectified DC flow in a single device. Initially, we observed that certain devices provided DC flow in the "forward" direction expected from previous work with a similar valve geometry, and the maximum DC flow occurred at the same frequency as a prominent peak in the AC flow magnitude, as expected. However, devices of a slightly different geometry provided the DC flow in the opposite direction and at a frequency well below the peak AC flow. Using an equivalent electrical circuit model, we found that the "forward" DC flow occurred at the series resonance frequency (with large AC flow peak), while the "backward" DC flow occurred at a less obvious parallel resonance (a valley in AC flow magnitude). We also observed that the DC flow occurred only when there was a measurable differential in the AC flow magnitude across the valve, and the DC flow direction was from the channel with large AC flow magnitude to that with small AC flow magnitude. Using these observations and the AC flow predictions from the equivalent circuit model, we designed a device with an AC flowrate frequency profile that was expected to allow the DC flow in opposite directions at two distinct frequencies. The fabricated device showed the expected flow reversal at the expected frequencies. This approach expands the flow control toolkit to include both magnitude and direction control in frequency-tuned microfluidic pumps. The work also raises interesting questions about the

High voltage direct current transmission converters, systems and DC grids

CERN Document Server

Jovcic, Dragan

2015-01-01

This comprehensive reference guides the reader through all HVDC technologies, including LCC (Line Commutated Converter), 2-level VSC and VSC HVDC based on modular multilevel converters (MMC) for an in-depth understanding of converters, system level design, operating principles and modeling. Written in a tutorial style, the book also describes the key principles of design, control, protection and operation of DC transmission grids, which will be substantially different from the practice with AC transmission grids. The first dedicated reference to the latest HVDC technologies and DC grid developments; this is an essential resource for graduate students and researchers as well as engineers and professionals working on the design, modeling and operation of DC grids and HVDC.

A single-phase PWM controlled AC to DC converter based on control of unity displacement power factor

OpenAIRE

Funabiki, Shigeyuki

1990-01-01

A modified pulse-width modulation (PWM) technique that improves the displacement power factor and the input power factor of a single-phase AC to DC converter is discussed. The modified converter is shown to have a high input power factor and allows the of DC voltage from zero to more than the maximum value of the source voltage. The displacement power factor is unity, and the input power factor is almost unity in the wide range of current command

Disrupted bandcount doubling in an AC-DC boost PFC circuit modeled by a time varying map

DEFF Research Database (Denmark)

Avrutin, Viktor; Zhusubaliyev, Zhanybai T.; Aroudi, Abdelali El

2016-01-01

Power factor correction converters are used in many applications as AC-DC power supplies aiming at maintaining a near unity power factor. Systems of this type are known to exhibit nonlinear phenomena such as sub-harmonic oscillations and chaotic regimes that cannot be described by traditional ave...

DC Home Appliances for DC Distribution System

Directory of Open Access Journals (Sweden)

MUHAMMAD KAMRAN

2017-10-01

Full Text Available This paper strengthens the idea of DC distribution system for DC microgrid consisting of a building of 50 apartments. Since the war of currents AC system has been dominant because of the paucity of research in the protection of the DC system. Now with the advance research in power electronics material and components, generation of electricity is inherently DC as by solar PV, fuel cell and thermoelectric generator that eliminates the rectification process. Transformers are replaced by the power electronics buck-boost converters. DC circuit breakers have solved the protection problems for both DC transmission and distribution system. In this paper 308V DC microgrid is proposed and home appliances (DC internal are modified to operate on 48V DC from DC distribution line. Instead of using universal and induction motors in rotary appliances, BLDC (Brushless DC motors are proposed that are highly efficient with minimum electro-mechanical and no commutation losses. Proposed DC system reduces the power conversion stages, hence diminishes the associated power losses and standby losses that boost the overall system efficiency. So in view of all this a conventional AC system can be replaced by a DC system that has many advantages by cost as well as by performance

Effective response of nonlinear cylindrical coated composites under external AC and DC electric field

International Nuclear Information System (INIS)

Yu-Yan, Shen; Xiao-Gang, Chen; Wei, Cui; Yan-Hua, Hao; Qian-Qian, Li

2009-01-01

This paper uses the perturbation method to study effective response of nonlinear cylindrical coated composites. Under the external AC and DC electric field E a (1 + sin ωt), the local potentials of composites at all harmonic frequencies are induced. An effective nonlinear response to composite is given for the cylindrical coated inclusions in the dilute limit. (condensed matter: electronic structure, electrical, magnetic, and optical properties)

Cost-based droop scheme for DC microgrid

DEFF Research Database (Denmark)

Nutkani, Inam Ullah; Wang, Peng; Loh, Poh Chiang

2014-01-01

voltage level, less on optimized operation and control of generation sources. The latter theme is perused in this paper, where cost-based droop scheme is proposed for distributed generators (DGs) in DC microgrids. Unlike traditional proportional power sharing based droop scheme, the proposed scheme......-connected operation. Most importantly, the proposed scheme can reduce overall total generation cost in DC microgrids without centralized controller and communication links. The performance of the proposed scheme has been verified under different load conditions.......DC microgrids are gaining interest due to higher efficiencies of DC distribution compared with AC. The benefits of DC systems have been widely researched for data centers, IT facilities and residential applications. The research focus, however, has been more on system architecture and optimal...

AC and DC electrical properties of graphene nanoplatelets reinforced epoxy syntactic foam

Science.gov (United States)

Zegeye, Ephraim; Wicker, Scott; Woldesenbet, Eyassu

2018-04-01

Benefits of employing graphene nanopletlates (GNPLs) in composite structures include mechanical as well as multifunctional properties. Understanding the impedance behavior of GNPLs reinforced syntactic foams may open new applications for syntactic foam composites. In this work, GNPLs reinforced syntactic foams were fabricated and tested for DC and AC electrical properties. Four sets of syntactic foam samples containing 0, 0.1, 0.3, and 0.5 vol% of GNPLs were fabricated and tested. Significant increase in conductivity of syntactic foams due to the addition of GNPLs was noted. AC impedance measurements indicated that the GNPLs syntactic foams become frequency dependent as the volume fraction of GNPLs increases. With addition of GNPLs, the characteristic of the syntactic foams are also observed to transition from dominant capacitive to dominant resistive behavior. This work was carried out at Southern University, Mechanical Engineering Department, Baton Rouge, LA 70802, United States of America.

Single conversion audio amplifier and DC-AC converters with high performance and low complexity control scheme

DEFF Research Database (Denmark)

Poulsen, Søren; Andersen, Michael Andreas E.

2004-01-01

This paper proposes a novel control topology for a mains isolated single conversion audio amplifier and DC-AC converters. The topology is made for use in audio applications, and differs from prior art in terms of significantly reduced distortion as well as lower system complexity. The topology can...

Control model design to limit DC-link voltage during grid fault in a dfig variable speed wind turbine

Science.gov (United States)

Nwosu, Cajethan M.; Ogbuka, Cosmas U.; Oti, Stephen E.

2017-08-01

This paper presents a control model design capable of inhibiting the phenomenal rise in the DC-link voltage during grid- fault condition in a variable speed wind turbine. Against the use of power circuit protection strategies with inherent limitations in fault ride-through capability, a control circuit algorithm capable of limiting the DC-link voltage rise which in turn bears dynamics that has direct influence on the characteristics of the rotor voltage especially during grid faults is here proposed. The model results so obtained compare favorably with the simulation results as obtained in a MATLAB/SIMULINK environment. The generated model may therefore be used to predict near accurately the nature of DC-link voltage variations during fault given some factors which include speed and speed mode of operation, the value of damping resistor relative to half the product of inner loop current control bandwidth and the filter inductance.

Parameter Improved Particle Swarm Optimization Based Direct-Current Vector Control Strategy for Solar PV System

Directory of Open Access Journals (Sweden)

NAMMALVAR, P.

2018-02-01

Full Text Available This paper projects Parameter Improved Particle Swarm Optimization (PIPSO based direct current vector control technology for the integration of photovoltaic array in an AC micro-grid to enhance the system performance and stability. A photovoltaic system incorporated with AC micro-grid is taken as the pursuit of research study. The test system features two power converters namely, PV side converter which consists of DC-DC boost converter with Perturbation and Observe (P&O MPPT control to reap most extreme power from the PV array, and grid side converter which consists of Grid Side-Voltage Source Converter (GS-VSC with proposed direct current vector control strategy. The gain of the proposed controller is chosen from a set of three values obtained using apriori test and tuned through the PIPSO algorithm so that the Integral of Time multiplied Absolute Error (ITAE between the actual and the desired DC link capacitor voltage reaches a minimum and allows the system to extract maximum power from PV system, whereas the existing d-q control strategy is found to perform slowly to control the DC link voltage under varying solar insolation and load fluctuations. From simulation results, it is evident that the proposed optimal control technique provides robust control and improved efficiency.

Engineering Design of the ITER AC/DC Power Supplies

International Nuclear Information System (INIS)

Oh, B. H.; Lee, K. W.; Hwang, C. K.; Jin, J. T.; Chang, D. S.; Kim, T. S.

2009-02-01

To design high power pulse power supplies, especially in huge power supplies have not designed till now, it is necessary to analyze a system's characteristics and relations with another systems as well as to know high voltage, high current control technologies. Contents of this project are; - Study for the engineering designs changed recently by ITER Organization(IO) and writing specifications for the power supplies to reduce project risk. - Detailed analysis of the AC/DC Converters and writing subtask reports on the Task Agreement. - Study for thyristor numbers, DCR's specifications for Korea-China sharing meetings. - Study for the grounding systems of the ITER power supply system. The results may used as one of reference for practical designs of the high power coil power supplies and also may used in various field such as electroplating, plasma arc furnaces, electric furnaces

The effect of ac-driven force on superlubricity in a two-dimensional Frenkel-Kontorova model

International Nuclear Information System (INIS)

Lin Maimai

2010-01-01

By using the molecular dynamic simulation method with a fourth-order Runge-Kutta algorithm, a two-dimensional dc- and ac-driven Frenkel-Kontorova model with a square symmetry substrate potential for a square lattice layer has been investigated in this paper. For this system, the effects of many different parameters on the static friction force have been studied in detail. It was found that not only the amplitude and frequency of the ac-driven force, but also the direction of dc- and ac-driven forces and the misfit angle between two layers have a strong influence on the static friction force. This indicated that the phenomenon of superlubricity appears easily with larger ac amplitude and smaller ac frequency for some special direction of the external driving force and misfit angle.

Active Damping Control Methods for Three-Phase Slim DC-link Drive System

DEFF Research Database (Denmark)

Yang, Feng; Wang, Dong; Blaabjerg, Frede

2017-01-01

for stabilizing such slim dc-link drives together with the benefit of low cost and high flexibility. This paper gives an overview of the state-of-the-art active damping methods for the three-phase slim dc-link drive. The main pros and cons of each method are identified. The theoretical comparison is validated...

Proportional-Integral-Resonant AC Current Controller

Directory of Open Access Journals (Sweden)

STOJIC, D.

2017-02-01

Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.

AC-DC PFC Converter Using Combination of Flyback Converter and Full-bridge DC-DC Converter

Directory of Open Access Journals (Sweden)

Moh. Zaenal Efendi

2014-06-01

Full Text Available This paper presents a combination of power factor correction converter using Flyback converter and Full-bridge dc-dc converter in series connection. Flyback converter is operated in discontinuous conduction mode so that it can serve as a power factor correction converter and meanwhile Full-bridge dc-dc converter is used for dc regulator. This converter system is designed to produce a 86 Volt of output voltage and 2 A of output current. Both simulation and experiment results show that the power factor of this converter achieves up to 0.99 and meets harmonic standard of IEC61000-3-2. Keywords: Flyback Converter, Full-bridge DC-DC Converter, Power Factor Correction.

Control of a resonant d.c.-link converter for a.c. motor drives

Directory of Open Access Journals (Sweden)

Astrid Petterteig

1992-10-01

Full Text Available This paper presents the control of the resonant d.c.-link converter for a.c. motor drives. This is a low loss converter with higher efficiency than a conventional PWM converter, but it requires complex control. It needs a special control of the resonant d.c.-link voltage in addition to the discrete control of the a.c. side currents. Simulations show how the control of the a.c. currents, the modulation principle, influences the overall performance of the converter.

75 FR 47199 - Airworthiness Directives; McDonnell Douglas Corporation Model DC-9-10 Series Airplanes, DC-9-30...

Science.gov (United States)

2010-08-05

... Airworthiness Directives; McDonnell Douglas Corporation Model DC- 9-10 Series Airplanes, DC-9-30 Series... existing airworthiness directive (AD), which applies to all McDonnell Douglas Model DC-9-10 series..., 2010). That AD applies to all McDonnell Douglas Corporation Model DC-9-10 series airplanes, DC-9-30...

Power Quality in DC Power Distribution Systems and Microgrids

Directory of Open Access Journals (Sweden)

Stephen Whaite

2015-05-01

Full Text Available This review paper discusses power quality considerations for direct current (DC electric power distribution systems, particularly DC microgrids. First, four selected sample DC architectures are discussed to provide motivation for the consideration of power quality in DC systems. Second, a brief overview of power quality challenges in conventional alternating current (AC distribution systems is given to establish the field of power quality. Finally, a survey of literature addressing power quality issues in DC systems is presented, and necessary power quality considerations in DC distribution system design and operation are discussed.

DC Voltage Droop Control Structures and its Impact on the Interaction Modes in Interconnected AC-HVDC Systems

DEFF Research Database (Denmark)

Thams, Florian; Chatzivasileiadis, Spyros; Eriksson, Robert

2017-01-01

Different dc voltage droop control structures for future multi-terminal HVDC systems have been proposed in literature. This paper contributes to the evaluation of those structures by an analysis of their impact on the coupling of the interconnected subsystems. In particular, the modes...... of the systems are classified in different subsets according to the participation of the various subsystems. Those subsets are then evaluated qualitatively and quantitatively indicating which impact the choice of the droop control structure has on the degree of coupling between the connected ac and dc systems...

AC/DC electrical conduction and dielectric properties of PMMA/PVAc/C60 down-shifting nanocomposite films

Science.gov (United States)

El-Bashir, S. M.; Alwadai, N. M.; AlZayed, N.

2018-02-01

Polymer nanocomposite films were prepared by doping fullerene C60 in polymer blend composed of polymethacrylate/polyvinyl acetate blends (PMMA/PVAc) using solution cast technique. The films were characterized by differential scanning calorimeter (DSC), Transmission electron microscope (TEM), DC/AC electrical conductivity and dielectric measurements in the frequency range (100 Hz- 1 MHz). The glass transition temperature, Tg, was increased by increasing the concentration of fullerene C60; this property reflects the increase of thermal stability by increasing the nanofiller content. The DC and AC electrical conductivities were enhanced by increasing C60 concentration due to the electron hopping or tunneling between filled and empty localized states above Tg. The relaxation time was determined from the αβ -relaxations and found to be attenuated by increasing the temperature as a typical behavior of amorphous polymers. The calculated values of thermodynamic parameters revealed the increase of molecular stability by increasing the doping concentration; this feature supports the application of PMMA/PVAc/C60 nanocomposite films in a wide scale of solar energy conversion applications such as luminescent down-shifting (LDS) coatings for photovoltaic cells.

Magnetic hysteresis and complex susceptibility as measures of ac losses in a multifilamentary NbTi superconductor

International Nuclear Information System (INIS)

Goldfarb, R.B.; Clark, A.F.

1985-01-01

Magnetization and ac susceptibility of a standard NbTi superconductor were measured as a function of longitudinal dc magnetic field. The ac-field-amplitude and frequency dependences of the complex susceptibility are examined. The magnetization is related to the susceptibility by means of a theoretical derivation based on the field dependence of the critical current density. Hysteresis losses, obtained directly from dc hysteresis loops and derived theoretically from ac susceptibility and critical current density, were in reasonable agreement

ac loss and dc critical current densities of Nb3Sn tapes by the solid state diffusion process

International Nuclear Information System (INIS)

Suenaga, M.; Klamut, C.; Bussiere, J.F.

1976-01-01

The effects of metallurgical processing on 60 Hz ac losses and dc critical currents in Nb 3 Sn tapes fabricated by the solid state diffusion technique were investigated. An addition of Al to the Cu--Sn alloy for the matrix resulted in large reduction in the ac losses of Nb 3 Sn tapes, but the highest linear critical current densities were observed in Nb 3 Sn tapes produced with a Nb-1 wt percent Zr core in a Cu-13 wt percent Sn matrix. Values of the losses and the critical currents in these tapes can meet the present requirements for the ac superconducting power cables

Harmonic elimination technique for a single-phase multilevel converter with unequal DC link voltage levels

DEFF Research Database (Denmark)

Ghasemi, N.; Zare, F.; Boora, A.A.

2012-01-01

Multilevel converters, because of the benefits they attract in generating high quality output voltage, are used in several applications. Various modulation and control techniques are introduced by several researchers to control the output voltage of the multilevel converters like space vector...... modulation and harmonic elimination (HE) methods. Multilevel converters may have a DC link with equal or unequal DC voltages. In this study a new HE technique based on the HE method is proposed for multilevel converters with unequal DC link voltage. The DC link voltage levels are considered as additional...

A Unidirectional DC-DC Autotransformer for DC Grid Application

Directory of Open Access Journals (Sweden)

Meng Zhou

2018-03-01

Full Text Available Conventional unidirectional DC-DC converters for DC grid application employ DC-AC-DC two-stage conversion technology and suffer from high converter cost and power loss. To solve these issues, a unidirectional step-up DC-DC autotransformer (UUDAT and a unidirectional step-down DC-DC autotransformer (DUDAT are studied. The UUDAT and DUDAT are composed of a series connection of diode bridges and voltage source converters. Topologies of UUDAT and DUDAT are detailed. The harmonic and un-controllability issues are discussed. Control and possible application scenarios for UUDAT and DUDAT are depicted. DC fault isolation mechanism and the methods of dimensioning the voltage and power ratings of the components in UUDAT and DUDAT are studied. Extensive simulations on power system level and experiments on a UUDAT and DUDAT prototype verified their technical feasibility.

DC to DC power converters and methods of controlling the same

Science.gov (United States)

Steigerwald, Robert Louis; Elasser, Ahmed; Sabate, Juan Antonio; Todorovic, Maja Harfman; Agamy, Mohammed

2012-12-11

A power generation system configured to provide direct current (DC) power to a DC link is described. The system includes a first power generation unit configured to output DC power. The system also includes a first DC to DC converter comprising an input section and an output section. The output section of the first DC to DC converter is coupled in series with the first power generation unit. The first DC to DC converter is configured to process a first portion of the DC power output by the first power generation unit and to provide an unprocessed second portion of the DC power output of the first power generation unit to the output section.

How much electricity can we save by using direct current circuits in homes? Understanding the potential for electricity savings and assessing feasibility of a transition towards DC powered buildings

International Nuclear Information System (INIS)

Glasgo, Brock; Azevedo, Inês Lima; Hendrickson, Chris

2016-01-01

Highlights: • DC distribution systems are analyzed using monitored appliance and solar PV data. • DC-distributed PV energy generates savings under real-world load and solar profiles. • Savings from direct-DC are generally not cost-effective in current markets. • Non-technical hurdles remain before DC can be widely adopted in US homes. - Abstract: Advances in semiconductor-based power electronics and growing direct current loads in buildings have led researchers to reconsider whether buildings should be wired with DC circuits to reduce power conversions and facilitate a transition to efficient DC appliances. The feasibility, energy savings, and economics of such systems have been assessed and proven in data centers and commercial buildings, but the outcomes are still uncertain for the residential sector. In this work, we assess the technical and economic feasibility of DC circuits using data for 120 traditionally-wired AC homes in Austin, Texas to understand the effect of highly variable demand profiles on DC-powered residences, using appliance-level use and solar generation data, and performing a Monte Carlo simulation to quantify costs and benefits. Results show site energy savings between 9% and 20% when solar PV is distributed to all home appliances. When battery storage for excess solar energy is considered, these savings increase to 14–25%. At present DC equipment prices, converting all equipment to DC causes levelized annual costs of electricity to homeowners to roughly double. However, by converting only homes’ air conditioning condensing units to DC, the costs of direct-DC are greatly reduced and home site energy savings of 7–16% are generated. In addition to quantifying savings, we find major nontechnical barriers to implementing direct-DC in homes. These include a lack of standards for such systems, a relatively small market for DC appliances and components, utility programs designed for AC power, and a workforce unfamiliar with DC

Voltage Stability Bifurcation Analysis for AC/DC Systems with VSC-HVDC

Directory of Open Access Journals (Sweden)

Yanfang Wei

2013-01-01

Full Text Available A voltage stability bifurcation analysis approach for modeling AC/DC systems with VSC-HVDC is presented. The steady power model and control modes of VSC-HVDC are briefly presented firstly. Based on the steady model of VSC-HVDC, a new improved sequential iterative power flow algorithm is proposed. Then, by use of continuation power flow algorithm with the new sequential method, the voltage stability bifurcation of the system is discussed. The trace of the P-V curves and the computation of the saddle node bifurcation point of the system can be obtained. At last, the modified IEEE test systems are adopted to illustrate the effectiveness of the proposed method.

Modeling, Control and Protection of Low-Voltage DC Microgrids

OpenAIRE

Salomonsson, Daniel

2008-01-01

Current trends in electric power consumption indicate an increasing use of dc in end-user equipment, such as computers and other electronic appliances used in households and offices. With a dc power system, ac/dc conversion within these loads can be avoided, and losses reduced. AC/DC conversion is instead centralized, and by using efficient, fully controllable power-electronic interfaces, high power quality for both ac and dc systems during steady state and ac grid disturbances can be obtaine...

Temperature dependence of the minimum in AC power losses of (Nb/sub 0.99/Zr/sub 0.01/)3Sn in parallel AC and DC magnetic fields

International Nuclear Information System (INIS)

Kovachev, V.T.

1980-01-01

ac losses P/sub L/ of bronze-processed (Nb/sub 0.99/Zr/sub 0.01/) 3 Sn strips have been measured between 4.2 and 16.5 K in the presence of a dc magnetic field H 0 . The measurements were performed using an electronic wattmeter with both ac and dc fields parallel to the long flat surfaces of the sample. A minimum in the function P/sub L/(H 0 ) was observed for fixed ac amplitudes h 0 . This minimum was found to occur in the entire temperature range between 4.2 and 16.5 K. A similar minimum was recently reported in Nb 3 Ge [Thompson et al., J. Appl. Phys. 50, 3514 (1979)] at 4.2 K. The position of the minimum is explained here by the same physical model as in Thompson et al. [J. Appl. Phys. 50, 3514 (1979)]; and Clem (ibid. 3518), but extending the model to include the temperature dependence of the entry surface shielding fields ΔH/sub en/(B,T) for flux density in the sample B=0. It is also shown here that loss minimum measurements can be used for the determination of ΔH/sub en/(0,T) in the temperature range 4.2--16.5 K

Troubleshooting of Modulator DC power supply at KOMAC

Energy Technology Data Exchange (ETDEWEB)

Jeong, Hae Seong; Kim, Han Sung; Kwon, Hyeok Jung; Kim, Seong Gu; Kim, Dae Il; Lee, Seok Geun; Kim, Jae Ha; Seol, Kyeong Tae; Cho, Yong Sub [KAERI, Daejeon (Korea, Republic of)

2016-05-15

The process of solving problems to operate the 2nd converter modulator will be introduced. Also, the PSpice simulation result about the 12-pulse rectifier will be compared with the measurement result. KOMAC (KOrea Multi-purpose Accelerator Complex) has four HVCMs (High Voltage Converter Modulator) which are the power source of nine klystrons. Four HVCMs are already operated since 2013 for operating the 100 MeV linear proton accelerator at KOMAC. This HVCM system includes the 12-pulse rectifier (ac-dc), capacitors bank (dc-link, Pos, Neg) and converter modulator (dc-dc). Especially, the 12-pulse rectifier system receives the power from the utility and converts 3,300 ac voltage to 2,200 dc voltage for supplying the dc power to the capacitors bank. This rectifier system used twelve thyristors for the rectification and applied RC snubber networks to protect the semiconductor switches (thyristors). Since the 2nd modulator dc power supply has troubled, the troubleshooting process conducted by the staves of KOMAC. It takes 3 months to solve the problems because it is not easy to find the faulty wiring. Nevertheless, our staves found the faulty point with a hope to operate the modulator system and the PSpice simulation helps to solve the problems. Using PSpice which is tool for simulating the circuit, the dc power supply abnormal phenomenon was simulated exactly. After corrected the faulty wiring, the modulator dc power supply operated.

Voltage ripple compensation for grid connected electrolyser power supply using small DC link capacitor

DEFF Research Database (Denmark)

Török, Lajos; Mathe, Laszlo; Munk-Nielsen, Stig

2014-01-01

The purpose of this work was to investigate a three-phase-grid connected power supply using small DC link capacitor for electrolyser application. The hydrogen generation system requires low voltage and high current power supply. Thus the structure of the 3-phase power supply is defined as follows......: a three phase rectification, a small DC-link capacitor and a phase-shifted full-bridge converter with current doubler rectification. Design constraints and control problems are investigated. The advantages and problems caused by the use of small DC link capacitor are presented. The control of the system...

Load Flow Analysis of Hybrid AC-DC Power System with Offshore Wind Power

DEFF Research Database (Denmark)

Dhua, Debasish; Huang, Shaojun; Wu, Qiuwei

2017-01-01

The offshore wind power has received immense attention because of higher wind speed and lower opposition for construction. A wide range of combinations of high-voltage ACDC transmission have been proposed for integrating offshore wind farms and long-distance power transmission. This paper...... is to model such hybrid AC-DC systems including the interfacing converters, which have several control parameters that can change the load flow of the hybrid systems. Then, the paper proposes a Load Flow algorithm based on the Newton-Raphson method, which covers three different section types...

Piezoelectric power converter with bi-directional power transfer

DEFF Research Database (Denmark)

2014-01-01

The present invention relates to a bi-directional piezoelectric power converter com¬ prising a piezoelectric transformer. The piezoelectric transformer comprises an input electrode electrically coupled to a primary section of the piezoelectric transformer and an output electrode electrically...... coupled to an output section of the piezoelectric transformer to provide a transformer output signal. A bi-directional switching circuit is coupled between the output electrode and a DC or AC output voltage of the power converter. Forward and reverse current conducting periods of the bi......, a reverse current is conducted through the bi-directional switching circuit from the DC or AC output voltage to the output electrode to discharge the DC or AC output voltage and return power to the primary section of the piezoelectric transformer....

Analysis and Design of Bi-Directional DC-DC Converter in the Extended Run Time DC UPS System Based on Fuel Cell and Supercapacitor

DEFF Research Database (Denmark)

Zhang, Zhe; Thomsen, Ole Cornelius; Andersen, Michael A. E.

2009-01-01

Abstract-In this paper, an extended run time DC UPS system structure with fuel cell and supercapacitor is investigated. A wide input range bi-directional dc-dc converter is described along with the phase-shift modulation scheme and phase-shift with duty cycle control, in different modes. The deli......Abstract-In this paper, an extended run time DC UPS system structure with fuel cell and supercapacitor is investigated. A wide input range bi-directional dc-dc converter is described along with the phase-shift modulation scheme and phase-shift with duty cycle control, in different modes...

Analysis of AC and DC Lighting Systems with 150-Watt Peak Solar Panel in Denpasar Based on NASA Data

Science.gov (United States)

Narottama, A. A. N. M.; Amerta Yasa, K.; Suwardana, I. W.; Sapteka, A. A. N. G.; Priambodo, P. S.

2018-01-01

Solar energy on the Earth’s surface has different magnitudes on every longitude and latitude. National Aeronautics and Space Administration (NASA) provides surface meteorology and solar energy database which can be accessed openly online. This database delivers information about Monthly Averaged Insolation Incident On A Horizontal Surface, Monthly Averaged Insolation Incident On A Horizontal Surface At Indicated GMT Times and also data about Equivalent Number Of No-Sun Or Black Days for any latitude and longitude. Therefore, we investigate the lighting systems with 150-Watt peak solar panel in Denpasar City, the capital province of Bali. Based on NASA data, we analyse the received wattage by a unit of 150-Watt peak solar panel in Denpasar City and the sustainability of 150-Watt peak solar panel to supply energy for 432-Watt hour/day AC and 360-Watt hour/day DC lighting systems using 1.2 kWh battery. The result shows that the maximum received wattage by a unit of 150-Watt peak solar panel is 0.76 kW/day in October. We concluded that the 1.2 kWh installed battery has higher capacity than the battery capacity needed in March, the month with highest no-sun days, for both AC and DC lighting systems. We calculate that the installed battery can be used to store the sustainable energy from sun needed by AC and DC lighting system for about 2.78 days and 3.51 days, consecutively.

Quench behavior of Sr{sub 0.6}K{sub 0.4}Fe{sub 2}As{sub 2}/Ag tapes with AC and DC transport currents at different temperature

Energy Technology Data Exchange (ETDEWEB)

Liu, Qi [Key Laboratory of Applied Superconductivity, Chinese Academy of Sciences, Beijing 100190 (China); Institute of Electrical Engineering, Chinese Academy of Sciences, Beijing 100190 (China); University of the Chinese Academy of Sciences, Beijing 100049 (China); Institute of Science, Information Engineering University, Zhengzhou 450001 (China); Zhang, Guomin, E-mail: gmzhang@mail.iee.ac.cn [Key Laboratory of Applied Superconductivity, Chinese Academy of Sciences, Beijing 100190 (China); Institute of Electrical Engineering, Chinese Academy of Sciences, Beijing 100190 (China); Yang, Hua [Institute of Science, Information Engineering University, Zhengzhou 450001 (China); Li, Zhenming; Liu, Wei [China Electric Power Research Institute, Beijing 100192 (China); Jing, Liwei [Key Laboratory of Applied Superconductivity, Chinese Academy of Sciences, Beijing 100190 (China); Institute of Electrical Engineering, Chinese Academy of Sciences, Beijing 100190 (China); Yu, Hui; Liu, Guole [Key Laboratory of Applied Superconductivity, Chinese Academy of Sciences, Beijing 100190 (China); Institute of Electrical Engineering, Chinese Academy of Sciences, Beijing 100190 (China); University of the Chinese Academy of Sciences, Beijing 100049 (China)

2016-09-15

Highlights: • Quench behavior of Sr{sub 0.6}K{sub 0.4}Fe{sub 2}As{sub 2}/ Ag tape with AC transport current was reported for the first time. • The measurement are performed as a function of different temperature (20 K–30 K), transport current (AC and DC) and operating frequency (50 Hz–250 Hz). • The study is concentrated on the research of quench development, and the discussions of NZPV and MQE values. - Abstract: In applications, superconducting wires may carry AC or DC transport current. Thus, it is important to understand the behavior of normal zone propagation in conductors and magnets under different current conditions in order to develop an effective quench protection system. In this paper, quench behavior of Ag sheathed Sr{sub 0.6}K{sub 0.4}Fe{sub 2}As{sub 2} (Sr-122 in the family of iron-based superconductor) tapes with AC and DC transport current is reported. The measurements are performed as a function of different temperature (20 K–30 K), varying transport current and operating frequency (50 Hz–250 Hz). The focus of the research is the minimum quench energy (MQE), the normal zone propagation velocity (NZPV) and the comparison of the related results with AC and DC transport current.

75 FR 61352 - Airworthiness Directives; McDonnell Douglas Corporation Model DC-10-30, DC-10-30F, DC-10-30F (KC...

Science.gov (United States)

2010-10-05

... Airworthiness Directives; McDonnell Douglas Corporation Model DC- 10-30, DC-10-30F, DC-10-30F (KC-10A and KDC-10...-13 McDonnell Douglas Corporation: Amendment 39-16448; Docket No. FAA-2010-0553; Directorate.... Applicability (c) This AD applies to McDonnell Douglas Corporation Model DC- 10-30, DC-10-30F, DC-10-30F (KC-10A...

A new on-chip all-digital three-phase full-bridge dc/ac power inverter with feedforward and frequency control techniques.

Science.gov (United States)

Chen, Jiann-Jong; Kung, Che-Min

2010-09-01

The communication speed between components is far from satisfactory. To achieve high speed, simple control system configuration, and low cost, a new on-chip all-digital three-phase dc/ac power inverter using feedforward and frequency control techniques is proposed. The controller of the proposed power inverter, called the shift register, consists of six-stage D-latch flip-flops with a goal of achieving low-power consumption and area efficiency. Variable frequency is achieved by controlling the clocks of the shift register. One advantage regarding the data signal (D) and the common clock (CK) is that, regardless of the phase difference between the two, all of the D-latch flip-flops are capable of delaying data by one CK period. To ensure stability, the frequency of CK must be six times higher than that of D. The operation frequency of the proposed power inverter ranges from 10 Hz to 2 MHz, and the maximum output loading current is 0.8 A. The prototype of the proposed circuit has been fabricated with TSMC 0.35 μm 2P4M CMOS processes. The total chip area is 2.333 x 1.698 mm2. The three-phase dc/ac power inverter is applicable in uninterrupted power supplies, cold cathode fluorescent lamps, and motors, because of its ability to convert the dc supply voltage into the three-phase ac power sources.

An improved soft switched PWM interleaved boost AC-DC converter

International Nuclear Information System (INIS)

Genc, Naci; Iskender, Ires

2011-01-01

In this paper, an improved soft switched two cell interleaved boost AC/DC converter with high power factor is proposed and investigated. A new auxiliary circuit is designed and added to two cell interleaved boost converter to reduce the switching losses. The proposed auxiliary circuit is implemented using only one auxiliary switch and a minimum number of passive components without an important increase in the cost and complexity of the converter. The main advantage of this auxiliary circuit is that it not only provides zero-voltage-transition (ZVT) for the main switches but also provides soft switching for the auxiliary switch and diodes. Though all semiconductor devices operate under soft switching, they do not have any additional voltage and current stresses. The proposed converter operates successfully in soft switching operation mode for a wide range of input voltage level and the load. In addition, it has advantages such as fewer structure complications, lower cost and ease of control. In the study, the transition modes for describing the behavior of the proposed converter in one switching period are described. A prototype with 600 W output power, 50 kHz/cell switching frequency, input line voltage of 110-220 V rms and an output voltage of 400 V dc has been implemented. Analysis, design and the control circuitry are also presented in the paper.

Analog Fiber Optic Link with DC-100 MHz Bandwidth

National Research Council Canada - National Science Library

Sullivan, C. A; Girardi, P. G; Lohrmann, Dieter R

2008-01-01

An analog fiber optic link covering the frequency range from DC to 100 MHz was designed, constructed, and tested, in order to connect a 10 kA pulse current probe to oscilloscopes for oscillographing...

A novel design of DC-AC electrical machine rotary converter for hybrid solar and wind energy applications

International Nuclear Information System (INIS)

Mohammed, K G; Ramli, A Q; Amirulddin, U A U

2013-01-01

This paper proposes the design of a new bi-directional DC-AC rotary converter machine to convert a d.c. voltage to three-phase voltage and vice-versa using a two-stage energy conversion machine. The rotary converter consists of two main stages which are combined into single frame. These two stages are constructed from three main electromagnetic components. The first inner electromagnetic component represents the input stage that enables the DC power generated by solar energy from photo-voltaic cells to be transformed by the second and third components electro-magnetically to produce multi-phase voltages at the output stage. At the same time, extra kinetic energy from wind, which is sufficiently available, can be added to existing torque on the second electromagnetic component. Both of these input energies will add up to the final energy generated at the output terminals. Therefore, the machine will be able to convert solar and wind energies to the output terminals simultaneously. If the solar energy is low, the available wind energy will be able to provide energy to the output terminals and at the same time charges the batteries which are connected as backup system. At this moment, the machine behaves as wind turbine. The energy output from the machine benefits from two energy sources which are solar and wind. At night when the solar energy is not available and also the load is low, the wind energy is able to charge the batteries and at the same time provides output electrical power to the remaining the load. Therefore, the proposed system will have high usage of available renewable energy as compared to separated wind or solar systems. MATLAB codes are used to calculate the required dimensions, the magnetic and electrical circuits parameters to design of the new bi-directional rotary converter machine.

Implementation of a Single-Phase SST for the Interface between a 13.2 kV MVAC Network and a 750 V Bipolar DC Distribution

Directory of Open Access Journals (Sweden)

Hyeok-Jin Yun

2018-05-01

Full Text Available This paper presents the implementation of a single-phase solid-state transformer (SST for the interface between a 13.2 kV medium voltage alternative current (MVAC network and a 750 V bipolar DC distribution. The SST has ten cascaded subunits in consideration of the device rating and modulation index (MI. Each subunit consists of an AC/DC stage and a DC/DC stage with a high frequency isolated transformer (HFIT. The AC/DC stage consists of cascaded H-bridges (CHBs to cope with the MVAC. The DC/DC stage employs a triple active bridge (TAB converter for bipolar DC distribution. Topology analysis and controller design for this specific structure are discussed. In addition, the insulation of HFIT used in DC/DC converters is also discussed. A simple balancing controller at the AC/DC stage and a current sharing controller at the DC/DC stage are used to prevent DC-link voltage unbalance caused by the cascaded structure. The discussions are validated using a 150 kW single-phase 21-level SST prototype at the laboratory level.

Energy Management of a Hybrid AC–DC Micro-Grid Based on a Battery Testing System

Directory of Open Access Journals (Sweden)

Bo Long

2015-02-01

Full Text Available Energy Recovery Battery Testing Systems (ERBTS plays an important role in battery manufacture. The conventional ERBTS configuration contains a fundamental transformer, and a bidirectional Direct Current (DC–DC and Alternating Current (AC–DC converter. All ERBTS are connected in parallel, thus constituting a special and complicated AC micro-grid system. Aiming at addressing their low energy recovery efficiency, complex grid-connected control algorithm issues for islanded detection, and complicated power circuit topology issues, a hierarchical DC-link voltage hybrid AC–DC micro-grid that contains composite energy storing devices is proposed. Moreover, an energy management optimal scheme for the proposed scheme is put forward. The system configuration of the proposed scheme is described in detail. Compared to the conventional scheme, the proposed scheme has the merits of simplified power circuit topology, no need for phase synchronous control, and much higher energy recovery efficiency and reliability. The validity and effectiveness of the proposed technique is verified through numerous experimental results.

Liquid helium boil-off measurements of heat leakage from sinter-forged BSCCO current leads under DC and AC conditions

International Nuclear Information System (INIS)

Cha, Y.S.; Niemann, R.C.; Hull, J.R.; Youngdahl, C.A.; Lanagan, M.T.; Nakade, M.; Hara, T.

1995-06-01

Liquid helium boil-off experiments are conducted to determine the heat leakage rate of a pair of BSCCO 2223 high-temperature superconductor current leads made by sinter forging. The experiments are carried out in both DC and AC conditions and with and without an intermediate heat intercept. Current ranges are from 0-500 A for DC tests and 0-1,000 A rms for AC tests. The leads are self-cooled. Results show that magnetic hysteresis (AC) losses for both the BSCCO leads and the low-temperature superconductor current jumper are small for the current range. It is shown that significant reduction in heat leakage rate (liquid helium boil-off rate) is realized by using the BSCCO superconductor leads. At 100 A, the heat leakage rate of the BSCCO/copper binary lead is approximately 29% of that of the conventional copper lead. Further reduction in liquid helium boil-off rate can be achieved by using an intermediate heat intercept. For example, at 500 K, the heat leakage rate of the BSCCO/copper binary lead is only 7% of that of the conventional copper lead when an intermediate heat intercept is used

DC Polarographic and Plane Polarographic investigation of the ...

African Journals Online (AJOL)

Bheema

D.C., A.C. and Complex Plane Polarographic behavior of copper (II) in monoethanolamine /sodium ... The Cd of supporting electrolyte can be directly measured. Theoretical phase sensitive ..... The mass and drop time of mercury are provided ...

Control of parallel-connected bidirectional AC-DC converters in stationary frame for microgrid application

DEFF Research Database (Denmark)

Lu, Xiaonan; Guerrero, Josep M.; Teodorescu, Remus

2011-01-01

With the penetration of renewable energy in modern power system, microgrid has become a popular application worldwide. In this paper, parallel-connected bidirectional converters for AC and DC hybrid microgrid application are proposed as an efficient interface. To reach the goal of bidirectional...... power conversion, both rectifier and inverter modes are analyzed. In order to achieve high performance operation, hierarchical control system is accomplished. The control system is designed in stationary frame, with harmonic compensation in parallel and no coupled terms between axes. In this control...

AC impedance behavior of a practical-size single-cell SOFC under DC current

Energy Technology Data Exchange (ETDEWEB)

Momma, Akihiko; Kaga, Yasuo; Takano, Kiyonami; Nozaki, Ken; Negishi, Akira; Kato, Ken; Kato, Tohru [Fuel Cell Group, Energy Electronics Institute, National Institute of Advanced Industrial Science and Technology, Umezono Tsukuba-shi, Ibaraki 305-8568 (Japan); Inagaki, Toru; Yoshida, Hiroyuki [Energy Use R and D Center, The Kansai Electric Power Company, Inc., 11-20 Nakoji, 3-Chome, Amagasaki, Hyogo 661-0974 (Japan); Hosoi, Kei; Hoshino, Koji; Akbay, Taner; Akikusa, Jun; Yamada, Masaharu; Chitose, Norihisa [Central Research Institute, Naka Research Center, Mitsubishi Materials Corp. 1002-14 Mukohyama, Naka-machi, Naka-gun, Ibaraki 311-0102 (Japan)

2004-10-29

AC impedance measurements were carried out using practical-size planar disc-type SOFC which employs lanthanum gallate as a solid electrolyte. The data were obtained under practical conditions of gas flow rate and DC current. Under these conditions, the gas conversion impedance (GCI), which originates from the change of the electromotive force (EMF) caused by the change in anodic gaseous concentrations along the flow direction, was observed in the low-frequency range of the data obtained. The overlapping impedance together with GCI on the low-frequency arc was also estimated. Experimentally obtained GCI was in good agreement with that calculated. It was concluded that GCI was predominant in the impedance data obtained under practical conditions. The shift of the high-frequency intercept in the complex impedance diagrams was shown to appear as a result of the change in the distribution of gaseous composition in the anode. The dependency of the low-frequency arc on temperature was also shown, and it was assumed that the overlapped impedance varies as the temperature changes. The validity of the impedance measurement, as a diagnostic means to evaluate the gas flow in SOFC stack, was suggested.

Long Lifetime DC-Link Voltage Stabilization Module for Smart Grid Application

DEFF Research Database (Denmark)

Wang, Huai; Chung, Henry; Liu, Wenchao

2012-01-01

Power converters enable efficient and flexible control and conversion of electric energy among different smart grid players (i.e. producers, energy storage systems, and loads). One of the expected features of smart grid is that it will be more reliable compared to conventional grid. However, power...... converters are one kind of the lifetime limiting components applied in smart grid. One of the major causes is the malfunction of electrolytic capacitors (E-Caps) which are widely used for stabilizing the dc-link voltage in various types of power converters applied in smart grid. A dc-link module is therefore...

Analysis of voltage modulation based active damping techniques for small DC-link drive system

DEFF Research Database (Denmark)

Wang, Dong; Lu, Kaiyuan; Rasmussen, Peter Omand

2015-01-01

Small DC-link drive system, built with film capacitor in the DC link, may have the advantages of longer lifetime and the possibility to achieve a more compact design of capacitor bank at medium and high power rates. However, it exhibits instability problem, especially when it is fed by a soft grid...

Overview of Multi-DC-Bus Solutions for DC Microgrids

DEFF Research Database (Denmark)

Ricchiuto, D.; Mastromauro, R.A.; Liserre, Marco

2013-01-01

DC Microgrids have recently received a lot of attention in the last years due to high penetration of renewable energy sources as well as distributed energy storage systems. In the future DC microgrids could be preferable respect to AC microgrids in terms of redundancy since multi-DC-Bus solutions...... could provide a continuative power supply to the loads. An overview of Multi-DC-Bus solutions is presented in this paper. The performances are compared on the basis of possible DC microgrid configurations, redundancy, different DC voltage levels....

On-grid and Off-grid Operation of Multi-Input Single-Output DC/DC Converter based Fuel Cell Generation System

Directory of Open Access Journals (Sweden)

Noroozian

2009-06-01

Full Text Available This paper presents the modeling and simulation of a proton exchange membrane fuel cell (PEMFC generation system for off-grid and on-grid operation and configuration. A fuel cell DG system consists of a fuel cell power plant, a DC/DC converter and a DC/AC inverter. The dynamic model for fuel cell array and its power electronic interfacing are presented also a multi-input single output (MISO DC/DC converter and its control scheme is proposed and analyzed. This DC/DC converter is capable of interfacing fuel cell arrays to the DC/AC inverter. Also the mathematical model of the inverter is obtained by using average technique. Then the novel control strategy of DC/AC inverter for different operating conditions is demonstrated. The simulation results show the effectiveness of the suggested control systems under both on-grid and off-grid operation modes.

Reduction of dc-link capacitance for three-phase three-wire shunt active power filters

DEFF Research Database (Denmark)

Jin, Chi; Tang, Yi; Wang, Peng

2013-01-01

. This paper presents the concept of dc-link compensator (DLC) that aims to decouple the harmonic power from the dc-link of APF. With proper system sizing and design, most of the harmonic power can be eliminated by this DLC circuit and very small electrolytic capacitors or even film type capacitors can be used...

A Single-Phase Current Source Solar Inverter with Constant Instantaneous Power, Improved Reliability, and Reduced-Size DC-Link Filter

Science.gov (United States)

Bush, Craig R.

This dissertation presents a novel current source converter topology that is primarily intended for single-phase photovoltaic (PV) applications. In comparison with the existing PV inverter technology, the salient features of the proposed topology are: a) the low frequency (double of line frequency) ripple that is common to single-phase inverters is greatly reduced; b) the absence of low frequency ripple enables significantly reduced size pass components to achieve necessary DC-link stiffness and c) improved maximum power point tracking (MPPT) performance is readily achieved due to the tightened current ripple even with reduced-size passive components. The proposed topology does not utilize any electrolytic capacitors. Instead an inductor is used as the DC-link filter and reliable AC film capacitors are utilized for the filter and auxiliary capacitor. The proposed topology has a life expectancy on par with PV panels. The proposed modulation technique can be used for any current source inverter where an unbalanced three-phase operation is desires such as active filters and power controllers. The proposed topology is ready for the next phase of microgrid and power system controllers in that it accepts reactive power commands. This work presents the proposed topology and its working principle supported by with numerical verifications and hardware results. Conclusions and future work are also presented.

Input Harmonic Analysis on the Slim DC-Link Drive Using Harmonic State Space Model

DEFF Research Database (Denmark)

Yang, Feng; Kwon, Jun Bum; Wang, Xiongfei

2017-01-01

The harmonic performance of the slim dc-link adjustable speed drives has shown good performance in some studies but poor in some others. The contradiction indicates that a feasible theoretical analysis is still lacking to characterize the harmonic distortion for the slim dc-link drive. Considerin...... results of the slim dc-link drive, loaded up to 2.0 kW, are presented to validate the theoretical analysis....... variation according to the switching instant, the harmonics at the steady-state condition, as well as the coupling between the multiple harmonic impedances. By using this model, the impaction on the harmonics performance by the film capacitor and the grid inductance is derived. Simulation and experimental...

DC Collection Network Simulation for Offshore Wind Farms

DEFF Research Database (Denmark)

Vogel, Stephan; Rasmussen, Tonny Wederberg; El-Khatib, Walid Ziad

2015-01-01

The possibility to connect offshore wind turbines with a collection network based on Direct Current (DC), instead of Alternating Current (AC), gained attention in the scientific and industrial environment. There are many promising properties of DC components that could be beneficial such as......: smaller dimensions, less weight, fewer conductors, no reactive power considerations, and less overall losses due to the absence of proximity and skin effects. This work describes a study about the simulation of a Medium Voltage DC (MVDC) grid in an offshore wind farm. Suitable converter concepts...

Superconducting DC homopolar motors for ship propulsion

Energy Technology Data Exchange (ETDEWEB)

Heiberger, M.; Reed, M.R.; Creedon, W.P.; O' Hea, B.J. [General Atomic (United States)

2000-07-01

Superconducting DC homopolar motors have undergone recent advances in technology, warranting serious consideration of their use for ship propulsion. Homopolar motor propulsion is now practical because of two key technology developments: cryogen-free superconducting refrigeration and high performance motor fiber brushes. These compact motors are ideal for podded applications, where reduced drag and fuel consumption are predicted. In addition, the simple DC motor controller is more efficient and reliable compared with AC motor controllers. Military ships also benefit from increased stealth implicit in homopolar DC excitation, which also allows the option for direct hull or pod mounting. (authors)

DC Fault Analysis and Clearance Solutions of MMC-HVDC Systems

Directory of Open Access Journals (Sweden)

Zheng Xu

2018-04-01

Full Text Available In this paper, the DC short-circuit fault and corresponding clearance solutions of modular multilevel converter-based high-voltage direct current (MMC-HVDC systems are analyzed in detail. Firstly, the analytical expressions of DC fault currents before and after blocking the MMC are derived based on the operation circuits. Before blocking the MMC, the sub-module (SM capacitor discharge current is the dominant component of the DC fault current. It will reach the blocking threshold value in several milliseconds. After blocking the MMC, the SM capacitor is no longer discharged. Therefore, the fault current from the AC system becomes the dominant component. Meanwhile, three DC fault clearance solutions and the corresponding characteristics are discussed in detail, including tripping AC circuit breaker, adopting the full-bridge MMC and employing the DC circuit breaker. A simulation model of the MMC-HVDC is realized in PSCAD/EMTDC and the results of the proposed analytical expressions are compared with those of the simulation. The results show that the analytical DC fault currents coincide well with the simulation results.

Optimizing efficiency on conventional transformer based low power AC/DC standby power supplies

DEFF Research Database (Denmark)

Nielsen, Nils

2004-01-01

This article describes the research results for simple and cheap methods to reduce the idle- and load-losses in very low power conventional transformer based power supplies intended for standby usage. In this case "very low power" means 50 Hz/230 V-AC to 5 V-DC@1 W. The efficiency is measured...... on two common power supply topologies designed for this power level. The two described topologies uses either a series (or linear) or a buck regulation approach. Common to the test power supplies is they either are using a standard cheap off-the-shelf transformer, or one, which are loss optimized by very...

75 FR 80744 - Airworthiness Directives; McDonnell Douglas Corporation Model DC-9-81 (MD-81), DC-9-82 (MD-82...

Science.gov (United States)

2010-12-23

...-1203; Directorate Identifier 2010-NM-168-AD] RIN 2120-AA64 Airworthiness Directives; McDonnell Douglas... amends Sec. 39.13 by adding the following new airworthiness directive (AD): McDonnell Douglas Corporation... Douglas Corporation Model DC-9-81 (MD-81), DC-9-82 (MD-82), DC-9-83 (MD-83), DC-9-87 (MD-87) and MD-88...

DC bias effect on alternating current electrical conductivity of poly(ethylene terephthalate)/alumina nanocomposites

Science.gov (United States)

Nikam, Pravin N.; Deshpande, Vineeta D.

2016-05-01

Polymer nanocomposites based on metal oxide (ceramic) nanoparticles are a new class of materials with unique properties and designed for various applications such as electronic device packaging, insulation, fabrication and automotive industries. Poly(ethylene terephthalate) (PET)/alumina (Al2O3) nanocomposites with filler content between 1 wt% and 5 wt% were prepared by melt compounding method using co-rotating twin screw extruder and characterized by scanning electron microscopy (SEM), transmission electron microscopy (TEM) and precision LCR meter techniques. The results revealed that proper uniform dispersion at lower content up to 2 wt% of nano-alumina observed by using TEM. Aggregation of nanoparticles was observed at higher content of alumina examined by using SEM and TEM. The frequency dependences of the alternating current (AC) conductivity (σAC) of PET/alumina nanocomposites on the filler content and DC bias were investigated in the frequency range of 20Hz - 1MHz. The results showed that the AC and direct current (DC) conductivity increases with increasing DC bias and nano-alumina content upto 3 wt%. It follows the Jonscher's universal power law of solids. It revealed that σAC of PET/alumina nanocomposites can be well characterized by the DC conductivity (σDC), critical frequency (ωc), critical exponent of the power law (s). Roll of DC bias potential led to an increase of DC conductivity (σDC) due to the creation of additional conducting paths with the polymer nanocomposites and percolation behavior achieved through co-continuous morphology.

A measurement system for two-dimensional DC-biased properties of magnetic materials

International Nuclear Information System (INIS)

Enokizono, M.; Matsuo, H.

2003-01-01

So far, the DC-biased magnetic properties have been measured in one dimension (scalar). However, these scalar magnetic properties are not enough to clarify the DC-biased magnetic properties because the scalar magnetic properties cannot exactly take into account the phase difference between the magnetic flux density B vector and the magnetic filed strength H vector. Thus, the magnetic field strength H and magnetic flux density B in magnetic materials must be measured as vector quantities (two-dimensional), directly. We showed the measurement system using a single-sheet tester (SST) to clarify the two-dimensional DC-biased magnetic properties. This system excited AC in Y-direction and DC in X-direction. This paper shows the measurement system using an SST and presents the measurement results of two-dimensional DC-biased magnetic properties when changing the DC exciting voltage and the iron loss

A DC-Link Modulation Scheme with Phase-Shifted Current Control for Harmonic Cancellations in Multidrive Applications

DEFF Research Database (Denmark)

Yang, Yongheng; Davari, Pooya; Zare, Firuz

2016-01-01

of a new DC link modulation scheme with a phase-shifted current control enabled by the SCR. The DC-link current modulation scheme is implemented by adding and subtracting specific modulation levels, which makes the total currents drawn from the grid “multi-level”, resulting in an improved current quality......This letter proposes a harmonic mitigation strategy to cancel out current harmonics induced by the front-end rectifiers in multi-drive systems, which consist of diode rectifiers, Silicon-Controlled Rectifiers (SCR), and boost converters in the DC-link. The proposed strategy is a combination...

Harmonic Coupling Analysis of a Multi-Drive System with Slim DC-link Drive

DEFF Research Database (Denmark)

Yang, Feng; Kwon, Jun Bum; Blaabjerg, Frede

2017-01-01

One of the problems with slim dc-link adjustable speed drive is the difficulties to analyze the harmonic coupling when it is integrated into a multi-drive system. The traditional methods analyze this harmonic issue by neglecting the harmonic coupling, and base on the linear time-invariant methods....... Its disadvantages include the time consumption and large computer memory. This paper proposes to do harmonic analysis by using the harmonic state-space modeling method by using the linear time-periodic theory. By using the proposed model, the harmonic couplings, between dc-link and point of common...... coupling in different drives, are all analyzed in the multi-drive system. In the meantime, the effects of the small film dc-link capacitance and the nonlinear characteristic of the diode rectifier are considered. The detailed modeling procedure, the simulations and the lab experiment on a two-drive system...

Large Signal Model of a Four-quadrant AC to DC Converter for Accelerator Magnets

CERN Document Server

De la Calle, R; Rinaldi, L; Völker, F V

2001-01-01

This paper presents the large signal model of a four-quadrant AC to DC converter, which is expected to be used in the area of particle accelerators. The system’s first stage is composed of a three-phase boost PWM (Pulse Width Modulated) rectifier with DSP (Digital Signal Processing) based power factor correction (PFC) and output voltage regulation. The second stage is a full-bridge PWM inverter that allows fast four-quadrant operation. The structure is fully reversible, and an additional resistance (brake chopper) is not needed to dissipate the energy when the beam deflection magnet acts as generator.

The Impact of Grid Unbalances on the Reliability of DC-link Capacitors in a Motor Drive

DEFF Research Database (Denmark)

Wang, Huai; Davari, Pooya; Kumar, Dinesh

2017-01-01

DC-link capacitor is one of the reliability-critical components in motor drive applications, which contributes to a considerable cost, size and failure. Its reliability performance depends on both inherent physical strength and external loading. The grid unbalances could alter the electro......-thermal stresses of key components in a motor drive. Therefore, this digest investigates the impact of grid voltage amplitude and phase unbalances on the lifetime of DC-link capacitors used in a standard three-phase motor drive. The theoretical stress models and experimental measurements of the capacitor voltages...... and ripple currents are presented. The relationship between the DC-link capacitor lifetime and the level of unbalances and loads are discussed based on a 7.5 kW motor drive system. The results serve as a guideline to size the DC-link capacitors to be robust enough at the presence of grid unbalance conditions....

Method to predetermine current/power flow change in a dc grid

DEFF Research Database (Denmark)

2017-01-01

occurs at one of the AC/DC converters; establishing a generalized droop feedback gain matrix G; controlling current/power flow within DC grid towards predefined setpoints, by use of control law. The invention presents an analytical approach to derive the generalized feedback gain allowing......The invention relates to a method for controlling current/power flow within a power transmission system, comprising two or more interconnected converter stations. The method comprises the steps of: providing a DC admittance matrix given from the DC grid; providing a current distribution matrix...... for a number of, such as for all possible AC/DC converter outages; providing a DC bus voltage vector for the DC grid; the DC bus voltage vector being a vector containing the values of the voltage change at the AC/DC converters, measured at the AC/DC converters, before, during and after a forced current change...

Predictive Current Control of a 7-level AC-DC back-to-back Converter for Universal and Flexible Power Management System

DEFF Research Database (Denmark)

Bifaretti, Steffano; Zanchetta, Pericle; Iov, Florin

2008-01-01

The paper proposes a novel power conversion system for Universal and Flexible Power Management (UNIFLEX-PM) in Future Electricity Network. Its structure is based on a back-to-back three-phase AC-DC 7-level converter; each AC side is connected to a different PCC, representing the main grid and....../or various distributed generation systems. Effective and accurate power flow control is demonstrated through simulation in Matlab- Simulink environment on a model based on a two-port structure and using a Predictive Control technique. Control of different Power flow profiles has been successfully tested...

Hierarchical Control for Multiple DC-Microgrids Clusters

DEFF Research Database (Denmark)

Shafiee, Qobad; Dragicevic, Tomislav; Vasquez, Juan Carlos

2014-01-01

DC microgrids (MGs) have gained research interest during the recent years because of many potential advantages as compared to the ac system. To ensure reliable operation of a low-voltage dc MG as well as its intelligent operation with the other DC MGs, a hierarchical control is proposed in this p......DC microgrids (MGs) have gained research interest during the recent years because of many potential advantages as compared to the ac system. To ensure reliable operation of a low-voltage dc MG as well as its intelligent operation with the other DC MGs, a hierarchical control is proposed...

Method and system for a gas tube-based current source high voltage direct current transmission system

Science.gov (United States)

She, Xu; Chokhawala, Rahul Shantilal; Bray, James William; Sommerer, Timothy John; Zhou, Rui; Zhang, Di

2017-08-29

A high-voltage direct-current (HVDC) transmission system includes an alternating current (AC) electrical source and a power converter channel that includes an AC-DC converter electrically coupled to the electrical source and a DC-AC inverter electrically coupled to the AC-DC converter. The AC-DC converter and the DC-AC inverter each include a plurality of legs that includes at least one switching device. The power converter channel further includes a commutating circuit communicatively coupled to one or more switching devices. The commutating circuit is configured to "switch on" one of the switching devices during a first portion of a cycle of the H-bridge switching circuits and "switch off" the switching device during a second portion of the cycle of the first and second H-bridge switching circuits.

Insulation measurement and supervision in live AC and DC unearthed systems

CERN Document Server

Olszowiec, Piotr

2014-01-01

Low voltage unearthed (IT) AC and DC systems are commonly applied for supply of power and control circuits in industry, transportation, medical objects etc. The main reasons for their use are high reliability and numerous advantages offered by isolating them against ground. Insulation level is a decisive factor for networks operational reliability and safety. Insufficient insulation-to-ground resistance can cause various disturbances. Though ground faults in IT systems do not make networks operation impossible, they may cause severe problems with their safe functioning. In this book the most important issues concerning normal operation and ground fault phenomena are described in concise form. Numerous methods of insulation resistance and capacitance measurement in live circuits are presented. Important other procedures of  these parameters determination based on measurement and calculation are explained and reviews of selected insulation resistance measurement devices as well as earth fault locating systems ...

Insulation measurement and supervision in live AC and DC unearthed systems

CERN Document Server

Olszowiec, Piotr

2013-01-01

Low voltage unearthed (IT) AC and DC systems are commonly applied for supply of power and control circuits in industry, transportation, medical objects etc. The main reasons for their use are high reliability and numerous advantages offered by isolating them against ground. Insulation level is a decisive factor for networks operational reliability and safety. Insufficient insulation-to-ground resistance can cause various disturbances. Though ground faults in IT systems do not make networks operation impossible, they may cause severe problems with their safe functioning. In this book the most important issues concerning normal operation and ground fault phenomena are described in concise form. Numerous methods of insulation resistance and capacitance measurement in live circuits are presented. Important other procedures of  these parameters determination based on measurement and calculation are explained and reviews of selected insulation resistance measurement devices as well as earth fault locating systems ...

DC bias effect on alternating current electrical conductivity of poly(ethylene terephthalate)/alumina nanocomposites

Energy Technology Data Exchange (ETDEWEB)

Nikam, Pravin N., E-mail: pravinya26@gmail.com; Deshpande, Vineeta D., E-mail: drdeshpandevd@gmail.com [Department of Physics, Institute of Chemical Technology, Matunga, Mumbai-400019, Maharashtra (India)

2016-05-06

Polymer nanocomposites based on metal oxide (ceramic) nanoparticles are a new class of materials with unique properties and designed for various applications such as electronic device packaging, insulation, fabrication and automotive industries. Poly(ethylene terephthalate) (PET)/alumina (Al{sub 2}O{sub 3}) nanocomposites with filler content between 1 wt% and 5 wt% were prepared by melt compounding method using co-rotating twin screw extruder and characterized by scanning electron microscopy (SEM), transmission electron microscopy (TEM) and precision LCR meter techniques. The results revealed that proper uniform dispersion at lower content up to 2 wt% of nano-alumina observed by using TEM. Aggregation of nanoparticles was observed at higher content of alumina examined by using SEM and TEM. The frequency dependences of the alternating current (AC) conductivity (σ{sub AC}) of PET/alumina nanocomposites on the filler content and DC bias were investigated in the frequency range of 20Hz - 1MHz. The results showed that the AC and direct current (DC) conductivity increases with increasing DC bias and nano-alumina content upto 3 wt%. It follows the Jonscher’s universal power law of solids. It revealed that σ{sub AC} of PET/alumina nanocomposites can be well characterized by the DC conductivity (σ{sub DC}), critical frequency (ω{sub c}), critical exponent of the power law (s). Roll of DC bias potential led to an increase of DC conductivity (σ{sub DC}) due to the creation of additional conducting paths with the polymer nanocomposites and percolation behavior achieved through co-continuous morphology.

Risk Assessment Method of UHV AC/DC Power System under Serious Disasters

Directory of Open Access Journals (Sweden)

Rishang Long

2016-12-01

Full Text Available Based on the theory of risk assessment, the risk assessment method for an ultra-high voltage (UHV AC/DC hybrid power system under severe disaster is studied. Firstly, considering the whole process of cascading failure, a fast failure probability calculation method is proposed, and the whole process risk assessment model is established considering the loss of both fault stage and recovery stage based on Monte Carlo method and BPA software. Secondly, the comprehensive evaluation index system is proposed from the aspects of power system structure, fault state and economic loss, and the quantitative assessment of system risk is carried out by an entropy weight model. Finally, the risk assessment of two UHV planning schemes are carried out and compared, which proves the effectiveness of the research work.

Polaron effects on the dc- and ac-tunneling characteristics of molecular Josephson junctions

Science.gov (United States)

Wu, B. H.; Cao, J. C.; Timm, C.

2012-07-01

We study the interplay of polaronic effect and superconductivity in transport through molecular Josephson junctions. The tunneling rates of electrons are dominated by vibronic replicas of the superconducting gap, which show up as prominent features in the differential conductance for the dc and ac current. For relatively large molecule-lead coupling, a features that appears when the Josephson frequency matches the vibron frequency can be identified with an over-the-gap structure observed by Marchenkov [Nat. Nanotech. 1748-338710.1038/nnano.2007.2182, 481 (2007)]. However, we are more concerned with the weak-coupling limit, where resonant tunneling through the molecular level dominates. We find that certain features involving both Andreev reflection and vibron emission show an unusual shift of the bias voltage V at their maximum with the gate voltage Vg as V˜(2/3)Vg. Moreover, due to the polaronic effect, the ac Josephson current shows a phase shift of π when the bias eV is increased by one vibronic energy quantum ℏωv. This distinctive even-odd effect is explained in terms of the different sign of the coupling to vibrons of electrons and of Andreev-reflected holes.

Insulation coordination workstation for AC and DC substations

International Nuclear Information System (INIS)

Booth, R.R.; Hileman, A.R.

1990-01-01

The Insulation Coordination Workstation was designed to aid the substation design engineer in the insulation coordination process. The workstation utilizes state of the art computer technology to present a set of tools necessary for substation insulation coordination, and to support the decision making process for all aspects of insulation coordination. The workstation is currently being developed for personal computers supporting OS/2 Presentation Manager. Modern Computer-Aided Software Engineering (CASE) technology was utilized to create an easily expandable framework which currently consists of four modules, each accessing a central application database. The heart of the workstation is a library of user-friendly application programs for the calculation of important voltage stresses used for the evaluation of insulation coordination. The Oneline Diagram is a graphic interface for data entry into the EPRI distributed EMTP program, which allows the creation of complex systems on the CRT screen using simple mouse clicks and keyboard entries. Station shielding is graphically represented in the Geographic Viewport using a three-dimensional substation model, and the interactive plotting package allows plotting of EPRI EMTP output results on the CRT screen, printer, or pen plotter. The Insulation Coordination Workstation was designed by Advanced Systems Technology (AST), a division of ABB Power Systems, Inc., and sponsored by the Electric Power Research Institute under RP 2323-5, AC/DC Insulation Coordination Workstation

Instantaneous thermal modeling of the DC-link capacitor in PhotoVoltaic systems

DEFF Research Database (Denmark)

Yang, Yongheng; Ma, Ke; Wang, Huai

2015-01-01

, instantaneous thermal modeling approaches considering mission profiles for the DC-link capacitor in single-phase PV systems are explored in this paper. These thermal modelling approaches are based on: a) fast Fourier transform, b) look-up tables, and c) ripple current reconstruction. Moreover, the thermal...... grid-connected PV system have been adopted to demonstrate a look-up table based modelling approach, where real-field daily ambient conditions are considered....... modelling approaches for the DC-link capacitors take into account the instantaneous thermal characteristics, which are more challenging to the capacitor reliability during operation. Such instantaneous thermal modeling approaches enable a translation of instantaneous capacitor power losses to capacitor...

Virtual resistance-based control strategy for DC link regeneration protection and current sharing in uninterruptible power supply

DEFF Research Database (Denmark)

Lu, Jinghang; Guan, Yajuan; Savaghebi, Mehdi

2017-01-01

To address the DC link voltage regeneration issue in parallel Uninterruptible Power Supply (UPS) system, a DC link voltage protection (DCVP) method through online virtual resistance regulation is proposed. The proposed control strategy is able to protect the DC link from overvoltage that may...... trigger the protection mechanism of the UPS system. Moreover, a current sharing control strategy by regulating the virtual resistance is proposed to address the circulating current caused by the active power feeding. Finally, the feasibility of the proposed method is verified by experimental results from...

Performance evaluation of directly photovoltaic powered DC PM (direct current permanent magnet) motor – propeller thrust system

International Nuclear Information System (INIS)

Atlam, Ozcan; Kolhe, Mohan

2013-01-01

Photovoltaic (PV) powered directly coupled electro-mechanical system has wide applications (e.g. PV powered cooling fans in green houses, PV water pumping system, solar vehicles). The objective of this work is to analyse the operation of directly PV powered DC PM (direct current permanent magnet) motor – propeller system for selection of motor parameters. The performance of such system mainly depends on the incident solar radiation, operating cell temperature, DC motor and propeller load parameters. It is observed that the operating points of the PV DC PM motor – propeller system matches very closely with the maximum power points (MPPs) of the PV array, if the DC PM motor – propeller parameters have been properly selected. It is found that for a specific application of such type of system, matching of torque–speed operating points with respect to the maximum power points of PV array are very important. It is ascertained through results that the DC PM motor's armature resistance, magnetic field constant, starting current to overcome the starting torque and torque coefficient are the main parameters. In designing a PV powered DC PM motor for a specific application, selection of these parameters are important for maximum utilization of the PV array output. The results of this system are useful for designing of directly PV powered DC PM motor's for aerodynamic applications. - Highlights: • We analyse the performance of directly PV powered DC PM motor – propeller system. • We examine PV electro-mechanical system for selection of DC motor parameters. • Matching of torque–speed curve to maximum power points of PV array is important

Impacts on the Voltage Profile of DC Distribution Network with DG Access

Science.gov (United States)

Tu, J. J.; Yin, Z. D.

2017-07-01

With the development of electronic, more and more distributed generations (DGs) access into grid and cause the research fever of direct current (DC) distribution network. Considering distributed generation (DG) location and capacity have great impacts on voltage profile, so use IEEE9 and IEEE33 typical circuit as examples, with DGs access in centralized and decentralized mode, to compare voltage profile in alternating and direct current (AC/DC) distribution network. Introducing the voltage change ratio as an evaluation index, so gets the general results on voltage profile of DC distributed network with DG access. Simulation shows that, in the premise of reasonable location and capacity, DC distribution network is more suitable for DG access.

Optimal Constant DC Link Voltage Operation of aWave Energy Converter

Directory of Open Access Journals (Sweden)

Mats Leijon

2013-04-01

Full Text Available This article proposes a simple and reliable damping strategy for wave powerfarm operation of small-scale point-absorber converters. The strategy is based on passiverectification onto a constant DC-link, making it very suitable for grid integration of the farm.A complete model of the system has been developed in Matlab Simulink, and uses real sitedata as input. The optimal constant DC-voltage is evaluated as a function of the significantwave height and energy period of the waves. The total energy output of the WEC is derivedfor one year of experimental site data. The energy output is compared for two cases, onewhere the optimal DC-voltage is determined and held constant at half-hour basis throughoutthe year, and one where a selected value of the DC-voltage is kept constant throughout theyear regardless of sea state.

Innovative application of AC-voltammetry in the characterization of oxides nanolayers formed on metals, under the effect of AC-perturbations

Energy Technology Data Exchange (ETDEWEB)

Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering

2008-07-01

Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.

Electrical conductivity of polytetrafluoroethylene in dc and ac electric fields under continuous electron bombardment

International Nuclear Information System (INIS)

Khatipov, S.A.; Turdybekov, K.M.; Milinchuk, V.K.

1993-01-01

A study has been made of the time of the radiation current density in dc and ac (10 2 -5-10 3 Hz) electric fields (10 3 -5-10 5 V/cm) at temperatures from 80 to 393 K and dose rates from 5-10 3 Gy/sec, for PTFE films (50-180 μm) with various thermal prehistories, when exposed to continuous bombardment by 9-MeV electrons. It has been shown that the experimental results cannot be interpreted from the standpoint of free-charge conduction; they can be explained qualitatively within the framework of concepts of inhomogeneous ionization of the substance, due to the formation of short tracks

RHIC spin flipper AC dipole controller

Energy Technology Data Exchange (ETDEWEB)

Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

2011-03-28

The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

Analysis of Harmonics Suppression by Active Damping Control on Multi Slim DC-link Drives

DEFF Research Database (Denmark)

Yang, Feng; Máthé, Lászlo; Lu, Kaiyuan

2016-01-01

Compared with conventional dc-link drive, slim dc-link drive is expected to achieve lower cost and longer life time. However, harmonics distortion problem may occur in such drive systems. This paper proposes to use an active damping control method to suppress the harmonic distortion...... with the benefit of low cost and also low loss. A new analysis method, based on the frequency domain impedance model, is presented to explore the mechanism of harmonics suppression. Also, a general method is presented to build the impedance model of a PMSM drive system using Field Oriented Control (FOC) method....... Some design issues, including power levels, current control bandwidth and harmonic interaction, are discussed when the drive system is fed by a weak grid. Case studies on a two-drive system composed by two slim dc-link drive units are provided to verify the proposed analysis method....

IMPROVEMENT OF POWER SYSTEM QUALITY USING VSC ...

African Journals Online (AJOL)

The HVDC technology can be represented by the combination of a Direct Current (DC) circuit with two power electronics converters, each one at a link terminal, for AC/DC and DC/AC conversion The principal characteristic of VSC-HVDC transmission is its ability to independently control the reactive and real power flow at ...

A New Control Structure for Multi-Terminal dc Grids to Damp Inter-Area Oscillations

DEFF Research Database (Denmark)

Eriksson, Robert

2014-01-01

This article analyzes the control structure of the multi-terminal dc (MTDC) system to damp ac system interarea oscillations through active power modulation. A new control structure is presented that maximizes the relative controllability without the need for communication among the dc terminals....... In point-to-point high voltage dc (HVDC) transmission, the active power modulation of the two terminals occurs in opposite directions. In this case the control direction is given and only needs to be phase compensated to align for maximal damping. In the case of MTDC systems the control direction...... interrelates with the active power modulation share of the dc terminals and the relative controllability depends on this. The new control structure eliminates the need of communication between the dc terminals by performing dc voltage feedback loop shaping. This makes it possible to modulate the power in one...

Active superconducting DC fault current limiter based on flux compensation

International Nuclear Information System (INIS)

Shi Jing; Tang Yuejin; Wang, Chen; Zhou Yusheng; Li Jingdong; Ren Li; Chen Shijie

2006-01-01

With the extensive application of DC power systems, suppression of DC fault current is an important subject that guarantees system security. This paper presents an active superconducting DC fault current limiter (DC-SFCL) based on flux compensation. The DC-SFCL is composed of two superconducting windings wound on a single iron core, the primary winding is in series with DC power system, and the second winding is connected with AC power system through a PWM converter. In normal operating state, the flux in the iron core is compensated to zero, and the SFCL has no influence on DC power system. In the case of DC system accident, through regulating the active power exchange between the SFCL's second winding and the AC power system, the current on the DC side can be limited to different level complying with the system demand. Moreover, the PWM converter that interface the DC system and AC system can be controlled as a reactive power source to supply voltage support for the AC side, which has little influence on the performance of SFCL. Using MATLAB SIMULINK, the mathematic model of the DC-SFCL is created, simulation results validate the dynamics of system, and the performance of DC-SFCL is confirmed

World's longest underwater line part of new dc transmission link

Energy Technology Data Exchange (ETDEWEB)

1967-04-01

The world's seventh dc transmission system including the world's longest underwater power cable is now operative. The system, linking the Italian Mainland with Sardinia, was designed and engineered by the English Electric Co. Ltd. It will ensure a constant power supply for Sardinia and allow export of 200 MW of power to the Tuscany area in Italy. Proving test began on the link in Decmeber and continued until full demand is made on it from Italy.

Power Electronic Systems for Switched Reluctance Generator based Wind Farms and DC Networks

DEFF Research Database (Denmark)

Park, Kiwoo

enable various renewable energy sources, such as Photovoltaic (PV) and wind, to produce dc power directly. In addition, battery-based energy storage systems inherently operate with dc power. Hence, dc network (dc-grid) systems which connect these dc sources and storages directly using dc networks...... are gaining much attention again. The dc network system has a great potential to outdo the traditional ac systems in many technical challenges and could be highly profitable especially for offshore wind farm applications, where the size and weight of the components are crucial to the entire system costs......Wind power technology, as the most competitive renewable energy technology, is quickly developing. The wind turbine size is growing and the grid penetration of wind power is increasing rapidly. Recently, the developments on wind power technology pay more attentions on efficiency and reliability...

Application of Distributed DC/DC Electronics in Photovoltaic Systems

Science.gov (United States)

Kabala, Michael

In a typical residential, commercial or utility grade photovoltaic (PV) system, PV modules are connected in series and in parallel to form an array that is connected to a standard DC/AC inverter, which is then connected directly to the grid. This type of standard installation; however, does very little to maximize the energy output of the solar array if certain conditions exist. These conditions could include age, temperature, irradiance and other factors that can cause mismatch between PV modules in an array that severely cripple the output power of the system. Since PV modules are typically connected in series to form a string, the output of the entire string is limited by the efficiency of the weakest module. With PV module efficiencies already relatively low, it is critical to extract the maximum power out of each module in order to make solar energy an economically viable competitor to oil and gas. Module level DC/DC electronics with maximum power point (MPP) tracking solves this issue by decoupling each module from the string in order for the module to operate independently of the geometry and complexity of the surrounding system. This allows each PV module to work at its maximum power point by transferring the maximum power the module is able to deliver directly to the load by either boosting (stepping up) the voltage or bucking (stepping down) the voltage. The goal of this thesis is to discuss the development of a per-module DC/DC converter in order to maximize the energy output of a PV module and reduce the overall cost of the system by increasing the energy harvest.

Design of Neutral-Point Voltage Controller of a Three-level NPC Inverter with Small DC-Link Capacitors

DEFF Research Database (Denmark)

Maheshwari, Ram Krishan; Munk-Nielsen, Stig; Busquets-Monge, S.

2013-01-01

A Neutral-Point-Clamped (NPC) three-level inverter with small dc-link capacitors is presented in this paper. The inverter requires zero average neutral-point current for stable neutral-point voltage. The small dc-link capacitors may not maintain capacitor voltage balance, even with zero neutral......-point voltage control on the basis of the continuous model. The design method for optimum performance is discussed. The implementation of the proposed modulation strategy and the controller is very simple. The controller is implemented in a 7.5 kW induction machine based drive with only 14 ìF dc-link capacitors...

Nonlinear control techniques of a controllable rectifier/inverter-motor drive system with a small dc-link capacitor

International Nuclear Information System (INIS)

Liutanakul, Pisit; Pierfederici, Serge; Meibody-Tabar, Farid

2008-01-01

The necessity of the converters compactness in many applications imposes the reduction of their different components size when it is possible. In this paper, a control method allowing the use of a small size dc-link capacitor for the cascade of voltage controlled-rectifier/inverter-motor drive system is proposed. This is achieved by adding the power balance equation in the system's model and the application of an exact input/output feedback linearization technique in a way that the rectifier controller compensates any sudden change in the inverter load, which is here an induction motor. Since the exact input/output feedback linearization technique is sensitive to the uncertainties over system parameters, a robust control strategy based on sliding mode controller is proposed. By this approach, the dc-link voltage becomes almost insensitive to the load variations. As a result, the level of the dc-link voltage could be stabilized with a small size dc-link capacitor. Without any considerations of the RMS current stress on this dc-link capacitor, a calculation method of a minimum value of this capacitor based on its storage energy is proposed. All the investigations are shown by computer simulations and the performance of controlled system is verified by experimentation results

Methods, systems and apparatus for controlling operation of two alternating current (AC) machines

Science.gov (United States)

Gallegos-Lopez, Gabriel [Torrance, CA; Nagashima, James M [Cerritos, CA; Perisic, Milun [Torrance, CA; Hiti, Silva [Redondo Beach, CA

2012-02-14

A system is provided for controlling two AC machines. The system comprises a DC input voltage source that provides a DC input voltage, a voltage boost command control module (VBCCM), a five-phase PWM inverter module coupled to the two AC machines, and a boost converter coupled to the inverter module and the DC input voltage source. The boost converter is designed to supply a new DC input voltage to the inverter module having a value that is greater than or equal to a value of the DC input voltage. The VBCCM generates a boost command signal (BCS) based on modulation indexes from the two AC machines. The BCS controls the boost converter such that the boost converter generates the new DC input voltage in response to the BCS. When the two AC machines require additional voltage that exceeds the DC input voltage required to meet a combined target mechanical power required by the two AC machines, the BCS controls the boost converter to drive the new DC input voltage generated by the boost converter to a value greater than the DC input voltage.

DC grid for home applications

Science.gov (United States)

Elangovan, D.; Archana, R.; Jayadeep, V. J.; Nithin, M.; Arunkumar, G.

2017-11-01

More than fifty percent Indian population do not have access to electricity in daily lives. The distance between the power generating stations and the distribution centers forms one of the main reasons for lack of electrification in rural and remote areas. Here lies the importance of decentralization of power generation through renewable energy resources. In the present world, electricity is predominantly powered by alternating current, but most day to day devices like LED lamps, computers and electrical vehicles, all run on DC power. By directly supplying DC to these loads, the number of power conversion stages was reduced, and overall system efficiency increases. Replacing existing AC network with DC is a humongous task, but with power electronic techniques, this project intends to implement DC grid at a household level in remote and rural areas. Proposed work was designed and simulated successfully for various loads amounting to 250 W through appropriate power electronic convertors. Maximum utilization of the renewable sources for domestic and commercial application was achieved with the proposed DC topology.

Atmel Microcontroller Based Soft Switched PWM ZVS Full Bridge DC to DC Converter

Directory of Open Access Journals (Sweden)

DEEPAK KUMAR NAYAK

2010-12-01

Full Text Available This paper deals with the simulation and implementation of soft switched PWM ZVS full bridge DC to DC converter. The 48V DC is efficiently reduced to 12V DC using a DC to DC converter. This converter has advantages like reduced switching losses, stresses and EMI. Input DC is converted into high frequency AC and it is stepped down to 12V level. Later it is rectified using a full wave rectifier. Laboratory model of microcontroller based DC to DC converter is fabricated and tested. The experimental results are compared with the simulation results.

Theoretical Analysis of the Relative Significance of Thermodynamic and Kinetic Dispersion in the dc and ac Voltammetry of Surface-Confined Molecules

KAUST Repository

Morris, Graham P.; Baker, Ruth E.; Gillow, Kathryn; Davis, Jason J.; Gavaghan, David J.; Bond, Alan M.

2015-01-01

© 2015 American Chemical Society. Commonly, significant discrepancies are reported in theoretical and experimental comparisons of dc voltammograms derived from a monolayer or close to monolayer coverage of redox-active surface-confined molecules. For example, broader-than-predicted voltammetric wave shapes are attributed to the thermodynamic or kinetic dispersion derived from distributions in reversible potentials (E⁰) and electrode kinetics (k⁰), respectively. The recent availability of experimentally estimated distributions of E⁰ and k⁰ values derived from the analysis of data for small numbers of surface-confined modified azurin metalloprotein molecules now allows more realistic modeling to be undertaken, assuming the same distributions apply under conditions of high surface coverage relevant to voltammetric experiments. In this work, modeling based on conventional and stochastic kinetic theory is considered, and the computationally far more efficient conventional model is shown to be equivalent to the stochastic one when large numbers of molecules are present. Perhaps unexpectedly, when experimentally determined distributions of E⁰ and k⁰ are input into the model, thermodynamic dispersion is found to be unimportant and only kinetic dispersion contributes significantly to the broadening of dc voltammograms. Simulations of ac voltammetric experiments lead to the conclusion that the ac method, particularly when the analysis of kinetically very sensitive higher-order harmonics is undertaken, are far more sensitive to kinetic dispersion than the dc method. ac methods are therefore concluded to provide a potentially superior strategy for addressing the inverse problem of determining the k⁰ distribution that could give rise to the apparent anomalies in surface-confined voltammetry.

Theoretical Analysis of the Relative Significance of Thermodynamic and Kinetic Dispersion in the dc and ac Voltammetry of Surface-Confined Molecules

KAUST Repository

Morris, Graham P.

2015-05-05

© 2015 American Chemical Society. Commonly, significant discrepancies are reported in theoretical and experimental comparisons of dc voltammograms derived from a monolayer or close to monolayer coverage of redox-active surface-confined molecules. For example, broader-than-predicted voltammetric wave shapes are attributed to the thermodynamic or kinetic dispersion derived from distributions in reversible potentials (E⁰) and electrode kinetics (k⁰), respectively. The recent availability of experimentally estimated distributions of E⁰ and k⁰ values derived from the analysis of data for small numbers of surface-confined modified azurin metalloprotein molecules now allows more realistic modeling to be undertaken, assuming the same distributions apply under conditions of high surface coverage relevant to voltammetric experiments. In this work, modeling based on conventional and stochastic kinetic theory is considered, and the computationally far more efficient conventional model is shown to be equivalent to the stochastic one when large numbers of molecules are present. Perhaps unexpectedly, when experimentally determined distributions of E⁰ and k⁰ are input into the model, thermodynamic dispersion is found to be unimportant and only kinetic dispersion contributes significantly to the broadening of dc voltammograms. Simulations of ac voltammetric experiments lead to the conclusion that the ac method, particularly when the analysis of kinetically very sensitive higher-order harmonics is undertaken, are far more sensitive to kinetic dispersion than the dc method. ac methods are therefore concluded to provide a potentially superior strategy for addressing the inverse problem of determining the k⁰ distribution that could give rise to the apparent anomalies in surface-confined voltammetry.

Reliability of hybrid photovoltaic DC micro-grid systems for emergency shelters and other applications

Science.gov (United States)

Dhere, Neelkanth G.; Schleith, Susan

2014-10-01

Improvement of energy efficiency in the SunSmart Schools Emergency Shelters requires new methods for optimizing the energy consumption within the shelters. One major limitation in current systems is the requirement of converting direct current (DC) power generated from the PV array into alternating current (AC) power which is distributed throughout the shelters. Oftentimes, this AC power is then converted back to DC to run certain appliances throughout the shelters resulting in a significant waste of energy due to DC to AC and then again AC to DC conversion. This paper seeks to extract the maximum value out of PV systems by directly powering essential load components within the shelters that already run on DC power without the use of an inverter and above all to make the system reliable and durable. Furthermore, additional DC applications such as LED lighting, televisions, computers and fans operated with DC brushless motors will be installed as replacements to traditional devices in order to improve efficiency and reduce energy consumption. Cost of energy storage technologies continue to decline as new technologies scale up and new incentives are put in place. This will provide a cost effective way to stabilize the energy generation of a PV system as well as to provide continuous energy during night hours. It is planned to develop a pilot program of an integrated system that can provide uninterrupted DC power to essential base load appliances (heating, cooling, lighting, etc.) at the Florida Solar Energy Center (FSEC) command center for disaster management. PV arrays are proposed to be installed on energy efficient test houses at FSEC as well as at private homes having PV arrays where the owners volunteer to participate in the program. It is also planned to monitor the performance of the PV arrays and functioning of the appliances with the aim to improve their reliability and durability. After a successful demonstration of the hybrid DC microgrid based emergency

75 FR 38017 - Airworthiness Directives; McDonnell Douglas Corporation Model DC-9-10 Series Airplanes, DC-9-30...

Science.gov (United States)

2010-07-01

... Airworthiness Directives; McDonnell Douglas Corporation Model DC- 9-10 Series Airplanes, DC-9-30 Series... previously to all known U.S. owners and operators of the McDonnell Douglas Corporation airplanes identified... INFORMATION: On July 15, 2009, we issued AD 2009-15-16, which applies to all McDonnell Douglas Model DC-9-10...

Research on Two-channel Interleaved Two-stage Paralleled Buck DC-DC Converter for Plasma Cutting Power Supply

DEFF Research Database (Denmark)

Yang, Xi-jun; Qu, Hao; Yao, Chen

2014-01-01

As for high power plasma power supply, due to high efficiency and flexibility, multi-channel interleaved multi-stage paralleled Buck DC-DC Converter becomes the first choice. In the paper, two-channel interleaved two- stage paralleled Buck DC-DC Converter powered by three-phase AC power supply...

Autonomous Control of Interlinking Converter With Energy Storage in Hybrid AC–DC Microgrid

DEFF Research Database (Denmark)

Loh, Poh Chiang; Li, Ding; Chai, Yi Kang

2013-01-01

, simplicity, and industry relevance of the converter. The desired operating features of the hybrid microgrid can then be added through this interlinking converter. To demonstrate, an appropriate control scheme is now developed for controlling the interlinking converter. The objective is to keep the hybrid......The coexistence of ac and dc subgrids in a hybrid microgrid is likely given that modern distributed sources can either be ac or dc. Linking these subgrids is a power converter, whose topology should preferably be not too unconventional. This is to avoid unnecessary compromises to reliability...... microgrid in autonomous operation with active power proportionally shared among its distributed sources. Power sharing here should depend only on the source ratings and not their placements within the hybrid microgrid. The proposed scheme can also be extended to include energy storage within...

Family of multiport bidirectional DC-DC converters

NARCIS (Netherlands)

Tao, H.; Kotsopoulos, A.; Duarte, J.L.; Hendrix, M.A.M.

2006-01-01

Multiport DC-DC converters are of potential interest in applications such as generation systems utilising multiple sustainable energy sources. A family of multiport bidirectional DC-DC converters derived from a general topology is presented. The topology shows a combination of DC-link and magnetic

Direct switching control of DC-DC power electronic converters using hybrid system theory

Energy Technology Data Exchange (ETDEWEB)

Zhao, J.; Lin, F. [Wayne State Univ., Detroit, MI (United States). Dept. of Electrical and Computer Engineering; Wang, C. [Wayne State Univ., Detroit, MI (United States). Dept. of Electrical and Computer Engineering; Wayne State Univ., Detroit, MI (United States). Div. of Engineering Technology

2010-07-01

A direct switching control (DSC) scheme for power electronics converters was described. The system was designed for use in both traditional and renewable energy applications as well as in electric drive vehicles. The proposed control scheme was based on a detailed hybrid system converter model that used model predictive control (MPC), piecewise affine (PWA) approximations and constrained optimal control methods. A DC-DC converter was modelled as a hybrid machine. Switching among different modes of the DC-DC converter were modelled as discrete events controlled by the hybrid controller. The modelling scheme was applied to a Buck converter. The DSC was used to control the switch of the power converter based on a hybrid machine model. Results of the study showed that the method can be used to regulate output voltage and inductor currents. The method also provides fast transient responses and effectively regulates both currents and voltage. The controller can be used to provide immediate responses to dynamic disturbances and output voltage fluctuations. 23 refs., 7 figs.

DC-Link Voltage Coordinated-Proportional Control for Cascaded Converter With Zero Steady-State Error and Reduced System Type

DEFF Research Database (Denmark)

Tian, Yanjun; Loh, Poh Chiang; Deng, Fujin

2016-01-01

Cascaded converter is formed by connecting two subconverters together, sharing a common intermediate dc-link voltage. Regulation of this dc-link voltage is frequently realized with a proportional-integral (PI) controller, whose high gain at dc helps to force a zero steady-state tracking error....... The proposed scheme can be used with either unidirectional or bidirectional power flow, and has been verified by simulation and experimental results presented in this paper........ Such precise tracking is, however, at the expense of increasing the system type, caused by the extra pole at the origin introduced by the PI controller. The overall system may, hence, be tougher to control. To reduce the system type while preserving precise dc-link voltage tracking, this paper proposes...

An Improved Control Strategy of Limiting the DC-Link Voltage Fluctuation for a Doubly Fed Induction Wind Generator

DEFF Research Database (Denmark)

Yao, J.; Li, H.; Liao, Y.

2008-01-01

The paper presents to develop a new control strategy of limiting the dc-link voltage fluctuation for a back-to-back pulsewidth modulation converter in a doubly fed induction generator (DFIG) for wind turbine systems. The reasons of dc-link voltage fluctuation are analyzed. An improved control...... strategy with the instantaneous rotor power feedback is proposed to limit the fluctuation range of the dc-link voltage. An experimental rig is set up to valid the proposed strategy, and the dynamic performances of the DFIG are compared with the traditional control method under a constant grid voltage....... Furthermore, the capabilities of keeping the dc-link voltage stable are also compared in the ride-through control of DFIG during a three-phase grid fault, by using a developed 2 MW DFIG wind power system model. Both the experimental and simulation results have shown that the proposed control strategy is more...

Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

Energy Technology Data Exchange (ETDEWEB)

Ljusev, P.; Andersen, Michael A.E.

2005-07-01

This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

Effect of applied DC electric fields in flame spread over polyethylene-coated electrical wire

KAUST Repository

Jin, Young Kyu

2011-03-01

We experimentally investigated the effect of applied DC electric fields on the flame spread over polyethylene-coated electrical wire. The flame-spread rates over electrical wire with negative and positive DC electric fields from 0 to ±7 kV were measured and analyzed. We compared the results for DC electric fields with previous results for AC electric fields. We explored whether or not various flame shapes could be obtained with DC electric fields and the main reason for the flame-spread acceleration, particularly at the end of the electrical wire, for AC electric fields. We found that DC electric fields do not significantly affect the flame-spread rates. However, the flame shape is mildly altered by the ionic wind effect even for DC electric fields. The flame-spread rate is relevant to the flame shape and the slanted direction in spite of the mild impact. A possible explanation for the flame spread is given by a thermal-balance mechanism and fuel-vapor jet. © 2011 The Korean Society of Mechanical Engineers.

A Comparison of Alternating Current and Direct Current Electrospray Ionization for Mass Spectrometry

Science.gov (United States)

Sarver, Scott A.; Chetwani, Nishant; Dovichi, Norman J.; Go, David B.; Gartner, Carlos A.

2014-04-01

A series of studies comparing the performance of alternating current electrospray ionization (AC ESI) mass spectrometry (MS) and direct current electrospray ionization (DC ESI) MS have been conducted, exploring the absolute signal intensity and signal-to-background ratios produced by both methods using caffeine and a model peptide as targets. Because the high-voltage AC signal was more susceptible to generating gas discharges, the operating voltage range of AC ESI was significantly smaller than that for DC ESI, such that the absolute signal intensities produced by DC ESI at peak voltages were one to two orders of magnitude greater than those for AC ESI. Using an electronegative nebulizing gas, sulfur hexafluoride (SF6), instead of nitrogen (N2) increased the operating range of AC ESI by ~50 %, but did not appreciably improve signal intensities. While DC ESI generated far greater signal intensities, both ionization methods produced comparable signal-to-background noise, with AC ESI spectra appearing qualitatively cleaner. A quantitative calibration analysis was performed for two analytes, caffeine and the peptide MRFA. AC ESI utilizing SF6 outperforms all other techniques for the detection of MRFA, producing chromatographic limits of detection nearly one order of magnitude lower than that of DC ESI utilizing N2, and one-half that of DC ESI utilizing SF6. However, DC ESI outperforms AC ESI for the analysis of caffeine, indicating that improvements in spectral quality may benefit certain compounds or classes of compounds, on an individual basis.

Modelling and control of three-phase grid-connected power supply with small DC-link capacitor for electrolysers

DEFF Research Database (Denmark)

Török, Lajos; Máthé, Lászlo; Nielsen, Carsten Karup

2016-01-01

These days electrolyzers are becoming more and more interesting due to the high demand for energy storage in form of hydrogen for renewable power generation using fuel cells. The design of a power supply for such a system is complex especially when the DC-link capacitance is reduced....... By substituting the complex switching model of the power supply with a simplified one, the system dynamics can be better observed. The resonances caused by the small DC link capacitor and grid side inductance can be easier analyzed. A feed forward compensation method is proposed based on the simplified model......-forward compensation signal is created, canceling in such a way the resonance introduced by the grid inductance and the DC-link capacitor from the feed-forward loop. The theoretical work has been validated through experiments on a 5 kW DC power supply used for electrolyser application....

Ripple Field AC Losses in 10-MW Wind Turbine Generators With a MgB2 Superconducting Field Winding

DEFF Research Database (Denmark)

Liu, Dong; Polinder, Henk; Magnusson, Niklas

2016-01-01

Superconducting (SC) synchronous generators are proposed as a promising candidate for 10-20-MW direct-drive wind turbines because they can have low weights and small sizes. A common way of designing an SC machine is to use SC wires with high current-carrying capability in the dc field winding...... and the ac armature winding is made with copper conductors. In such generators, the dc field winding is exposed to ac magnetic field ripples due to space harmonics from the armature. In generator design phases, the ac loss caused by these ripple fields needs to be evaluated to avoid local overheating...... and an excessive cooling budget. To determine the applicability of different design solutions in terms of ac losses, this paper estimates the ac loss level of 10-MW wind generator designs employing a MgB2 SC field winding. The effects on ac losses are compared between nonmagnetic and ferromagnetic teeth...

THERMIONIC AC GENERATION

Science.gov (United States)

is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)

Performance evaluation of a DC-AC inverter controlled with ZAD-FPIC

Directory of Open Access Journals (Sweden)

Fredy Edimer Hoyos Velasco

2018-01-01

Full Text Available Introduction: Power converters are used in microgrids to transfer power to the load with a regulated voltage. However, the DC-AC converters present distortions in the waveform that can be improved with the help of real-time controllers. Objective: Evaluate the response in alternating current of the buck converter controlled using ZAD-FPIC technique. Methodology: Based on the differential equations that describe the buck power converter, the ZAD and FPIC controllers are designed, simulations of the complete controlled system are made in Simulink of MATLAB, the system is implemented experimentally, and the controller is executed in real-time with the help of a DS1104 from dSPACE. In the end, several tests are carried out to check the effectiveness of the controller. Results: The results show that the controller allows good stability against different variations in the system and in the load. Conclusions: The ZAD-FPIC technique controls the variable and tracks changes in the waveform, magnitude, and frequency of the reference signal. The controller presents good stability to different tests, tracking the reference signal after each event.

A New Control Method for a Bi-Directional Phase-Shift-Controlled DC-DC Converter with an Extended Load Range

Directory of Open Access Journals (Sweden)

Wenzheng Xu

2017-10-01

Full Text Available Phase-shifted converters are practically important to provide high conversion efficiencies through soft-switching techniques. However, the limitation on a resonant inductor current in the converters often leads to a non-fulfillment of the requirement of minimum load current. This paper presents a new power electronics control technique to enable the dual features of bi-directional power flow and an extended load range for soft-switching in phase-shift-controlled DC-DC converters. The proposed technique utilizes two identical full bridge converters and inverters in conjunction with a new control logic for gate-driving signals to facilitate both Zero Current Switching (ZCS and Zero Voltage Switching (ZVS in a single phase-shift-controlled DC-DC converter. The additional ZCS is designed for light load conditions at which the minimum load current cannot be attained. The bi-directional phase-shift-controlled DC-DC converter can implement the function of synchronous rectification. Its fast dynamic response allows for quick energy recovery during the regenerative braking of traction systems in electrified trains.

Gene delivery by microfluidic flow-through electroporation based on constant DC and AC field.

Science.gov (United States)

Geng, Tao; Zhan, Yihong; Lu, Chang

2012-01-01

Electroporation is one of the most widely used physical methods to deliver exogenous nucleic acids into cells with high efficiency and low toxicity. Conventional electroporation systems typically require expensive pulse generators to provide short electrical pulses at high voltage. In this work, we demonstrate a flow-through electroporation method for continuous transfection of cells based on disposable chips, a syringe pump, and a low-cost power supply that provides a constant voltage. We successfully transfect cells using either DC or AC voltage with high flow rates (ranging from 40 µl/min to 20 ml/min) and high efficiency (up to 75%). We also enable the entire cell membrane to be uniformly permeabilized and dramatically improve gene delivery by inducing complex migrations of cells during the flow.

Capacitance estimation algorithm based on DC-link voltage harmonics using artificial neural network in three-phase motor drive systems

DEFF Research Database (Denmark)

Soliman, Hammam Abdelaal Hammam; Davari, Pooya; Wang, Huai

2017-01-01

to industry. In this digest, a condition monitoring methodology that estimates the capacitance value of the dc-link capacitor in a three phase Front-End diode bridge motor drive is proposed. The proposed software methodology is based on Artificial Neural Network (ANN) algorithm. The harmonics of the dc......-link voltage are used as training data to the Artificial Neural Network. Fast Fourier Transform (FFT) of the dc-link voltage is analysed in order to study the impact of capacitance variation on the harmonics order. Laboratory experiments are conducted to validate the proposed methodology and the error analysis......In modern design of power electronic converters, reliability of dc-link capacitors is one of the critical considered aspects. The industrial field have been attracted to the monitoring of their health condition and the estimation of their ageing process status. However, the existing condition...

Investigation into the Control Methods to Reduce the DC-Link Capacitor Ripple Current in a Back-to-Back Converter

DEFF Research Database (Denmark)

Qin, Zian; Wang, Huai; Blaabjerg, Frede

2014-01-01

Three-phase back-to-back converters have a wide range of applications (e.g. wind turbines) in which the reliability and cost-effectiveness are of great concern. Among other components and interconnections, DC-link capacitors are one of the weak links influenced by environmental stresses (e.......g. ambient temperature, humidity, etc.) and operating stresses (e.g. voltage, ripple current). This paper serves to investigate the ways of reducing ripple current stresses of DC-link capacitors in back-toback converters. The outcome could benefit to achieve either an extended lifetime for a designed DC...

Synchronverter-Enabled DC Power Sharing Approach for LVDC Microgrids

DEFF Research Database (Denmark)

Peyghami, Saeed; Davari, Pooya; Mokhtari, Hossein

2017-01-01

by introducing a small ac voltage superimposed onto the output dc voltage of converters. Therefore, dc sources can be coordinated together with the frequency of the ac voltage, without any communication network like Synchronous Generators (SGs) in conventional power systems. Small signal stability analysis......In a classical ac Micro-Grid (MG), a common frequency exists for coordinating active power sharing among droop-controlled sources. Like the frequency droop method, a voltage based droop approach has been employed to control the converters in dc MGs. However, voltage variation due to the droop gains...... and line resistances causes poor power sharing and voltage regulation in dc MG, which in most cases are solved by a secondary controller using a communication network. To avoid such an infrastructure and its accompanied complications, this paper proposes a new droop scheme to control dc sources...

Effects of DC bias on magnetic performance of high grades grain-oriented silicon steels

Energy Technology Data Exchange (ETDEWEB)

Ma, Guang; Cheng, Ling [Global Energy Interconnection Research Institute, State Key Laboratory of Advanced Transmission Technology,Beijing 102211 (China); Lu, Licheng [State Grid Corporation of China, Beijing 100031 (China); Yang, Fuyao; Chen, Xin [Global Energy Interconnection Research Institute, State Key Laboratory of Advanced Transmission Technology,Beijing 102211 (China); Zhu, Chengzhi [State Grid Zhejiang Electric Power Company, Hangzhou 310007 (China)

2017-03-15

When high voltage direct current (HVDC) transmission adopting mono-polar ground return operation mode or unbalanced bipolar operation mode, the invasion of DC current into neutral point of alternating current (AC) transformer will cause core saturation, temperature increasing, and vibration acceleration. Based on the MPG-200D soft magnetic measurement system, the influence of DC bias on magnetic performance of 0.23 mm and 0.27 mm series (P{sub 1.7}=0.70–1.05 W/kg, B{sub 8}>1.89 T) grain-oriented (GO) silicon steels under condition of AC / DC hybrid excitation were systematically realized in this paper. For the high magnetic induction GO steels (core losses are the same), greater thickness can lead to stronger ability of resisting DC bias, and the reasons for it were analyzed. Finally, the magnetostriction and A-weighted magnetostriction velocity level of GO steel under DC biased magnetization were researched. - Highlights: • Magnetic properties of 0.23 mm and 0.27 mm series (P{sub 1.7}=0.70–1.05 W/kg, B{sub 8}>1.89 T) grain-oriented (GO) silicon steels under condition of AC / DC hybrid excitation were systematically analyzed. • Influence of DC biased magnetization on core loss, magnetostriction, and A-weighted magnetostriction velocity level of GO steel were researched. • Greater thickness and relatively lower magnetic induction (B{sub 8}>1.89 T yet) of GO steel can lead to stronger ability of resisting DC bias, and the reasons for it were analyzed.

SQUIDs De-fluxing Using a Decaying AC Magnetic Field

Energy Technology Data Exchange (ETDEWEB)

Matlashov, Andrei Nikolaevich [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Semenov, Vasili Kirilovich [State Univ. of New York (SUNY), Plattsburgh, NY (United States); Anderson, Bill [Senior Scientific, LLC, Albuquerque, NM (United States)

2016-06-08

Flux trapping is the Achilles’ heel of all superconductor electronics. The most direct way to avoid flux trapping is a prevention of superconductor circuits from exposure to magnetic fields. Unfortunately this is not feasible if the circuits must be exposed to a strong DC magnetic field even for a short period of time. For example, such unavoidable exposures take place in superparamagnetic relaxation measurements (SPMR) and ultra-low field magnetic resonance imaging (ULF MRI) using unshielded thin-film SQUID-based gradiometers. Unshielded SQUIDs stop working after being exposed to DC magnetic fields of only a few Gauss in strength. In this paper we present experimental results with de-fluxing of planar thin-film LTS SQUID-based gradiometers using a strong decaying AC magnetic field. We used four commercial G136 gradiometers for SPMR measurements with up to a 10 mT magnetizing field. Strong 12.9 kHz decaying magnetic field pulses reliably return SQUIDs to normal operation 50 ms after zeroing the DC magnetizing field. This new AC de-fluxing method was also successfully tested with seven other different types of LTS SQUID sensors and has been shown to dissipate extremely low energy.

Method and system for a gas tube switch-based voltage source high voltage direct current transmission system

Science.gov (United States)

She, Xu; Chokhawala, Rahul Shantilal; Zhou, Rui; Zhang, Di; Sommerer, Timothy John; Bray, James William

2016-12-13

A voltage source converter based high-voltage direct-current (HVDC) transmission system includes a voltage source converter (VSC)-based power converter channel. The VSC-based power converter channel includes an AC-DC converter and a DC-AC inverter electrically coupled to the AC-DC converter. The AC-DC converter and a DC-AC inverter include at least one gas tube switching device coupled in electrical anti-parallel with a respective gas tube diode. The VSC-based power converter channel includes a commutating circuit communicatively coupled to one or more of the at least one gas tube switching devices. The commutating circuit is configured to "switch on" a respective one of the one or more gas tube switching devices during a first portion of an operational cycle and "switch off" the respective one of the one or more gas tube switching devices during a second portion of the operational cycle.

Gas tube-switched high voltage DC power converter

Science.gov (United States)

She, Xu; Bray, James William; Sommerer, Timothy John; Chokhawala, Rahul

2018-05-15

A direct current (DC)-DC converter includes a transformer and a gas tube-switched inverter circuit. The transformer includes a primary winding and a secondary winding. The gas tube-switched inverter circuit includes first and second inverter load terminals and first and second inverter input terminals. The first and second inverter load terminals are coupled to the primary winding. The first and second inverter input terminals are couplable to a DC node. The gas tube-switched inverter circuit further includes a plurality of gas tube switches respectively coupled between the first and second inverter load terminals and the first and second inverter input terminals. The plurality of gas tube switches is configured to operate to generate an alternating current (AC) voltage at the primary winding.

Nucleation behavior of melted Bi films at cooling rates from 101 to 104 K/s studied by combining scanning AC and DC nano-calorimetry techniques

International Nuclear Information System (INIS)

Xiao, Kechao; Vlassak, Joost J.

2015-01-01

Highlights: • We proposed a general data reduction scheme that combines scanning AC and DC calorimetry results for the study of reaction kinetics. • Calorimetry measurements at cooling rates ranging from 30 K/s to 20,000 K/s were achieved. • Upon initial melting, the Bi thin-film sample breaks up into thousands of isolated islands, and highly repeatable nucleation behavior is observed. • The nucleation rate of melted Bi is calculated, which can be well described by classical nucleation theory over a wide range of cooling rates. - Abstract: We study the nucleation behavior of undercooled liquid Bi at cooling rates ranging from 10 1 to 10 4 K/s using a combination of scanning DC and AC nano-calorimetry techniques. Upon initial melting, the Bi thin-film sample breaks up into silicon nitride-coated isolated islands. The number of islands in a typical sample is sufficiently large that highly repeatable nucleation behavior is observed, despite the stochastic nature of the nucleation process. We establish a data reduction technique to evaluate the nucleation rate from DC and AC calorimetry results. The results show that the driving force for the nucleation of melted Bi is well described by classical nucleation theory over a wide range of cooling rates. The proposed technique provides a unique and efficient way to examine nucleation kinetics with cooling rates over several orders of magnitude. The technique is quite general and can be used to evaluate reaction kinetics in other materials

An AC modulated near infrared gain calibration system for a "Violin-Mode" transimpedance amplifier, intended for advanced LIGO suspensions

Science.gov (United States)

Lockerbie, N. A.; Tokmakov, K. V.

2016-07-01

The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a "tall-thin" rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse "Violin-Mode" vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor's DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor's more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz-300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m-1 was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC/DC transimpedance gain ratio

An AC modulated near infrared gain calibration system for a "Violin-Mode" transimpedance amplifier, intended for advanced LIGO suspensions.

Science.gov (United States)

Lockerbie, N A; Tokmakov, K V

2016-07-01

The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a "tall-thin" rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse "Violin-Mode" vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor's DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor's more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz-300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m(-1) was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC/DC transimpedance gain

Dedicated algorithm and software for the integrated analysis of AC and DC electrical outputs of piezoelectric vibration energy harvesters

Energy Technology Data Exchange (ETDEWEB)

Kim, Jae Eum [Catholic University of Daegu, Gyeongsan (Korea, Republic of)

2014-10-15

DC electrical outputs of a piezoelectric vibration energy harvester by nonlinear rectifying circuitry can hardly be obtained either by any mathematical models developed so far or by finite element analysis. To address the issue, this work used an equivalent electrical circuit model and newly developed an algorithm to efficiently identify relevant circuit parameters of arbitrarily-shaped cantilevered piezoelectric energy harvesters. The developed algorithm was then realized as a dedicated software module by adopting ANSYS finite element analysis software for the parameters identification and the Tcl/Tk programming language for a graphical user interface and linkage with ANSYS. For verifications, various AC electrical outputs by the developed software were compared with those by traditional finite element analysis. DC electrical outputs through rectifying circuitry were also examined for varying values of the smoothing capacitance and load resistance.

Dedicated algorithm and software for the integrated analysis of AC and DC electrical outputs of piezoelectric vibration energy harvesters

International Nuclear Information System (INIS)

Kim, Jae Eum

2014-01-01

DC electrical outputs of a piezoelectric vibration energy harvester by nonlinear rectifying circuitry can hardly be obtained either by any mathematical models developed so far or by finite element analysis. To address the issue, this work used an equivalent electrical circuit model and newly developed an algorithm to efficiently identify relevant circuit parameters of arbitrarily-shaped cantilevered piezoelectric energy harvesters. The developed algorithm was then realized as a dedicated software module by adopting ANSYS finite element analysis software for the parameters identification and the Tcl/Tk programming language for a graphical user interface and linkage with ANSYS. For verifications, various AC electrical outputs by the developed software were compared with those by traditional finite element analysis. DC electrical outputs through rectifying circuitry were also examined for varying values of the smoothing capacitance and load resistance.

Direct amplitude detuning measurement with ac dipole

Directory of Open Access Journals (Sweden)

S. White

2013-07-01

Full Text Available In circular machines, nonlinear dynamics can impact parameters such as beam lifetime and could result in limitations on the performance reach of the accelerator. Assessing and understanding these effects in experiments is essential to confirm the accuracy of the magnetic model and improve the machine performance. A direct measurement of the machine nonlinearities can be obtained by characterizing the dependency of the tune as a function of the amplitude of oscillations (usually defined as amplitude detuning. The conventional technique is to excite the beam to large amplitudes with a single kick and derive the tune from turn-by-turn data acquired with beam position monitors. Although this provides a very precise tune measurement it has the significant disadvantage of being destructive. An alternative, nondestructive way of exciting large amplitude oscillations is to use an ac dipole. The perturbation Hamiltonian in the presence of an ac dipole excitation shows a distinct behavior compared to the free oscillations which should be correctly taken into account in the interpretation of experimental data. The use of an ac dipole for direct amplitude detuning measurement requires careful data processing allowing one to observe the natural tune of the machine; the feasibility of such a measurement is demonstrated using experimental data from the Large Hadron Collider. An experimental proof of the theoretical derivations based on measurements performed at injection energy is provided as well as an application of this technique at top energy using a large number of excitations on the same beam.

Robust method for stator current reconstruction from DC link in a ...

African Journals Online (AJOL)

Using the switching signals and dc link current, this paper presents a new algorithm for the reconstruction of stator currents of an inverter-fed, three-phase induction motor drive. Unlike the classical and improved methods available in literature, the proposed method is neither based on pulse width modulation pattern ...

Active damping technique for small DC-link capacitor based drive system

DEFF Research Database (Denmark)

Maheshwari, Ram Krishan; Munk-Nielsen, Stig; Henriksen, Bjarne

2010-01-01

A detailed model of Adjustable Speed Drive (ASD) is discussed, which yield a general rule for active damping in a small DC link based drive. A desired value of input LC resonance damping coefficient can be achieved by changing gain parameters. The modified state space matrix due to active damping...

DC-bus voltage control of grid-connected voltage source converter by using space vector modulated direct power control under unbalanced network conditions

DEFF Research Database (Denmark)

Xiao, Lei; Huang, Shoudao; Lu, Kaiyuan

2013-01-01

Unbalanced grid voltage will cause large dc-bus voltage ripple and introduce high harmonic current components on the grid side. This will severely threaten the safety of the grid-connected voltage source converter (VSC) and consequently, affect the healthy operation condition of the load. In this......Unbalanced grid voltage will cause large dc-bus voltage ripple and introduce high harmonic current components on the grid side. This will severely threaten the safety of the grid-connected voltage source converter (VSC) and consequently, affect the healthy operation condition of the load....... In this study, a new proportional-integral-resonant (PI-RES) controller-based, space vector modulated direct power control topology is proposed to suppress the dc-bus voltage ripple and in the same time, controlling effectively the instantaneous power of the VSC. A special ac reactive power reference component...... is introduced in the controller, which is necessary in order to reduce the dc-bus voltage ripple and active power harmonics at the same time. The proposed control topology is implemented in the lab. Simulation and experimental results are provided to validate its performance and the analysis presented...

Regulation of an Induction Motor under Broad Changes in DC-Link Voltage

Czech Academy of Sciences Publication Activity Database

Kokeš, Petr; Semerád, Radko

2006-01-01

Roč. 51, č. 4 (2006), s. 363-394 ISSN 0001-7043 Institutional research plan: CEZ:AV0Z20570509 Keywords : induction motor (IM) * DC-link voltage drop * stator flux vector control (SFVC) Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

Electrical Tree Initiation and Growth in Silicone Rubber under Combined DC-Pulse Voltage

Directory of Open Access Journals (Sweden)

Tao Han

2018-03-01

Full Text Available Electrical tree is a serious threat to silicone rubber (SIR insulation and can even cause breakdown. Electrical trees under alternating current (AC and direct current (DC voltage have been widely researched. While there are pulses in high-voltage direct current (HVDC cables under operating conditions caused by lightning and operating overvoltage in the power system, little research has been reported about trees under combined DC-pulse voltage. Their inception and growth mechanism is still not clear. In this paper, electrical trees are studied under several types of combined DC-pulse voltage. The initiation and growth process was recorded by a digital microscope system. The experimental results indicate that the inception pulse voltage is different under each voltage type and is influenced by the combined DC. The initial tree has two structures, determined by the pulse polarity. With increased DC prestressing time, tree inception pulse voltage with the same polarity is clearly decreased. Moreover, a special initial bubble tree was observed after the prestressing DC.

Measurement of AC losses in superconducting tapes by reproduction of thermometric dynamic response

Energy Technology Data Exchange (ETDEWEB)

Ligneris, Benoit des; Aubin, Marcel; Cave, Julian

2003-04-15

We have developed a dynamic response thermometric method for the measurement of AC losses in high T{sub c} superconductors. This method is based on the comparison of a temperature response caused by a known dissipation in the sample with that produced by the AC losses. By passing a DC current and measuring the DC voltage and corresponding temperature response the sample can be used as its own power dissipation reference. The advantages of this method are the short measurement duration time and the possibility to vary many experimental conditions: for example, AC and DC transport currents and AC, DC and rotating applied magnetic fields. In this article we present the basic method using variable short pulses of constant DC current for calibration and similarly of constant amplitude AC current to create the losses. The losses are obtained by numerical modelling and comparison of the thermometric dynamic response in the two above conditions. Finally, we present some experimental results for a Bi2223 superconducting tape at 50 Hz and 77 K.

A Review on Direct Power Control for Applications to Grid Connected PWM Converters

Directory of Open Access Journals (Sweden)

T. A. Trivedi

2015-08-01

Full Text Available The Direct Power Control strategy has become popular as an alternative to the conventional vector oriented control strategy for grid connected PWM converters. In this paper, Direct Power Control as applied to various applications of grid connected converters is reviewed. The Direct Power Control for PWM rectifiers, Grid Connected DC/AC inverters applications such as renewable energy sources interface, Active Power Filters, Doubly Fed Induction Generators and AC-DC-AC converters are discussed. Control strategies such as Look-Up table based control, predictive control, Virtual Flux DPC, Model based DPC and DPC-Space Vector Modulation are critically reviewed. The effects of various key parameters such as selection of switching vector, sampling time, hysteresis band and grid interfacing on performance of direct power controlled converters are presented.

Pulse-width modulated DC-DC power converters

CERN Document Server

Kazimierczuk, Marian K

2008-01-01

This book studies switch-mode power supplies (SMPS) in great detail. This type of converter changes an unregulated DC voltage into a high-frequency pulse-width modulated (PWM) voltage controlled by varying the duty cycle, then changes the PWM AC voltage to a regulated DC voltage at a high efficiency by rectification and filtering. Used to supply electronic circuits, this converter saves energy and space in the overall system. With concept-orientated explanations, this book offers state-of-the-art SMPS technology and promotes an understanding of the principle operations of PWM converters,

An AC modulated near infrared gain calibration system for a “Violin-Mode” transimpedance amplifier, intended for advanced LIGO suspensions

International Nuclear Information System (INIS)

Lockerbie, N. A.; Tokmakov, K. V.

2016-01-01

The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a “tall-thin” rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse “Violin-Mode” vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor’s DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor’s more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz–300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m"−"1 was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC/DC

An AC modulated near infrared gain calibration system for a “Violin-Mode” transimpedance amplifier, intended for advanced LIGO suspensions

Energy Technology Data Exchange (ETDEWEB)

Lockerbie, N. A.; Tokmakov, K. V. [SUPA (Scottish Universities Physics Alliance) Department of Physics, University of Strathclyde, 107 Rottenrow, Glasgow G4 0NG (United Kingdom)

2016-07-15

The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a “tall-thin” rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse “Violin-Mode” vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor’s DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor’s more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz–300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m{sup −1} was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC/DC

Rapid, directed transport of DC-SIGN clusters in the plasma membrane.

Science.gov (United States)

Liu, Ping; Weinreb, Violetta; Ridilla, Marc; Betts, Laurie; Patel, Pratik; de Silva, Aravinda M; Thompson, Nancy L; Jacobson, Ken

2017-11-01

C-type lectins, including dendritic cell-specific intercellular adhesion molecule-3-grabbing nonintegrin (DC-SIGN), are all-purpose pathogen receptors that exist in nanoclusters in plasma membranes of dendritic cells. A small fraction of these clusters, obvious from the videos, can undergo rapid, directed transport in the plane of the plasma membrane at average speeds of more than 1 μm/s in both dendritic cells and MX DC-SIGN murine fibroblasts ectopically expressing DC-SIGN. Surprisingly, instantaneous speeds can be considerably greater. In MX DC-SIGN cells, many cluster trajectories are colinear with microtubules that reside close to the ventral membrane, and the microtubule-depolymerizing drug, nocodazole, markedly reduced the areal density of directed movement trajectories, suggesting a microtubule motor-driven transport mechanism; by contrast, latrunculin A, which affects the actin network, did not depress this movement. Rapid, retrograde movement of DC-SIGN may be an efficient mechanism for bringing bound pathogen on the leading edge and projections of dendritic cells to the perinuclear region for internalization and processing. Dengue virus bound to DC-SIGN on dendritic projections was rapidly transported toward the cell center. The existence of this movement within the plasma membrane points to an unexpected lateral transport mechanism in mammalian cells and challenges our current concepts of cortex-membrane interactions.

DC Distributed Power Systems. Analysis, Design and Control for a Renewable Energy System

Energy Technology Data Exchange (ETDEWEB)

Karlsson, Per

2002-12-01

Renewable energy systems are likely to become wide spread in the future due to environmental demands. As a consequence of the dispersed nature of renewable energy systems, this implies that there will be a distributed generation of electric power. Since most of the distributed electrical energy sources do not provide their electric power at line frequency and voltage, a DC bus is a useful common connection for several such sources. Due to the differences in output voltage among the sources, depending on both the type of source and their actual operating point, the sources are connected to the DC power system via power electronic converters. The intention behind the presented work is not to replace the existing AC power system, but to include local DC power systems. The AC and DC power systems are connected at some points in the network. The renewable energy sources are weak compared to the present hydro power and nuclear power plants, resulting in a need of power conditioning before the renewable energy is fed to the transmission lines. The benefit of such an approach is that power conditioning is applied on a central level, i.e. at the interface between the AC and DC power systems. The thesis starts with an overview of related work. Present DC transmission systems are discussed and investigated in simulations. Then, different methods for load sharing and voltage control are discussed. Especially, the voltage droop control scheme is examined thoroughly. Since the droop control method does not require any high-speed communication between sources and loads, this is considered the most suitable for DC distributed power systems. The voltage feed back design of the controller also results in a specification of the DC bus capacitors (equivalents to DC link capacitors of single converters) needed for filtering. If the converters in the DC distribution system are equipped with capacitors selected from this design criterion and if the DC bus impedance is neglected, the

Effect of impurities on the steady component of the current in a quantum wire under the joint action of ac and dc fields

International Nuclear Information System (INIS)

Zav'yalov, D. V.; Kryuchkov, S. V.

2008-01-01

The current flowing along a cylindrical quantum wire with a superlattice in the case of the simultaneous application of dc and ac fields is calculated. It is assumed that the wire contains impurity centers, whose ionization results in the generation of nonequilibrium carriers in the conduction band. It is found that the dependence of the steady component of the current on the ac-field frequency is a step-like function. It is shown that the distance between steps depends on the conduction miniband width and the transverse quantum confinement parameters and is independent of the impurity-level depth.

Design and development of microcontroller based programmable ramp generator for AC-DC converter for simulating decay power transient in experimental facility for nuclear power plants

International Nuclear Information System (INIS)

Srivastava, Gaurava Deep; Kulkarni, R.D.

2015-01-01

In nuclear power plants, fuel is subjected to a wide range of power and temperature transients during normal and abnormal conditions. The reactor setback and step-back power pattern, fast temperature profile occurred during Loss of Coolant Accident and decay power followed by shutdown of power plant are the typical transients in nuclear power plant. For a variety of reactor engineering and reactor safety related study, one needs to simulate these transients in experimental facility. In experimental facilities, high response AC-DC converters are used to handle these power and temperature transients safely in a controlled manner for generating a database which is utilized for design of thermal hydraulic system, development of computer codes, study of reliability of reactor safety system, etc. for nuclear power plants. The paper presents the methodology developed for simulating the typical reactor decay power transient in an experimental facility. The design and simulation of AC-DC power electronic converter of 3 MW capacity is also presented. The microcontroller based programmable ramp generator is designed and hardware implemented for feeding reference voltage to the closed loop control system of AC-DC converter for obtaining the decay power profile at the converter output. The typical decay power transient of the nuclear power plant is divided into several small power ramps for simulating the transient. The signal corresponding to each power ramp is generated by programmable ramp generator and fed to the comparator for generating control signal for the converter. The actual decay power transient obtained from the converter is compared with the theoretical decay power transient. (author)

ANALISA SISTEM KENDALI PUTARAN MOTOR DC MENGGUNAKAN SILICON CONTROLLED RECTIFIERS

Directory of Open Access Journals (Sweden)

M. Khairudin, Efendi, N Purwantiningsih,

2016-01-01

Full Text Available ABSTRAK Paper ini bertujuan untuk menganalisa rangkaian sistem kendali putaran motor menggunakan Silicon Controlled Rectifier (SCR atau Thyristor. Eksperimen sistem kendali putaran motor ini menggunakan dua rangkaian yang berbeda. Rangkaian pertama menggunakan dua sumber, yaitu sumber tegangan DC 12 v terhubung dengan motor universal secara seri dengan resistor dan SCR, sedangkan sumber tegangan DC variabel 0 sampai 1.5 v dihubung paralel dengan kapasitor dan resistor. Rangkaian kedua menggunakan satu sumber tegangan AC 5 v yang dihubungkan dengan saklar dan motor. Pada rangkaian kedua ini motor dihubungkan dengan potensio, SCR, dioda serta kapasitor yang dipasang paralel dengan sumber tegangan AC. Hasil eksperimen menunjukkan dalam rangkaian menggunakan sumber tegangan DC, motor DC akan berputar saat saklar S1 tertutup. Kondisi motor akan berputar lebih cepat ketika sumber tegangan variabel diatur lebih besar dari 0 v sehingga arus gate Ig lebih bear dari 400 mA. Adapun Eksperimen dengan sumber tegangan AC, motor akan berputar dengan menambahkan dioda D3 dan pengaturan kecepatan melalui potensio meter Rv sampai posisi maksimum. Kata kunci: analisa, motor DC, SCR, sistem kendali ABSTRACT The objective of this study is to analyse the circuit of DC motor control system using Silicon Controlled Rectifier (SCR or Thyristor. In this experiment the circuit of control system for the motor using two different circuits. The first circuit using two sources, the 12 v DC voltage is connected to universal motor and series with a resistor and SCR, while the DC variable voltage source of 0 to 1.5 v connected in parallel to the capacitor and resistor. The second circuit uses a single source of 5 V AC voltage connected to the switch and the motor. In the second circuit, the motor is connected to the potentio meter, SCR, diode and capacitor in parallel with the AC voltage source. The experimental results showed the circuit using a DC voltage source impacted the

Demonstration of AC and DC charge control for the LISA test masses

Science.gov (United States)

Olatunde, Taiwo Janet

2018-01-01

Taiwo Olatunde, Stephen Apple, Andrew Chilton, Samantha Parry, Peter Wass, Guido Mueller, John W. Conklin The residual test mass acceleration in LISA must be below 3 fm/s2/√Hz at all frequencies between 0.1 and 3 mHz. Test mass charge coupled with stray electrical potentials and external electromagnetic fields is a well-known source of acceleration noise. LISA Pathfinder uses Hg lamps emitting mostly around 254 nm to discharge the test masses via photoemission, but a future LISA mission launched around 2030 will likely replace the lamps with newer UV LEDs with lower mass, better power efficiency, smaller size and higher bandwidth. This presentation will discuss charge control demonstrated on the torsion pendulum in AC and DC modes at the University of Florida using latest generation UV LEDs producing light at 240 nm with energy above the work function of pure Au. Initial results of Au quantum efficiency measurements (number of emitted electrons per incident photons) which is critical for bi-polar charge control will also be presented.

An Active Damping Technique for Small DC-Link Capacitor Based Drive System

DEFF Research Database (Denmark)

Maheshwari, Ram Krishan; Munk-Nielsen, Stig; Lu, Kaiyuan

2013-01-01

A small dc-link capacitor based drive system shows instability when it is operated with large input line inductance at operating points with high power. This paper presents a simple, new active damping technique that can stabilize effectively the drive system at unstable operating points, offering...

75 FR 35611 - Airworthiness Directives; McDonnell Douglas Corporation Model DC-10-10, DC-10-10F, and MD-10-10F...

Science.gov (United States)

2010-06-23

... Airworthiness Directives; McDonnell Douglas Corporation Model DC- 10-10, DC-10-10F, and MD-10-10F Airplanes... certain McDonnell Douglas Model DC-10-10, DC-10-10F, and MD-10-10F airplanes. That NPRM was published in... amends Sec. 39.13 by adding the following new AD: 2010-13-06 McDonnell Douglas Corporation: Amendment 39...

Benchmark of AC and DC Active Power Decoupling Circuits for Second-Order Harmonic Mitigation in Kilowatt-Scale Single-Phase Inverters

DEFF Research Database (Denmark)

Qin, Zian; Tang, Yi; Loh, Poh Chiang

2016-01-01

efficiency and high power density is identified and comprehensively studied, and the commercially available film capacitors, the circuit topologies, and the control strategies adopted for active power decoupling are all taken into account. Then, an adaptive decoupling voltage control method is proposed...... to further improve the performance of dc decoupling in terms of efficiency and reliability. The feasibility and superiority of the identified solution for active power decoupling together with the proposed adaptive decoupling voltage control method are finally verified by both the simulation and experimental......This paper presents the benchmark study of ac and dc active power decoupling circuits for second order harmonic mitigation in kW scale single-phase inverters. First of all, a brief comparison of recently reported active power decoupling circuits is given, and the best solution that can achieve high...

A Modular PV System Using Chain-Link-Type Multilevel Converter

Science.gov (United States)

Hatano, Nobuhiko; Ise, Toshifumi

This paper presents a modular photovoltaic system (MPVS) that uses a chain-link-type multilevel converter (CLMC). In large-scale PV generating systems, the DC power supply is generally composed of a large number of PV panels. Hence, losses are caused by differences in the maximum power point at each PV panel. An MPVS has been proposed to address the above mentioned problem. It helps improve the photoelectric conversion efficiency by applying maximum power point tracking (MPPT) control to each group of PV panels. In addition, if a CLMC is used in an MPVS, a high voltage can be output from the AC side and transmission losses can be decreased. However, with this circuit configuration, the current output from the AC side may be unbalanced. Therefore, we propose a method to output balanced current from the AC side, even if the output of the DC power supply is unbalanced. The validity of the proposed method is examined by digital simulation.

Decentralised control method for DC microgrids with improved current sharing accuracy

DEFF Research Database (Denmark)

Yang, Jie; Jin, Xinmin; Wu, Xuezhi

2017-01-01

A decentralised control method that deals with current sharing issues in dc microgrids (MGs) is proposed in this study. The proposed method is formulated in terms of ‘modified global indicator’ concept, which was originally proposed to improve reactive power sharing in ac MGs. In this work......, the ‘modified global indicator’ concept is extended to coordinate dc MGs, which aims to preserve the main features offered by decentralised control methods such as no need of communication links, central controller or knowledge of the microgrid topology and parameters. This global indicator is inserted between...... a shunt virtual resistance. The operation under multiple dc-buses is also included in order to enhance the applicability of the proposed controller. A detailed mathematical model including the effect of network mismatches is derived for analysis of the stability of the proposed controller. The feasibility...

DC-Compensated Current Transformer.

Science.gov (United States)

Ripka, Pavel; Draxler, Karel; Styblíková, Renata

2016-01-20

Instrument current transformers (CTs) measure AC currents. The DC component in the measured current can saturate the transformer and cause gross error. We use fluxgate detection and digital feedback compensation of the DC flux to suppress the overall error to 0.15%. This concept can be used not only for high-end CTs with a nanocrystalline core, but it also works for low-cost CTs with FeSi cores. The method described here allows simultaneous measurements of the DC current component.

A New Coordinated Voltage Control Scheme for Offshore AC Grid of HVDC Connected Offshore Wind Power Plants

DEFF Research Database (Denmark)

Sakamuri, Jayachandra N.; Cutululis, Nicolaos Antonio; Rather, Zakir Hussain

2015-01-01

This paper proposes a coordinated voltage control scheme (CVCS) which enhances the voltage ride through (VRT) capability of an offshore AC grid comprised of a cluster of offshore wind power plants (WPP) connected through AC cables to the offshore voltage source converter based high voltage DC (VSC......-HVDC) converter station. Due to limited short circuit power contribution from power electronic interfaced variable speed wind generators and with the onshore main grid decoupled by the HVDC link, the offshore AC grid becomes more vulnerable to dynamic voltage events. Therefore, a short circuit fault...... in the offshore AC Grid is likely to have significant implications on the voltage of the offshore AC grid, hence on the power flow to the onshore mainland grid. The proposed CVCS integrates individual local reactive power control of wind turbines and of the HVDC converter with the secondary voltage controller...

Switching-mode Audio Power Amplifiers with Direct Energy Conversion

DEFF Research Database (Denmark)

Ljusev, Petar; Andersen, Michael Andreas E.

2005-01-01

has been replaced with a high frequency AC link. When compared to the conventional Class D amplifiers with a separate DC power supply, the proposed single conversion stage amplifier provides simple and compact solution with better efficiency and higher level of integration, leading to reduced...

75 FR 2831 - Airworthiness Directives; McDonnell Douglas Corporation Model DC-10-10, DC-10-10F, and MD-10-10F...

Science.gov (United States)

2010-01-19

...-0043; Directorate Identifier 2009-NM-128-AD] RIN 2120-AA64 Airworthiness Directives; McDonnell Douglas... directive (AD) for certain McDonnell Douglas Model DC-10-10, DC-10-10F, and MD-10-10F airplanes. This... adding the following new AD: McDonnell Douglas Corporation: Docket No. FAA-2010-0043; Directorate...

Composite Cu/Fe/MgB{sub 2} superconducting wires and MgB{sub 2}/YSZ/Hastelloy coated conductors for ac and dc applications

Energy Technology Data Exchange (ETDEWEB)

Glowacki, B A [Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge (United Kingdom); Majoros, M [Interdisciplinary Research Centre in Superconductivity, University of Cambridge, Madingley Road, Cambridge (United Kingdom); Vickers, M [Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge (United Kingdom); Eisterer, M [Atomic Institute of the Austrian Universities, A-1020 Vienna (Austria); Toenies, S [Atomic Institute of the Austrian Universities, A-1020 Vienna (Austria); Weber, H W [Atomic Institute of the Austrian Universities, A-1020 Vienna (Austria); Fukutomi, M [National Institute for Materials Science, Superconducting Materials Center, 1-2-1, Sengen, Ibaraki (Japan); Komori, K [National Institute for Materials Science, Superconducting Materials Center, 1-2-1, Sengen, Ibaraki (Japan); Togano, K [National Institute for Materials Science, Superconducting Materials Center, 1-2-1, Sengen, Ibaraki (Japan)

2003-02-01

We discuss the results of a study of MgB{sub 2} multifilamentary conductors and coated conductors from the point of view of their future dc and ac applications. The correlation between the slope of the irreversibility line induced by neutron irradiation defects and in situ structural imperfections and the critical temperature and critical current density is discussed with respect to the conductor performance and applicability. We debate the possible origin of the observed anomalous decrease of ac susceptibility at 50 K in copper clad in situ powder-in-tube MgB{sub 2} wires. Different conductor preparation methods and conductor architectures, and attainable critical current densities are presented. Some numerical results on critical currents, thermal stability and ac losses of future MgB{sub 2} multifilamentary and coated conductors with magnetic cladding of their filaments are also discussed.

Effect of dc field on ac-loss peak in a commercial Bi:2223/Ag tape

Science.gov (United States)

Öztürk, Ali; Düzgün, İbrahim; Çelebi, Selahattin

2017-12-01

Measurements of the ac susceptibility in a commercial Bi:2223/Ag tape for some different ac magnetic field amplitudes, Hac, in the presence of bias magnetic field Hdc directed along Hac are reported. It is found that the peak values of the imaginary component of ac susceptibility χ″max versus Hac trace a valley for the orientation where applied field Ha perpendicular to wide face of the tape total. We note that the observation of the valley depends on various parameters such as field dependence parameter n in the critical current density, in the simple power law expression jc = α(T)/Bn, choice of the bias field Hdc together with selected ac field amplitudes Hac, and dimension and geometry of sample studied. Our calculations based on critical state model with jc = α(1 - T/Tcm)p/Bn using the fitting parameters of n = 0.25, p = 2.2, Tcm = 108 K gives quite good results to compare the experimental and calculated curves.

Efficiency Analyses of a DC Residential Power Distribution System for the Modern Home

Directory of Open Access Journals (Sweden)

GELANI, H. E.

2015-02-01

Full Text Available The electric power system started as DC back in the nineteenth century. However, the DC paradigm was soon ousted by AC due to inability of DC to change its voltage level. Now, after many years, with the development of power electronic converters capable of stepping-up and down DC voltage and converting it to-and-from AC, DC appears to be challenging AC and attempting a comeback. We now have DC power generation by solar cells, fuel cells and wind farms, DC power transmission in the form of HVDC (High Voltage DC transmission, DC power utilization by various modern electronic loads and DC power distribution that maybe regarded as still in research phase. This paper is an attempt to investigate feasibility of DC in the distribution portion of electrical power system. Specifically, the efficiency of a DC distribution system for residential localities is determined while keeping in view the concept of daily load variation. The aim is to bring out a more practical value of system efficiency as the efficiencies of DC/DC converters making up the system vary with load variation. This paper presents the modeling and simulation of a DC distribution system and efficiency results for various scenarios are presented.

High Current Planar Transformer for Very High Efficiency Isolated Boost DC-DC Converters

DEFF Research Database (Denmark)

Pittini, Riccardo; Zhang, Zhe; Andersen, Michael A. E.

2014-01-01

This paper presents a design and optimization of a high current planar transformer for very high efficiency dc-dc isolated boost converters. The analysis considers different winding arrangements, including very high copper thickness windings. The analysis is focused on the winding ac-resistance a......This paper presents a design and optimization of a high current planar transformer for very high efficiency dc-dc isolated boost converters. The analysis considers different winding arrangements, including very high copper thickness windings. The analysis is focused on the winding ac......-resistance and transformer leakage inductance. Design and optimization procedures are validated based on an experimental prototype of a 6 kW dcdc isolated full bridge boost converter developed on fully planar magnetics. The prototype is rated at 30-80 V 0-80 A on the low voltage side and 700-800 V on the high voltage side...... with a peak efficiency of 97.8% at 80 V 3.5 kW. Results highlights that thick copper windings can provide good performance at low switching frequencies due to the high transformer filling factor. PCB windings can also provide very high efficiency if stacked in parallel utilizing the transformer winding window...

Proposed inverter to link generators at PPPL

International Nuclear Information System (INIS)

Lawn, F.; Huttar, D.E.

1983-01-01

Large magnetic confinement experiments and the associated energy conversion systems which power the coils of such machines are a challenge to the energy supply engineer. Characteristically, the energy required per pulse is measured in gigajoules, the peak power level is hundreds of megawatts and the power supplies present a power factor of 0.6 or less to the AC supply system during the actual experiment. Direct coil supply systems such as homopolar generators and commutated DC generators are used in some cases but are not as flexible as AC power distribution systems feeding solid state rectifiers. When PPPL required high pulsed energy for the PLT and PDX machines, stored energy was obtained from existing MG sets at C-Site. These consist of three shafts each driven by a 7,000 horsepower AC motor, each shaft drives four DC generators and a flywheel. These generators combined with utility fed, static power supplies provided the energy for these machines

Benchmark of AC and DC active power decoupling circuits for second-order harmonic mitigation in kW-scale single-phase inverters

DEFF Research Database (Denmark)

Qin, Zian; Tang, Yi; Loh, Poh Chiang

2015-01-01

studied, where the commercially available film capacitors, circuit topologies, and control strategies for active power decoupling are all taken into account. Then, an adaptive decoupling voltage control method is proposed to further improve the performance of dc decoupling in terms of efficiency...... and reliability. The feasibility and superiority of the identified solution for active power decoupling together with the proposed adaptive decoupling voltage control method are finally verified by both the experimental results obtained on a 2 kW single-phase inverter.......This paper presents the benchmark study of ac and dc active power decoupling circuits for second-order harmonic mitigation in kW-scale single-phase inverters. First of all, the best solutions of active power decoupling to achieve high efficiency and power density are identified and comprehensively...

EMI performance comparison of two-level and three-level inverters in small dc-link capacitors based motor drives

DEFF Research Database (Denmark)

Maheshwari, Ram Krishan; Munk-Nielsen, Stig; Busquets-Monge, S.

2012-01-01

The size of passive components in an adjustable speed drive can be reduced by using small dc-link capacitors. The EMI filter in the drive also consists of passive components. The size of the filter can be reduced by using a three-level inverter, which can have low output voltage distortion. However......, the three-level inverter based on small dc-link capacitors requires a PWM strategy to maintain neutral-point voltage balance. In this paper, the common mode voltage, which is the determining factor for the EMI filter size, is analyzed for a virtual-vector-based PWM strategy. The common mode voltage......, the shaft voltage, and the conducted emission for the small dc-link capacitor based three-level inverter are compared with that of the two-level inverter operated with space vector PWM strategy. Experimental results for the common mode voltage, the shaft voltage, and the conducted emission are presented...

Ac-driven vortex-antivortex dynamics in nanostructured superconductor-ferromagnetic hybrids

Energy Technology Data Exchange (ETDEWEB)

Lima, Clessio L.S., E-mail: clsl@df.ufpe.br [Nucleo de Tecnologia, Centro Academico do Agreste, Universidade Federal de Pernambuco, 55002-970 Caruaru-PE (Brazil); Souza Silva, Clecio C. de; Aguiar, J. Albino [Departamento de Fisica, Universidade Federal de Pernambuco, 50670-901 Recife-PE (Brazil)

2012-09-15

The dynamics of ac-driven vortices and antivortices in a superconducting film interacting with an array of magnetic dipoles on top is investigated via hybrid molecular dynamics-Monte Carlo simulations. The dipole array considered in this study is capable to stabilize in equilibrium vortex-antivortex pairs. The appearance of a net electric field out of the ac excitation demonstrates that this system behaves as a voltage rectifier. Because of the asymmetric nature of the effective pinning potential generated by the dipole array, the ac-driven vortices and antivortices are ratcheted in opposite directions, thereby contributing additively to the observed net voltage. In addition, for high frequency values, the dc electric field-ac amplitude curves present a series of steps. A careful analysis of the time series of the electric field and number of vortex-antivortex (v-av) pairs reveals that these steps are related to mode-locking between the drive frequency and the number of v-av creation-annihilation events.

System and method for determining stator winding resistance in an AC motor

Science.gov (United States)

Lu, Bin [Kenosha, WI; Habetler, Thomas G [Snellville, GA; Zhang, Pinjia [Atlanta, GA; Theisen, Peter J [West Bend, WI

2011-05-31

A system and method for determining stator winding resistance in an AC motor is disclosed. The system includes a circuit having an input connectable to an AC source and an output connectable to an input terminal of an AC motor. The circuit includes at least one contactor and at least one switch to control current flow and terminal voltages in the AC motor. The system also includes a controller connected to the circuit and configured to modify a switching time of the at least one switch to create a DC component in an output of the system corresponding to an input to the AC motor and determine a stator winding resistance of the AC motor based on the injected DC component of the voltage and current.

Comparative Study of Breakdown Voltage of Mineral, Synthetic and Natural Oils and Based Mineral Oil Mixtures under AC and DC Voltages

Directory of Open Access Journals (Sweden)

Abderrahmane Beroual

2017-04-01

Full Text Available This paper deals with a comparative study of AC and DC breakdown voltages of based mineral oil mixtures with natural and synthetic esters mainly used in high voltage power transformers. The goal was to analyze the performances of oil mixtures from the dielectric withstand point of view and to predict the behavior of transformers originally filled with mineral oil and re-filled with synthetic or natural ester oils when emptied for maintenance. The study concerns mixtures based on 20%, 50%, and 80% of natural and synthetic ester oils. AC breakdown voltages were measured using a sphere-sphere electrode system according to IEC 60156 specifications; the same specification was adopted for DC measurements since there is no standard specifications for this voltage waveform. A statistical analysis of the mean values, standard deviations, and histograms of breakdown voltage data was carried out. The Normal and Weibull distribution functions were used to analyze the experimental data and the best function that the data followed was used to estimate the breakdown voltage with risk of 1%, 10%, and 50% probability. It was shown that whatever the applied voltage waveforms, ester oils always have a significantly higher breakdown voltage than mineral oil. The addition of only 20% of natural or synthetic ester oil was sufficient to considerably increase the breakdown voltage of mineral oil. The dielectric strength of such a mixture is much higher than that of mineral oil alone and can reach that of ester oils. From the point of view of dielectric strength, the mixtures constitute an option for improving the performance of mineral oil. Thus, re-filling of transformers containing up to 20% mineral oil residues with ester oils, does not present any problem; it is even advantageous when considering only the breakdown voltage. Under AC, the mixtures with natural ester always follow the behavior of vegetable oil alone. With the exception of the 20% mixture of natural

Low AC Loss YBCO Coated Conductor Geometry by Direct Inkjet Printing

Energy Technology Data Exchange (ETDEWEB)

Rupich, Martin, Dr. [American Superconductor Corporation; Duckworth, Robert, Dr. [Oak Ridge National Laboratory

2009-10-01

The second generation (2G) high temperature superconductors (HTS) wire offers potential benefits for many electric power applications, including ones requiring filamentized conductors with low ac loss, such as transformers and fault current limiters. However, the use of 2G wire in these applications requires the development of both novel multi-filamentary conductor designs with lower ac losses and the development of advanced manufacturing technologies that enable the low-cost manufacturing of these filamentized architectures. This Phase I SBIR project focused on testing inkjet printing as a potential low-cost, roll-to-roll manufacturing technique to fabricate potential low ac loss filamentized architectures directly on the 2G template strips.

Power Loss Analysis and Comparision of DC and AC Side Decoupling Module in a H-bridge Inverter

DEFF Research Database (Denmark)

Ma, Siyuan; Wang, Haoran; Zhu, Guorong

2016-01-01

perspective. The analytical power loss models are derived based on the operation principles of the active power decoupling methods. A comparative study is performed based on a 500 W single-phase H-bridge inverter study case with 400 V DC-link voltage level. The results provide a guideline to justify whether...

Experimental power reactor dc generator energy storage study

International Nuclear Information System (INIS)

Heck, F.M.; Smeltzer, G.S.; Myers, E.H.; Kilgore, L.

1978-01-01

This study covers the use of dc generators for meeting the Experimental Power Reactor Ohmic Heating Energy Storage Requirements. The dc generators satisfy these requirements which are the same as defined in WFPS-TME-038 which covered the use of ac generators and homopolar generators. The costs of the latter two systems have been revised to eliminate first-of-a-kind factors. The cost figures for dc generators indicate a need to develop larger machines in order to take advantage of the economy-of-scale that the large ac machines have. Each of the systems has its own favorable salient features on which to base a system selection

Neutral-point current modeling and control for Neutral-Point Clamped three-level converter drive with small DC-link capacitors

DEFF Research Database (Denmark)

Maheshwari, Ram Krishan; Munk-Nielsen, Stig; Busquets-Monge, Sergio

2011-01-01

A Neutral-Point-Clamped (NPC) three-level inverter with small DC-link capacitors is presented in this paper. This inverter requires zero average neutral-point current for stable neutral-point potential. A simple carrier based modulation strategy is proposed for achieving zero average neutral...... drive with only 14 μF DC-link capacitors. A fast and stable performance of the neutral-point voltage controller is achieved and verified by experiments....

DC-Compensated Current Transformer †

Science.gov (United States)

Ripka, Pavel; Draxler, Karel; Styblíková, Renata

2016-01-01

Instrument current transformers (CTs) measure AC currents. The DC component in the measured current can saturate the transformer and cause gross error. We use fluxgate detection and digital feedback compensation of the DC flux to suppress the overall error to 0.15%. This concept can be used not only for high-end CTs with a nanocrystalline core, but it also works for low-cost CTs with FeSi cores. The method described here allows simultaneous measurements of the DC current component. PMID:26805830

Move to Solar-DC at Home Premises

Indian Academy of Sciences (India)

48V DC line as an additional power line at home. Highly power-efficient usage of Solar; Low-power from grid alone converted from AC-DC. Designed to have minimal loss. Battery can be added with higher efficiency (no convertors), if required.

ac propulsion system for an electric vehicle

Science.gov (United States)

Geppert, S.

1980-01-01

It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

An isolated bridgeless AC-DC PFC converter using a LC resonant voltage doubler rectifier

Science.gov (United States)

Lee, Sin-woo; Do, Hyun-Lark

2016-12-01

This paper proposed an isolated bridgeless AC-DC power factor correction (PFC) converter using a LC resonant voltage doubler rectifier. The proposed converter is based on isolated conventional single-ended primary inductance converter (SEPIC) PFC converter. The conduction loss of rectification is reduced than a conventional one because the proposed converter is designed to eliminate a full-bridge rectifier at an input stage. Moreover, for zero-current switching (ZCS) operation and low voltage stresses of output diodes, the secondary of the proposed converter is designed as voltage doubler with a LC resonant tank. Additionally, an input-output electrical isolation is provided for safety standard. In conclusion, high power factor is achieved and efficiency is improved. The operational principles, steady-state analysis and design equations of the proposed converter are described in detail. Experimental results from a 60 W prototype at a constant switching frequency 100 kHz are presented to verify the performance of the proposed converter.

Damping of power oscillations of exchange lines using a DC link; Amortecimento de oscilacoes de potencia de linhas de intercambio utilizando um elo de CC

Energy Technology Data Exchange (ETDEWEB)

Paccini, Rodrigo de O.; Custodio, Diogo T.; Kopcak, Igor; Costa, Vivaldo F. da [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Dept. de Sistemas de Energia Eletrica], Emails: rodrigo@dsee.fee.unicamp.br, totti@dsee.fee.unicamp.br, kopcak@dsee.fee.unicamp.br, vivaldo@dsee.fee.unicamp.br.

2009-07-01

This article presents a study that evaluates the effectiveness of a DC link in order to damp power oscillations, of inter area exchange, under small disturbance conditions, operating with Automatic Control Generation. The DC link was represented by a power injection model included the Sensitivity Power Model. Through this representation, the DC link was inserted in the block diagram, modeled as an injection power in the bars terminals in the net active and reactive, closing a new power balance at every instant. It was also designed a controller for damping power oscillations (POD-Power Oscillation Damping Controller) for modulation the power of the DC link and, therefore, insertion of additional damping in a frequency oscillations of exchange lines. The results confirm that the DC link has a great potential for maintaining the damping of oscillations frequency so inter area when equipped with POD controllers.

Dicty_cDB: FC-AC21 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

Direct current power delivery system and method

Science.gov (United States)

Zhang, Di; Garces, Luis Jose; Dai, Jian; Lai, Rixin

2016-09-06

A power transmission system includes a first unit for carrying out the steps of receiving high voltage direct current (HVDC) power from an HVDC power line, generating an alternating current (AC) component indicative of a status of the first unit, and adding the AC component to the HVDC power line. Further, the power transmission system includes a second unit for carrying out the steps of generating a direct current (DC) voltage to transfer the HVDC power on the HVDC power line, wherein the HVDC power line is coupled between the first unit and the second unit, detecting a presence or an absence of the added AC component in the HVDC power line, and determining the status of the first unit based on the added AC component.

Interpretation of dc and ac conductivity of Ag2O–SeO2–MoO3 glass-nanocomposite-semiconductor

International Nuclear Information System (INIS)

Bhattacharya, Sanjib; Kundu, Ranadip; Das, Anindya Sundar; Roy, Debasish

2015-01-01

Highlights: • Polaron hopping. • Dc and ac conductivity. • Mott's model and Greave's model. • Ag 2 MoO 4 , Ag 2 Mo 2 O 7 and Ag 6 Mo 10 O 33 nanoparticles and SeO 3 and SeO 4 nanoclusters. • XRD and FESEM studies. - Abstract: A new type of semiconducting glass-nanocomposites 0.3Ag 2 O–0.7 (xMoO 3 –(1 − x) SeO 2 ) is prepared by melt-quenching route. The formation of Ag 2 MoO 4 , Ag 2 Mo 2 O 7 and Ag 6 Mo 10 O 33 nanoparticles and SeO 3 and SeO 4 nanoclusters in glass-nanocomposites has been confirmed from X-ray diffraction (XRD) and field emission scanning electron microscopic (FESEM) studies. Fourier transform infrared (FTIR) spectroscopy is employed to find out Se−O stretching vibration as well as stretching vibrations of Mo 2 O 7 2− ions. The dc conductivity of them is studied on the light of polaron hopping approach in a wide temperature range. At low temperatures, variable range hopping model (Mott's model) is employed to analyze the conductivity data. Greave's model is used to predict temperature dependent variable range hopping in the high temperature region. Frequency dependent ac conductivity is well explained on the basis of tunneling. I–V characteristics of the as-prepared samples have also been investigated

Robust Frequency and Voltage Stability Control Strategy for Standalone AC/DC Hybrid Microgrid

Directory of Open Access Journals (Sweden)

Furqan Asghar

2017-05-01

Full Text Available The microgrid (MG concept is attracting considerable attention as a solution to energy deficiencies, especially in remote areas, but the intermittent nature of renewable sources and varying loads cause many control problems and thereby affect the quality of power within a microgrid operating in standalone mode. This might cause large frequency and voltage deviations in the system due to unpredictable output power fluctuations. Furthermore, without any main grid support, it is more complex to control and manage the system. In past, droop control and various other coordination control strategies have been presented to stabilize the microgrid frequency and voltages, but in order to utilize the available resources up to their maximum capacity in a positive way, new and robust control mechanisms are required. In this paper, a standalone microgrid is presented, which integrates renewable energy-based distributed generations and local loads. A fuzzy logic-based intelligent control technique is proposed to maintain the frequency and DC (direct current-link voltage stability for sudden changes in load or generation power. Also from a frequency control perspective, a battery energy storage system (BESS is suggested as a replacement for a synchronous generator to stabilize the nominal system frequency as a synchronous generator is unable to operate at its maximum efficiency while being controlled for stabilization purposes. Likewise, a super capacitor (SC and BESS is used to stabilize DC bus voltages even though maximum possible energy is being extracted from renewable generated sources using maximum power point tracking. This newly proposed control method proves to be effective by reducing transient time, minimizing the frequency deviations, maintaining voltages even though maximum power point tracking is working and preventing generators from exceeding their power ratings during disturbances. However, due to the BESS limited capacity, load switching

Improved Control of an Active-Front-End Adjustable Speed Drive with a Small dc-link Capacitor under Real Grid Conditions

DEFF Research Database (Denmark)

Klumpner, Christian; Liserre, Marco; Blaabjerg, Frede

2004-01-01

capacitors will be replaced by film capacitors in order to increase the ASD lifetime, but as this has lower energy density, the dc-link capacitance is expected to decrease. In these circumstances, operation under unbalanced and distorted supply voltage as well as high dynamic operation of the ASD makes...... the control task more challenging. This paper discusses problems related to the ASD dc-link both in respect to its stability (under regeneration as well as in the case of constant power absorbed by the inverter stage) both also in respect to the dc voltage ripple generated by the grid unbalance and made more...

Operation and control of a DC-grid offshore wind farm under DC transmission system faults

DEFF Research Database (Denmark)

Deng, Fujin; Chen, Zhe

2013-01-01

. Consequently, the protection and control strategies of dc systems need to be established. This paper studies a dc-grid offshore wind farm, where the wind power collection system and power transmission system adopt dc technology. In this paper, the redundancy of the HVDC transmission system under faults...... is studied, and a fault ridethrough strategy for the dc-grid offshore wind farm is proposed. The proposed strategy can effectively minimize the impacts of the power transmission system disturbance on the offshore wind farm, and on the ac grid. A dc-grid offshore wind farm example is simulated with PSCAD....../EMTDC, and the results validate the feasibility of the presented redundancy configuration and operation approach, and the fault ridethrough control strategy....

Design of an AC/DC power supply for telecom applications

Energy Technology Data Exchange (ETDEWEB)

Suntio, T.; Vallittu, P.; Laurinen, T.; Ikonen, M. [Efore Oy, Espoo (Finland)

1997-12-31

Typical Telecom uninterruptible power supply system (UPS) comprises of parallel connected rectifiers and storage batteries supplying DC power for Telecom switching systems on fixed or mobile telephone networks. The requirement is most often of total uninterruptibility meaning high reliability and availability performance as a vital design and development goal. The Telecom systems must also meet stringent noise emission and immunity requirements stipulated by EMC and Low Voltage Directives, European Telecommunications Standard Institute (ETSI) as well as other global and local standards depending on the area they are to be used. This paper will describe in practice the vital features the rectifiers should contain as well as presents results from a practical equipment of 48 V, 500 W. (orig.) 27 refs.

AC power flow importance measures considering multi-element failures

International Nuclear Information System (INIS)

Li, Jian; Dueñas-Osorio, Leonardo; Chen, Changkun; Shi, Congling

2017-01-01

Quantifying the criticality of individual components of power systems is essential for overall reliability and management. This paper proposes an AC-based power flow element importance measure, while considering multi-element failures. The measure relies on a proposed AC-based cascading failure model, which captures branch overflow, bus load shedding, and branch failures, via AC power flow and optimal power flow analyses. Taking the IEEE 30, 57 and 118-bus power systems as case studies, we find that N-3 analyses are sufficient to measure the importance of a bus or branch. It is observed that for a substation bus, its importance is statistically proportional to its power demand, but this trend is not observed for power plant buses. While comparing with other reliability, functionality, and topology-based importance measures popular today, we find that a DC power flow model, although better correlated with the benchmark AC model as a whole, still fails to locate some critical elements. This is due to the focus of DC-based models on real power that ignores reactive power. The proposed importance measure is aimed to inform decision makers about key components in complex systems, while improving cascading failure prevention, system backup setting, and overall resilience. - Highlights: • We propose a novel importance measure based on joint failures and AC power flow. • A cascading failure model considers both AC power flow and optimal power flow. • We find that N-3 analyses are sufficient to measure the importance of an element. • Power demand impacts the importance of substations but less so that of generators. • DC models fail to identify some key elements, despite correlating with AC models.

Influence of direct and alternating current electric fields on efficiency promotion and leaching risk alleviation of chelator assisted phytoremediation.

Science.gov (United States)

Luo, Jie; Cai, Limei; Qi, Shihua; Wu, Jian; Sophie Gu, Xiaowen

2018-03-01

Direct and alternating current electric fields with various voltages were used to improve the decontamination efficiency of chelator assisted phytoremediation for multi-metal polluted soil. The alleviation effect of electric field on leaching risk caused by chelator application during phytoremediation process was also evaluated. Biomass yield, pollutant uptake and metal leaching retardation under alternating current (AC) and direct current (DC) electric fields were compared. The biomass yield of Eucalyptus globulus under AC fields with various voltages (2, 4 and 10 V) were 3.91, 4.16 and 3.67kg, respectively, significantly higher than the chelator treatment without electric field (2.71kg). Besides growth stimulation, AC fields increased the metal concentrations of plant tissues especially in aerial parts manifested by the raised translocation factor of different metals. Direct current electric fields with low and moderate voltages increased the biomass production of the species to 3.45 and 3.12kg, respectively, while high voltage on the contrary suppressed the growth of the plants (2.66kg). Under DC fields, metal concentrations elevated obviously with increasing voltages and the metal translocation factors were similar under all voltages. Metal extraction per plant achieved the maximum value under moderate voltage due to the greatest biomass production. DC field with high voltage (10V) decreased the volume of leachate from the chelator treatment without electric field from 1224 to 56mL, while the leachate gathered from AC field treatments raised from 512 to 670mL. DC field can retard the downward movement of metals caused by chelator application more effectively relative to AC field due to the constant water flow and electroosmosis direction. Alternating current field had more promotive effect on chelator assisted phytoremediation efficiency than DC field illustrated by more metal accumulation in the species. However, with the consideration of leaching risk, DC

Analytical Comparison of Dual-Input Isolated dc-dc Converter with an ac or dc Inductor for Renewable Energy Systems

DEFF Research Database (Denmark)

Zhang, Zhe; Mira Albert, Maria del Carmen; Andersen, Michael A. E.

2017-01-01

This paper presents two configurations of dualinput (DI) or three-port (TPC) isolated dc-dc converters for hybrid renewable energy systems such as photovoltaics and batteries. These two converters are derived by integrating an interleaved boost converter and a single-active bridge converter...... and control perspective, distinct in operation principles, voltage/power transfer functions, loss distributions, soft-switching constraints, and power efficiency under the same operating conditions. Moreover, the inductor design differs greatly between these two cases. In this paper, a comprehensive...

System and method for monitoring and controlling stator winding temperature in a de-energized AC motor

Science.gov (United States)

Lu, Bin [Kenosha, WI; Luebke, Charles John [Sussex, WI; Habetler, Thomas G [Snellville, GA; Zhang, Pinjia [Atlanta, GA; Becker, Scott K [Oak Creek, WI

2011-12-27

A system and method for measuring and controlling stator winding temperature in an AC motor while idling is disclosed. The system includes a circuit having an input connectable to an AC source and an output connectable to an input terminal of a multi-phase AC motor. The circuit further includes a plurality of switching devices to control current flow and terminal voltages in the multi-phase AC motor and a controller connected to the circuit. The controller is configured to activate the plurality of switching devices to create a DC signal in an output of the motor control device corresponding to an input to the multi-phase AC motor, determine or estimate a stator winding resistance of the multi-phase AC motor based on the DC signal, and estimate a stator temperature from the stator winding resistance. Temperature can then be controlled and regulated by DC injection into the stator windings.

A control strategy for DC-link voltage control containing PV generation and energy storage — An intelligent approach

OpenAIRE

Rouzbehi, Kumars; Miranian, Arash; Candela García, José Ignacio; Luna Alloza, Álvaro; Rodríguez Cortés, Pedro

2014-01-01

In this paper, DC-link voltage control in DC microgrids with photovoltaic (PV) generation and battery, is addressed based on an intelligent approach. The proposed strategy is based on the modeling of the power interface, i.e. power electronic converter, located between the PV array, battery and DC bus, by use of measurement data. For this purpose, a local model network (LMN) is developed to model the converter and then a local linear control (LLC) strategy is designed based on the LMN. Simula...

Non-Federal participation in AC Intertie: Final environmental impact statement

International Nuclear Information System (INIS)

1994-01-01

Bonneville Power Administration (BPA) is considering action in two areas: (1) non-Federal access to the AC Intertie, and, (2) BPA Intertie marketing. BPA's preferred alternative for non-Federal access is the Capacity Ownership alternative combined with the Increased Assured Delivery -- Access for Non-Scheduling Utilities alternative; the preferred alternative for BPA Intertie marketing is the Federal Marketing and Joint Ventures alternative. BPA considered these two areas previously in its Intertie Development and Use EIS of April 1988. The EIS resulted in BPA decisions to participate in the construction of the Third AC Intertie, to allow non-Federal access to BPA's share of the Pacific Northwest-Pacific Southwest (PNW-PSW) Intertie (AC and DC lines) pursuant to a Long-Term Intertie Access Policy (LTIAP), and to pursue BPA's export marketing alternative. The decision on allowing direct financial non-Federal participation in the Third AC line was deferred to a later, separate process, examined here. Also, BPA's export marketing objectives must now be examined in view of changed operations of Columbia River hydro facilities for improved fish survival

Direct Torque Control of Matrix Converter Fed Induction Motor Drive

Directory of Open Access Journals (Sweden)

JAGADEESAN Karpagam

2011-10-01

Full Text Available This paper presents the Direct TorqueControl (DTC of induction motor drive using matrixconverters. DTC is a high performance motor controlscheme with fast torque and flux responses. However,the main disadvantage of conventional DTC iselectromagnetic torque ripple. In this paper, directtorque control for Induction Motors using MatrixConverters is analysed and points out the problem ofthe electromagnetic torque ripple which is one of themost important drawbacks of the Direct TorqueControl. Besides, the matrix converter is a single-stageac-ac power conversion device without dc-link energystorage elements. Matrix converter (MC may becomea good alternative to voltage-source inverter (VSI.This work combines the advantages of the matrixconverter with those of the DTC technique, generatingthe required voltage vectors under unity input powerfactor operation. Simulation results demonstrates theeffectiveness of the torque control.

Optimal Power Flow Modelling and Analysis of Hybrid AC-DC Grids with Offshore Wind Power Plant

DEFF Research Database (Denmark)

Dhua, Debasish; Huang, Shaojun; Wu, Qiuwei

2017-01-01

In order to develop renewables based energy systems, the installation of the offshore wind power plants (WPPs) is globally encouraged. However, wind power generation is intermittent and uncertain. An accurate modelling and evaluation reduces investment and provide better operation. Hence......, the wind power production level also plays a major role in a hybrid system on transmission loss evaluation. The developed model is tested in Low, Medium and High wind power production levels to determine the objective function of the OPF solution. MATLAB Optimization Toolbox and MATLAB script are used......, it is essential to develop a suitable model and apply optimization algorithms for different application scenarios. The objective of this work is to develop a generalized model and evaluate the Optimal Power Flow (OPF) solutions in a hybrid AC/DC system including HVDC (LCC based) and offshore WPP (VSC based...

Artificial Neural Network Algorithm for Condition Monitoring of DC-link Capacitors Based on Capacitance Estimation

DEFF Research Database (Denmark)

Soliman, Hammam Abdelaal Hammam; Wang, Huai; Gadalla, Brwene Salah Abdelkarim

2015-01-01

challenges. A capacitance estimation method based on Artificial Neural Network (ANN) algorithm is therefore proposed in this paper. The implemented ANN estimated the capacitance of the DC-link capacitor in a back-toback converter. Analysis of the error of the capacitance estimation is also given......In power electronic converters, reliability of DC-link capacitors is one of the critical issues. The estimation of their health status as an application of condition monitoring have been an attractive subject for industrial field and hence for the academic research filed as well. More reliable...... solutions are required to be adopted by the industry applications in which usage of extra hardware, increased cost, and low estimation accuracy are the main challenges. Therefore, development of new condition monitoring methods based on software solutions could be the new era that covers the aforementioned...

AC Conductivity and Dielectric Properties of Borotellurite Glass

Science.gov (United States)

Taha, T. A.; Azab, A. A.

2016-10-01

Borotellurite glasses with formula 60B2O3-10ZnO-(30 - x)NaF- xTeO2 ( x = 0 mol.%, 5 mol.%, 10 mol.%, and 15 mol.%) have been synthesized by thermal melting. X-ray diffraction (XRD) analysis confirmed that the glasses were amorphous. The glass density ( ρ) was determined by the Archimedes method at room temperature. The density ( ρ) and molar volume ( V m) were found to increase with increasing TeO2 content. The direct-current (DC) conductivity was measured in the temperature range from 473 K to 623 K, in which the electrical activation energy of ionic conduction increased from 0.27 eV to 0.48 eV with increasing TeO2 content from 0 mol.% to 15 mol.%. The dielectric parameters and alternating-current (AC) conductivity ( σ ac) were investigated in the frequency range from 1 kHz to 1 MHz and temperature range from 300 K to 633 K. The AC conductivity and dielectric constant decreased with increasing TeO2 content from 0 mol.% to 15 mol.%.

Effects of direct and alternating current on the treatment of oily water in an electroflocculation process

Directory of Open Access Journals (Sweden)

A. A. Cerqueira

2014-09-01

Full Text Available In the direct current mode (DC, widely used in electroflocculation (EC, the formation of an impermeable oxide layer on the cathode causes the declining of the efficiency of this process. This disadvantage has been reduced by adopting alternating current (AC. In this study, the effects of AC and DC on operational parameters such as the removal of oils and greases (O&G, color and turbidity from oil-in-water (O/W emulsions of the petroleum industry using aluminum electrodes were investigated. Removal efficiencies of 95%, 97% and 99% of O&G, color and turbidity with energy consumption of 0.280 kWh/m³ and electrode consumption of 0.12 g and 0.18 g were achieved at a current density of 3 A, operation time of 3 minutes and initial pH of 9.0 using AC and DC, respectively. In continuous flow tests performed with the same experimental conditions, the electrode consumption at times up to 60 minutes were 1.6 g and 3.4 g using AC and DC, respectively.

Capacitance Estimation for DC-link Capacitors in a Back-to-Back Converter Based on Artificial Neural Network Algorithm

DEFF Research Database (Denmark)

Soliman, Hammam Abdelaal Hammam; Wang, Huai; Blaabjerg, Frede

2016-01-01

of the aforementioned challenges and shortcomings. In this paper, a pure software condition monitoring method based on Artificial Neural Network (ANN) algorithm is proposed. The implemented ANN estimates the capacitance of the dc-link capacitor in a back-to-back converter. The error analysis of the estimated results......The reliability of dc-link capacitors in power electronic converters is one of the critical aspects to be considered in modern power converter design. The observation of their ageing process and the estimation of their health status have been an attractive subject for the industrial field and hence...

DC Pollution of AC Mains due to modern compact fluorescent light lamps and LED lamps

NARCIS (Netherlands)

Keyer, Cornelis H.A.; Timens, R.B.; Buesink, Frederik Johannes Karel; Leferink, Frank Bernardus Johannes

2013-01-01

Modern so-called energy efficient equipment often draw current only during a very short period of the period of a power supply mains. This is causing unwanted non-sinusoidal and harmonic currents. In some cases even a single diode is used for rectification causing direct current (DC) in the mains

Control of a high-speed switched reluctance machine using only the DC-link measurements

NARCIS (Netherlands)

Marinkov, Sava; De Jager, Bram

2015-01-01

In this paper we present a novel speed control strategy for a high-speed Switched Reluctance Machine that uses only the DC-link voltage and current measurements. This eliminates a number of hardware components such as position, speed, phase current and phase voltage sensors. It further lowers the

A CMOS integrated voltage and power efficient AC/DC converter for energy harvesting applications

International Nuclear Information System (INIS)

Peters, Christian; Ortmanns, Maurits; Manoli, Yiannos; Spreemann, Dirk

2008-01-01

In this paper, a fully CMOS integrated active AC/DC converter for energy harvesting applications is presented. The rectifier is realized in a standard 0.35 µm CMOS process without special process options. It works as a full wave rectifier and can be separated into two stages—one passive and one active. The active part is powered from the storage capacitor and consumes about 600 nA at 2 V supply. The input voltage amplitude range is between 1.25 and 3.75 V, and the operating frequency range is from 1 Hz to as much as several 100 kHz. The series voltage drop over the rectifier is less than 20 mV. Measurements in combination with an electromagnetic harvester show a significant increase in the achievable output voltage and power compared to a common, discrete Schottky diode rectifier. The measured efficiency of the rectifier is over 95%. Measurements show a negligible temperature influence on the output voltage between −40 °C and +125 °C

Impact of ac/dc spark anodizing on the corrosion resistance of Al-Cu alloys

Energy Technology Data Exchange (ETDEWEB)

Alsrayheen, Enam, E-mail: ealsrayh@ucalgary.ca [Department of Chemistry, University of Calgary, 2500 University Drive NW, Calgary AB, T2N 1N4 (Canada); McLeod, Eric, E-mail: hmolero@ucalgary.ca [Department of Chemistry, University of Calgary, 2500 University Drive NW, Calgary AB, T2N 1N4 (Canada); Rateick, Richard, E-mail: richard.rateick@honeywell.com [Department of Chemistry, University of Calgary, 2500 University Drive NW, Calgary AB, T2N 1N4 (Canada); Molero, Hebert, E-mail: Eric.McLeod@stmu.ab.ca [Department of Chemistry, University of Calgary, 2500 University Drive NW, Calgary AB, T2N 1N4 (Canada); Birss, Viola, E-mail: birss@ucalgary.ca [Department of Chemistry, University of Calgary, 2500 University Drive NW, Calgary AB, T2N 1N4 (Canada)

2011-07-01

An ac/dc spark anodization method was used to deposit an oxide film (6 {+-} 3 {mu}m in thickness) on the Al-Cu alloy AA2219. The oxide films were formed at 10 mA/cm{sup 2} for 30 min in an alkaline silicate solution, showing three main stages of growth. Scanning electron microscopy and electron microprobe analysis revealed that the oxide films are not uniform and consist of three main layers, an inner Al-rich barrier layer ({approx}1 {mu}m), an intermediate Al-Si mixed oxide layer ({approx}2 {+-} 1 {mu}m), and an outer porous Si-rich layer ({approx}3 {+-} 3 {mu}m). In addition, microscopic analysis showed that the Al{sub 2}Cu intermetallics present in the alloy have not been excessively oxidized during the anodization process and thus are retained beneath the oxide film, as desired. The coating passivity and corrosion resistance, evaluated using linear sweep voltammetry (LSV) in pH 7 borate buffer solution and electrochemical impedance spectroscopy (EIS) in 0.86 M NaCl solution, respectively, were both significantly improved after spark-anodization.

Controller design and stability analysis of grid connected DC microgrid

DEFF Research Database (Denmark)

Chauhan, Rajeev Kumar; Chauhan, Kalpana; Guerrero, Josep M.

2018-01-01

DC microgrids are desired to provide the electricity for the remote areas which are far from the main grid. The microgrid gets popularity because DC power sources such as photovoltaics (PVs), battery banks, and fuel cells can be interconnected without AC/DC converters. The stochastic nature of PV...

Preliminary design of the ITER AC/DC converters supplied by the Korean Domestic Agency

International Nuclear Information System (INIS)

Oh, J.S.; Choi, J.; Suh, J.H.; Liu, H.; Hwang, K.; Chung, I.; Lee, S.; Kang, J.; Park, H.; Jung, W.; Jo, S.; Gweon, H.; Lee, Y.; Lee, W.; Kim, J.B.; Han, S.H.; Hong, G.D.; Lee, J.S.; Lee, B.W.; Yeo, C.H.

2013-01-01

Highlights: ► A self-supporting aluminium structure and symmetrical thyristor assembly are devised to assure a strong and reliable ITER converter. ► Converters are designed to be installable in a compact space with three times higher power density than normal industrial installations. ► Heating of the building structure due to high magnetic field by converters are identified and certain solutions are addressed in the building design. ► A cooperative fast control scheme is adopted to compensate fast reactive power change of up to the level of 900 Mvar. -- Abstract: The preliminary design for ITER AC/DC converters under the responsibility of the Korean Domestic Agency is performed on the basis of the engineering experience of previous R and D for a full-scale 6-pulse CS (Central Solenoid) converter unit. This paper describes key features of the preliminary design for the respective sub-systems; integrated self-supporting aluminium structure and symmetrical thyristor assembly for strong and reliable converters, optimised impedance of the converter transformer to limit short circuit current, coaxial-type AC bus bars to shield high magnetic field around wall penetrations, compact components to fit into given building space. The insulation and the minimisation of electrical loops of concrete rebar below the converter installations are essential to prevent floor heating. Required output voltage or current of converters is provided by a conventional controller. A master controller is designed to collect predicted reactive powers from each converter and deliver processed data to the reactive power compensation (RPC) system to improve the regulation speed of the RPC controller with fast feed-forward compensation under fast reactive power transients

Preliminary design of the ITER AC/DC converters supplied by the Korean Domestic Agency

Energy Technology Data Exchange (ETDEWEB)

Oh, J.S., E-mail: jsoh@nfri.re.kr [ITER Korea, National Fusion Research Institute, Daejeon 305-806 (Korea, Republic of); Choi, J.; Suh, J.H. [ITER Korea, National Fusion Research Institute, Daejeon 305-806 (Korea, Republic of); Liu, H.; Hwang, K.; Chung, I.; Lee, S.; Kang, J.; Park, H.; Jung, W.; Jo, S.; Gweon, H.; Lee, Y.; Lee, W. [Dawonsys Corp., Siheung 429-450 (Korea, Republic of); Kim, J.B.; Han, S.H.; Hong, G.D.; Lee, J.S.; Lee, B.W.; Yeo, C.H. [Hyosung Corp., 450, Gongdeok-Dong, Seoul 121-720 (Korea, Republic of); and others

2013-10-15

Highlights: ► A self-supporting aluminium structure and symmetrical thyristor assembly are devised to assure a strong and reliable ITER converter. ► Converters are designed to be installable in a compact space with three times higher power density than normal industrial installations. ► Heating of the building structure due to high magnetic field by converters are identified and certain solutions are addressed in the building design. ► A cooperative fast control scheme is adopted to compensate fast reactive power change of up to the level of 900 Mvar. -- Abstract: The preliminary design for ITER AC/DC converters under the responsibility of the Korean Domestic Agency is performed on the basis of the engineering experience of previous R and D for a full-scale 6-pulse CS (Central Solenoid) converter unit. This paper describes key features of the preliminary design for the respective sub-systems; integrated self-supporting aluminium structure and symmetrical thyristor assembly for strong and reliable converters, optimised impedance of the converter transformer to limit short circuit current, coaxial-type AC bus bars to shield high magnetic field around wall penetrations, compact components to fit into given building space. The insulation and the minimisation of electrical loops of concrete rebar below the converter installations are essential to prevent floor heating. Required output voltage or current of converters is provided by a conventional controller. A master controller is designed to collect predicted reactive powers from each converter and deliver processed data to the reactive power compensation (RPC) system to improve the regulation speed of the RPC controller with fast feed-forward compensation under fast reactive power transients.

Space Vector Modulation for DC-Link Current Ripple Reduction in Back-To-Back Current Source Converters for Microgrid Applications

DEFF Research Database (Denmark)

Guo, Xiaoqiang; Xu, David; Guerrero, Josep M.

2015-01-01

Back-to-back converters have been typically used to interconnect the microgrids. For a back-to-back current source converter, the dc-link current ripple is one of the important parameters. A large ripple will cause the electromagnetic interference, undesirable high-frequency losses, and system...... instability. Conventionally, with a given switching frequency and rated voltage, the current ripple can be reduced by increasing the dc-link inductor, but it leads to bulky size, high cost and slow dynamic response. In order to solve this problem, this paper reveals that the current ripple can...

Operation strategy for grid-tied DC-coupling power converter interface integrating wind/solar/battery

Science.gov (United States)

Jou, H. L.; Wu, J. C.; Lin, J. H.; Su, W. N.; Wu, T. S.; Lin, Y. T.

2017-11-01

The operation strategy for a small-capacity grid-tied DC-coupling power converter interface (GDPCI) integrating wind energy, solar energy and battery energy storage is proposed. The GDPCI is composed of a wind generator, a solar module set a battery bank, a boost DC-DC power converter (DDPC), a bidirectional DDPC power converter, an AC-DC power converter (ADPC) and a five-level DC-AC inverter (DAI). A solar module set, a wind generator and a battery bank are coupled to the common DC bus through the boost DDPC, the ADPC and the bidirectional DDPC, respectively. For verifying the performance of the GDPCI under different operation modes, computer simulation is carried out by PSIM.

Hybrid PV/wind system with quinary asymmetric inverter without increasing DC-link number

Directory of Open Access Journals (Sweden)

Aida Baghbany Oskouei

2016-06-01

Full Text Available This paper suggests quinary asymmetric inverter with coupled inductors and transformer, and uses it in hybrid system including photovoltaic (PV and wind. This inverter produces twenty-five-level voltage in addition to merits of multilevel inverter, has only one DC source. Then, it is adequate for hybrid systems, which prevents increasing DC-link and makes control of system easy. Proposed structure also provides isolation in the system and the switch numbers are reduced in this topology compared with other multilevel structures. In this system, battery is used as backup, where PV and wind have complementary nature. The performance of proposed inverter and hybrid system is validated with simulation results using MATLAB/SIMULINK software and experimental results based PCI-1716 data acquisition system.

Modular AC Nano-Grid with Four-Quadrant Micro-Inverters and High-Efficiency DC-DC Conversion

Science.gov (United States)

Poshtkouhi, Shahab

A significant portion of the population in developing countries live in remote communities, where the power infrastructure and the required capital investment to set up local grids do not exist. This is due to the fuel shipment and utilization costs required for fossil fuel based generators, which are traditionally used in these local grids, as well as high upfront costs associated with the centralized Energy Storage Systems (ESS). This dissertation targets modular AC nano-grids for these remote communities developed at minimal capital cost, where the generators are replaced with multiple inverters, connected to either Photovoltaic (PV) or battery modules, which can be gradually added to the nano-grid. A distributed droop-based control architecture is presented for the PV and battery Micro-Inverters (MIV) in order to achieve frequency and voltage stability, as well as active and reactive power sharing. The nano-grid voltage is regulated collectively in either one of four operational regions. Effective load sharing and transient handling are demonstrated experimentally by forming a nano-grid which consists of two custom 500 W MIVs. The MIVs forming the nano-grid have to meet certain requirements. A two-stage MIV architecture and control scheme with four-quadrant power-flow between the nano-grid, the PV/battery and optional short-term storage is presented. The short-term storage is realized using high energy-density Lithium-Ion Capacitor (LIC) technology. A real-time power smoothing algorithm utilizing LIC modules is developed and tested, while the performance of the 100 W MIV is experimentally verified under closed-loop dynamic conditions. Two main limitations of the DAB topology, as the core of the MIV architecture's dc-dc stage, are addressed: 1) This topology demonstrates poor efficiency and limited regulation accuracy at low power. These are improved by introducing a modified topology to operate the DAB in Flyback mode, achieving up to an 8% increase in

Universality of ac conduction in disordered solids

DEFF Research Database (Denmark)

Dyre, Jeppe; Schrøder, Thomas

2000-01-01

The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

Distributed Control for Paralleled PWM Inverters in the DC Zonal Distribution System

National Research Council Canada - National Science Library

Marinac, Mark

1999-01-01

.... The advantages of DC ZEDS will be exploited in the next class of surface combatants. Part of the development research for DC ZEDS includes the design of autonomous DC-to-AC inverter modules having robust load sharing capability...

Control of a hybrid HVDC link to increase inter-regional power transfer

DEFF Research Database (Denmark)

Kotb, Omar; Ghandhari, Mehrdad; Eriksson, Robert

2016-01-01

This paper examines the application of a hybrid HVDC link in a two area power system with the purpose of increasing the inter-regional power transfer. A hybrid HVDC system combines both LCCs and VSCs, and hence it is capable of combining the benefits of both converter technologies, such as reduced...... cost and power losses due to the LCCs, and ability to connect to weak AC grids due to the VSCs. The mathematical model of the power system including the HVDC link is presented. The increase in inter-area power transfer is demonstrated and compared to the case when the hybrid HVDC link is not used....... Furthermore, the transient stability of the AC/DC power system was enhanced using auxiliary controllers for Power Oscillation Damping (POD). The results show the ability of the hybrid HVDC link to increase the unidirectional inter-area power transfer, while enhancing the transient stability of the power...

Introduction to AC machine design

CERN Document Server

Lipo, Thomas A

2018-01-01

AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...

Optimizing Inductor Winding Geometry for Lowest DC-Resistance using LiveLink between COMSOL and MATLAB

DEFF Research Database (Denmark)

Schneider, Henrik; Andersen, Thomas; Mønster, Jakob Døllner

2013-01-01

An optimization routine is presented to optimize a hybrid winding geometry for a toroid inductor in terms of the DC resistance. The hybrid winding geometry consist of bended foil pieces connected through traces in a printed circuit board. MATLAB is used to create a graphical user interface...... that visually plots the winding using input parameters such as core dimensions, number of turns, clearance between windings, and the winding angle of each segment of the winding. COMSOL LiveLink is used to import the winding geometry from MATLAB and create a 2D finite element model to simulate the DC...

AC Conductivity Studies of Lithium Based Phospho Vanadate Glasses

International Nuclear Information System (INIS)

Nagendra, K.; Babu, G. Satish; Gowda, Veeranna; Reddy, C. Narayana

2011-01-01

Glasses in the system xLi 2 SO 4 -20Li 2 O-(80-x) [80P 2 O 5 -20V 2 O 5 ](5≥x≥20 mol%) has been prepared by melt quenching method. Dc and ac conductivity has been studied over a wide range of frequency (10 Hz to 10 MHz) and temperature (298 K-523 K). The dc conductivity found to increase with increase of Li 2 SO 4 concentration. The ac conductivities have been fitted to the Almond-West type single power law equation σ(ω) = σ(0)+Aω s where 's' is the power law exponent. The ac conductivity found to increase with increase of Li 2 SO 4 concentration. An attempt is made to elucidate the enhancement of lithium ion conduction in phosphor-vanadate glasses by considering the expansion of network structure.

A Three-Phase Boost DC-AC Converter | Odeh | Nigerian Journal of ...

African Journals Online (AJOL)

Sliding mode controllers are designed to perform a robust control for the three boost dc-dc converters. Computer simulations and spectral analysis demonstrate the feasibility of the proposed three-phase inverter. The inverter is intended to be used in three-phase electric drives and uninterruptible power supply (UPS) ...

DC Microgrids Scoping Study. Estimate of Technical and Economic Benefits

Energy Technology Data Exchange (ETDEWEB)

Backhaus, Scott N. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Swift, Gregory William [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Chatzivasileiadis, Spyridon [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Tschudi, William [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Glover, Steven [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Starke, Michael [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wang, Jianhui [Argonne National Lab. (ANL), Argonne, IL (United States); Yue, Meng [Brookhaven National Lab. (BNL), Upton, NY (United States); Hammerstrom, Donald [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

2015-03-23

Microgrid demonstrations and deployments are expanding in US power systems and around the world. Although goals are specific to each site, these microgrids have demonstrated the ability to provide higher reliability and higher power quality than utility power systems and improved energy utilization. The vast majority of these microgrids are based on AC power transfer because this has been the traditionally dominant power delivery scheme. Independently, manufacturers, power system designers and researchers are demonstrating and deploying DC power distribution systems for applications where the end-use loads are natively DC, e.g., computers, solid-state lighting, and building networks. These early DC applications may provide higher efficiency, added flexibility, reduced capital costs over their AC counterparts. Further, when onsite renewable generation, electric vehicles and storage systems are present, DC-based microgrids may offer additional benefits. Early successes from these efforts raises a question - can a combination of microgrid concepts and DC distribution systems provide added benefits beyond what has been achieved individually?

Study of the Effect of Transport Current and Combined Transverse and Longitudinal Fields on the AC Loss in NET Prototype Conductors

NARCIS (Netherlands)

Nijhuis, Arend; ten Kate, Herman H.J.

1994-01-01

AC losses in cables carrying DC as well as AC transport currents at different DC background fields up to 2T have been measured on three types of Nb3Sn subcables in a new test facility. In this facility it is possible to apply sinusoidal transverse AC fields up to dB/dt=5T/s and longitudinal AC

Simulation of the AC corona phenomenon with experimental validation

International Nuclear Information System (INIS)

Villa, Andrea; Barbieri, Luca; Marco, Gondola; Malgesini, Roberto; Leon-Garzon, Andres R

2017-01-01

The corona effect, and in particular the Trichel phenomenon, is an important aspect of plasma physics with many technical applications, such as pollution reduction, surface and medical treatments. This phenomenon is also associated with components used in the power industry where it is, in many cases, the source of electro-magnetic disturbance, noise and production of undesired chemically active species. Despite the power industry to date using mainly alternating current (AC) transmission, most of the studies related to the corona effect have been carried out with direct current (DC) sources. Therefore, there is technical interest in validating numerical codes capable of simulating the AC phenomenon. In this work we describe a set of partial differential equations that are comprehensive enough to reproduce the distinctive features of the corona in an AC regime. The model embeds some selectable chemical databases, comprising tens of chemical species and hundreds of reactions, the thermal dynamics of neutral species and photoionization. A large set of parameters—deduced from experiments and numerical estimations—are compared, to assess the effectiveness of the proposed approach. (paper)

Verification of Safety Margins of Battery Banks Capacity of Class 1E DC System in a Nuclear Power Plant

International Nuclear Information System (INIS)

Lukman, Abdulrauf; Zhu, Oon-Pyo

2015-01-01

According to Ref 'Station blackout (SBO) is generally a plant condition with complete loss of all alternating current (AC) power from off-site sources, from the main generator and from standby AC power sources important to safety to the essential and nonessential switchgear buses. Direct current (DC) power supplies and uninterruptible AC power supplies may be available as long as batteries can supply the loads, alternate AC power supplies are available'. The above IAEA document indicated the importance of batteries during SBO. Prior to the Fukushima accident, most batteries might be designed with coping capability of four hours. However, the accident showed the need for the coping capability to be increased to at least eight hours. The purpose of this research is to verify the safety capacity margin of the nuclear qualified battery banks of class 1E DC system and test the response to SBO using the load profile of a Korean design nuclear power plant (NPP). The capacity margins of class 1E batteries of DC power system batteries in a nuclear power plant were determined using the load profile of the plant. It was observed that if appropriate manufacturer Kt data are not available, the accuracy of the battery capacity might not be accurately calculated. The result obtained shows that the batteries have the coping capability of two hours for channel A and B, and eight hours for channel C and D. Also capacity margin as show in figure show a reasonable margin for each batteries of the DC system

Reducing AC-Winding Losses in High-Current High-Power Inductors

DEFF Research Database (Denmark)

Nymand, Morten; Madawala, Udaya K.; Andersen, Michael Andreas E.

2009-01-01

Foil windings are preferable in high-current high-power inductors to realize compact designs and to reduce dc-current losses. At high frequency, however, proximity effect will cause very significant increase in ac resistance in multi-layer windings, and lead to high ac winding losses. This paper ...

Two coupled Josephson junctions: dc voltage controlled by biharmonic current

International Nuclear Information System (INIS)

Machura, L; Spiechowicz, J; Kostur, M; Łuczka, J

2012-01-01

We study transport properties of two Josephson junctions coupled by an external shunt resistance. One of the junctions (say, the first) is driven by an unbiased ac current consisting of two harmonics. The device can rectify the ac current yielding a dc voltage across the first junction. For some values of coupling strength, controlled by an external shunt resistance, a dc voltage across the second junction can be generated. By variation of system parameters such as the relative phase or frequency of two harmonics, one can conveniently manipulate both voltages with high efficiency, e.g. changing the dc voltages across the first and second junctions from positive to negative values and vice versa. (paper)

Technical report on dc power supplies in nuclear power plants

International Nuclear Information System (INIS)

1977-06-01

Emergency electrical power supplies, both a.c. and d.c. for nuclear power plants are important to safety. For this reason, the electric power systems for operating nuclear plants and those plants under licensing review have been required to provide a high degree of reliability. It is this high reliability that provides confidence that sufficient safety margin exists against loss of all d.c. power for extended periods of time to allow an orderly examination of safety issues, such as this. However, because of the importance of the a.c. and d.c. power systems, the staff has been expending effort to review the reliability of these systems and shall continue to do so in the future

Study of the Dependency on Magnetic Field and Bias Voltage of an AC-Biased TES Microcalorimeter

Science.gov (United States)

Gottardi, L.; Bruijn, M.; denHartog, R.; Hoevers, H.; deKorte, P.; vanderKuur, J.; Linderman, M.; Adams, J.; Bailey, C.; Bandler, S.;

Analysis of DC/DC Converter Efficiency for Energy Storage System Based on Bidirectional Fuel Cells

DEFF Research Database (Denmark)

Pittini, Riccardo; Zhang, Zhe; Andersen, Michael A. E.

2013-01-01

interface to the grid. In power electronics, the converter efficiency is characterized at fixed operating voltage for various output power. This type of characterization is not suitable for fuel cells, since as the power from the fuel cell increases, the cell voltage decreases. This paper analyses how......Renewable energy sources are fluctuating depending on the availability of the energy source. For this reason, energy storage is becoming more important and bidirectional fuel cells represent an attractive technology. Fuel cells require highcurrent low-voltage dc-dc or dc-ac converters as power...... the fuel cell I-V characteristics influences the power electronics converter efficiency and their consequence on the overall system. A loaddependent efficiency curve is presented based on experimental results from a 6 kW dc-dc converter prototype including the most suitable control strategy which maximizes...

The performance of the DC motor by the PID controlling PWM DC-DC boost converter

OpenAIRE

Can, Erol; Sayan, Hasan Hüseyin

2017-01-01

This paper presents the PID controlling direct current (DC) to the direct current boost converter feds DC motor which has a 3.68 kW and 240 V of DC voltage input on its characteristics. What is first formed is the boost converter mathematical model at the design stage. Secondly, a mathematical model of the DC motor is created so that the boost converter with the machine can be established and modeled at the Matlab Simulink. The PID controller is considered for arranging a pulse width modulati...

DC bias effect on alternating current electrical conductivity of poly(ethylene terephthalate)/alumina nanocomposites

International Nuclear Information System (INIS)

Nikam, Pravin N.; Deshpande, Vineeta D.

2016-01-01

Polymer nanocomposites based on metal oxide (ceramic) nanoparticles are a new class of materials with unique properties and designed for various applications such as electronic device packaging, insulation, fabrication and automotive industries. Poly(ethylene terephthalate) (PET)/alumina (Al_2O_3) nanocomposites with filler content between 1 wt% and 5 wt% were prepared by melt compounding method using co-rotating twin screw extruder and characterized by scanning electron microscopy (SEM), transmission electron microscopy (TEM) and precision LCR meter techniques. The results revealed that proper uniform dispersion at lower content up to 2 wt% of nano-alumina observed by using TEM. Aggregation of nanoparticles was observed at higher content of alumina examined by using SEM and TEM. The frequency dependences of the alternating current (AC) conductivity (σ_A_C) of PET/alumina nanocomposites on the filler content and DC bias were investigated in the frequency range of 20Hz - 1MHz. The results showed that the AC and direct current (DC) conductivity increases with increasing DC bias and nano-alumina content upto 3 wt%. It follows the Jonscher’s universal power law of solids. It revealed that σ_A_C of PET/alumina nanocomposites can be well characterized by the DC conductivity (σ_D_C), critical frequency (ω_c), critical exponent of the power law (s). Roll of DC bias potential led to an increase of DC conductivity (σ_D_C) due to the creation of additional conducting paths with the polymer nanocomposites and percolation behavior achieved through co-continuous morphology.

A Transient Fault Recognition Method for an AC-DC Hybrid Transmission System Based on MMC Information Fusion

Directory of Open Access Journals (Sweden)

Jikai Chen

2016-12-01

Full Text Available At present, the research is still in the primary stage in the process of fault disturbance energy transfer in the multilevel modular converter based high voltage direct current (HVDC-MMC. An urgent problem is how to extract and analyze the fault features hidden in MMC electrical information in further studies on the HVDC system. Aiming at the above, this article analyzes the influence of AC transient disturbance on electrical signals of MMC. At the same time, it is found that the energy distribution of electrical signals in MMC is different for different arms in the same frequency bands after the discrete wavelet packet transformation (DWPT. Renyi wavelet packet energy entropy (RWPEE and Renyi wavelet packet time entropy (RWPTE are proposed and applied to AC transient fault feature extraction from electrical signals in MMC. Using the feature extraction results of Renyi wavelet packet entropy (RWPE, a novel recognition method is put forward to recognize AC transient faults using the information fusion technology. Theoretical analysis and experimental results show that the proposed method is available to recognize transient AC faults.

Magnetization reversal of Co-based amorphous wires induced by longitudinal AC magnetic field

Energy Technology Data Exchange (ETDEWEB)

Perov, N.S.; Antonov, A.S.; Buznikov, N.A.; Granovsky, A.B. E-mail: granov@magn.ru; Iakubov, I.T.; Kartashov, M.A.; Rakhmanov, A.A

2004-05-01

The remagnetization process in CoFeSiB amorphous wires under influence of a high-amplitude AC longitudinal magnetic field is studied. The frequency spectra of the voltage at the wire ends are measured as a function of a longitudinal DC magnetic field and the AC field amplitude. A high sensitivity of the voltage harmonics to the DC magnetic field is demonstrated. The experimental results are interpreted within a simple rotational model.

Magnetization reversal of Co-based amorphous wires induced by longitudinal AC magnetic field

International Nuclear Information System (INIS)

Perov, N.S.; Antonov, A.S.; Buznikov, N.A.; Granovsky, A.B.; Iakubov, I.T.; Kartashov, M.A.; Rakhmanov, A.A.

2004-01-01

The remagnetization process in CoFeSiB amorphous wires under influence of a high-amplitude AC longitudinal magnetic field is studied. The frequency spectra of the voltage at the wire ends are measured as a function of a longitudinal DC magnetic field and the AC field amplitude. A high sensitivity of the voltage harmonics to the DC magnetic field is demonstrated. The experimental results are interpreted within a simple rotational model

Independent control strategy of two DC-link voltages for separate MPPTs in transformerless photovoltaic systems using neutral-point-clamped inverters

DEFF Research Database (Denmark)

Choi, Uimin; Blaabjerg, Frede; Lee, Kyo-Beum

2014-01-01

To improve the efficiency of the photovoltaic (PV) system, the centralized topology using three-level inverters are widely used. In this system, PV modules are separately connected to the split DC-links. This causes a decrease of maximum power point tracking (MPPT) efficiency under the partial...... shading condition. This paper proposes an independent control of two DC-link voltages for separate MPPT of each PV module in three-level inverters. The proposed method is simply implemented by adding or subtracting the time-offset to the three-phase turn-on times and modifying the reference voltages...

System and Battery Charge Control for PV-Powered AC Lighting Systems

Energy Technology Data Exchange (ETDEWEB)

Kern, G.

1999-04-01

This report reviews a number of issues specific to stand-alone AC lighting systems. A review of AC lighting technology is presented, which discusses the advantages and disadvantages of various lamps. The best lamps for small lighting systems are compact fluorescent. The best lamps for intermediate-size systems are high- or low-pressure sodium. Specifications for battery charging and load control are provided with the goal of achieving lamp lifetimes on the order of 16,000 to 24,000 hours and battery lifetimes of 4 to 5 years. A rough estimate of the potential domestic and global markets for stand-alone AC lighting systems is presented. DC current injection tests were performed on high-pressure sodium lamps and the test results are presented. Finally, a prototype system was designed and a prototype system controller (with battery charger and DC/AC inverter) was developed and built.

Effects of alternating and direct current in electrocoagulation process on the removal of cadmium from water