Sterile Neutrino Searches in MINOS and MINOS+ Experiments
International Nuclear Information System (INIS)
Huang, Junting
2015-01-01
This dissertation presents the searches on sterile neutrinos using the data collected in MINOS+ Experiment from September 2013 to September 2014, and the full data set of MINOS Experiment collected from 2005 to 2012. Anomalies in short baseline experiments, such as LSND and MiniBooNE, showed hints of sterile neutrinos, a type of neutrino that does not interact with the Standard Model particles. In this work, two models are considered: 3+1 and large extra dimension (LED). In the 3+1 model, one sterile neutrino state is added into the standard oscillation scheme consisting of three known active neutrino states v e , v μ and v τ . In the LED model, sterile neutrinos arise as Kaluza-Klein (KK) states due to assumed large extra dimensions. Mixing between sterile and active neutrino states may modify the oscillation patterns observed in the MINOS detectors. Both searches yield null results. For 3+1, a combined fit of MINOS and MINOS+ data gives a stronger limit on θ 24 in the range of 10 -2 eV 2 < Δm 43 2 < 1 eV 2 than previous experiments. For LED, with the complete MINOS data set, the size of extra dimensions is constrained to be smaller than ~ 0.35 μm at 90% C.L. in the limit of a vanishing lightest neutrino mass.
Sterile Neutrino Searches in MINOS and MINOS+ Experiments
Energy Technology Data Exchange (ETDEWEB)
Huang, Junting [Univ. of Texas, Austin, TX (United States)
2015-05-01
This dissertation presents the searches on sterile neutrinos using the data collected in MINOS+ Experiment from September 2013 to September 2014, and the full data set of MINOS Experiment collected from 2005 to 2012. Anomalies in short baseline experiments, such as LSND and MiniBooNE, showed hints of sterile neutrinos, a type of neutrino that does not interact with the Standard Model particles. In this work, two models are considered: 3+1 and large extra dimension (LED). In the 3+1 model, one sterile neutrino state is added into the standard oscillation scheme consisting of three known active neutrino states ve, vμ and vτ. In the LED model, sterile neutrinos arise as Kaluza-Klein (KK) states due to assumed large extra dimensions. Mixing between sterile and active neutrino states may modify the oscillation patterns observed in the MINOS detectors. Both searches yield null results. For 3+1, a combined fit of MINOS and MINOS+ data gives a stronger limit on θ24 in the range of 10-2 eV2 < Δm412 < 1 eV2 than previous experiments. For LED, with the complete MINOS data set, the size of extra dimensions is constrained to be smaller than ~ 0.35 μm at 90% C.L. in the limit of a vanishing lightest neutrino mass.
Energy Technology Data Exchange (ETDEWEB)
Koskinen, David Jason [Univ. College London, Bloomsbury (United Kingdom)
2009-02-01
The Main Injector Neutrino Oscillation Search (MINOS) is a long-baseline accelerator neutrino experiment designed to measure properties of neutrino oscillation. Using a high intensity muon neutrino beam, produced by the Neutrinos at Main Injector (NuMI) complex at Fermilab, MINOS makes two measurements of neutrino interactions. The first measurement is made using the Near Detector situated at Fermilab and the second is made using the Far Detector located in the Soudan Underground laboratory in northern Minnesota. The primary goal of MINOS is to verify, and measure the properties of, neutrino oscillation between the two detectors using the v μ→ Vτ transition. A complementary measurement can be made to search for the existence of sterile neutrinos; an oft theorized, but experimentally unvalidated particle. The following thesis will show the results of a sterile neutrino search using MINOS RunI and RunII data totaling ~2.5 x 1020 protons on target. Due to the theoretical nature of sterile neutrinos, complete formalism that covers transition probabilities for the three known active states with the addition of a sterile state is also presented.
A new monitoring data tool for MINOS+
International Nuclear Information System (INIS)
Castromonte, Cesar; Gomes, Ricardo A.
2013-01-01
Full text: Monitoring the data taking process is one of the most important and critical parts of every High Energy Physics (HEP) experiment. This guarantees the reliability and good quality of the data taken. It also allows detecting and tracking down the different problems associated with the detector operations. The MINOS+ experiment is the continuation of the former MINOS neutrino experiment, which operated from August 2003 to April 2012. MINOS+ will continue exposing the two MINOS detectors (Near and Far) to the NuMI muon neutrino beam for three years starting in 2013. The medium energy setting of the NuMI beam projected for NO νA will deliver about 18 X 10 20 protons-on-target during the first three years of operation. This will allow the MINOS Far Detector to collect more than 10,000 charged current muon neutrino events in the 4-10 GeV energy range, providing an accurate test for non-standard neutrino interactions, sterile neutrinos, extra dimensions, neutrino time-of-flight, and perhaps more. In this poster we show the full MINOS+ monitoring process, how this process is done, the several tools used to perform this task, and specially, the web monitoring data tool developed and implemented by the HEP group of the Federal University of Goiania as a contribution for the MINOS+ experiment. (author)
A new monitoring data tool for MINOS+
Energy Technology Data Exchange (ETDEWEB)
Castromonte, Cesar; Gomes, Ricardo A. [Universidade Federal de Goias, Goiania (Brazil)
2013-07-01
Full text: Monitoring the data taking process is one of the most important and critical parts of every High Energy Physics (HEP) experiment. This guarantees the reliability and good quality of the data taken. It also allows detecting and tracking down the different problems associated with the detector operations. The MINOS+ experiment is the continuation of the former MINOS neutrino experiment, which operated from August 2003 to April 2012. MINOS+ will continue exposing the two MINOS detectors (Near and Far) to the NuMI muon neutrino beam for three years starting in 2013. The medium energy setting of the NuMI beam projected for NO νA will deliver about 18 X 10{sup 20} protons-on-target during the first three years of operation. This will allow the MINOS Far Detector to collect more than 10,000 charged current muon neutrino events in the 4-10 GeV energy range, providing an accurate test for non-standard neutrino interactions, sterile neutrinos, extra dimensions, neutrino time-of-flight, and perhaps more. In this poster we show the full MINOS+ monitoring process, how this process is done, the several tools used to perform this task, and specially, the web monitoring data tool developed and implemented by the HEP group of the Federal University of Goiania as a contribution for the MINOS+ experiment. (author)
A search for sterile neutrinos in MINOS
International Nuclear Information System (INIS)
Osiecki, Thomas Henry
2007-01-01
MINOS, the Main Injector Neutrino Oscillation Search, is a long baseline neutrino oscillation experiment based at Fermilab National Accelerator Laboratory. The experiment uses a neutrino beam, which is measured 1 km downstream from its origin in the Near detector at Fermilab and then 735 km later in the Far detector at the Soudan mine. By comparing these two measurements, MINOS can attain a very high precision for parameters in the atmospheric sector of neutrino oscillations. In addition to precisely determining Δm 23 2 and θ 23 through the disappearance of ν μ , MINOS is able to measure ν μ → ν sterile by looking for a deficit in the number of neutral current interactions seen in the Far detector. In this thesis, we present the results of a search for sterile neutrinos in MINOS
A search for sterile neutrinos in MINOS
Energy Technology Data Exchange (ETDEWEB)
Osiecki, Thomas Henry [Univ. of Texas, Austin, TX (United States)
2007-01-01
MINOS, the Main Injector Neutrino Oscillation Search, is a long baseline neutrino oscillation experiment based at Fermilab National Accelerator Laboratory. The experiment uses a neutrino beam, which is measured 1 km downstream from its origin in the Near detector at Fermilab and then 735 km later in the Far detector at the Soudan mine. By comparing these two measurements, MINOS can attain a very high precision for parameters in the atmospheric sector of neutrino oscillations. In addition to precisely determining Δm$2\\atop{23}$ and θ23 through the disappearance of vμ, MINOS is able to measure vμ → vsterile by looking for a deficit in the number of neutral current interactions seen in the Far detector. In this thesis, we present the results of a search for sterile neutrinos in MINOS.
Electromagnetic interactions in the MINOS detectors
Energy Technology Data Exchange (ETDEWEB)
Vahle, Patricia LaVern [Univ. of Texas, Austin, TX (United States)
2004-08-01
MINoS is a long-baseline neutrino experiment designed to observe the oscillation of neutrinos traveling between two detectors, a Near Detector at Fermi National Accelerator Laboratory and a Far Detector at the Soudan Underground Laboratory in northern Minnesota. Precision measurement of the oscillation parameters requires a better than 5% absolute energy calibration with is derived using a dedicated calibration detector, called CalDet. A smaller version of the MINOS detectors, the CalDet was exposed to particular beams in the CERN PS East Area test beams in 2001-2003. This document describes the conditions under which the CalDet beam data were taken, establishes selection criteria to identify a sample of electrons, and discusses the characteristics of electromagnetic interactions in the CalDet.
Search for sterile neutrinos in MINOS and MINOS+ using a two-detector fit
Energy Technology Data Exchange (ETDEWEB)
Adamson, P.; et al.
2017-10-17
A search for mixing between active neutrinos and light sterile neutrinos has been performed by looking for muon neutrino disappearance in two detectors at baselines of 1.04 km and 735 km, using a combined MINOS and MINOS+ exposure of $16.36\\times10^{20}$ protons-on-target. A simultaneous fit to the charged-current muon neutrino and neutral-current neutrino energy spectra in the two detectors yields no evidence for sterile neutrino mixing using a 3+1 model. The most stringent limit to date is set on the mixing parameter $\\sin^2\\theta_{24}$ for most values of the sterile neutrino mass-splitting $\\Delta m^2_{41} > 10^{-4}$ eV$^2$.
Energy Technology Data Exchange (ETDEWEB)
Medeiros, Michelle Mesquita de [Federal Univ. of Goiás, Goiania, GO (Brazil)
2015-01-01
The MINOS (Main Injector Neutrino Oscillation Search) and MINOS+ experiments were designed to study neutrino oscillations using a muon neutrino beam which is detected in two different locations, in the Near Detector and in the Far Detector. The distance between the detectors allows the beam neutrinos to oscillate to a different flavor. Therefore, a disappearance of the muon neutrinos from the beam is observed in the Far Detector. The Far Detector has a special apparatus which makes possible the selection of atmospheric neutrinos and antineutrinos. These come from interactions of cosmic rays with the Earth’s atmosphere. Both detectors have a magnetic field, allowing the distiction between neutrinos and antineutrinos interactions. This thesis presents the first combined analysis of data from the MINOS and MINOS+ experiments. We have analyzed the combined neutrino energy spectrum from the complete MINOS beam data and the first, more energetic, MINOS+ beam data. The disappearance of the muon neutrinos was observed and the data has shown to be congruent with the oscillation model. Beyond that, we have measured the atmospheric oscillation parameters of the beam and atmospheric neutrinos and antineutrinos from MINOS combined with the atmospheric neutrinos and antineutrinos from MINOS+. Assuming the same oscillation parameters for both neutrinos and antineutrinos, the best fit is obtained for inverted hierarchy and lower octant with Δm2 32 = 2:37 X 10-3 eV2 and sin2 θ 23 = 0:43, and the limits m2 32 = [2,29 - 2,49] 10-3 eV2 (68%) and sin2 θ23 = 0.36 - 0.66 (90%). These results are the most precise measurement of the neutrinos mass splitting using muon neutrino disappearance data only.
Electron Neutrino Appearance in the MINOS Experiment
Energy Technology Data Exchange (ETDEWEB)
Holin, Anna Maria [Univ. College London, Bloomsbury (United Kingdom)
2010-02-01
The MINOS experiment is a long-baseline neutrino oscillation experiment which sends a high intensity muon neutrino beam through two functionally identical detectors, a Near detector at the Fermi National Accelerator Laboratory in Illinois, 1km from the beam source, and a Far detector, 734km away, in the Soudan Mine in Minnesota. MINOS may be able to measure the neutrino mixing angle parameter sin2 2θ 13 for the rst time. Detector granularity, however, makes it very hard to distinguish any e appearance signal events characteristic of a non-zero value of θ 13 from background neutral current (NC) and short-track vμ charged current (CC) events. Also, uncertainties in the hadronic shower modeling in the kinematic region characteristic of this analysis are relatively large. A new data-driven background decomposition method designed to address those issues is developed and its results presented. By removing the long muon tracks from vμ-CC events, the Muon Removed Charge Current (MRCC) method creates independent pseudo-NC samples that can be used to correct the MINOS Monte Carlo to agree with the high-statistics Near detector data and to decompose the latter into components so as to predict the expected Far detector background. The MRCC method also provides an important cross-check in the Far detector to test the background in the signal selected region. MINOS finds a 1.0-1.5 σ ve-CC excess above background in the Far detector data, depending on method used, for a total exposure of 3.14 x 1020 protons-on-target. Interpreting this excess as signal, MINOS can set limits on sin2 2θ 13. Using the MRCC method, MINOS sets a limit of sin2 2 θ 13 < 0.265 at the 90% confidence limit for a CP-violating phase δ = 0.
Muon neutrino disappearance at MINOS
International Nuclear Information System (INIS)
Armstrong, R.
2009-01-01
A strong case has been made by several experiments that neutrinos oscillate, although important questions remain as to the mechanisms and precise values of the parameters. In the standard picture, two parameters describe the nature of how the neutrinos oscillate: the mass-squared difference between states and the mixing angle. The purpose of this thesis is to use data from the MINOS experiment to precisely measure the parameters associated with oscillations first observed in studies of atmospheric neutrinos. MINOS utilizes two similar detectors to observe the oscillatory nature of neutrinos. The Near Detector, located 1 km from the source, observes the unoscillated energy spectrum while the Far Detector, located 735 km away, is positioned to see the oscillation signal. Using the data in the Near Detector, a prediction of the expected neutrino spectrum at the Far Detector assuming no oscillations is made. By comparing this prediction with the MINOS data, the atmospheric mixing parameters are measured to be Δm 32 2 = 2.45 +0.12 -0.12 x 10 -3 eV 2 and sin 2 (2θ 32 ) = 1.00 -0.04 +0.00 (> 0.90 at 90% confidence level).
Muon Energy Calibration of the MINOS Detectors
Energy Technology Data Exchange (ETDEWEB)
Miyagawa, Paul S. [Somerville College, Oxford (United Kingdom)
2004-01-01
MINOS is a long-baseline neutrino oscillation experiment designed to search for conclusive evidence of neutrino oscillations and to measure the oscillation parameters precisely. MINOS comprises two iron tracking calorimeters located at Fermilab and Soudan. The Calibration Detector at CERN is a third MINOS detector used as part of the detector response calibration programme. A correct energy calibration between these detectors is crucial for the accurate measurement of oscillation parameters. This thesis presents a calibration developed to produce a uniform response within a detector using cosmic muons. Reconstruction of tracks in cosmic ray data is discussed. This data is utilized to calculate calibration constants for each readout channel of the Calibration Detector. These constants have an average statistical error of 1.8%. The consistency of the constants is demonstrated both within a single run and between runs separated by a few days. Results are presented from applying the calibration to test beam particles measured by the Calibration Detector. The responses are calibrated to within 1.8% systematic error. The potential impact of the calibration on the measurement of oscillation parameters by MINOS is also investigated. Applying the calibration reduces the errors in the measured parameters by ~ 10%, which is equivalent to increasing the amount of data by 20%.
Study of Neutrino Interactions in MINOS
Energy Technology Data Exchange (ETDEWEB)
Sharma, Richa [Panjab Univ., Chandigarh (India)
2014-01-01
MINOS stands for Main Injector Neutrino Oscillation Search. It is a long baseline experiment located in the USA and is composed of two detectors. The Near Detector is at Fermilab, 1 km from the source of neutrinos. The Far Detector is in Minnesota at a distance of 735 km from the source. Both detectors are steel scintillator tracking calorimeters. MINOS searches for neutrino oscillations by comparing the neutrino energy spectrum at the Far Detector with that obtained from a prediction based on the spectrum at the Near Detector. The primary aim of MINOS is to measure the atmospheric oscillation parameters Δm2 32 and θ23. CPT symmetry requires that these parameters should be same for neutrinos and antineutrinos. Di erences between neutrino and antineutrino oscillations would be an indication of new physics beyond the neutrino-Standard Model ( SM). Additionally, violation of Lorentz or CPT symmetry could also give rise to oscillations di erent from that expected from the SM predictions, such as neutrino to antineutrino transitions.
Remote MINOS Shift Station at IF-UFG
International Nuclear Information System (INIS)
Tognini, Stefano Castro; Gomes, Ricardo Avelino
2011-01-01
Full text: MINOS is a very well known neutrino experiment mainly designed to study neutrino oscillations and measure the parameters that rule the phenomena. The experiment uses an intense neutrino beam provided by the NuMI (Neutrinos at the Main Injector) beamline at Fermilab and two similar magnetized detectors - the Near Detector located at Fermilab, 1 km downstream the target and 94 m underground; and the Far Detector located in the Soudan Mine in northern Minnesota, 734 km downstream the Near Detector and 713 m underground. The MINOS control room is consisted of four main systems used to monitor the beam, the detectors and the data acquisition process: the Beam Monitoring System - a set of tools used to monitor the status of the NuMI beam, such as its intensity, its alignment with the target and beamline and if the beam data acquisition is working properly; the Online Monitoring System (OM) - responsible for monitoring the electronics of both detectors, which determines the quality of the data; the Detector Control System (DCS) - which monitors the detectors information, such as the high voltage systems, state of the rack protection system, the magnet control, chiller monitor, coil current, humidity and environmental temperatures; and the Data Acquisition System (DAQ) - used to control the runs/subruns and monitor the recording process. The experiment is taking data with the Far Detector since 2003 and with the Near Detector since 2005. The Physics Institute of the Federal University of Goias (IF-UFG) is joining the MINOS Collaboration since June 2009 and this work describes the configuration of our Remote MINOS Shift Station. In order to accomplish the shift tasks with minimum expenditure of time and money efforts, MINOS decided to authorize remote shifts on January 2011. Apart of being able to realize remote shifts, the main goals of our shift station are to allow the training of new users, in particular graduate students; to allow our real-time monitoring of
Hadronic interactions in the MINOS detectors
Energy Technology Data Exchange (ETDEWEB)
Kordosky, Michael Alan [Univ. of Texas, Austin, TX (United States)
2004-08-01
MINOS, the Main Injector Neutrino Oscillation Search, will study neutrino flavor transformations using a Near detector at the Fermi National Accelerator Laboratory and a Far detector located in the Soudan Underground Laboratory in northern Minnesota. The MINOS collaboration also constructed the CalDet (calibration detector), a smaller version of the Near and Far detectors, to determine the topological and signal response to hadrons, electrons and muons. The detector was exposed to test-beams in the CERN Proton Synchrotron East Hall during 2001-2003, where it collected events at momentum settings between 200 MeV/c and 10 GeV/c. In this dissertation we present results of the CalDet experiment, focusing on the topological and signal response to hadrons. We briefly describe the MINOS experiment and its iron-scintillator tracking-sampling calorimters as a motivation for the CalDet experiment. We discuss the operation of the CalDet in the beamlines as well as the trigger and particle identification systems used to isolate the hadron sample. The method used to calibrate the MINOS detector is described and validated with test-beam data. The test-beams were simulated to model the muon flux, energy loss upstream of the detector and the kaon background. We describe the procedure used to discriminate between pions and muons on the basis of the event topology. The hadron samples were used to benchmark the existing GEANT3 based hadronic shower codes and determine the detector response and resolution for pions and protons. We conclude with comments on the response to single hadrons and to neutrino induced hadronic showers.
Discussion of Minos Mine operating system
Energy Technology Data Exchange (ETDEWEB)
Pan, B.
1991-10-01
The MINOS (mine operating system), which is used in the majority of British collieries, provides central control at the surface for the machinery and environmental equipment distributed throughout the mine. Installed equipment, including face machinery, conveyors, pumps, fans and sensors are connected to local outstations which all communicate with the control system via a single run of signal cable. The article discusses the system particularly its use in the Automated Control System of Underground Mining Locomotives (ACSUML). The discussion includes the use of MINOS to improve wagon identification, the operating principle of ACSUML and the possibilities of a driverless locomotive. 2 figs.
Sterile Neutrino Search with MINOS
International Nuclear Information System (INIS)
Devan, Alena V.
2015-01-01
MINOS, Main Injector Neutrino Oscillation Search, is a long-baseline neutrino oscillation experiment in the NuMI muon neutrino beam at the Fermi National Accelerator Laboratory in Batavia, IL. It consists of two detectors, a near detector positioned 1 km from the source of the beam and a far detector 734 km away in Minnesota. MINOS is primarily designed to observe muon neutrino disappearance resulting from three flavor oscillations. The Standard Model of Particle Physics predicts that neutrinos oscillate between three active flavors as they propagate through space. This means that a muon-type neutrino has a certain probability to later interact as a different type of neutrino. In the standard picture, the neutrino oscillation probabilities depend only on three neutrino flavors and two mass splittings, Δm 2 . An anomaly was observed by the LSND and MiniBooNE experiments that suggests the existence of a fourth, sterile neutrino flavor that does not interact through any of the known Standard Model interactions. Oscillations into a theoretical sterile flavor may be observed by a deficit in neutral current interactions in the MINOS detectors. A distortion in the charged current energy spectrum might also be visible if oscillations into the sterile flavor are driven by a large mass-squared difference, Δm s 2 ~ 1 eV 2 . The results of the 2013 sterile neutrino search are presented here.
A Sterile-Neutrino Search with the MINOS Experiment
International Nuclear Information System (INIS)
Rodrigues, Philip
2010-01-01
The MINOS experiment is a long-baseline neutrino oscillation experiment in the the NuMI beamline at Fermilab, USA. Using a near detector at 1 km distance from the neutrino production target, and a far detector at 735 km from the target, it is designed primarily to measure the disappearance of muon neutrinos. This thesis presents an analysis using MINOS data of the possibility of oscil- lation of the neutrinos in the NuMI beam to a hypothetical sterile flavour, which would have no Standard Model couplings. Such oscillations would result in a deficit in the neutral current interaction rate in the MINOS far detector relative to the expectation derived from the near detector data. The method used to identify neutral current and charged current events in the MINOS detectors is described and a new method of predicting and fitting the far detector spectrum presented, along with the effects of systematic uncertainties on the sterile neutrino oscillation analysis. Using this analysis, the fraction f s of the disappearing neutrinos that go to steriles is constrained to be below 0.15 at the 90% confidence level in the absence of electron neutrino appearance in the NuMI beam. With electron appearance at the CHOOZ limit, f s < 0.41 at 90% C.L.
Sterile Neutrino Search with MINOS
Energy Technology Data Exchange (ETDEWEB)
Devan, Alena V. [College of William and Mary, Williamsburg, VA (United States)
2015-08-01
MINOS, Main Injector Neutrino Oscillation Search, is a long-baseline neutrino oscillation experiment in the NuMI muon neutrino beam at the Fermi National Accelerator Laboratory in Batavia, IL. It consists of two detectors, a near detector positioned 1 km from the source of the beam and a far detector 734 km away in Minnesota. MINOS is primarily designed to observe muon neutrino disappearance resulting from three flavor oscillations. The Standard Model of Particle Physics predicts that neutrinos oscillate between three active flavors as they propagate through space. This means that a muon-type neutrino has a certain probability to later interact as a different type of neutrino. In the standard picture, the neutrino oscillation probabilities depend only on three neutrino flavors and two mass splittings, Δm2. An anomaly was observed by the LSND and MiniBooNE experiments that suggests the existence of a fourth, sterile neutrino flavor that does not interact through any of the known Standard Model interactions. Oscillations into a theoretical sterile flavor may be observed by a deficit in neutral current interactions in the MINOS detectors. A distortion in the charged current energy spectrum might also be visible if oscillations into the sterile flavor are driven by a large mass-squared difference, ms2 ~ 1 eV2. The results of the 2013 sterile neutrino search are presented here.
A Sterile-Neutrino Search with the MINOS Experiment
Energy Technology Data Exchange (ETDEWEB)
Rodrigues, Philip [Univ. of Oxford (United Kingdom)
2010-01-01
The MINOS experiment is a long-baseline neutrino oscillation experiment in the the NuMI beamline at Fermilab, USA. Using a near detector at 1 km distance from the neutrino production target, and a far detector at 735 km from the target, it is designed primarily to measure the disappearance of muon neutrinos. This thesis presents an analysis using MINOS data of the possibility of oscil- lation of the neutrinos in the NuMI beam to a hypothetical sterile flavour, which would have no Standard Model couplings. Such oscillations would result in a deficit in the neutral current interaction rate in the MINOS far detector relative to the expectation derived from the near detector data. The method used to identify neutral current and charged current events in the MINOS detectors is described and a new method of predicting and fitting the far detector spectrum presented, along with the effects of systematic uncertainties on the sterile neutrino oscillation analysis. Using this analysis, the fraction fs of the disappearing neutrinos that go to steriles is constrained to be below 0.15 at the 90% confidence level in the absence of electron neutrino appearance in the NuMI beam. With electron appearance at the CHOOZ limit, fs < 0.41 at 90% C.L.
Detectors for the MINOS long-baseline neutrino oscillation experiment
International Nuclear Information System (INIS)
Ayres, D.S.
1996-01-01
The MINOS long-baseline experiment will use an intense neutrino beam, generated by Fermilab''s Main Injector accelerator, and 730 km flight path to search for neutrino oscillations. The 10,000 ton MINOS far detector will utilize toroidally magnetized steel plates interleaved with track chambers to reconstruct event topologies and to measure the energies of the muons, hadrons and electromagnetic showers produced by neutrino interactions. The MINOS collaboration is currently developing three alternative technologies for the track chambers: ''Iarocci'' tubes (operated in either limited streamer or saturated proportional mode), RPC''s (with either glass or ABS plates), and scintillator (either liquid or plastic) with wavelength shifting fiber readout. The technology choice will be made in mid 1997 based on the projected performance and cost of the 32,000 m 2 active detector system
Search for Sterile Neutrinos with the MINOS Long-Baseline Experiment
Energy Technology Data Exchange (ETDEWEB)
Timmons, Ashley Michael [Univ. of Manchester (United Kingdom)
2016-01-01
This thesis will present a search for sterile neutrinos using data taken with the MINOS experiment between 2005 and 2012. MINOS is a two-detector on-axis experiment based at Fermilab. The NuMI neutrino beam encounters the MINOS Near Detector 1km downstream of the neutrino-production target before traveling a further 734km through the Earth's crust, to reach the Far Detector located at the Soudan Underground Laboratory in Northern Minnesota. By searching for oscillations driven by a large mass splitting, MINOS is sensitive to the existence of sterile neutrinos through looking for any energy-dependent perturbations using a charged-current sample, as well as looking at any relative deficit in neutral current events between the Far and Near Detectors. This thesis will discuss the novel analysis that enabled a search for sterile neutrinos covering five orders of magnitude in the mass splitting and setting a limit in previously unexplored regions of the parameter space $\\left\\{\\Delta m^{2}_{41},\\sin^2\\theta_{24}\\right\\}$, where a 3+1-flavour phenomenological model was used to extract parameter limits. The results presented in this thesis are sensitive to the sterile neutrino parameter space suggested by the LSND and MiniBooNE experiments.
MINOS Calibration and NA49 Hadronic Production Studies
Energy Technology Data Exchange (ETDEWEB)
Morse, Robert James [Univ. of Sussex, Brighton (United Kingdom)
2003-08-01
An overview of the current status of the Main Injector Neutrino Oscillation Search (MINOS) is presented. MINOS is a long-baseline experiment with two detectors situated in North America. The near detector is based at the emission point of the NuMI beam at Fermilab, Chicago, the far detector is 735 km downstream in a disused iron mine in Soudan, Minnesota. A third detector, the calibration detector, is used to cross-calibrate these detectors by sampling different particle beams at CERN. A detailed description of the design and construction of the light-injection calibration system is included. Also presented are experimental investigations into proton-carbon collisions at 158 GeV/c carried out with the NA49 experiment at CERN. The NA49 experiment is a Time Projection Chamber (TPC) based experiment situated at CERN's North Area. It is a well established experiment with well known characteristics. The data gained from this investigation are to be used to parameterize various hadronic production processes in accelerator and atmospheric neutrino production. These hadronic production parameters will be used to improve the neutrino generation models used in calculating the neutrino oscillation parameters in MINOS.
Atmospheric Neutrinos in the MINOS Far Detector
Energy Technology Data Exchange (ETDEWEB)
Howcroft, Caius Leo Frederick [Univ. of Cambridge (United Kingdom)
2004-12-01
The phenomenon of flavour oscillations of neutrinos created in the atmosphere was first reported by the Super-Kamiokande collaboration in 1998 and since then has been confirmed by Soudan 2 and MACRO. The MINOS Far Detector is the first magnetized neutrino detector able to study atmospheric neutrino oscillations. Although it was designed to detect neutrinos from the NuMI beam, it provides a unique opportunity to measure the oscillation parameters for neutrinos and anti-neutrinos independently. The MINOS Far Detector was completed in August 2003 and since then has collected 2.52 kton-years of atmospheric data. Atmospheric neutrino interactions contained within the volume of the detector are separated from the dominant background from cosmic ray muons. Thirty seven events are selected with an estimated background contamination of less than 10%. Using the detector's magnetic field, 17 neutrino events and 6 anti-neutrino events are identified, 14 events have ambiguous charge. The neutrino oscillation parameters for vμ and $\\bar{v}$μ are studied using a maximum likelihood analysis. The measurement does not place constraining limits on the neutrino oscillation parameters due to the limited statistics of the data set analysed. However, this thesis represents the first observation of charge separated atmospheric neutrino interactions. It also details the techniques developed to perform atmospheric neutrino analyses in the MINOS Far Detector.
Measuring the Disappearance of Muon Neutrinos with the MINOS Detector
Energy Technology Data Exchange (ETDEWEB)
Radovic, Alexander [Univ. College London, Bloomsbury (United Kingdom)
2013-08-01
MINOS is a long baseline neutrino oscillation experiment. It measures the flux from the predominately muon neutrino NuMI beam first 1 km from beam start and then again 735 km later using a pair of steel scintillator tracking calorimeters. The comparison of measured neutrino energy spectra at our Far Detector with the prediction based on our Near Detector measurement allows for a measurement of the parameters which define neutrino oscillations. This thesis will describe the most recent measurement of muon neutrino disappearance in the NuMI muon neutrino beam using the MINOS experiment.
Studies of Nu-mu to Nu-e Oscillation Appearance in the MINOS Experiment
Energy Technology Data Exchange (ETDEWEB)
Pereira e Sousa, Alexandre Bruno [Tufts Univ., Medford, MA (United States)
2006-02-01
The MINOS experiment uses a long baseline neutrino beam, measured 1 km downstream from its origin in the Near Detector at Fermilab, and 734 km later in the large underground Far Detector in the Soudan mine. By comparing these two measurements, MINOS can probe the atmospheric domain of the neutrino oscillation phenomenology with unprecedented precision. Besides the ability to perform a world leading determination of the Δm$2\\atop{23}$ and θ23 parameters, via vμ flux disappearance, MINOS has the potential to make a leading measurement of vμ → ve oscillations in the atmospheric sector by looking for ve appearance at the Far Detector. The observation of ve appearance, tantamount to establishing a non-zero value of the θ13 mixing angle, opens the way to studies of CP violation in the leptonic sector, the neutrino spectral mass pattern ordering and neutrino oscillations in matter, the driving motivations of the next generation of neutrino experiments. In this thesis, we study the MINOS potential for measuring θ13 in the context of the MINOS Mock Data Challenge using a multivariate discriminant analysis method. We show the method's validity in the application to ve event classification and background identification, as well as in its ability to identify a ve signal in a Mock Data sample generated with undisclosed parameters. An independent shower reconstruction method based on three-dimensional hit matching and clustering was developed, providing several useful discriminator variables used in the multivariate analysis method. We also demonstrate that within 2 years of running, MINOS has the potential to improve the current best limit on θ13, from the CHOOZ experiment, by a factor of 2.
Energy Technology Data Exchange (ETDEWEB)
de Abreu Barbosa Coelho, Joao [Campinas State Univ., Sao Paulo (Brazil)
2012-01-01
The neutrino oscillation model is very successful in explaining a large variety of experiments. The model is based on the premise that the neutrinos that interact through the weak force via charged current are not mass eigenstates, but a superposition of them. In general, a quantum superposition is subject to loss of coherence, so that pure states tend toward mixed states. This type of evolution is not possible within the context of isolated quantum systems because the evolution is unitary and, therefore, is invariant under time reversal. By breaking unitarity, an arrow of time is introduced and the characteristic effect for neutrinos is a damping of oscillations. In this thesis, some phenomenological decoherence and decay models are investigated, which could be observed by MINOS, a neutrino oscillation experiment that consists of measuring the neutrino flux produced in a particle accelerator 735 km away. We analyse the disappearance of muon neutrinos in MINOS. Information from other experiments is used to constrain the number of parameters, leaving only one extra parameter in each model. We assume a power law energy dependence of the decoherence parameter. The official MINOS software and simulation are used to obtain the experiment's sensitivities to the effects of unitarity breaking considered.
Evangelinos, Minoas; Anagnostopoulos, Gerasimos; Karvela-Kalogeraki, Iliana; Stathopoulou, Panagiota M; Scazzocchio, Claudio; Diallinas, George
2015-08-01
Transposons constitute powerful genetic tools for gene inactivation, exon or promoter trapping and genome analyses. The Minos element from Drosophila hydei, a Tc1/mariner-like transposon, has proved as a very efficient tool for heterologous transposition in several metazoa. In filamentous fungi, only a handful of fungal-specific transposable elements have been exploited as genetic tools, with the impala Tc1/mariner element from Fusarium oxysporum being the most successful. Here, we developed a two-component transposition system to manipulate Minos transposition in Aspergillus nidulans (AnMinos). Our system allows direct selection of transposition events based on re-activation of niaD, a gene necessary for growth on nitrate as a nitrogen source. On average, among 10(8) conidiospores, we obtain up to ∼0.8×10(2) transposition events leading to the expected revertant phenotype (niaD(+)), while ∼16% of excision events lead to AnMinos loss. Characterized excision footprints consisted of the four terminal bases of the transposon flanked by the TA target duplication and led to no major DNA rearrangements. AnMinos transposition depends on the presence of its homologous transposase. Its frequency was not significantly affected by temperature, UV irradiation or the transcription status of the original integration locus (niaD). Importantly, transposition is dependent on nkuA, encoding an enzyme essential for non-homologous end joining of DNA in double-strand break repair. AnMinos proved to be an efficient tool for functional analysis as it seems to transpose in different genomic loci positions in all chromosomes, including a high proportion of integration events within or close to genes. We have used Minos to obtain morphological and toxic analogue resistant mutants. Interestingly, among morphological mutants some seem to be due to Minos-elicited over-expression of specific genes, rather than gene inactivation. Copyright © 2015 Elsevier Inc. All rights reserved.
In vitro activity of DMG-Mino and DMG-DM Dot, two new glycylcyclines, against anaerobic bacteria.
Nord, C E; Lindmark, A; Persson, I
1993-10-01
The in vitro activity of DMG-Mino and DMG-DM Dot against 350 anaerobic bacterial strains including anaerobic cocci, Propionibacterium acnes, Clostridium perfringens, Clostridium difficile, Bacteroides fragilis, other Bacteroides species and fusobacteria was determined by the agar dilution method. Their activity was compared with that of minocycline, doxycycline, piperacillin, cefoxitin, imipenem, clindamycin and metronidazole. DMG-Mino and DMG-DM Dot and imipenem were the most active agents tested. DMG-Mino and DMG-DM Dot had in vitro activity superior to that of minocycline and doxycycline.
Energy Technology Data Exchange (ETDEWEB)
Dorman, Mark Edward [Univ. College London, Bloomsbury (United Kingdom)
2008-04-01
The Main Injector Neutrino Oscillation Search (MINOS) is a long baseline neutrino oscillation experiment based at the Fermi National Accelerator Laboratory (FNAL) in Chicago, Illinois. MINOS measures neutrino interactions in two large iron-scintillator tracking/sampling calorimeters; the Near Detector on-site at FNAL and the Far Detector located in the Soudan mine in northern Minnesota. The Near Detector has recorded a large number of neutrino interactions and this high statistics dataset can be used to make precision measurements of neutrino interaction cross sections. The cross section for charged-current quasi-elastic scattering has been measured by a number of previous experiments and these measurements disagree by up to 30%. A method to select a quasi-elastic enriched sample of neutrino interactions in the MINOS Near Detector is presented and a procedure to fit the kinematic distributions of this sample and extract the quasi-elastic cross section is introduced. The accuracy and robustness of the fitting procedure is studied using mock data and finally results from fits to the MINOS Near Detector data are presented.
International Nuclear Information System (INIS)
Dorman, Mark Edward
2008-01-01
The Main Injector Neutrino Oscillation Search (MINOS) is a long baseline neutrino oscillation experiment based at the Fermi National Accelerator Laboratory (FNAL) in Chicago, Illinois. MINOS measures neutrino interactions in two large iron-scintillator tracking/sampling calorimeters; the Near Detector on-site at FNAL and the Far Detector located in the Soudan mine in northern Minnesota. The Near Detector has recorded a large number of neutrino interactions and this high statistics dataset can be used to make precision measurements of neutrino interaction cross sections. The cross section for charged-current quasi-elastic scattering has been measured by a number of previous experiments and these measurements disagree by up to 30%. A method to select a quasi-elastic enriched sample of neutrino interactions in the MINOS Near Detector is presented and a procedure to fit the kinematic distributions of this sample and extract the quasi-elastic cross section is introduced. The accuracy and robustness of the fitting procedure is studied using mock data and finally results from fits to the MINOS Near Detector data are presented
Systematic Comparison of the MINOS Near and Far Detector Readout Systems
Energy Technology Data Exchange (ETDEWEB)
Cabrera, Anatael [Univ. of Oxford (United Kingdom). Queen' s College
2005-06-22
The MINOS experiment is a neutrino oscillation baseline experiment intending to use high resolution L/E neutrinos to measure the atmospheric neutrino oscillations parameters to unprecedented precision. Two detectors have been built to realize the measurements, a Near detector, located about 1km downstream from the beam target at the Fermi Laboratory, and a Far detector, located at 736km, at the Soudan Laboratory. The technique relies on the Near detector to measure the un-oscillated neutrino spectrum, while the Far detector measures the neutrino spectrum once oscillated. The comparison between the two measurements is expected to allow MINOS to measure Δm2 beyond 10% precision level. The Near and Far detectors have been built similarly to minimize possible systematic effects. Both detectors have been endowed with different readout systems, as the beam event rates are very different. The MINOS calibration detector (CalDet), installed at CERN, was instrumented with both readout systems such that they can simultaneously measure and characterize the energy deposition (response and event topology) of incident known particle from test-beams. This thesis presents the investigations to quantify the impact of the performance of both readout systems on the MINOS results using the measurements obtained with CalDet. The relative comparison of the responses of both readout systems have been measured to be consistent with being identical within a systematic uncertainty of 0.6%. The event topologies have been found to be negligibly affected. In addition, the performance of the detector simulations have been thoroughly investigated and validated to be in agreement with data within similar level of uncertainties.
Energy Technology Data Exchange (ETDEWEB)
Mayer, Nathan Samuel [Indiana Univ., Bloomington, IN (United States)
2011-12-05
The Main Injector Neutrino Oscillation Search (MINOS) is a two detector, long baseline neutrino oscillation experiment. The MINOS near detector is an ironscintillator tracking/sampling calorimeter and has recorded the world’s largest data set of neutrino interactions in the 0-5 GeV region. This high statistics data set is used to make precision measurements of neutrino interaction cross-sections on iron. The Q2 dependence in charged current quasi-elastic (CCQE) scattering probes the axial and vector structure (form factor) of the nucleon/nuclear target, and nuclear effects in neutrino scattering. Presented here is a study of the MINOS Data that will introduce a method that improves the existing MINOS CCQE analysis. This analysis uses an additional CCQE dominated sub-sample from a different kinematic region to reduce correlations between fit parameters in the existing MINOS CCQE analysis. The measured value of the axial-vector mass is MQE A = 1.312+0.037 -0.038(fit)+0.123 -0.265(syst.) GeV.
Neutrino induced events in the MINOS detectors
International Nuclear Information System (INIS)
Litchfield, Reuben Phillip
2008-01-01
The MINOS experiment is designed to study neutrino oscillations. It uses an accelerator generated beam of neutrinos and two detectors, the smaller at a distance of 1km and the larger at 735 km. By comparing the spectrum and flavour composition of the beam at the two detectors precise determinations of the oscillation parameters are possible. This thesis concentrates on the analysis of data from the larger Far Detector. By studying the spectrum of neutral current events it is possible to look for evidence of non-interacting 'sterile' neutrinos. The thesis describes how events are selected for this analysis, and a method for discriminating between charged current and neutral current events. The systematic uncertainties resulting from these cuts are evaluated. Several techniques for using Near Detector data to eliminate systematic uncertainties in the predicted Far Detector spectrum are compared. An oscillation analysis, based on the first year of MINOS data, uses the selected events to make a measurement of f s , the fraction of unseen neutrinos that are sterile. The measured value is f s = 0.07 +0.32 at 68%C.L., and is consistent with the standard three-neutrino picture, which has no sterile neutrino
Measurement of electron neutrino appearance with the MINOS experiment
International Nuclear Information System (INIS)
Boehm, Joshua Adam Alpern
2009-01-01
MINOS is a long-baseline two-detector neutrino oscillation experiment that uses a high intensity muon neutrino beam to investigate the phenomena of neutrino oscillations. By measuring the neutrino interactions in a detector near the neutrino source and again 735 km away from the production site, it is possible to probe the parameters governing neutrino oscillation. The majority of the ν μ oscillate to ν τ but a small fraction may oscillate instead to ν e . This thesis presents a measurement of the ν e appearance rate in the MINOS far detector using the first two years of exposure. Methods for constraining the far detector backgrounds using the near detector measurements is discussed and a technique for estimating the uncertainty on the background and signal selection are developed. A 1.6σ excess over the expected background rate is found providing a hint of ν e appearance.
Effects of non-standard interactions in the MINOS experiment
International Nuclear Information System (INIS)
Blennow, Mattias; Ohlsson, Tommy; Skrotzki, Julian
2008-01-01
We investigate the effects of non-standard interactions on the determination of the neutrino oscillation parameters Δm 31 2 , θ 23 , and θ 13 in the MINOS experiment. We show that adding non-standard interactions to the analysis lead to an extension of the allowed parameter space to larger values of Δm 31 2 and smaller θ 23 , and basically removes all predictability for θ 13 . In addition, we discuss the sensitivities to the non-standard interaction parameters of the MINOS experiment alone. In particular, we examine the degeneracy between θ 13 and the non-standard interaction parameter ε eτ . We find that this degeneracy is responsible for the removal of the θ 13 predictability and that the possible bound on |ε eτ | is competitive with direct bounds only if a more stringent external bound on θ 13 is applied
MINOS: A simplified Pn solver for core calculation
International Nuclear Information System (INIS)
Baudron, A.M.; Lautard, J.J.
2007-01-01
This paper describes a new generation of the neutronic core solver MINOS resulting from developments done in the DESCARTES project. For performance reasons, the numerical method of the existing MINOS solver in the SAPHYR system has been reused in the new system. It is based on the mixed-dual finite element approximation of the simplified transport equation. We have extended the previous method to the treatment of unstructured geometries composed by quadrilaterals, allowing us to treat geometries where fuel pins are exactly represented. For Cartesian geometries, the solver takes into account assembly discontinuity coefficients in the simplified P n context. The solver has been rewritten in C + + programming language using an object-oriented design. Its general architecture was reconsidered in order to improve its capability of evolution and its maintainability. Moreover, the performance of the previous version has been improved mainly regarding the matrix construction time; this result improves significantly the performance of the solver in the context of industrial application requiring thermal-hydraulic feedback and depletion calculations. (authors)
Electron Neutrino and Antineutrino Appearance in the MINOS Detector
Energy Technology Data Exchange (ETDEWEB)
Schreckenberger, Adam Paul [Univ. of Minnesota, Minneapolis, MN (United States)
2013-04-01
The Main Injector Neutrino Oscillation Search (MINOS) is a long-baseline neutrino experiment that utilizes a particle beam and two steel-scintillator calorimeters designed to determine the parameters associated with muon neutrino disappearance. Analysis methods developed by the MINOS νe group have facilitated the placement of limits upon the mixing angle associated with νμ → νe oscillations. Since the polarity of the focusing horns can be switched, we can perform a similar analysis with an antineutrino-enriched beam to select electron antineutrino appearance candidates. Using 3.34e20 POT (protons on target) in the antineutrino mode, we exclude θ13 = 0 at the 80% C.L. A joint fit of the 3.34e20 POT antineutrino and 10.6e20 POT neutrino samples excluded θ13 = 0 at the 96% C.L. In addition, the combined data were used to produce exclusions regarding the CP-violating phase.
Measurement of electron neutrino appearance with the MINOS experiment
Energy Technology Data Exchange (ETDEWEB)
Boehm, Joshua Adam Alpern [Harvard Univ., Cambridge, MA (United States)
2009-05-01
MINOS is a long-baseline two-detector neutrino oscillation experiment that uses a high intensity muon neutrino beam to investigate the phenomena of neutrino oscillations. By measuring the neutrino interactions in a detector near the neutrino source and again 735 km away from the production site, it is possible to probe the parameters governing neutrino oscillation. The majority of the vμ oscillate to vτ but a small fraction may oscillate instead to ve. This thesis presents a measurement of the ve appearance rate in the MINOS far detector using the first two years of exposure. Methods for constraining the far detector backgrounds using the near detector measurements is discussed and a technique for estimating the uncertainty on the background and signal selection are developed. A 1.6σ excess over the expected background rate is found providing a hint of ve appearance.
The magnetized steel and scintillator calorimeters of the MINOS experiment
Energy Technology Data Exchange (ETDEWEB)
Michael, : D.G.
2008-05-01
The Main Injector Neutrino Oscillation Search (MINOS) experiment uses an accelerator-produced neutrino beam to perform precision measurements of the neutrino oscillation parameters in the 'atmospheric neutrino' sector associated with muon neutrino disappearance. This long-baseline experiment measures neutrino interactions in Fermilab's NuMI neutrino beam with a near detector at Fermilab and again 735 km downstream with a far detector in the Soudan Underground Laboratory in northern Minnesota. The two detectors are magnetized steel-scintillator tracking calorimeters. They are designed to be as similar as possible in order to ensure that differences in detector response have minimal impact on the comparisons of event rates, energy spectra and topologies that are essential to MINOS measurements of oscillation parameters. The design, construction, calibration and performance of the far and near detectors are described in this paper.
Neutrino induced events in the MINOS detectors
Energy Technology Data Exchange (ETDEWEB)
Litchfield, Reuben Phillip [Univ. of Oxford (United Kingdom). Keble College
2008-01-01
The MINOS experiment is designed to study neutrino oscillations. It uses an accelerator generated beam of neutrinos and two detectors, the smaller at a distance of 1km and the larger at 735 km. By comparing the spectrum and flavour composition of the beam at the two detectors precise determinations of the oscillation parameters are possible. This thesis concentrates on the analysis of data from the larger Far Detector. By studying the spectrum of neutral current events it is possible to look for evidence of non-interacting 'sterile' neutrinos. The thesis describes how events are selected for this analysis, and a method for discriminating between charged current and neutral current events. The systematic uncertainties resulting from these cuts are evaluated. Several techniques for using Near Detector data to eliminate systematic uncertainties in the predicted Far Detector spectrum are compared. An oscillation analysis, based on the first year of MINOS data, uses the selected events to make a measurement of f{sub s}, the fraction of unseen neutrinos that are sterile. The measured value is fs = 0.07+0.32 at 68%C.L., and is consistent with the standard three-neutrino picture, which has no sterile neutrino.
A measurement of neutrino oscillations with muon neutrinos in the MINOS experiment
Energy Technology Data Exchange (ETDEWEB)
Coleman, Stephen James [College of William and Mary, Williamsburg, VA (United States)
2011-05-01
Experimental evidence has established that neutrino flavor states evolve over time. A neutrino of a particular flavor that travels some distance can be detected in a different neutrino flavor state. The Main Injector Neutrino Oscillation Search (MINOS) is a long-baseline experiment that is designed to study this phenomenon, called neutrino oscillations. MINOS is based at Fermilab near Chicago, IL, and consists of two detectors: the Near Detector located at Fermilab, and the Far Detector, which is located in an old iron mine in Soudan, MN. Both detectors are exposed to a beam of muon neutrinos from the NuMI beamline, and MINOS measures the fraction of muon neutrinos that disappear after traveling the 734 km between the two detectors. One can measure the atmospheric neutrino mass splitting and mixing angle by observing the energy-dependence of this muon neutrino disappearance. MINOS has made several prior measurements of these parameters. Here I describe recently-developed techniques used to enhance our sensitivity to the oscillation parameters, and I present the results obtained when they are applied to a dataset that is twice as large as has been previously analyzed. We measure the mass splitting Δm232 = (2.32-0.08+0.12) x 10-3 eV2/c4 and the mixing angle sin2(2θ32) > 0.90 at 90% C.L. These results comprise the world's best measurement of the atmospheric neutrino mass splitting. Alternative disappearance models are also tested. The neutrino decay hypothesis is disfavored at 7.2σ and the neutrino quantum decoherence hypothesis is disfavored at 9.0σ.
Louise Erdrich: The Aesthetics of Mino bimaadiziwin
Madsen, Deborah Lea
2011-01-01
This article is the editorial introduction to the collection of essays entitled Louise Erdrich. An overview of Erdrich's literary innovations is offered in three sections that explain her relationship to Native place; the Native American historical contexts upon which her writing draws; and the specifically Ojibwe tribal contexts that inform her literary worldview. The discussions cohere through the argument that Erdrich's core theme is the Ojibwe concept of the 'good life'–mino bimaadiziwin–...
Energy Technology Data Exchange (ETDEWEB)
Loiacono, Laura Jean [Univ. of Texas, Austin, TX (United States)
2010-05-01
The Neutrinos at the Main Injector (NuMI) facility at Fermi National Accelerator Laboratory (FNAL) produces an intense muon neutrino beam used by the Main Injector Neutrino Oscillation Search (MINOS), a neutrino oscillation experiment, and the Main INjector ExpeRiment v-A, (MINERv A), a neutrino interaction experiment. Absolute neutrino cross sections are determined via σv = N v/Φv , where the numerator is the measured number of neutrino interactions in the MINOS Detector and the denominator is the flux of incident neutrinos. Many past neutrino experiments have measured relative cross sections due to a lack of precise measurements of the incident neutrino flux, normalizing to better established reaction processes, such as quasielastic neutrino-nucleon scattering. But recent measurements of neutrino interactions on nuclear targets have brought to light questions about our understanding of nuclear effects in neutrino interactions. In this thesis the vμ inclusive charged current cross section on iron is measured using the MINOS Detector. The MINOS detector consists of alternating planes of steel and scintillator. The MINOS detector is optimized to measure muons produced in charged current vμ interactions. Along with muons, these interactions produce hadronic showers. The neutrino energy is measured from the total energy the particles deposit in the detector. The incident neutrino flux is measured using the muons produced alongside the neutrinos in meson decay. Three ionization chamber monitors located in the downstream portion of the NuMI beamline are used to measure the muon flux and thereby infer the neutrino flux by relation to the underlying pion and kaon meson flux. This thesis describes the muon flux instrumentation in the NuMI beam, its operation over the two year duration of this measurement, and the techniques used to derive the neutrino flux.
Spontaneous light emission from fibers in MINOS
International Nuclear Information System (INIS)
Avvakumov, S.; Barrett, W.L.; Belias, T.; Bower, C.; Erwin, A.; Kordosky, M.; Lang, K.; Lee, R.; Liu, J.; Miller, W.; Mualem, L.; Nichol, R.; Nelson, J.; Pearce, G.; Proga, M.; Rebel, B.; Ruddick, K.; Smith, C.; Thomas, J.; Vahle, P.; Webb, R.
2005-01-01
We report on the observation and measurements of unexpected background rates in the MINOS Far Detector. The noise level at the Far Detector is significantly greater than that expected from natural radioactivity and intrinsic photomultiplier dark current. We have conducted a series of additional tests which demonstrate that the excess rate is caused by spontaneous light emission in the wavelength-shifting fibers, which are used to read out signals from scintillator strips. This noise due to fibers exhibits an exponential fall off with time with a decay time constant of the order of 100 days
CPT conservation and atmospheric neutrinos in the MINOS far detector
International Nuclear Information System (INIS)
Becker, Bernard Raymond
2006-01-01
The MINOS Far Detector is a 5400 ton iron calorimeter located at the Soudan state park in Soudan Minnesota. The MINOS far detector can observe atmospheric neutrinos and separate charge current ν μ and (bar ν) μ interactions by using a 1.4 T magnetic field to identify the charge of the produced muon. The CPT theorem requires that neutrinos and anti-neutrinos oscillate in the same way. In a fiducial exposure of 5.0 kilo-ton years a total of 41 candidate neutrino events are observed with an expectation of 53.1 ± 7.6(system.) ± 7.2(stat.) unoscillated events or 31.6 ± 4.7(system.) ± 5.6(stat.) events with Δm 2 = 2.4 x 10 -3 eV 2 , sin 2 (2θ) = 1.0 as oscillation parameters. These include 28 events which can have there charge identified with high confidence. These 28 events consist of 18 events consistent with being produced by ν μ and 10 events being consistent with being produced by (bar ν) μ . No evidence of CPT violation is observed
CPT conservation and atmospheric neutrinos in the MINOS far detector
Energy Technology Data Exchange (ETDEWEB)
Becker, Bernard Raymond [Univ. of Minnesota, Minneapolis, MN (United States)
2006-02-01
The MINOS Far Detector is a 5400 ton iron calorimeter located at the Soudan state park in Soudan Minnesota. The MINOS far detector can observe atmospheric neutrinos and separate charge current νμ and $\\bar{v}$μ interactions by using a 1.4 T magnetic field to identify the charge of the produced muon. The CPT theorem requires that neutrinos and anti-neutrinos oscillate in the same way. In a fiducial exposure of 5.0 kilo-ton years a total of 41 candidate neutrino events are observed with an expectation of 53.1 ± 7.6(system.) ± 7.2(stat.) unoscillated events or 31.6 ± 4.7(system.) ± 5.6(stat.) events with Δm2 = 2.4 x 10-3 eV2, sin2(2θ) = 1.0 as oscillation parameters. These include 28 events which can have there charge identified with high confidence. These 28 events consist of 18 events consistent with being produced by νμ and 10 events being consistent with being produced by $\\bar{v}$μ. No evidence of CPT violation is observed.
Measuring $\\theta_{13}$ via Muon Neutrino to Electron Neutrino Oscillations in the MINOS Experiment
Energy Technology Data Exchange (ETDEWEB)
Toner, Ruth B. [Univ. of Cambridge (United Kingdom). Pembroke College
2011-01-01
One of the primary goals in neutrino physics at the present moment is to make a measurement of the neutrino oscillation parameter $\\theta_{13}$. This parameter, in addition to being unknown, could potentially allow for the introduction of CP violation into the lepton sector. The MINOS long-baseline neutrino oscillation experiment has the ability to make a measurement of this parameter, by looking for the oscillation of muon neutrinos to electron neutrinos between a Near and Far Detector over a distance of 735 km. This thesis discusses the development of an analysis framework to search for this oscillation mode. Two major improvements to pre-existing analysis techniques have been implemented by the author. First, a novel particle ID technique based on strip topology, known as the Library Event Matching (LEM) method, is optimized for use in MINOS. Second, a multiple bin likelihood method is developed to fit the data. These two improvements, when combined, increase MINOS' sensitivity to $\\sin^2(2\\theta_{13})$ by 27\\% over previous analyses. This thesis sees a small excess over background in the Far Detector. A Frequentist interpretation of the data rules out $\\theta_{13}=0$ at 91\\%. A Bayesian interpretation of the data is also presented, placing the most stringent upper boundary on the oscillation parameter to date, at $\\sin^2(2\\theta_{13})<0.09(0.015)$ for the Normal (Inverted) Hierarchy and $\\delta_{CP}=0$.
Energy Technology Data Exchange (ETDEWEB)
Adamson, P. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States). et al.
2015-06-09
We report the first observation of seasonal modulations in the rates of cosmic ray multiple-muon events at two underground sites, the MINOS Near Detector with an overburden of 225 mwe, and the MINOS Far Detector site at 2100 mwe. Thus, at the deeper site, multiple-muon events with muons separated by more than 8 m exhibit a seasonal rate that peaks during the summer, similar to that of single-muon events. In contrast and unexpectedly, the rate of multiple-muon events with muons separated by less than 5–8 m, and the rate of multiple-muon events in the smaller, shallower Near Detector, exhibit a seasonal rate modulation that peaks in the winter.
Searching for Sterile Neutrinos with MINOS
Energy Technology Data Exchange (ETDEWEB)
Timmons, Ashley [Manchester U.
2016-01-01
This document presents the latest results for a 3+1 sterile neutrino search using the $10.56 \\times 10^{20}$ protons-on-target data set taken from 2005 - 2012. By searching for oscillations driven by a large mass splitting, MINOS is sensitive to the existence of sterile neutrinos through any energy dependent deviations using a charged current sample, as well as looking at any relative deficit between neutral current events between the far and near detectors. This document will discuss the novel analysis that enabled a search for sterile neutrinos setting a limit in the previously unexplored regions in the parameter space $\\{\\Delta m^{2}_{41}, \\sin^2\\theta_{24}\\}$. The results presented can be compared to the parameter space suggested by LSND and MiniBooNE and complements other previous experimental searches for sterile neutrinos in the electron neutrino appearance channel.
An atmospheric muon neutrino disappearance measurement with the MINOS far detector
Energy Technology Data Exchange (ETDEWEB)
Gogos, Jeremy Peter [Univ. of Minnesota, Minneapolis, MN (United States)
2007-12-01
It is now widely accepted that the Standard Model assumption of massless neutrinos is wrong, due primarily to the observation of solar and atmospheric neutrino flavor oscillations by a small number of convincing experiments. The MINOS Far Detector, capable of observing both the outgoing lepton and associated showering products of a neutrino interaction, provides an excellent opportunity to independently search for an oscillation signature in atmospheric neutrinos. To this end, a MINOS data set from an 883 live day, 13.1 kt-yr exposure collected between July, 2003 and April, 2007 has been analyzed. 105 candidate charged current muon neutrino interactions were observed, with 120.5 ± 1.3 (statistical error only) expected in the absence of oscillation. A maximum likelihood analysis of the observed log(L/E) spectrum shows that the null oscillation hypothesis is excluded at over 96% confidence and that the best fit oscillation parameters are sin2 2θ23 = 0.95 -0.32 and Δm$2\\atop{23}$ = 0.93$+3.94\\atop{ -0.44}$ x 10-3 eV2. This measurement of oscillation parameters is consistent with the best fit values from the Super-Kamiokande experiment at 68% confidence.
A model study of ozone in the eastern Mediterranean free troposphere during MINOS (August 2001)
Roelofs, GJ; Scheeren, HA; Heland, J; Ziereis, H; Lelieveld, J
2003-01-01
A coupled tropospheric chemistry-climate model is used to analyze tropospheric ozone distributions observed during the MINOS campaign in the eastern Mediterranean region ( August, 2001). Modeled ozone profiles are generally in good agreement with the observations. Our analysis shows that the
Measurement of Neutrino Oscillation Parameters Using Anti-fiducial Charged Current Events in MINOS
Energy Technology Data Exchange (ETDEWEB)
Strait, Matthew Levy [Univ. of Minnesota, Minneapolis, MN (United States)
2010-09-01
Abstract The Main Injector Neutrino Oscillation Search (MINOS) obse rves the disappearance of muon neutrinos as they propagate in the long baseline Neutri nos at the Main Injector (NuMI) beam. MINOS consists of two detectors. The near detector sam ples the initial composition of the beam. The far detector, 735 km away, looks for an energy-d ependent deficit in the neutrino spectrum. This energy-dependent deficit is interpreted as q uantum mechanical oscillations be- tween neutrino flavors. A measurement is made of the effective two-neutrino mixing parameters Δ m 2 ≈ Δ m 2 23 and sin 2 2 θ ≈ sin 2 2 θ 23 . The primary MINOS analysis uses charged current events in the fiducial volume of the far detector. This analysis uses the roughly equal-sized sample of events that fails the fiducial cut, consisting of interact ions outside the fiducial region of the detector and in the surrounding rock. These events provide a n independent and complementary measurement, albeit weaker due to incomplete reconstructi on of the events. This analysis reports on an exposure of 7 . 25 × 10 20 protons-on-target. Due to poor energy resolution, the meas urement of sin 2 2 θ is much weaker than established results, but the measuremen t of sin 2 2 θ > 0 . 56 at 90% confidence is consistent with the accepted value. The measur ement of Δ m 2 is much stronger. Assuming sin 2 2 θ = 1 , Δ m 2 = (2 . 20 ± 0 . 18[stat] ± 0 . 14[syst]) × 10 - -3 eV 2 .
Studying neutrino oscillations using quasi-elastic events in MINOS
Energy Technology Data Exchange (ETDEWEB)
Kumaratunga, Sujeewa Terasita [Univ. of Minnesota, Minneapolis, MN (United States)
2008-02-01
MINOS (Main Injector Neutrino Oscillation Search), is a long baseline neutrino experiment designed to search for neutrino oscillations using two detectors at Fermi National Accelerator Laboratory, IL (Near Detector) and Soudan, MN (Far Detector). It will study vμ → vτ oscillations and make a measurement on the oscillation parameters, Δm$2\\atop{23}$ and sin2 2θ23, via a vμ beam made at Fermilab. Charge current neutrino interactions in the MINOS detectors are of three types: quasi-elastic scattering (QEL), resonance scattering (RES) and deep inelastic scattering (DIS). Of these, quasi-elastic scattering leaves the cleanest signal with just one μ and one proton in the final state, thus rendering the reconstruction of the neutrino energy more accurate. This thesis will outline a method to separate QEL events from the others in the two detectors and perform a calculation of Δm$2\\atop{23}$ and sin2 2θ23 using those events. The period under consideration was May 2005 to February 2006. The number of observed quasi-elastic events with energies below 10 GeV was 29, where the expected number was 60 ± 3. A fit to the energy distribution of these events gives Δm$2\\atop{23}$ = 2.91$+0.49\\atop{-0.53}$(stat)$+0.08\\atop{-0.09}$(sys) x 10-3 eV2 and sin2 2θ23 = 0.990-0.180(stat)-0.030(sys).
Measuring Antineutrino Oscillations with the MINOS Experiment
Energy Technology Data Exchange (ETDEWEB)
Evans, Justin John [Univ. of Oxford (United Kingdom)
2008-09-01
MINOS is a long baseline neutrino oscillation experiment. A manmade beam of predominantly muon neutrinos is detected both 1 km and 735 km from the production point by two functionally identical detectors. A comparison of the energy spectra measured by the two detectors shows the energy-dependent disappearance of muon neutrinos characteristic of oscillations and allows a measurement of the parameters governing the oscillations. This thesis presents work leading to measurements of disappearance in the 6% $\\bar{v}$μ background in that beam. A calibration is developed to correct for time-dependent changes in the responses of both detectors, reducing the corresponding uncertainty on hadronic energy measurements from 1.8% to 0.4% in the near detector and from 0.8% to 0.4% in the far detector. A method of selecting charged current $\\bar{v}$μ events is developed, with purities (efficiencies) of 96.5% (74.4%) at the near detector, and 98.8% (70.9%) at the far detector in the region below 10 GeV reconstructed antineutrino energy. A method of using the measured near detector neutrino energy spectrum to predict that expected at the far detector is discussed, and developed for use in the $\\bar{v}$μ analysis. Sources of systematic uncertainty contributing to the oscillation measurements are discussed. In the far detector, 32 charged current $\\bar{v}$μ events are observed below a reconstructed energy of 30 GeV, compared to an expectation of 47.8 for Δ$\\bar{m}$atm2 = Δ$\\bar{m}$atm2, sin2(2$\\bar{θ}$23) = sin2(2θ23). This deficit, in such a low-statistics sample, makes the result difficult to interpret in the context of an oscillation parameter measurement. Possible sources for the discrepancy are discussed, concluding that considerably more data are required for a definitive solution. Running MINOS with a dedicated $\\bar
International Nuclear Information System (INIS)
Symes, Philip Andrew; Sussex U.
2005-01-01
This thesis explains the origins of neutrinos and their interactions, and the phenomenon of neutrino oscillations. Experiments for measuring neutrino oscillations are mentioned and the experiment investigated in this thesis, the ''Main Injector Neutrino Oscillation Search'', and its neutrino beam, the Fermi National Accelerator Laboratory's ''Neutrinos At The Main Injector'', are described. MINOS is a long baseline (735 km) neutrino oscillation experiment with a near and a far detector, intended to make precision measurements of the atmospheric sector neutrino oscillation parameters. A measurement is made of the ''atmospheric'' neutrino oscillation parameters, Δm 23 2 and sin 2 (2θ 23 ), using neutrinos from the NuMI beam. The results of this analysis are compared to measurements at MINOS using neutrinos from the atmosphere and with other experiments. A more detailed method of beam neutrino analysis is discussed, and the extra calibrations needed to perform that analysis properly are described, with special attention paid to two aspects of the calibration, which comprise the bulk of work for this thesis. The light injection calibration system uses LEDs to illuminate the detector readout and provides a normalization of the stability of the detector over time. The hardware and different modi operandi of the system are described. There is a description of installation and commissioning of the system at one of the MINOS detectors. The response normalization of each detector with cosmic ray muons is described. Special attention is paid to the explanation of necessary corrections that must be made to the muon sample in order for the sample to be used to calibrate each detector to the specified accuracy. The performance of the calibration is shown
Energy Technology Data Exchange (ETDEWEB)
Symes, Philip Andrew [Univ. of Sussex, Brighton (United Kingdom)
2005-11-01
This thesis explains the origins of neutrinos and their interactions, and the phenomenon of neutrino oscillations. Experiments for measuring neutrino oscillations are mentioned and the experiment investigated in this thesis, the ''Main Injector Neutrino Oscillation Search'', and its neutrino beam, the Fermi National Accelerator Laboratory's ''Neutrinos At The Main Injector'', are described. MINOS is a long baseline (735 km) neutrino oscillation experiment with a near and a far detector, intended to make precision measurements of the atmospheric sector neutrino oscillation parameters. A measurement is made of the ''atmospheric'' neutrino oscillation parameters, Δm$2\\atop{23}$ and sin2(2θ23), using neutrinos from the NuMI beam. The results of this analysis are compared to measurements at MINOS using neutrinos from the atmosphere and with other experiments. A more detailed method of beam neutrino analysis is discussed, and the extra calibrations needed to perform that analysis properly are described, with special attention paid to two aspects of the calibration, which comprise the bulk of work for this thesis. The light injection calibration system uses LEDs to illuminate the detector readout and provides a normalization of the stability of the detector over time. The hardware and different modi operandi of the system are described. There is a description of installation and commissioning of the system at one of the MINOS detectors. The response normalization of each detector with cosmic ray muons is described. Special attention is paid to the explanation of necessary corrections that must be made to the muon sample in order for the sample to be used to calibrate each detector to the specified accuracy. The performance of the calibration is shown.
Characterization of 1600 Hamamatsu 16-anode photomultipliers for the MINOS Far detector
International Nuclear Information System (INIS)
Lang, K.; Day, J.; Eilerts, S.; Fuqua, S.; Guillen, A.; Kordosky, M.; Lang, M.; Liu, J.; Opaska, W.; Proga, M.; Vahle, P.; Winbow, A.; Drake, G.; Thomas, J.; Andreopoulos, C.; Saoulidou, N.; Stamoulis, P.; Tzanakos, G.; Zois, M.; Weber, A.; Michael, D.
2005-01-01
We are reporting results of the characterization of over 1600 multi-anode R5900-00-M16 photomultipliers manufactured by Hamamatsu Photonics K.K., and installed in the MINOS Far detector. We have conducted extensive tests of the uniformity of gain and collection efficiency of individual anodes, the cross-talk among all 16 channels, the dark noise, and the linearity of response. In our studies we used a blue light-emitting diode to illuminate phototubes through 1.2 mm diameter optical fibers. In this paper, we present summaries of the main characteristics of the tested photomultipliers
A study of muon neutrino disappearance in the MINOS detectors and the NuMI beam
Energy Technology Data Exchange (ETDEWEB)
Ling, Jiajie [Univ. of South Carolina, Columbia, SC (United States)
2010-01-01
There is now substantial evidence that the proper description of neutrino involves two representations related by the 3 x 3 PMNS matrix characterized by either distinct mass or flavor. The parameters of this mixing matrix, three angles and a phase, as well as the mass differences between the three mass eigenstates must be determined experimentally. The Main Injector Neutrino Oscillation Search experiment is designed to study the flavor composition of a beam of muon neutrinos as it travels between the Near Detector at Fermi National Accelerator Laboratory at 1 km from the target, and the Far Detector in the Soudan iron mine in Minnesota at 735 km from the target. From the comparison of reconstructed neutrino energy spectra at the near and far location, precise measurements of neutrino oscillation parameters from muon neutrino disappearance and electron neutrino appearance are expected. It is very important to know the neutrino flux coming from the source in order to achieve the main goal of the MINOS experiment: precise measurements of the atmospheric mass splitting |Δm232|, sin2 θ23. The goal of my thesis is to accurately predict the neutrino flux for the MINOS experiment and measure the neutrino mixing angle and atmospheric mass splitting.
Directory of Open Access Journals (Sweden)
G. Salisbury
2003-01-01
Full Text Available This study presents measurements of acetonitrile, benzene, toluene, methanol and acetone made using the proton-transfer-reaction mass spectrometry (PTR-MS technique at the Finokalia ground station in Crete during the Mediterranean INtensive Oxidant Study (MINOS in July-August 2001. Three periods during the campaign with broadly consistent back trajectories are examined in detail. In the first, air was advected from Eastern Europe without significant biomass burning influence (mean acetonitrile mixing ratio 154 pmol/mol. In the second period, the sampled air masses originated in Western Europe, and were advected approximately east-south-east, before turning south-west over the Black Sea and north-western Turkey. The third well-defined period included air masses advected from Eastern Europe passing east and south of/over the Sea of Azov, and showed significant influence by biomass burning (mean acetonitrile mixing ratio 436 pmol/mol, confirmed by satellite pictures. The mean toluene:benzene ratios observed in the three campaign periods described were 0.35, 0.37 and 0.22, respectively; the use of this quantity to determine air mass age is discussed. Methanol and acetone were generally well-correlated both with each other and with carbon monoxide throughout the campaign. Comparison of the acetone and methanol measurements with the MATCH-MPIC model showed that the model underestimated both species by a factor of 4, on average. The correlations between acetone, methanol and CO implied that the relatively high levels of methanol observed during MINOS were largely due to direct biogenic emissions, and also that biogenic sources of acetone were highly significant during MINOS (~35%. This in turn suggests that the model deficit in both species may be due, at least in part, to missing biogenic emissions.
Measuring neutrino oscillation parameters using νμ disappearance in MINOS
International Nuclear Information System (INIS)
Backhouse, Christopher James
2011-01-01
MINOS is a long-baseline neutrino oscillation experiment. It consists of two large steel-scintillator tracking calorimeters. The near detector is situated at Fermilab, close to the production point of the NuMI muon-neutrino beam. The far detector is 735 km away, 716m underground in the Soudan mine, Northern Minnesota. The primary purpose of the MINOS experiment is to make precise measurements of the 'atmospheric' neutrino oscillation parameters (Δm atm 2 and sin 2 2θ atm ). The oscillation signal consists of an energy-dependent deficit of ν μ interactions in the far detector. The near detector is used to characterize the properties of the beam before oscillations develop. The two-detector design allows many potential sources of systematic error in the far detector to be mitigated by the near detector observations. This thesis describes the details of the ν μ -disappearance analysis, and presents a new technique to estimate the hadronic energy of neutrino interactions. This estimator achieves a significant improvement in the energy resolution of the neutrino spectrum, and in the sensitivity of the neutrino oscillation fit. The systematic uncertainty on the hadronic energy scale was re-evaluated and found to be comparable to that of the energy estimator previously in use. The best-fit oscillation parameters of the ν μ -disappearance analysis, incorporating this new estimator were: Δm 2 = 2.32 -0.08 +0.12 x 10 -3 eV 2 , sin 2 2θ > 0.90 (90% C.L.). A similar analysis, using data from a period of running where the NuMI beam was operated in a configuration producing a predominantly (bar ν) μ beam, yielded somewhat different best-fit parameters Δ(bar m) 2 = (3.36 -0.40 +0.46 (stat.) ± 0.06(syst.)) x 10 -3 eV 2 , sin 2 2(bar θ) = 0.86 -0.12 0 .11 (stat.) ± 0.01(syst.). The tension between these results is intriguing, and additional antineutrino data is currently being taken in order to further investigate this apparent discrepancy.
Membrane-associated signaling in human B-lymphoma lines
Energy Technology Data Exchange (ETDEWEB)
Tauzin, Sebastien; Ding, Heidrun; Burdevet, Dimitri [Department of Pathology and Immunology, Centre medical universitaire, 1, rue Michel-Servet, 1211 Geneva 11 (Switzerland); Borisch, Bettina [Department of Social and Preventive Medicine, Centre medical universitaire, 1, rue Michel-Servet, 1211 Geneva 11 (Switzerland); Hoessli, Daniel C., E-mail: danielhoessli@gmail.com [Department of Pathology and Immunology, Centre medical universitaire, 1, rue Michel-Servet, 1211 Geneva 11 (Switzerland)
2011-01-15
In B-non-Hodgkin lymphomas, Lyn and Cbp/PAG constitute the core of an oncogenic signalosome that captures the Phosphatidylinositol-3-kinase, the Spleen tyrosine kinase and the Signal transducer and activator of transcription-3 to generate pro-survival and proliferative signals. Lymphoma lines corresponding to follicular, mantle-cell and Burkitt-derived lymphomas display type-specific signalosome organizations that differentially activate PI3K, Syk and STAT3. In the follicular lymphoma line, PI3K, Syk and STAT3 were optimally activated upon association with the Lyn-Cbp/PAG signalosome, while in the Burkitt lymphoma-derived line, the association with Cbp/PAG and activation of PI3K were interfered with by the latent membrane proteins encoded by the Epstein-Barr virus. In the Jeko-1 mantle-cell line, a weak association of Syk with the Lyn-Cbp/PAG signalosome resulted in poor activation of Syk, but in those cells, as in the follicular and Burkitt-derived lines, efficient apoptosis induction by the Syk inhibitor R406 indicated that Syk is nonetheless an important prosurvival element and therefore a valuable therapeutic target. In all configurations described herein is the Lyn-Cbp/PAG signalosome independent of external signals and provides efficient means of activation for its associated lipid and protein kinases. In follicular and Burkitt-derived lines, Syk appears to be activated following binding to Cbp/PAG and no longer requires B-cell receptor-associated activation motifs for activation. Assessment of the different modalities of Lyn-Cbp/PAG signalosome organization could help in selecting the appropriate combination of kinase inhibitors to eliminate a particular type of lymphoma cells.
Energy Technology Data Exchange (ETDEWEB)
Watabe, Masaki [Texas A & M Univ., College Station, TX (United States)
2010-05-01
MINOS (Main Injector Neutrino Oscillation Search) experiment has been designed to search for a change in the avor composition of a beam of muon neutrinos as they travel between the Near Detector at Fermi National Accelerator Laboratory and the Far Detector in the Soudan mine in Minnesota, 735 km from the target. The MINOS oscillation analysis is mainly performed with the charged current (CC) events and sensitive to constrain high- Δm2 values. However, the quasi-elastic (QEL) charged current interaction is dominant in the energy region important to access low- m2 values. For further improvement, the QEL oscillation analysis is performed in this dissertation. A data sample based on a total of 2.50 x 1020 POT is used for this analysis. In summary, 55 QEL-like events are observed at the Far detector while 87.06 ± 13.17 (syst:) events are expected with null oscillation hypothesis. These data are consistent with disappearance via oscillation with m2 = 2:10 0.37 (stat:) ± 0.24 (syst:) eV2 and the maximal mixing angle.
Electron Neutrino Appearance in the MINOS Experiment
Energy Technology Data Exchange (ETDEWEB)
Orchanian, Mhair-armen Hagop [California Inst. of Technology (CalTech), Pasadena, CA (United States)
2012-01-01
This thesis describes a search for ve appearance in the two-detector long-baseline MINOS neutrino experiment at Fermilab, based on a data set representing an exposure of 8.2×1020 protons on the NuMI target. The analysis detailed herein represents an increase in sensitivity to the θ13 mixing angle of approximately 25% over previous analyses, due to improvements in the event discriminant and fitting technique. Based on our observation, we constrain the value of θ13 further, finding 2 sin2θ 23 sin2θ 13< 0.12(0.20) at the 90% confidence level for δCP = 0 and the normal (inverted) neutrino mass hierarchy. The best-fit value is 2 sin2θ 23 sin2θ 13 = 0.041+0.047 -0.031(0.079+0.071 -0.053) under the same assumptions. We exclude the θ 13 = 0 hypothesis at the 89% confidence level.
Recent Results from the MINOS Experiment
International Nuclear Information System (INIS)
Diwan, M.V.
2009-01-01
MINOS is an accelerator neutrino oscillation experiment at Fermilab. An intense high energy neutrino beam is produced at Fermilab and sent to a near detector on the Fermilab site and also to a 5 kTon far detector 735 km away in the Soudan mine in northern Minnesota. The experiment has now had several years of running with millions of events in the near detector and hundreds of events recorded in the far detector. I will report on the recent results from this experiment which include precise measurement of |Δm 2 32 |, analysis of neutral current data to limit the component of sterile neutrinos and the search for ν μ → ν e conversion. The focus will be on the analysis of data for ν μ → ν e conversion. Using data from an exposure of 3.14 x 10 20 protons on target, we have selected electron type events in both the near and the far detector. The near detector is used to measure the background which is extrapolated to the far detector. We have found 35 events in the signal region with a background expectation of 27 ± 5(stat) ± 2(syst). Using this observation we set a 90% C.L. limit of sin 2 2θ 13 cp = 0 and normal mass hierarchy. Further analysis is under way to reduce backgrounds and improve sensitivity.
A study of muon neutrino to electron neutrino oscillations in the MINOS experiment
Energy Technology Data Exchange (ETDEWEB)
Yang, Tingjun [Stanford Univ., CA (United States)
2009-03-01
The observation of neutrino oscillations (neutrino changing from one flavor to another) has provided compelling evidence that the neutrinos have non-zero masses and that leptons mix, which is not part of the original Standard Model of particle physics. The theoretical framework that describes neutrino oscillation involves two mass scales (Δmatm2 and Δmsol2), three mixing angles (θ12, θ23, and θ13) and one CP violating phase (δCP). Both mass scales and two of the mixing angles (θ12 and θ23) have been measured by many neutrino experiments. The mixing angle θ13, which is believed to be very small, remains unknown. The current best limit on θ13 comes from the CHOOZ experiment: θ13 < 11° at 90% C.L. at the atmospheric mass scale. δCP is also unknown today. MINOS, the Main Injector Neutrino Oscillation Search, is a long baseline neutrino experiment based at Fermi National Accelerator Laboratory. The experiment uses a muon neutrino beam, which is measured 1 km downstream from its origin in the Near Detector at Fermilab and then 735 km later in the Far Detector at the Soudan mine. By comparing these two measurements, MINOS can obtain parameters in the atmospheric sector of neutrino oscillations. MINOS has published results on the precise measurement of Δmatm2 and θ23 through the disappearance of muon neutrinos in the Far Detector and on a search for sterile neutrinos by looking for a deficit in the number of neutral current interactions seen in the Far Detector. MINOS also has the potential to improve the limit on the neutrino mixing angle θ13 or make the first measurement of its value by searching for an electron neutrino appearance signal in the Far Detector. This is the focus of the study presented in this thesis. We developed a neural network based algorithm to
Recent results from the MINOS experiment
International Nuclear Information System (INIS)
Diwan, Milind
2009-01-01
MINOS is an accelerator neutrino oscillation experiment at Fermilab. An intense high energy neutrino beams is produced at Fermilab and sent to a near detector on the Fermilab site and also to a 5 kton far detector 735 km away in the Soudan mine in northern Minnesota. The experiment has now had several years of running with millions of events in the near detector and hundreds of events recorded in the far detector. Here it is reported on the recent results from this experiment which include precise measurement of ∣Δm 2 32 ∣, analysis of neutral current data to limit the component of sterile neutrinos, and the search for ν μ →ν e conversion. The focus will be on the analysis of data for ν μ →ν e conversion. Using data from an exposure of 3.14x10 20 protons on target, we have selected electron type events in both the near and the far detector. The near detector is used to measure the background which is extrapolated to the far detector. It has been found 35 events in the signal region with a background expectation of 27∓5(stat)∓2(Syst). Using this observation it has been set a 90 % C.L. limit of sin 2 2θ 13 cp =0 and normal mass hierarchy. Further analysis is under way to reduce backgrounds and improve sensitivity.
Observation of muon intensity variations by season with the MINOS near detector
Energy Technology Data Exchange (ETDEWEB)
Adamson, P.; Anghel, I.; Aurisano, A.; Barr, G.; Bishai, M.; Blake, A.; Bock, G. J.; Bogert, D.; Cao, S. V.; Castromonte, C. M.; Childress, S.; Coelho, J. A. B.; Corwin, L.; Cronin-Hennessy, D.; de Jong, J. K.; Devan, A. V.; Devenish, N. E.; Diwan, M. V.; Escobar, C. O.; Evans, J. J.; Falk, E.; Feldman, G. J.; Fields, T. H.; Frohne, M. V.; Gallagher, H. R.; Gomes, R. A.; Goodman, M. C.; Gouffon, P.; Graf, N.; Gran, R.; Grzelak, K.; Habig, A.; Hahn, S. R.; Hartnell, J.; Hatcher, R.; Holin, A.; Huang, J.; Hylen, J.; Irwin, G. M.; Isvan, Z.; James, C.; Jensen, D.; Kafka, T.; Kasahara, S. M. S.; Koizumi, G.; Kordosky, M.; Kreymer, A.; Lang, K.; Ling, J.; Litchfield, P. J.; Lucas, P.; Mann, W. A.; Marshak, M. L.; Mathis, M.; Mayer, N.; McGivern, C.; Medeiros, M. M.; Mehdiyev, R.; Meier, J. R.; Messier, M. D.; Miller, W. H.; Mishra, S. R.; Moed Sher, S.; Moore, C. D.; Mualem, L.; Musser, J.; Naples, D.; Nelson, J. K.; Newman, H. B.; Nichol, R. J.; Nowak, J. A.; O’Connor, J.; Orchanian, M.; Osprey, S.; Pahlka, R. B.; Paley, J.; Patterson, R. B.; Pawloski, G.; Perch, A.; Phan-Budd, S.; Plunkett, R. K.; Poonthottathil, N.; Qiu, X.; Radovic, A.; Rebel, B.; Rosenfeld, C.; Rubin, H. A.; Sanchez, M. C.; Schneps, J.; Schreckenberger, A.; Schreiner, P.; Sharma, R.; Sousa, A.; Tagg, N.; Talaga, R. L.; Thomas, J.; Thomson, M. A.; Tian, X.; Timmons, A.; Tognini, S. C.; Toner, R.; Torretta, D.; Urheim, J.; Vahle, P.; Viren, B.; Weber, A.; Webb, R. C.; White, C.; Whitehead, L.; Whitehead, L. H.; Wojcicki, S. G.; Zwaska, R.
2014-07-01
A sample of 1.53$\\times$10$^{9}$ cosmic-ray-induced single muon events has been recorded at 225 meters-water-equivalent using the MINOS Near Detector. The underground muon rate is observed to be highly correlated with the effective atmospheric temperature. The coefficient $\\alpha_{T}$, relating the change in the muon rate to the change in the vertical effective temperature, is determined to be 0.428$\\pm$0.003(stat.)$\\pm$0.059(syst.). An alternative description is provided by the weighted effective temperature, introduced to account for the differences in the temperature profile and muon flux as a function of zenith angle. Using the latter estimation of temperature, the coefficient is determined to be 0.352$\\pm$0.003(stat.)$\\pm$0.046(syst.).
Domain decomposition methods for core calculations using the MINOS solver
International Nuclear Information System (INIS)
Guerin, P.; Baudron, A. M.; Lautard, J. J.
2007-01-01
Cell by cell homogenized transport calculations of an entire nuclear reactor core are currently too expensive for industrial applications, even if a simplified transport (SPn) approximation is used. In order to take advantage of parallel computers, we propose here two domain decomposition methods using the mixed dual finite element solver MINOS. The first one is a modal synthesis method on overlapping sub-domains: several Eigenmodes solutions of a local problem on each sub-domain are taken as basis functions used for the resolution of the global problem on the whole domain. The second one is an iterative method based on non-overlapping domain decomposition with Robin interface conditions. At each iteration, we solve the problem on each sub-domain with the interface conditions given by the solutions on the close sub-domains estimated at the previous iteration. For these two methods, we give numerical results which demonstrate their accuracy and their efficiency for the diffusion model on realistic 2D and 3D cores. (authors)
Minos: a SPN solver for core calculation in the DESCARTES system
International Nuclear Information System (INIS)
Baudron, A.M.; Lautard, J.J.
2005-01-01
This paper describes a new development of a neutronic core solver done in the context of a new generation neutronic reactor computational system, named DESCARTES. For performance reasons, the numerical method of the existing MINOS solver in the SAPHYR system has been reused in the new system. It is based on the mixed dual finite element approximation of the simplified transport equation. The solver takes into account assembly discontinuity coefficients (ADF) in the simplified transport equation (SPN) context. The solver has been rewritten in C++ programming language using an object oriented design. Its general architecture was reconsidered in order to improve its capability of evolution and its maintainability. Moreover, the performances of the old version have been improved mainly regarding the matrix construction time; this result improves significantly the performance of the solver in the context of industrial application requiring thermal hydraulic feedback and depletion calculations. (authors)
An optimized oscillation analysis of MINOS beam data
International Nuclear Information System (INIS)
Culling, Andrew John
2007-01-01
This thesis presents results of the MINOS long baseline neutrino oscillation experiment. Charged Current interactions of ν μ from the NuMI beamline have been recorded in both the Near and Far Detectors between May 2005 and February 2006, corresponding to 1.27 x 10 20 protons being delivered to the NuMI target. Several techniques for improving the sensitivity of an oscillation measurement are discussed and their impact assessed. 378 events are observed in the Far Detector during this period, compared to a prediction of 459 ± 31 events are observed in the Far Detector during this period, compared to a prediction of 459 ± 31 events when the observed Near Detector spectrum is extrapolated to the Far Detector over the 735 km baseline with no oscillations. In addition to this deficit of observed events, there is also evidence for spectral distortion in the Far Detector. A maximum likelihood analysis is used to determine the best fit point and allowed regions in Δm 2 23 and sin 2 2θ 23 parameter space. The best fit values for Δm 2 23 and sin 2 2θ 23 are found to be 2.55 +0.39 -0.24 x 10 -3 eV 2 and > 0.87 (68% CL) respectively
Directory of Open Access Journals (Sweden)
J. Sciare
2003-01-01
Full Text Available During the major part of the Mediterranean Intensive Oxidant Study (MINOS campaign (summer 2001, Crete Isl., the Marine Boundary Layer (MBL air was influenced by long range transport of biomass burning from the northern and western part of the Black Sea. During this campaign, carbonaceous aerosols were collected on quartz filters at a Free Tropospheric (FT site, and at a MBL site together with size-resolved distribution of aerosols. Three Evolution Gas Analysis (EGA protocols have been tested in order to better characterize the collected aged biomass burning smoke: A 2-step thermal method (Cachier et al., 1989 and a thermo-optical technique using two different temperature programs. The later temperature programs are those used for IMPROVE (Interagency Monitoring of Protected Visual Environments and NIOSH 5040 (National Institute of Occupational Safety and Health. Artifacts were observed using the NIOSH temperature program and identified as interactions between carbon and dust deposited on the filter matrix at high temperature (T>550ºC under the pure helium step of the analysis. During the MINOS campaign, Black Carbon (BC and Organic Carbon (OC mass concentrations were on average respectively 1.19±0.56 and 3.62±1.08 mgC/m3 for the IMPROVE temperature program, and 1.09±0.36 and 3.75±1.24 mgC/m3 for the thermal method. Though these values compare well on average and the agreement between the Total Carbon (TC measurements sample to sample was excellent (slope=1.00, r2=0.93, n=56, important discrepancies were observed in determining BC concentrations from these two methods (average error of 33±22%. BC from the IMPROVE temperature program compared well with non-sea-salt potassium (nss-K pointing out an optical sensitivity to biomass burning. On the other hand, BC from the thermal method showed a better agreement with non-sea-salt sulfate (nss-SO4, considered as a tracer for fossil fuel combustion during the MINOS campaign. The coupling between
Prevalence of bortezomib-resistant constitutive NF-kappaB activity in mantle cell lymphoma
Directory of Open Access Journals (Sweden)
Kahl Brad S
2008-05-01
Full Text Available Abstract Background The proteasome inhibitor bortezomib can inhibit activation of the transcription factor NF-κB, a mechanism implicated in its anti-neoplastic effects observed in mantle cell lymphoma (MCL. However, NF-κB can be activated through many distinct mechanisms, including proteasome independent pathways. While MCL cells have been shown to harbor constitutive NF-κB activity, what fraction of this activity in primary MCL samples is sensitive or resistant to inhibition by bortezomib remains unclear. Results Proteasome activity in the EBV-negative MCL cell lines Jeko-1 and Rec-1 is inhibited by greater than 80% after exposure to 20 nM bortezomib for 4 hours. This treatment decreased NF-κB activity in Jeko-1 cells, but failed to do so in Rec-1 cells when assessed by electrophoretic mobility shift assay (EMSA. Concurrently, Rec-1 cells were more resistant to the cytotoxic effects of bortezomib than Jeko-1 cells. Consistent with a proteasome inhibitor resistant pathway of activation described in mouse B-lymphoma cells (WEHI231 and a breast carcinoma cell line (MDA-MB-468, the bortezomib-resistant NF-κB activity in Rec-1 cells is inhibited by calcium chelators, calmodulin inhibitors, and perillyl alcohol, a monoterpene capable of blocking L-type calcium channels. Importantly, the combination of perillyl alcohol and bortezomib is synergistic in eliciting Rec-1 cell cytotoxicity. The relevance of these results is illuminated by the additional finding that a considerable fraction of primary MCL samples (8 out of 10 displayed bortezomib-resistant constitutive NF-κB activity. Conclusion Our findings show that bortezomib-resistant NF-κB activity is frequently observed in MCL samples and suggest that this activity may be relevant to MCL biology as well as serve as a potential therapeutic target.
A measurement of muon neutrino disappearance with the MINOS detectors and NuMI beam
Energy Technology Data Exchange (ETDEWEB)
Ospanov, Rustem [Texas U.
2008-08-01
MINOS is a long-baseline two-detector neutrino oscillation experiment that uses a high intensity muon neutrino beam to investigate the phenomena of neutrino oscillations. The neutrino beam is produced by the NuMI facility at Fermilab, Batavia, Illinois, and is observed at near and far detectors placed 734 km apart. The neutrino interactions in the near detector are used to measure the initial muon neutrino fl The vast majority of neutrinos travel through the near detector and Earth matter without interactions. A fraction of muon neutrinos oscillate into other fl vors resulting in the disappearance of muon neutrinos at the far detector. This thesis presents a measurement of the muon neutrino oscillation parameters in the framework of the two-neutrino oscillation hypothesis.
A search for muon neutrino to electron neutrino oscillations in the MINOS Experiment
Energy Technology Data Exchange (ETDEWEB)
Ochoa Ricoux, Juan Pedro [California Inst. of Technology (CalTech), Pasadena, CA (United States)
2009-01-01
We perform a search for vμ → ve oscillations, a process which would manifest a nonzero value of the θ13 mixing angle, in the MINOS long-baseline neutrino oscillation experiment. The analysis consists of searching for an excess of ve charged-current candidate events over the predicted backgrounds, made mostly of neutral-current events with high electromagnetic content. A novel technique to select electron neutrino events is developed, which achieves an improved separation between the signal and the backgrounds, and which consequently yields a better reach in θ13. The backgrounds are predicted in the Far Detector from Near Detector measurements. An excess is observed in the Far Detector data over the predicted backgrounds, which is consistent with the background-only hypothesis at 1.2 standard deviations.
Observation in the MINOS far detector of the shadowing of cosmic rays by the sun and moon
International Nuclear Information System (INIS)
2010-01-01
The shadowing of cosmic ray primaries by the the moon and sun was observed by the MINOS far detector at a depth of 2070 mwe using 83.54 million cosmic ray muons accumulated over 1857.91 live-days. The shadow of the moon was detected at the 5.6 σ level and the shadow of the sun at the 3.8 σ level using a log-likelihood search in celestial coordinates. The moon shadow was used to quantify the absolute astrophysical pointing of the detector to be 0.17 ± 0.12 o . Hints of Interplanetary Magnetic Field effects were observed in both the sun and moon shadow.
Search for neutrino oscillations in the MINOS experiment by using quasi-elastic interactions
Energy Technology Data Exchange (ETDEWEB)
Piteira, Rodolphe [Univ. Pierre et Marie Curie, Paris (France)
2005-09-29
The enthusiasm of the scientific community for studying oscillations of neutrinos is equaled only by the mass of their detectors. The MINOS experiment determines and compares the near spectrum of muonic neutrinos from the NUMI beam to the far one, in order to measure two oscillation parameters: Δm$2\\atop{23}$ and sin2 (2θ23). The spectra are obtained by analyzing the charged current interactions which difficulty lies in identifying the interactions products (e.g. muons). An alternative method identifying the traces of muons, bent by the magnetic field of the detectors, and determining their energies is presented in this manuscript. The sensitivity of the detectors is optimal for the quasi-elastic interactions, for which a selection method is proposed, to study their oscillation. Even though it reduces the statistics, such a study introduces fewer systematic errors, constituting the ideal method on the long range.
International Nuclear Information System (INIS)
Fields, T.; Guarino, V.; Petereit, E.; Schoessow, P.; Thompson, K.
1996-01-01
This proposal describes an alternative to the reference design for the construction of the toroidal magnet for the detector for the MINOS experiment. This design proposes to construct the steel planes from several steel sheets and laminate them into the required thickness of four centimeters. The 8 meter planes are constructed by cutting all of the steel plates to the same size, which is pie a pie shaped segment of either 30 or 22.5 degrees each. All of the plates in the construction are identical, which is conducive to rapid production and lower cost. The advantages of the proposed laminated construction over the reference design are listed in this paper
International Nuclear Information System (INIS)
Bhattacharya, Debdatta
2009-01-01
This thesis presents the measurement of energy dependence of the neutrino-nucleon inclusive charged current cross section on an isoscalar target in the range 3-50 GeV for neutrinos and 5-50 GeV energy range for antineutrinos. The data set was collected with the MINOS Near Detector using the wide band NuMI beam at Fermilab. The size of the charged current sample is 1.94 x 10 6 neutrino events and 1.60 x 10 5 antineutrino events. The flux has been extracted using a low hadronic energy sub-sample of the charged current events. The energy dependence of the cross section is obtained by dividing the charged current sample with the extracted flux. The neutrino and antineutrino cross section exhibits a linear dependence on energy at high energy but shows deviations from linear behavior at low energy. We also present a measurement of the ratio of antineutrino to neutrino inclusive cross section
Energy Technology Data Exchange (ETDEWEB)
Bhattacharya, Debdatta [Univ. of Pittsburgh, PA (United States)
2009-01-01
This thesis presents the measurement of energy dependence of the neutrino-nucleon inclusive charged current cross section on an isoscalar target in the range 3-50 GeV for neutrinos and 5-50 GeV energy range for antineutrinos. The data set was collected with the MINOS Near Detector using the wide band NuMI beam at Fermilab. The size of the charged current sample is 1.94 x 106 neutrino events and 1.60 x 105 antineutrino events. The flux has been extracted using a low hadronic energy sub-sample of the charged current events. The energy dependence of the cross section is obtained by dividing the charged current sample with the extracted flux. The neutrino and antineutrino cross section exhibits a linear dependence on energy at high energy but shows deviations from linear behavior at low energy. We also present a measurement of the ratio of antineutrino to neutrino inclusive cross section.
Energy Technology Data Exchange (ETDEWEB)
De las Heras, A.; Medgar, M. J.
2004-07-01
The aim of the present work was to determine the water quality at the Mino river (Galicia), which belongs to the North river basin, as well as the problems associated to the contaminant contributions originated due to population changes, industrial development and agriculture and live-sock activities during a 23 years period (1973-1995). Similarly, the prediction of such changes till the year 2010 is also realized. The 26 analyzed parameters were obtained from the Database of the COCA-MOPU (Water Quality Control Web), and they were statistically analyzed by means of the hierarchical cluster analysis, principal complements multi variance analysis and the predictor technique for temporal series. Four different factors were identified: alkalinity, physical water characteristics, salinity and organic burden, with an accumulated variance of 60.2%. The predictive analysis adjusted to the ARIMA model, shows the tendency to rise of variables defining alkalinity, salinity and organic matter, if present conditions are maintained. (Author) 17 refs.
Testing CPT conservation using the NuMI neutrino beam with the MINOS experiment
Energy Technology Data Exchange (ETDEWEB)
Auty, David John [Univ. of Sussex, Brighton (United Kingdom)
2010-03-01
The MINOS experiment was designed to measure neutrino oscillation parameters with muon neutrinos. It achieves this by measuring the neutrino energy spectrum and flavor composition of the man-made NuMI neutrino beam 1km after the beam is formed and again after 735 km. By comparing the two spectra it is possible to measure the oscillation parameters. The NuMI beam is made up of 7.0%$\\bar{v}$μ, which can be separated from the vμ because the MINOS detectors are magnetized. This makes it possible to study $\\bar{v}$μ oscillations separately from those of muon neutrinos, and thereby test CPT invariance in the neutrino sector by determining the $\\bar{v}$μ oscillation parameters and comparing them with those for vμ, although any unknown physics of the antineutrino would appear as a difference in oscillation parameters. Such a test has not been performed with beam $\\bar{v}$μ before. It is also possible to produce an almost pure $\\bar{v}$μ beam by reversing the current through the magnetic focusing horns of the NuMI beamline, thereby focusing negatively, instead of positively charged particles. This thesis describes the analysis of the 7% $\\bar{v}$μ component of the forward horn current NuMI beam. The $\\bar{v}$μ of a data sample of 3.2 x 10{sup 20} protons on target analysis found 42 events, compared to a CPT conserving prediction of 58.3-7.6+7.6(stat.)-3.6+3.6(syst.) events. This corresponds to a 1.9 σ deficit, and a best fit value of Δ$\\bar{m}$322 = 18 x 10-3 eV2 and sin2 2$\\bar{θ}$23 = 0.55. This thesis focuses particularly on the selection of $\\bar{v}$μ events, and investigates possible improvements of the selection algorithm. From this a different selector was chosen, which corroborated the findings of the original selector. The
Sterile neutrino oscillations in MINOS and hadron production in pC collisions
Energy Technology Data Exchange (ETDEWEB)
Tinti, Gemma Maria [Univ. of Oxford (United Kingdom)
2010-01-01
MINOS is a long baseline neutrino oscillation experiment, starting with a muon-neutrino beam, for the precise measurement of the atmospheric neutrino oscillation parameters |Δm2| and θ23. The Near Detector measures the neutrino flux and spectra before oscillations. The beam propagates for 735 km to the Far Detector, which measures the depleted spectrum after oscillations. The depletion can be interpreted as vμ → vτ oscillations. Subdominant vμ → ve oscillations may be allowed if the mixing angle θ13 ≠ 0. The two detectors are functionally identical in order to cancel systematic errors when using the Near Detector data to constrain the Far Detector prediction. A crucial part of the analysis is the relative calibration between the two detectors, which is known at the 2% level. A calibration procedure to remove the time and temperature dependence of the detector response using through-going cosmic muons is presented here. Although the two-detector approach reduces the systematic uncertainties related to the neutrino flux, a cross check on the neutrino parent meson ratios is performed in this thesis. The cross sections of mesons produced in proton-carbon interactions from the NA49 experiment have been measured and the results have been compared to the MINOS expectations. A neutrino oscillation analysis allowing mixing to a sterile neutrino is performed, under the assumption that the additional mass splitting is Ο(1 eV2). The analysis uses the energy spectrum of the neutral current interaction products, as neutral current interactions are sensitive to sterile neutrino mixing but not to the active flavour neutrino mixing. The neutrino oscillation parameters have been found to be: |Δm2| = 2.43-0.18+0.21 x 10-3 eV2, θ23 = 40.27°-5.17+14.64, θ24 = 0.00°+5.99 and
Heterogeneity of mammary lesions represent molecular differences
International Nuclear Information System (INIS)
Namba, Ruria; Gregg, Jeffrey P; Maglione, Jeannie E; Davis, Ryan R; Baron, Colin A; Liu, Stephenie; Carmack, Condie E; Young, Lawrence JT; Borowsky, Alexander D; Cardiff, Robert D
2006-01-01
Human breast cancer is a heterogeneous disease, histopathologically, molecularly and phenotypically. The molecular basis of this heterogeneity is not well understood. We have used a mouse model of DCIS that consists of unique lines of mammary intraepithelial neoplasia (MIN) outgrowths, the premalignant lesion in the mouse that progress to invasive carcinoma, to understand the molecular changes that are characteristic to certain phenotypes. Each MIN-O line has distinguishable morphologies, metastatic potentials and estrogen dependencies. We utilized oligonucleotide expression arrays and high resolution array comparative genomic hybridization (aCGH) to investigate whole genome expression patterns and whole genome aberrations in both the MIN-O and tumor from four different MIN-O lines that each have different phenotypes. From the whole genome analysis at 35 kb resolution, we found that chromosome 1, 2, 10, and 11 were frequently associated with whole chromosome gains in the MIN-Os. In particular, two MIN-O lines had the majority of the chromosome gains. Although we did not find any whole chromosome loss, we identified 3 recurring chromosome losses (2F1-2, 3E4, 17E2) and two chromosome copy number gains on chromosome 11. These interstitial deletions and duplications were verified with a custom made array designed to interrogate the specific regions at approximately 550 bp resolution. We demonstrated that expression and genomic changes are present in the early premalignant lesions and that these molecular profiles can be correlated to phenotype (metastasis and estrogen responsiveness). We also identified expression changes associated with genomic instability. Progression to invasive carcinoma was associated with few additional changes in gene expression and genomic organization. Therefore, in the MIN-O mice, early premalignant lesions have the major molecular and genetic changes required and these changes have important phenotypic significance. In contrast, the changes
Johnson, D M; Jones, R N
1996-01-01
DMG-DMDOT (CL-331,002 OR CL-331,928) and DMG-MINO (CL-329,998 or CL-344,677) are two new semisynthetic tetracyclines called glycylcyclines, with a broad spectrum of activity and includes Enterobacteriaceae, Gram-positive cocci, JK diphtheroids, and Bacillus cereus. Potent activity was demonstrated against all Streptococcus spp. strains [minimum inhibitory concentrations] (MIC90S) 0.06-0.25 micrograms/ml) and staphylococci (oxacillin susceptible ans resistant; MIC90S 0.12-2 micrograms/ml). Both glycylcyclines (MIC90, 0.06 micrograms/ml) were more potent than minocycline (MIC90 8 micrograms/ml) against Enterococcus faecium, many of which were vancomycin resistant (116 strains). Organisms with minocycline MICs at > or = 8 micrograms/ml (Staphylococcus aureus, enterococci, beta-hemolytic streptococci, and pneumococci) had glycylcycline MIC results ranging from 0.06 to 0.5 micrograms/ml (e.g., apparent use against existing tetracycline-resistance phenotypes). Drugs in this class appear promising for therapy of infections caused by Gram-positive species now testing resistant to contemporary antimicrobial agents, and further development of compounds in this class is encouraged.
Antineutrino Oscillations and a Search for Non-standard Interactions with the MINOS
Energy Technology Data Exchange (ETDEWEB)
Isvan, Zeynep [Univ. of Pittsburgh, PA (United States)
2012-01-01
MINOS searches for neutrino oscillations using the disappearance of muon neutrinos from the NuMI beam at Fermilab between two detectors. The Near Detector, located near the source, measures the beam composition before flavor change occurs. The energy spectrum is measured again at the Far Detector after neutrinos travel a distance. The mixing angle and mass splitting between the second and third mass states are extracted from the energy dependent difference between the spectra at the two detectors. NuMI is able to produce an antineutrino-enhanced beam as well as a neutrino-enhanced beam. Collecting data in antineutrino-mode allows the direct measurement of antineutrino oscillation parameters. From the analysis of the antineutrino mode data we measure $|\\Delta\\bar{m}^{2}_{\\text{atm}}| = 2.62^{+0.31}_{-0.28}\\times10^{-3}\\text{eV}^{2}$ and $\\sin^{2}(2\\bar{\\theta})_{23} = 0.95^{+0.10}_{-0.11}$, which is the most precise measurement of antineutrino oscillation parameters to date. A difference between neutrino and antineutrino oscillation parameters may indicate new physics involving interactions that are not part of the Standard Model, called non-standard interactions, that alter the apparent disappearance probability. Collecting data in neutrino and antineutrino mode independently allows a direct search for non-standard interactions. In this dissertation non-standard interactions are constrained by a combined analysis of neutrino and antineutrino datasets and no evidence of such interactions is found.
Hormonal and lifestyle determinants of appendicular skeletal muscle mass in men: the MINOS study.
Szulc, Pawel; Duboeuf, François; Marchand, François; Delmas, Pierre D
2004-08-01
Aging-related sarcopenia is characterized by a loss of muscle mass and strength and increased fatigability. However, studies of its determinants in elderly men are scarce. We investigated risk factors for sarcopenia in a large cohort of men. We analyzed 845 men aged 45-85 y who belonged to the MINOS cohort. Lifestyle factors (physical activity, tobacco smoking, alcohol intake, caffeine intake) were evaluated by using a standardized questionnaire. Appendicular skeletal muscle mass (ASM) was estimated by using dual-energy X-ray absorptiometry. The relative appendicular skeletal muscle mass index (RASM) was calculated as ASM/body height(2.3). Apparent free testosterone concentration (AFTC) and free testosterone index (FTI) were calculated on the basis of concentrations of total testosterone and sex hormone-binding globulin. RASM decreased with age (r = -0.29, P values for AFTC, FTI, or 25-hydroxycholecalciferol [25(OH)D] were >2 SDs below the mean for young men had significantly lower RASM than did men with higher values. Men with sarcopenia, defined as the lowest quartile of RASM in the studied cohort (normal RASM, weighed significantly less, smoked more, and spent significantly less time on leisure-time activities. Sarcopenic men also had lower values for testosterone, AFTC, FTI, and 25(OH)D. In elderly men, low physical activity, tobacco smoking, thinness, low testosterone (AFTC and FTI), and decreased 25(OH)D concentrations are risk factors for sarcopenia.
Astroparticle physics with the MINOS Far Detector
Energy Technology Data Exchange (ETDEWEB)
Grashorn, Eric William [Univ. of Minnesota, Minneapolis, MN (United States)
2008-06-01
Since August 2003, the MINOS Far Detector collected over 67 million underground muons at Soudan MN, USA. As the temperature of the atmosphere changes, the interaction height of incident cosmic rays changes, which affects the production of muons that are seen underground. A four percent peak-to-peak seasonal fl was seen over a period of four years, which was highly correlated to the measured temperature variations of the upper atmosphere over the same period. The coeffi relating changes in the muon rate to changes changes in atmospheric temperature, αT , was found to be: αT = 0.877 ± 0.010 (stat.) ±0.017 (syst.). A new model was developed to describe the observed effect, and is the fi to include the contribution from kaons. This model predicts αT = 0.865 ± 0.015. The fi measurements of charge separated seasonal variations were reported: αT (µ+) = 0.782 ± 0.056 (stat.) ± 0.02 (syst.), αT (µ-) = 0.788 ± 0.066 (stat.) ± 0.02 (syst.). The observed difference between the pion-only temperature coeffi and the kaon-inclusive temperature coeffi allowed a measurement of the atmospheric K/π ratio = 0.21 ± 0.08. A high signifi observation of two muon signals, the shadow of the sun and moon, have been seen. The shadow of the moon was observed at the 5 σ level, and the shadow of the sun was observed at the 4.3 σ level. The angular resolution of the detector was found to be 0.62° using dimuons, and the two dimensional shadowing distribution was used to quantify the absolute pointing of the detector 0.15 ± 0.10 . A cosmic ray point source search was performed, and no statistically signifi source was found. In the absence of a source, 95% fl limits were placed on cosmic ray sources. The minimum fl limit was -16 -2 -1 2.7 × 10 cm s , which is comparable to the previous best limit set by MACRO [1, 2]. Using the 239 Gamma Ray Bursts (GRBs) of the fi Swift catalog a search for space-time coincidence
Directory of Open Access Journals (Sweden)
A. Ladstätter-Weißenmayer
2003-01-01
Full Text Available The MINOS (Mediterranean INtensive Oxidant Study campaign was an international, multi-platform field campaign to measure long-range transport of air-pollution and aerosols from South East Asia and Europe towards the Mediterranean basin during August 2001. High pollution events were observed during this campaign. For the Mediterranean region enhanced tropospheric nitrogen dioxide (NO2 and formaldehyde (HCHO, which are precursors of tropospheric ozone (O3, were detected by the satellite based GOME (Global Ozone Monitoring Experiment instrument and compared with airborne in situ measurements as well as with the output from the global 3D photochemistry-transport model MATCH-MPIC (Model of Atmospheric Transport and CHemistry - Max Planck Institute for Chemistry. The increase of pollution in that region leads to severe air quality degradation with regional and global implications.
A model study of ozone in the eastern Mediterranean free troposphere during MINOS (August 2001
Directory of Open Access Journals (Sweden)
G. J. Roelofs
2003-01-01
Full Text Available A coupled tropospheric chemistry-climate model is used to analyze tropospheric ozone distributions observed during the MINOS campaign in the eastern Mediterranean region (August, 2001. Modeled ozone profiles are generally in good agreement with the observations. Our analysis shows that the atmospheric dynamics in the region are strongly influenced by the occurrence of an upper tropospheric anti-cyclone, associated with the Asian summer monsoon and centered over the Tibetan Plateau. The anti-cyclone affects the chemical composition of the upper troposphere, where ozone concentrations of about 50 ppbv were measured, through advection of boundary layer air from South-East Asia. A layer between 4-6 km thickness was present beneath, containing up to 120 ppbv of ozone with substantial contributions by transport from the stratosphere and through lightning NOx. Additionally, pollutant ozone from North America was mixed in. Ozone in the lower troposphere originated mainly from the European continent. The stratospheric influence may be overestimated due to too strong vertical diffusion associated with the relatively coarse vertical resolution. The estimated tropospheric ozone column over the eastern Mediterranean is ~50 DU in summer, to which ozone from recent stratospheric origin contributes about 30%, ozone from lightning 13%, and from South-East Asia, North America and Europe about 7%, 8% and 14%, respectively, adding to a long-term hemispheric background of 25% of the column.
Xu, X.; Williams, C.; Plass-Dülmer, H.; Berresheim, H.; Salisbury, G.; Lange, L.; Lelieveld, J.
2003-09-01
During the Mediterranean Intensive Oxidant Study (MINOS) campaign in August 2001 gas-phase organic compounds were measured using comprehensive two-dimensional gas chromatography (GCxGC) at the Finokalia ground station, Crete. In this paper, C7-C11 aromatic and n-alkane measurements are presented and interpreted. The mean mixing ratios of the hydrocarbons varied from 1±1 pptv (i-propylbenzene) to 43±36 pptv (toluene). The observed mixing ratios showed strong day-to-day variations and generally higher levels during the first half of the campaign. Mean diel profiles showed maxima at local midnight and late morning, and minima in the early morning and evening. Results from analysis using a simplified box model suggest that both the chemical sink (i.e. reaction with OH) and the variability of source strengths were the causes of the observed variations in hydrocarbon mixing ratios. The logarithms of hydrocarbon concentrations were negatively correlated with the OH concentrations integral over a day prior to the hydrocarbon measurements. Slopes of the regression lines derived from these correlations for different compounds are compared with literature rate constants for their reactions with OH. The slopes for most compounds agree reasonably well with the literature rate constants. A sequential reaction model has been applied to the interpretation of the relationship between ethylbenzene and two of its potential products, i.e. acetophenone and benzeneacetaldehyde. The model can explain the good correlation observed between [acetophenone]/[ethylbenzene] and [benzeneacetaldehyde]/[ethylbenzene]. The model results and field measurements suggest that the reactivity of benzeneacetaldehyde may lie between those of acetophenone and ethylbenzene and that the ratio between yields of acetophenone and benzeneacetaldehyde may be up to 28:1. Photochemical ages of trace gases sampled at Finokalia during the campaign are estimated using the sequential reaction model and related data
Directory of Open Access Journals (Sweden)
M. Vrekoussis
2004-01-01
Full Text Available During the MINOS campaign (28 July-18 August 2001 the nitrate (NO3 radical was measured at Finokalia station, on the north coast of Crete in South-East Europe using a long path (10.4 km Differential Optical Absorption Spectroscopy instrument (DOAS. Hydroxyl (OH radical was also measured by a Chemical Ionization Mass-Spectrometer (Berresheim et al., 2003. These datasets represent the first simultaneous measurements of OH and NO3 radicals in the area. NO3 radical concentrations ranged from less than 3x107 up to 9x108 radicals· cm-3 with an average nighttime value of 1.1x108 radicals· cm-3. The observed NO3 mixing ratios are analyzed on the basis of the corresponding meteorological data and the volatile organic compound (VOC observations which were measured simultaneously at Finokalia station. The importance of the NO3 radical chemistry relatively to that of OH in the dimethylsulfide (DMS and nitrate cycles is also investigated. The observed NO3 levels regulate the nighttime variation of DMS. The loss of DMS by NO3 during night is about 75% of that by OH radical during day. NO3 and nitrogen pentoxide (N2O5 reactions account for about 21% of the total nitrate (HNO3(g+NO-3(g production.
Campero, Alvaro; Ajler, Pablo; Campero, Abraham Agustín
2014-01-01
Objetivo: El propósito del presente trabajo es presentar los resultados de 36 pacientes con diagnóstico de neuralgia del trigémino (NT), en los cuales se realizó una descompresión microvascular (DMV). Material y Método: Desde junio de 2005 a mayo de 2012, 36 pacientes con diagnóstico de NT fueron operados por el primer autor (AC), realizando una DMV. Se evaluó: Edad, sexo, tiempo de sintomatología previo a la cirugía, hallazgos intraoperatorios (a través de los videos quirúrgicos), y resultados postoperatorios. Resultados: De los 36 pacientes operados, 25 fueron mujeres y 11 varones. El promedio de edad fue de 48 años. El seguimiento postoperatorio fue en promedio de 38 meses. De los 36 pacientes, 32 (88%) evolucionaron sin dolor hasta la fecha. De los 4 casos con recurrencia de dolor, en dos pacientes se observó como hallazgo intraoperatorio un conflicto venoso. Conclusión: La DMV como tratamiento de la NT es un procedimiento efectivo y seguro. El hallazgo intraoperatorio de una “compresión” venosa podría indicar una evolución postoperatoria desfavorable. PMID:25379343
A search for sterile neutrinos at the MINOS experiment
Energy Technology Data Exchange (ETDEWEB)
Pittam, Robert Neil [Univ. of Oxford (United Kingdom)
2010-01-01
MINOS is a long baseline neutrino oscillation experiment based at the Fermi National Accelerator Laboratory in Illinois, USA. The experiment was designed to study neutrino oscillation phenomena. The vμ beam produced by the NuMI beam facility at FNAL is used along with two functionally identical detectors. The Near Detector at FNAL and a Far Detector 735 km away in the Soudan Underground Laboratory in northern Minnesota. Comparison of the observed spectra of neutrinos at the two detectors provides the evidence for neutrino oscillations. This thesis presents work on the postulated phenomena of sterile neutrinos. Oscillations between active and sterile neutrinos will lead to a deficit in the expected rate of measured Neutral Current interactions at the Far Detector. A technique for selecting Neutral Current events utilizing an Artificial Neural Network is presented with resulting overall efficiency of 91.1% and purity of 66.0%. A method of predicting the expected Charged and Neutral Current energy spectra at the Far Detector given the data recorded at the Near Detector is presented. A model to search for oscillations between sterile and active neutrinos is developed. Sources of systematic uncertainty that can effect the results of the analysis are discussed. The analysis developed is applied to a Standard Model 3 flavour oscillation model as a cross check under the scenarios with and without ve appearance. The oscillation parameters measured by this model are Δm322 = (2.39-0.15+0.23) x 10-3 eV2 and θ23 = 0.727-0.11+0.22 for the no ve appearance result. An analysis of the resulting prediction reveals no evidence for active neutrino disappearance. The analysis is then performed using the 4 flavour neutrino oscillation model developed. Again this is done under the 2 scenarios of ve appearance and no ve appearance
Directory of Open Access Journals (Sweden)
X. Xu
2003-01-01
Full Text Available During the Mediterranean Intensive Oxidant Study (MINOS campaign in August 2001 gas-phase organic compounds were measured using comprehensive two-dimensional gas chromatography (GCxGC at the Finokalia ground station, Crete. In this paper, C7-C11 aromatic and n-alkane measurements are presented and interpreted. The mean mixing ratios of the hydrocarbons varied from 1±1 pptv (i-propylbenzene to 43±36 pptv (toluene. The observed mixing ratios showed strong day-to-day variations and generally higher levels during the first half of the campaign. Mean diel profiles showed maxima at local midnight and late morning, and minima in the early morning and evening. Results from analysis using a simplified box model suggest that both the chemical sink (i.e. reaction with OH and the variability of source strengths were the causes of the observed variations in hydrocarbon mixing ratios. The logarithms of hydrocarbon concentrations were negatively correlated with the OH concentrations integral over a day prior to the hydrocarbon measurements. Slopes of the regression lines derived from these correlations for different compounds are compared with literature rate constants for their reactions with OH. The slopes for most compounds agree reasonably well with the literature rate constants. A sequential reaction model has been applied to the interpretation of the relationship between ethylbenzene and two of its potential products, i.e. acetophenone and benzeneacetaldehyde. The model can explain the good correlation observed between [acetophenone]/[ethylbenzene] and [benzeneacetaldehyde]/[ethylbenzene]. The model results and field measurements suggest that the reactivity of benzeneacetaldehyde may lie between those of acetophenone and ethylbenzene and that the ratio between yields of acetophenone and benzeneacetaldehyde may be up to 28:1. Photochemical ages of trace gases sampled at Finokalia during the campaign are estimated using the sequential reaction model and
Mitofilin complexes: conserved organizers of mitochondrial membrane architecture.
Zerbes, Ralf M; van der Klei, Ida J; Veenhuis, Marten; Pfanner, Nikolaus; van der Laan, Martin; Bohnert, Maria
2012-11-01
Mitofilin proteins are crucial organizers of mitochondrial architecture. They are located in the inner mitochondrial membrane and interact with several protein complexes of the outer membrane, thereby generating contact sites between the two membrane systems of mitochondria. Within the inner membrane, mitofilins are part of hetero-oligomeric protein complexes that have been termed the mitochondrial inner membrane organizing system (MINOS). MINOS integrity is required for the maintenance of the characteristic morphology of the inner mitochondrial membrane, with an inner boundary region closely apposed to the outer membrane and cristae membranes, which form large tubular invaginations that protrude into the mitochondrial matrix and harbor the enzyme complexes of the oxidative phosphorylation machinery. MINOS deficiency comes along with a loss of crista junction structures and the detachment of cristae from the inner boundary membrane. MINOS has been conserved in evolution from unicellular eukaryotes to humans, where alterations of MINOS subunits are associated with multiple pathological conditions.
International Nuclear Information System (INIS)
Dahmani, M.; Baudron, A.M.; Lautard, J.J.; Erradi, L.
2001-01-01
The mixed dual nodal method MINOS is used to solve the reactor kinetics equations with improved quasistatic IQS model and the θ method is used to solve the precursor equations. The speed of calculation which is the main advantage of the MINOS method and the possibility to use the large time step for shape flux calculation permitted by the IQS method, allow us to reduce considerably the computing time. The IQS/MINOS method is implemented in CRONOS 3D reactor code. Numerical tests on different transient benchmarks show that the results obtained with the IQS/MINOS method and the direct numerical method used to solve the kinetics equations, are very close and the total computing time is largely reduced
Directory of Open Access Journals (Sweden)
Lucie Lorkova
Full Text Available Mantle cell lymphoma (MCL is a chronically relapsing aggressive type of B-cell non-Hodgkin lymphoma considered incurable by currently used treatment approaches. Fludarabine is a purine analog clinically still widely used in the therapy of relapsed MCL. Molecular mechanisms of fludarabine resistance have not, however, been studied in the setting of MCL so far. We therefore derived fludarabine-resistant MCL cells (Mino/FR and performed their detailed functional and proteomic characterization compared to the original fludarabine sensitive cells (Mino. We demonstrated that Mino/FR were highly cross-resistant to other antinucleosides (cytarabine, cladribine, gemcitabine and to an inhibitor of Bruton tyrosine kinase (BTK ibrutinib. Sensitivity to other types of anti-lymphoma agents was altered only mildly (methotrexate, doxorubicin, bortezomib or remained unaffacted (cisplatin, bendamustine. The detailed proteomic analysis of Mino/FR compared to Mino cells unveiled over 300 differentially expressed proteins. Mino/FR were characterized by the marked downregulation of deoxycytidine kinase (dCK and BTK (thus explaining the observed crossresistance to antinucleosides and ibrutinib, but also by the upregulation of several enzymes of de novo nucleotide synthesis, as well as the up-regulation of the numerous proteins of DNA repair and replication. The significant upregulation of the key antiapoptotic protein Bcl-2 in Mino/FR cells was associated with the markedly increased sensitivity of the fludarabine-resistant MCL cells to Bcl-2-specific inhibitor ABT199 compared to fludarabine-sensitive cells. Our data thus demonstrate that a detailed molecular analysis of drug-resistant tumor cells can indeed open a way to personalized therapy of resistant malignancies.
Functional Insight From Fruit Flies on Human ADHD Candidate Genes
DEFF Research Database (Denmark)
Rohde, Palle Duun; Demontis, Ditte; Arvidson, Sandra Marie Neumann
2015-01-01
Attention deficit hyperactivity disorder (ADHD) is a psychiatric disorder emerging in early childhood with an average prevalence rate of 5% in children and 3.7% in adults. ADHD is characterized by inattention, impulsivity and hyperactivity. This, combined with educational and social dysfunctions...... of developing ADHD. We use Minos mutants, where target genes have been disrupted by the Minos transposable element, to test the effect on locomotor activity. By measuring the distance traveled, we find disparity in locomotor activity between control and Minos mutants. Impaired dopamine system underlies...
Directory of Open Access Journals (Sweden)
Shirsath Nitesh P
2012-10-01
Full Text Available Abstract Background Mantle cell lymphoma (MCL is a well-defined aggressive lymphoid neoplasm characterized by proliferation of mature B-lymphocytes that have a remarkable tendency to disseminate. This tumor is considered as one of the most aggressive lymphoid neoplasms with poor responses to conventional chemotherapy and relatively short survival. Since cyclin D1 and cell cycle control appears as a natural target, small-molecule inhibitors of cyclin-dependent kinases (Cdks and cyclins may play important role in the therapy of this disorder. We explored P276-00, a novel selective potent Cdk4-D1, Cdk1-B and Cdk9-T1 inhibitor discovered by us against MCL and elucidated its potential mechanism of action. Methods The cytotoxic effect of P276-00 in three human MCL cell lines was evaluated in vitro. The effect of P276-00 on the regulation of cell cycle, apoptosis and transcription was assessed, which are implied in the pathogenesis of MCL. Flow cytometry, western blot, immunoflourescence and siRNA studies were performed. The in vivo efficacy and effect on survival of P276-00 was evaluated in a Jeko-1 xenograft model developed in SCID mice. PK/PD analysis of tumors were performed using LC-MS and western blot analysis. Results P276-00 showed a potent cytotoxic effect against MCL cell lines. Mechanistic studies confirmed down regulation of cell cycle regulatory proteins with apoptosis. P276-00 causes time and dose dependent increase in the sub G1 population as early as from 24 h. Reverse transcription PCR studies provide evidence that P276-00 treatment down regulated transcription of antiapoptotic protein Mcl-1 which is a potential pathogenic protein for MCL. Most importantly, in vivo studies have revealed significant efficacy as a single agent with increased survival period compared to vehicle treated. Further, preliminary combination studies of P276-00 with doxorubicin and bortezomib showed in vitro synergism. Conclusion Our studies thus provide
Directory of Open Access Journals (Sweden)
Túlio César Azevedo Alves
2004-12-01
medicamentosa sistémica es considerada como el tratamiento de primera línea para esta enfermedad. El objetivo de este estudio fue de evaluar la eficacia, la seguridad y la tolerabilidad de los diversos tratamientos farmacológicos ofrecidos a los pacientes con neuralgia del trigémino, con la finalidad de suministrar evidencias para las recomendaciones de la práctica clínica e identificar las necesidades de pesquisas adicionales. MÉTODO: Fueron analizados ensayos clínicos aleatorios y controlados, publicados hasta julio de 2003, sobre el efecto analgésico de las drogas prescritas en el tratamiento de la neuralgia del trigémino. El análisis estadístico fue realizado con el auxilio del programa Review Manager 4.2.2 (Colaboración Cochrane, 2003. RESULTADOS: Los resultados de la metanálisis sugieren que la carbamazepina es más eficaz que el placebo. En tres estudios controlados comparando la lamotrigina, el topiramato y el cloridrato de proparacaína al placebo, solamente la lamotrigina se mostró superior a él. El dextrometafano fue comparado al lorazepam en dosis bajas, habiendo aumento del dolor con el uso de aquel fármaco. Tres estudios compararon la carbamazepina con la tizanidina, la tocainida y la pimozida, mostrándose apenas la pimozida superior a la carbamazepina. CONCLUSIONES: La carbamazepina continúa como droga de elección para el tratamiento de la neuralgia del trigémino, estando la lamotrigina y la pimozida indicadas en casos refractarios a la terapia convencional. Además, estudios adicionales son necesarios para que se establezcan futuras opciones terapéuticas.BACKGROUND AND OBJECTIVES: Trigeminal neuralgia is a syndrome of chronic pain, characterized by paroxysms of excruciating pain which dramatically affect patients' quality of life. Systemic drug therapy is the first line treatment for this disease. This study aimed at evaluating efficacy, safety and tolerability of several pharmacologic treatments offered to trigeminal neuralgia patients
Directory of Open Access Journals (Sweden)
Predrag Kalajdzic
Full Text Available Insecticide resistance is a worldwide problem with major impact on agriculture and human health. Understanding the underlying molecular mechanisms is crucial for the management of the phenomenon; however, this information often comes late with respect to the implementation of efficient counter-measures, particularly in the case of metabolism-based resistance mechanisms. We employed a genome-wide insertional mutagenesis screen to Drosophila melanogaster, using a Minos-based construct, and retrieved a line (MiT[w(-]3R2 resistant to the neonicotinoid insecticide Imidacloprid. Biochemical and bioassay data indicated that resistance was due to increased P450 detoxification. Deep sequencing transcriptomic analysis revealed substantial over- and under-representation of 357 transcripts in the resistant line, including statistically significant changes in mixed function oxidases, peptidases and cuticular proteins. Three P450 genes (Cyp4p2, Cyp6a2 and Cyp6g1 located on the 2R chromosome, are highly up-regulated in mutant flies compared to susceptible Drosophila. One of them (Cyp6g1 has been already described as a major factor for Imidacloprid resistance, which validated the approach. Elevated expression of the Cyp4p2 was not previously documented in Drosophila lines resistant to neonicotinoids. In silico analysis using the Drosophila reference genome failed to detect transcription binding factors or microRNAs associated with the over-expressed Cyp genes. The resistant line did not contain a Minos insertion in its chromosomes, suggesting a hit-and-run event, i.e. an insertion of the transposable element, followed by an excision which caused the mutation. Genetic mapping placed the resistance locus to the right arm of the second chromosome, within a ∼1 Mb region, where the highly up-regulated Cyp6g1 gene is located. The nature of the unknown mutation that causes resistance is discussed on the basis of these results.
A Measurement of Electron Neutrino Appearance in the MINOS Experiment After Four Years of Data
Energy Technology Data Exchange (ETDEWEB)
Cavanaugh, Steven [Harvard Univ., Cambridge, MA (United States)
2010-05-01
This work attempts to measure or set a limit on sin2(2θ13), the parameter which describes vμ → ve oscillations. The MINOS detectors at Fermilab are used to perform a search for the oscillations utilizing a beam of vμ neutrinos created in the NuMI beamline by the collisions of 120 GeV protons with a carbon target. These collisions create π± and K± which are focused with magnetic horns, are allowed to decay, and result in a beam of vμ in the energy range of 1 to 30 GeV. Two functionally identical steel-scintillator calorimetric detectors are utilized to measure the interactions of the generated neutrinos. A detector close to the NuMI beam, located 104 m underground and 1040 m from the target, is used to measure the properties of the neutrino beam, including the flux, composition, and energy spectrum. This information is used in part to generate a predicted spectrum of neutrinos in absence of vμ → ve oscillations in the detector located far from the target, at a distance of 705 m underground and 735.5 km from the target. An excess of predicted ve charged current events in this far detector will be interpreted as vμ → ve oscillations, and a measurement of sin2(2θ13) will be made using a Feldman-Cousins analysis. The measurement of vμ → ve requires the separation of ve candidates from background events. New reconstruction software was developed with a focus on identifying ve candidate events in order to reduce systematic errors. The event parameters measured by this software were used as an input to an artificial neutral network event discriminator. The details of this reconstruction software and the other steps of the analysis necessary to making the measurement will be discussed. This work builds on a previous measurement made with this
Groundwater protection for the NuMI project
International Nuclear Information System (INIS)
Wehmann, A.; Smart, W.; Menary, S.; Hylen, J.; Childress, S.
1997-01-01
The physics requirements for the long base line neutrino oscillation experiment MINOS dictate that the NuMI beamline be located in the aquifer at Fermilab. A methodology is described for calculating the level of radioactivation of groundwater caused by operation of this beamline. A conceptual shielding design for the 750 meter long decay pipe is investigated which would reduce radioactivation of the groundwater to below government standards. More economical shielding designs to meet these requirements are being explored. Also, information on local geology, hydrogeology, government standards, and a glossary have been included
Minocycline promotes the generation of dendritic cells with regulatory properties.
Kim, Narae; Park, Chan-Su; Im, Sun-A; Kim, Ji-Wan; Lee, Jae-Hee; Park, Young-Jun; Song, Sukgil; Lee, Chong-Kil
2016-08-16
Minocycline, which has long been used as a broad-spectrum antibiotic, also exhibits non-antibiotic properties such as inhibition of inflammation and angiogenesis. In this study, we show that minocycline significantly enhances the generation of dendritic cells (DCs) from mouse bone marrow (BM) cells when used together with GM-CSF and IL-4. DCs generated from BM cells in the presence of minocycline (Mino-DCs) demonstrate the characteristics of regulatory DCs. Compared with control DCs, Mino-DCs are resistant to subsequent maturation stimuli, impaired in MHC class II-restricted exogenous Ag presentation, and show decreased cytokine secretion. Mino-DCs also show decreased ability to prime allogeneic-specific T cells, while increasing the expansion of CD4+CD25+Foxp3+ T regulatory cells both in vitro and in vivo. In addition, pretreatment with MOG35-55 peptide-pulsed Mino-DCs ameliorates clinical signs of experimental autoimmune encephalitis induced by MOG peptide injection. Our study identifies minocycline as a new pharmacological agent that could be potentially used to increase the production of regulatory DCs for cell therapy to treat autoimmune disorders, allergy, and transplant rejection.
Moon and sun shadowing effect measurements
International Nuclear Information System (INIS)
Medeiros, Michelle Mesquita de; Gomes, Ricardo Avelino
2011-01-01
Full text: The deficit due to the absorption of cosmic rays by the Moon and the Sun can be observed detecting the muon flux generated in extensive air showers. This phenomenon, known as cosmic ray shadow, can be used to study the behaviour of the geomagnetic, solar and interplanetary magnetic fields, to measure the antiproton-proton ratio and to determine the angular resolution and alignment of the detectors to confirm its accuracy and precision. Many experiments using surface or underground detectors have measured the Moon and Sun shadow: MINOS, CYGNUS, CASA, Tibet, MACRO, Soudan2, L3+C, Milagro, BUST, GRAPE and HEGRA. The MINOS experiment (Main Injector Neutrino Oscillation Search) uses two layered steel and plastic scintillator detectors (Near Detector and Far Detector) along with a muon neutrino beam (NuMI - Neutrinos at the Main Injector) to search for ν μ disappearance, and thus neutrino oscillations. However the magnetic field and the fiducial volume of the underground Far Detector at Soudan Underground Mine State Park (Minnesota, USA) allow a great opportunity to investigate cosmic rays at TeV surface energy. The deficit caused by the Moon and the Sun was detected by the MINOS Far Detector and this could also be done using the Near Detector. In this report we describe the motivation of measuring this effect. We present the recent results from MINOS along with its experimental apparatus and, in addition, the main results from the various experiments. We also make considerations about the possibility of doing such a measurement with the MINOS Near Detector. (author)
Activated Microglia Targeting Dendrimer-Minocycline Conjugate as Therapeutics for Neuroinflammation.
Sharma, Rishi; Kim, Soo-Young; Sharma, Anjali; Zhang, Zhi; Kambhampati, Siva Pramodh; Kannan, Sujatha; Kannan, Rangaramanujam M
2017-11-15
Brain-related disorders have outmatched cancer and cardiovascular diseases worldwide as the leading cause of morbidity and mortality. The lack of effective therapies and the relatively dry central nervous system (CNS) drug pipeline pose formidable challenge. Superior, targeted delivery of current clinically approved drugs may offer significant potential. Minocycline has shown promise for the treatment of neurological diseases owing to its ability to penetrate the blood-brain barrier (BBB) and potency. Despite its potential in the clinic and in preclinical models, the high doses needed to affect a positive therapeutic response have led to side effects. Targeted delivery of minocycline to the injured site and injured cells in the brain can be highly beneficial. Systemically administered hydroxyl poly(amidoamine) (PAMAM) generation-6 (G6) dendrimers have a longer blood circulation time and have been shown to cross the impaired BBB. We have successfully prepared and characterized the in vitro efficacy and in vivo targeting ability of hydroxyl-G6 PAMAM dendrimer-9-amino-minocycline conjugate (D-mino). Minocycline is a challenging drug to carry out chemical transformations due to its inherent instability. We used a combination of a highly efficient and mild copper catalyzed azide-alkyne click reaction (CuAAC) along with microwave energy to conjugate 9-amino-minocycline (mino) to the dendrimer surface via enzyme responsive linkages. D-mino was further evaluated for anti-inflammatory and antioxidant activity in lipopolysaccharides-activated murine microglial cells. D-mino conjugates enhanced the intracellular availability of the drug due to their rapid uptake, suppressed inflammatory cytokine tumor necrosis factor α (TNF-α) production, and reduced oxidative stress by suppressing nitric oxide production, all significantly better than the free drug. Fluorescently labeled dendrimer conjugate (Cy5-D-mino) was systematically administered (intravenous, 55 mg/kg) on postnatal
Farooq, Noureen; Qamar, Nazia; Rashid, Shahnaz; Panhwar, Sher Khan
2017-09-01
This study records length-weight relationships (LWRs) for eleven commercially important marine catfish species of the family Ariidae (sea catfishes) and Plotosidae (eel catfishes) from the northern Arabian Sea coast of Pakistan. The specimens were sampled from December 2014 to November 2015, using bottom trawls with various mesh sizes by commercial vessels. The species were Nemapteryx caelatus, Sciades sona, Arius gagora, Batrachocephalus mino, Netuma thalassina, N. bilineata, Osteogeneiosus militaris, Plicofollis dussumieri, P. tenuispinis, Plotosus limbatus, and P. lineatus. Of the eleven species, two species A. gagora and N. bilineata were recorded for the first time and LWRs for four species A. gagora, N. bilineata, S. sona, and B. mino still have no data in the FishBase database. In addition, new maximum length for each of the three species N. bilineata, O. militaris and B. mino was also found.
Fujita, S; Tonohata, A
1990-05-01
The influence of Mueller-Hinton (MH) broth (from BBL Microbiology Systems, and Difco Laboratories) of minimum inhibitory concentrations (MIC) of cefuzoname (CZON), flomoxef (FMOX), imipenem (IPM), and minocycline (MINO) for 100 strains of Staphylococcus aureus was investigated. Antibacterial activity of MINO was stronger than any other antibiotics. MICs of CZON for 16 strains (14 of 50 methicillin-resistant S. aureus (MRSA), 2 of 50 methicillin-sensitive S. aureus) were greater than or equal to 4-fold greater when tested in BBL MH broth than when tested in Difco MH broth, thus, different media altered categories of some strains (8 of 50 MRSA) from susceptible to resistant. MICs of FMOX in the BBL MH broth for 12 of 50 MRSA strains rose greater than or equal to 4-fold compared to the Difco MH broth. On the other hand, MICs of IPM and MINO were affected very little by the different brand of MH broth used.
Extruded plastic scintillator for MINERvA
International Nuclear Information System (INIS)
Pla-Dalmau, Anna; Bross, Alan D.; FermilabRykalin, Victor V.; Wood, Brian M.; NICADD, DeKalb
2005-01-01
An extrusion line has recently been installed at Fermilab in collaboration with NICADD (Northern Illinois Center for Accelerator and Detector Development). This new facility will serve to further develop and improve extruded plastic scintillator. Since polystyrene is widely used in the consumer industry, the logical path was to investigate the extrusion of commercial-grade polystyrene pellets with dopants to yield high quality plastic scintillator. The D0 and MINOS experiments are already using extruded scintillator strips in their detectors. A new experiment at Fermilab is pursuing the use of extruded plastic scintillator. A new plastic scintillator strip is being tested and its properties characterized. The initial results are presented here
Emittance measurements from the LLUMC proton accelerator
International Nuclear Information System (INIS)
Coutrakon, G.; Gillespie, G.H.; Hubbard, J.; Sanders, E.
2005-01-01
A new method of calculating beam emittances at the extraction point of a particle accelerator is presented. The technique uses the optimization programs NPSOL and MINOS developed at Stanford University in order to determine the initial values of beam size, divergence and correlation parameters (i.e. beam sigma matrix, σ ij ) that best fit measured beam parameters. These σ ij elements are then used to compute the Twiss parameters α, β, and the phase space area, ε, of the beam at the extraction point. Beam size measurements in X and Y throughout the transport line were input to the optimizer along with the magnetic elements of bends, quads, and drifts. The σ ij parameters were optimized at the accelerator's extraction point by finding the best agreement between these measured beam sizes and those predicted by TRANSPORT. This expands upon a previous study in which a 'trial and error' technique was used instead of the optimizer software, and which yielded similar results. The Particle Beam Optics Laboratory (PBO Lab TM ) program used for this paper integrates particle beam optics and other codes into a single intuitive graphically-based computing environment. This new software provides a seamless interface between the NPSOL and MINOS optimizer and TRANSPORT calculations. The results of these emittance searches are presented here for the eight clinical energies between 70 and 250 MeV currently being used at LLUMC
The U-line line balancing problem
Miltenburg, G.J.; Wijngaard, J.
1994-01-01
The traditional line balancing (LB) problem considers a production line in which stations are arranged consecutively in a line. A balance is determined by grouping tasks into stations while moving forward (or backward) through a precedence network. Recently many production lines are being arranged
Lifescience Database Archive (English)
Full Text Available mino Acid sequence ---DLLIRKLPFQRLVREIAQEFKTDLRFQFAAIGALQEAFEAYLVGFFEDTNFCAIHAK RVTFMPKDFPLARRFRGERS*rvyfyfltkkkkkkkkqnysthl*ixxxii...TDLRFQFAAIGALQEAFEAYLVGFFEDTNFCAIHAK RVTFMPKDFPLARRFRGERS*rvyfyfltkkkkkkkkqnysthl*ixxxiip*kkkekkk rkkkkrkkkk
Multi-scale method for the resolution of the neutronic kinetics equations
International Nuclear Information System (INIS)
Chauvet, St.
2008-10-01
In this PhD thesis and in order to improve the time/precision ratio of the numerical simulation calculations, we investigate multi-scale techniques for the resolution of the reactor kinetics equations. We choose to focus on the mixed dual diffusion approximation and the quasi-static methods. We introduce a space dependency for the amplitude function which only depends on the time variable in the standard quasi-static context. With this new factorization, we develop two mixed dual problems which can be solved with Cea's solver MINOS. An algorithm is implemented, performing the resolution of these problems defined on different scales (for time and space). We name this approach: the Local Quasi-Static method. We present here this new multi-scale approach and its implementation. The inherent details of amplitude and shape treatments are discussed and justified. Results and performances, compared to MINOS, are studied. They illustrate the improvement on the time/precision ratio for kinetics calculations. Furthermore, we open some new possibilities to parallelize computations with MINOS. For the future, we also introduce some improvement tracks with adaptive scales. (author)
Performance of a new hand-held device for exhaled nitric oxide measurement in adults and children
Directory of Open Access Journals (Sweden)
Janson C
2006-04-01
Full Text Available Abstract Background Exhaled nitric oxide (NO measurement has been shown to be a valuable tool in the management of patients with asthma. Up to now, most measurements have been done with stationary, chemiluminescence-based NO analysers, which are not suitable for the primary health care setting. A hand-held NO analyser which simplifies the measurement would be of value both in specialized and primary health care. In this study, the performance of a new electrochemical hand-held device for exhaled NO measurements (NIOX MINO was compared with a standard stationary chemiluminescence unit (NIOX. Methods A total of 71 subjects (6–60 years; 36 males, both healthy controls and atopic patients with and without asthma were included. The mean of three approved exhalations (50 ml/s in each device, and the first approved measurement in the hand-held device, were compared with regard to NO readings (Bland-Altman plots, measurement feasibility (success rate with 6 attempts and repeatability (intrasubject SD. Results Success rate was high (≥ 84% in both devices for both adults and children. The subjects represented a FENO range of 8–147 parts per billion (ppb. When comparing the mean of three measurements (n = 61, the median of the intrasubject difference in exhaled NO for the two devices was -1.2 ppb; thus generally the hand-held device gave slightly higher readings. The Bland-Altman plot shows that the 95% limits of agreement were -9.8 and 8.0 ppb. The intrasubject median difference between the NIOX and the first approved measurement in the NIOX MINO was -2.0 ppb, and limits of agreement were -13.2 and 10.2 ppb. The median repeatability for NIOX and NIOX MINO were 1.1 and 1.2 ppb, respectively. Conclusion The hand-held device (NIOX MINO and the stationary system (NIOX are in clinically acceptable agreement both when the mean of three measurements and the first approved measurement (NIOX MINO is used. The hand-held device shows good repeatability, and it
Performance of a new hand-held device for exhaled nitric oxide measurement in adults and children.
Alving, K; Janson, C; Nordvall, L
2006-04-20
Exhaled nitric oxide (NO) measurement has been shown to be a valuable tool in the management of patients with asthma. Up to now, most measurements have been done with stationary, chemiluminescence-based NO analysers, which are not suitable for the primary health care setting. A hand-held NO analyser which simplifies the measurement would be of value both in specialized and primary health care. In this study, the performance of a new electrochemical hand-held device for exhaled NO measurements (NIOX MINO) was compared with a standard stationary chemiluminescence unit (NIOX). A total of 71 subjects (6-60 years; 36 males), both healthy controls and atopic patients with and without asthma were included. The mean of three approved exhalations (50 ml/s) in each device, and the first approved measurement in the hand-held device, were compared with regard to NO readings (Bland-Altman plots), measurement feasibility (success rate with 6 attempts) and repeatability (intrasubject SD). Success rate was high (> or = 84%) in both devices for both adults and children. The subjects represented a FENO range of 8-147 parts per billion (ppb). When comparing the mean of three measurements (n = 61), the median of the intrasubject difference in exhaled NO for the two devices was -1.2 ppb; thus generally the hand-held device gave slightly higher readings. The Bland-Altman plot shows that the 95% limits of agreement were -9.8 and 8.0 ppb. The intrasubject median difference between the NIOX and the first approved measurement in the NIOX MINO was -2.0 ppb, and limits of agreement were -13.2 and 10.2 ppb. The median repeatability for NIOX and NIOX MINO were 1.1 and 1.2 ppb, respectively. The hand-held device (NIOX MINO) and the stationary system (NIOX) are in clinically acceptable agreement both when the mean of three measurements and the first approved measurement (NIOX MINO) is used. The hand-held device shows good repeatability, and it can be used successfully on adults and most children
Energy Technology Data Exchange (ETDEWEB)
Bross, Alan D. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States)
2013-10-01
Detailed costing of the nuSTORM conventional facilities has been done by the Fermilab Facilities Engineering Services Section (FESS) and is reported on in the nuSTORM Project Definition Report (PDR) 6-13-1. Estimates for outfitting the primary proton beam line, the target station, the pion capture/transport line and decay ring are based on either experience from existing Fermilab infrastructure (NuMI) or is based on the detailed costing exercises for DOE CD-1 approval for future experiments (mu2e and LBNE). The detector costing utilized the Euronu costing for the Neutrino Factory Magnetized Iron Neutrino Detector (MIND), extrapolations from MINOS as-built costs and from recent vendor quotes. Costs included all manpower and are fully burdened (FY2013 dollars). The costs are not escalated, however, beyond the 5-year project timeline, since a project start for nuSTORM is unknown. Escalation can be estimated from various models (see Figure 1). LBNE has used the Jacob’s model to determine their cost escalation.
OPERA and MINOS Experimental Result Prove Big Bang Theory Invalid
Pressler, David E.
2012-03-01
The greatest error in the history of science is the misinterpretation of the Michelson-Morley Experiment. The speed of light was measured to travel at the same speed in all three directions (x, y, z axis) in ones own inertial reference system; however, c will always be measured as having an absolute different speed in all other inertial frames at different energy levels. Time slows down due to motion or a gravity field. Time is the rate of physical process. Speed = Distance/Time. If the time changes the distance must change. Therefore, BOTH mirrors must move towards the center of the interferometer and space must contract in all-three-directions; C-Space. Gravity is a C-Space condition, and is the cause of redshift in our universe-not motion. The universe is not expanding. OPERA results are directly indicated; at the surface of earth, the strength of the gravity field is at maximum-below the earth's surface, time and space is less distorted, C-Space; therefore, c is faster. Newtonian mechanics dictate that a spherical shell of matter at greater radii, with uniform density, produces no net force on an observer located centrally. An observer located on the sphere's surface, like our Earth's or a large sphere, like one located in a remote galaxy, will construct a picture centered on himself to be identical to the one centered inside the spherical shell of mass. Both observers will view the incoming radiation, emitted by the other observer, as redshifted, because they lay on each others radial line. The Universe is static and very old.
Energy Technology Data Exchange (ETDEWEB)
Morfin, J.G.; /Fermilab; McFarland, K.; /Rochester U.
2003-12-01
The NuMI facility at Fermilab will provide an extremely intense beam of neutrinos for the MINOS neutrino-oscillation experiment. The spacious and fully-outfitted MINOS near detector hall will be the ideal venue for a high-statistics, high-resolution {nu} and {bar {nu}}-nucleon/nucleus scattering experiment. The experiment described here will measure neutrino cross-sections and probe nuclear effects essential to present and future neutrino-oscillation experiments. Moreover, with the high NuMI beam intensity, the experiment will either initially address or significantly improve our knowledge of a wide variety of neutrino physics topics of interest and importance to the elementary-particle and nuclear-physics communities.
Konno, Tomoko; Motoori, Shigeatsu; Iwamoto, Nozomi; Miyazawa, Tomoe; Saito, Shigeyo; Kitagawa, Naoko; Saisho, Hiromitsu; Furuse, Junji; Itabashi, Masayuki
2010-10-01
A 52-year-old Japanese woman was referred to our Institute because of Helicobacter pylori(H. pylori)-positive gastric mucosa-associated lymphoid tissue(MALT)lymphoma. Since she had a penicillin allergy, we could not eradicate H. pylori using the standard triple therapy including amoxicillin. Additionally, H. pylori was resistant to both clarithromycin and metronidazole. So she was treated with minomycin (MINO), levofloxacin (LVFX), and rabeprazole (RPZ) based on a drug sensitivity test. MINO+LVFX+RPZ appear to be a promising, appropriate, and well-tolerated eradication regimen for H. pylori demonstrating resistance to both clarithromycin and metronidazole, and for patients who are allergic to penicillin.
International Nuclear Information System (INIS)
1998-08-01
This book deals with line facilities. The contents of this book are outline line of wire telecommunication ; development of line, classification of section of line and theory of transmission of line, cable line ; structure of line, line of cable in town, line out of town, domestic cable and other lines, Optical communication ; line of optical cable, transmission method, measurement of optical communication and cable of the sea bottom, Equipment of telecommunication line ; telecommunication line facilities and telecommunication of public works, construction of cable line and maintenance and Regulation of line equipment ; regulation on technique, construction and maintenance.
Similarity law for Widom lines and coexistence lines.
Banuti, D T; Raju, M; Ihme, M
2017-05-01
The coexistence line of a fluid separates liquid and gaseous states at subcritical pressures, ending at the critical point. Only recently, it became clear that the supercritical state space can likewise be divided into regions with liquidlike and gaslike properties, separated by an extension to the coexistence line. This crossover line is commonly referred to as the Widom line, and is characterized by large changes in density or enthalpy, manifesting as maxima in the thermodynamic response functions. Thus, a reliable representation of the coexistence line and the Widom line is important for sub- and supercritical applications that depend on an accurate prediction of fluid properties. While it is known for subcritical pressures that nondimensionalization with the respective species critical pressures p_{cr} and temperatures T_{cr} only collapses coexistence line data for simple fluids, this approach is used for Widom lines of all fluids. However, we show here that the Widom line does not adhere to the corresponding states principle, but instead to the extended corresponding states principle. We resolve this problem in two steps. First, we propose a Widom line functional based on the Clapeyron equation and derive an analytical, species specific expression for the only parameter from the Soave-Redlich-Kwong equation of state. This parameter is a function of the acentric factor ω and compares well with experimental data. Second, we introduce the scaled reduced pressure p_{r}^{*} to replace the previously used reduced pressure p_{r}=p/p_{cr}. We show that p_{r}^{*} is a function of the acentric factor only and can thus be readily determined from fluid property tables. It collapses both subcritical coexistence line and supercritical Widom line data over a wide range of species with acentric factors ranging from -0.38 (helium) to 0.34 (water), including alkanes up to n-hexane. By using p_{r}^{*}, the extended corresponding states principle can be applied within
A new mathematical formulation of the line-by-line method in case of weak line overlapping
Ishov, Alexander G.; Krymova, Natalie V.
1994-01-01
A rigorous mathematical proof is presented for multiline representation on the equivalent width of a molecular band which consists in the general case of n overlapping spectral lines. The multiline representation includes a principal term and terms of minor significance. The principal term is the equivalent width of the molecular band consisting of the same n nonoverlapping spectral lines. The terms of minor significance take into consideration the overlapping of two, three and more spectral lines. They are small in case of the weak overlapping of spectral lines in the molecular band. The multiline representation can be easily generalized for optically inhomogeneous gas media and holds true for combinations of molecular bands. If the band lines overlap weakly the standard formulation of line-by-line method becomes too labor-consuming. In this case the multiline representation permits line-by-line calculations to be performed more effectively. Other useful properties of the multiline representation are pointed out.
2011-08-18
... FEDERAL MARITIME COMMISSION [Docket No. 11-12] China Shipping Container Lines Co., Ltd.; COSCO Container Lines Company Limited; Evergreen Line A Joint Service Agreement; Hanjin Shipping Co., Ltd... Maritime Commission (Commission) by China Shipping Container Lines Co., Ltd.; COSCO Container Lines Company...
Energy Technology Data Exchange (ETDEWEB)
Hentschel, F. [ZI Mannheim (Germany). Abt. fuer Neuroradiologie; Moeckel, R.; Schlemmmer, H.P.; Gueckel, F.; Koepke, J.; Georgi, M. [Universitaetsklinik Mannheim (Germany). Inst. fuer Klinische Radiologie; Markus, A.; Goepel, C.; Schmidt, M.H. [ZI Mannheim (Germany). Klinik fuer Kinder- und Jugendpsychiatrie
1999-03-01
Results: The ratio of NAA/PCr in both voxels were not significantly different when comparing patients vs. controls. Patients showed significantly higher ratios of choline-containing components (Cho) or, respectively Cho/PCr and NAA/PCr in the white matter. Distinct, but not significant differences were detected both for m-Ino and m-Ino/PCr in the parieto-occipital region and for the Cho- and m-Ino cotained ratios in the thalamus. Conclusion: AN is not associated with neuronal damage. The ratio of Cho/PCr and NAA/Cho may reflect the disturbance of membrane-turnover. It is possible that the increase of membrane catabolism leads to a hyperosmolar state. The change of m-Ino/PCr ratio may reflect the regulation of osmolarity. (orig.) [Deutsch] Ergebnisse: In den beiden Voxeln wies N-acetylspartat (NAA) als NAA/PCr keine relevanten Unterschiede zwischen Patienten mit AN und Kontrollen auf. Signifikante Unterschiede wurden ausschliesslich fuer Cholin (Cho) resp. die Quotienten Cho/PCr und NAA/Cho in der POR gefunden. Die Ergebnisse fuer myo-Inositol (m-Ino) resp. den Quotienten m-Ino/PCr in der POR und beider relevanter Cho-Metabolitenratios in der ThR unterschieden sich z.T. deutlich, aber nicht signifikant. Diskussion: Unveraendertes NAA als NAA/PCr spricht in Korrelation mit den reversiblen klinischen und hirnmorphologischen Befunden dafuer, dass es bei der AN nicht zu einem neuronalen Untergang kommt. Als Ursache fuer die Erhoehung des Peaks von Cho/PCr ist ein vermehrter Membrankatabolismus bei der AN zu diskutieren, der zu einer Veraenderung des osmotischen Druckes im Gewebe fuehrt. In diesem Zusammenhang ist auch die Bedeutung des m-Ino als Osmolyt zu eroertern, wenngleich die Ergebnisse bei differierenden Einzelwerten fuer m-Ino/PCr noch keine einheitliche Interpretation zulassen. (orig.)
Neutrino velocity measurement with the OPERA experiment in the CNGS beam
International Nuclear Information System (INIS)
Brunetti, G.
2011-05-01
The thesis concerns the measurement of the neutrino velocity with the OPERA experiment in the CNGS beam. There are different theoretical models that allow for Lorentz violating effects which can be investigated with measurements on terrestrial neutrino beams. The MINOS experiment published in 2007 a measure on the muon neutrinos over a distance of 730 km finding a deviation with respect to the expected time of flight of 126 ns with a statistical error of 32 ns and a systematic error of 64 ns. The OPERA experiment observes as well muon neutrinos 730 km away from the source, with a sensitivity significantly better than MINOS thanks to the higher number of interactions in the detector due to the higher energy beam and the much more sophisticated timing system explicitly upgraded in view of the neutrino velocity measurement. This system is composed by atomic cesium clocks and GPS receivers operating in 'common view mode'. Thanks to this system a time-transfer between the two sites with a precision at the level of 1 ns is possible. Moreover, a Fast Waveform Digitizer was installed along the proton beam line at CERN in order to measure the internal time structure of the proton pulses that are sent to the CNGS target. The result on the neutrino velocity is the most precise measurement so far with terrestrial neutrino beams: the neutrino time of flight was determined with a statistical uncertainty of about 10 ns and a systematic uncertainty smaller than 20 nano-seconds. (author)
Lifescience Database Archive (English)
Full Text Available mino Acid sequence (All Frames) Frame A: kfifiiqilnsyfiflyivtfhkkkkkkkx*kixffekk--- ---lxxxxxxxxxxxxxxtqnsnx...hspfssqikrwyanfcknshw*nhytrs*r **qh*ecknknsrqrryx Frame B: nsfllyky*ihilffyil*HFIKKKKKKKXKKSXFLKKK--- ---xxxxsxxxxxxx...kxxxkiqxxkgixxxkkxxxxxgnx*xmvxxxxxnxxkkstxxlv xrikrwyxkflsktlxgkxhhxxklraqdnienvktkdsxqkkvsppdqqrli
From Off-line to On-line Handwriting Recognition
Lallican, P.; Viard-Gaudin, C.; Knerr, S.
2004-01-01
On-line handwriting includes more information on time order of the writing signal and on the dynamics of the writing process than off-line handwriting. Therefore, on-line recognition systems achieve higher recognition rates. This can be concluded from results reported in the literature, and has been
VT Digital Line Graph Miscellaneous Transmission Lines
Vermont Center for Geographic Information — (Link to Metadata) This datalayer is comprised of Miscellaineous Transmission Lines. Digital line graph (DLG) data are digital representations of cartographic...
Efficient algorithm for generating spectra using line-by-line methods
International Nuclear Information System (INIS)
Sonnad, V.; Iglesias, C.A.
2011-01-01
A method is presented for efficient generation of spectra using line-by-line approaches. The only approximation is replacing the line shape function with an interpolation procedure, which makes the method independent of the line profile functional form. The resulting computational savings for large number of lines is proportional to the number of frequency points in the spectral range. Therefore, for large-scale problems the method can provide speedups of two orders of magnitude or more. A method was presented to generate line-by-line spectra efficiently. The first step was to replace the explicit calculation of the profile by the Newton divided-differences interpolating polynomial. The second step is to accumulate the lines effectively reducing their number to the number of frequency points. The final step is recognizing the resulting expression as a convolution and amenable to FFT methods. The reduction in computational effort for a configuration-to-configuration transition array with large number of lines is proportional to the number of frequency points. The method involves no approximations except for replacing the explicit profile evaluation by interpolation. Specifically, the line accumulation and convolution are exact given the interpolation procedure. Furthermore, the interpolation makes the method independent of the line profile functional form contrary to other schemes using FFT methods to generate line-by-line spectra but relying on the analytic form of the profile Fourier transform. Finally, the method relies on a uniform frequency mesh. For non-uniform frequency meshes, however, the method can be applied by using a suitable temporary uniform mesh and the results interpolated onto the final mesh with little additional cost.
Yuan, Naichang; He, Jianguo; Yao, Demiao; Dai, Qin; Lin, Weigan
1995-06-01
Two types of coplanar transmission lines, rectangular microshield coplanar coupled lines (RMCCL) and coplanar coupled rectangular microshield lines (CCRML), are proposed for MMIC applications. These are developed from coplanar coupled lines (CCL) and coplanar coupled strip lines (CCS). Analytic formulas are presented for calculating the quasistatic TEM parameters of these coupled lines by means of exact conformal mapping techniques. Numerical results are also presented to illustrate the properties of these coplanar transmission lines.
Optimization of line configuration and balancing for flexible machining lines
Liu, Xuemei; Li, Aiping; Chen, Zurui
2016-05-01
Line configuration and balancing is to select the type of line and allot a given set of operations as well as machines to a sequence of workstations to realize high-efficiency production. Most of the current researches for machining line configuration and balancing problems are related to dedicated transfer lines with dedicated machine workstations. With growing trends towards great product variety and fluctuations in market demand, dedicated transfer lines are being replaced with flexible machining line composed of identical CNC machines. This paper deals with the line configuration and balancing problem for flexible machining lines. The objective is to assign operations to workstations and find the sequence of execution, specify the number of machines in each workstation while minimizing the line cycle time and total number of machines. This problem is subject to precedence, clustering, accessibility and capacity constraints among the features, operations, setups and workstations. The mathematical model and heuristic algorithm based on feature group strategy and polychromatic sets theory are presented to find an optimal solution. The feature group strategy and polychromatic sets theory are used to establish constraint model. A heuristic operations sequencing and assignment algorithm is given. An industrial case study is carried out, and multiple optimal solutions in different line configurations are obtained. The case studying results show that the solutions with shorter cycle time and higher line balancing rate demonstrate the feasibility and effectiveness of the proposed algorithm. This research proposes a heuristic line configuration and balancing algorithm based on feature group strategy and polychromatic sets theory which is able to provide better solutions while achieving an improvement in computing time.
International Nuclear Information System (INIS)
Hentschel, F.; Moeckel, R.; Schlemmmer, H.P.; Gueckel, F.; Koepke, J.; Georgi, M.; Markus, A.; Goepel, C.; Schmidt, M.H.
1999-01-01
Results: The ratio of NAA/PCr in both voxels were not significantly different when comparing patients vs. controls. Patients showed significantly higher ratios of choline-containing components (Cho) or, respectively Cho/PCr and NAA/PCr in the white matter. Distinct, but not significant differences were detected both for m-Ino and m-Ino/PCr in the parieto-occipital region and for the Cho- and m-Ino cotained ratios in the thalamus. Conclusion: AN is not associated with neuronal damage. The ratio of Cho/PCr and NAA/Cho may reflect the disturbance of membrane-turnover. It is possible that the increase of membrane catabolism leads to a hyperosmolar state. The change of m-Ino/PCr ratio may reflect the regulation of osmolarity. (orig.) [de
LINE FUSION GENES: a database of LINE expression in human genes
Directory of Open Access Journals (Sweden)
Park Hong-Seog
2006-06-01
Full Text Available Abstract Background Long Interspersed Nuclear Elements (LINEs are the most abundant retrotransposons in humans. About 79% of human genes are estimated to contain at least one segment of LINE per transcription unit. Recent studies have shown that LINE elements can affect protein sequences, splicing patterns and expression of human genes. Description We have developed a database, LINE FUSION GENES, for elucidating LINE expression throughout the human gene database. We searched the 28,171 genes listed in the NCBI database for LINE elements and analyzed their structures and expression patterns. The results show that the mRNA sequences of 1,329 genes were affected by LINE expression. The LINE expression types were classified on the basis of LINEs in the 5' UTR, exon or 3' UTR sequences of the mRNAs. Our database provides further information, such as the tissue distribution and chromosomal location of the genes, and the domain structure that is changed by LINE integration. We have linked all the accession numbers to the NCBI data bank to provide mRNA sequences for subsequent users. Conclusion We believe that our work will interest genome scientists and might help them to gain insight into the implications of LINE expression for human evolution and disease. Availability http://www.primate.or.kr/line
International Nuclear Information System (INIS)
Jang, Hak Sin; Kim, Sin Yeong
1998-02-01
This book is about cable line engineering. It is comprised of nine chapters, which deals with summary of cable communication such as way, process of cable communication and optical communication, Line constant of transmission on primary constant, reflection and crosstalk, communication cable line of types like flat cable, coaxial cable and loaded cable, Install of communication line with types and facility of aerial line, construction method of communication line facility, Measurement of communication line, Carrier communication of summary, PCM communication with Introduction, regeneration relay system sampling and quantization and Electric communication service and general information network with mobile communication technique and satellite communication system.
bottom of the page is a (planned) link to one of my favorite hobbies. Current Experiments MINOS Neutrino Argonne efforts to join this (existing) experiment * Talaga's Presentations Hobbies and Photos Dive Photos
International Nuclear Information System (INIS)
Guerin, P.
2007-12-01
The neutronic simulation of a nuclear reactor core is performed using the neutron transport equation, and leads to an eigenvalue problem in the steady-state case. Among the deterministic resolution methods, diffusion approximation is often used. For this problem, the MINOS solver based on a mixed dual finite element method has shown his efficiency. In order to take advantage of parallel computers, and to reduce the computing time and the local memory requirement, we propose in this dissertation two domain decomposition methods for the resolution of the mixed dual form of the eigenvalue neutron diffusion problem. The first approach is a component mode synthesis method on overlapping sub-domains. Several Eigenmodes solutions of a local problem solved by MINOS on each sub-domain are taken as basis functions used for the resolution of the global problem on the whole domain. The second approach is a modified iterative Schwarz algorithm based on non-overlapping domain decomposition with Robin interface conditions. At each iteration, the problem is solved on each sub domain by MINOS with the interface conditions deduced from the solutions on the adjacent sub-domains at the previous iteration. The iterations allow the simultaneous convergence of the domain decomposition and the eigenvalue problem. We demonstrate the accuracy and the efficiency in parallel of these two methods with numerical results for the diffusion model on realistic 2- and 3-dimensional cores. (author)
Energy Technology Data Exchange (ETDEWEB)
Guerin, P
2007-12-15
The neutronic simulation of a nuclear reactor core is performed using the neutron transport equation, and leads to an eigenvalue problem in the steady-state case. Among the deterministic resolution methods, diffusion approximation is often used. For this problem, the MINOS solver based on a mixed dual finite element method has shown his efficiency. In order to take advantage of parallel computers, and to reduce the computing time and the local memory requirement, we propose in this dissertation two domain decomposition methods for the resolution of the mixed dual form of the eigenvalue neutron diffusion problem. The first approach is a component mode synthesis method on overlapping sub-domains. Several Eigenmodes solutions of a local problem solved by MINOS on each sub-domain are taken as basis functions used for the resolution of the global problem on the whole domain. The second approach is a modified iterative Schwarz algorithm based on non-overlapping domain decomposition with Robin interface conditions. At each iteration, the problem is solved on each sub domain by MINOS with the interface conditions deduced from the solutions on the adjacent sub-domains at the previous iteration. The iterations allow the simultaneous convergence of the domain decomposition and the eigenvalue problem. We demonstrate the accuracy and the efficiency in parallel of these two methods with numerical results for the diffusion model on realistic 2- and 3-dimensional cores. (author)
Can OPERA help in constraining neutrino non-standard interactions?
Energy Technology Data Exchange (ETDEWEB)
Esteban-Pretel, A.; Valle, J.W.F. [AHEP Group, Institut de Fisica Corpuscular, C.S.I.C./Universitat de Valencia, Edificio Institutos de Paterna, Apt 22085, E-46071 Valencia (Spain); Huber, P. [Theory Division, Department of Physics, CERN, CH-1211 Geneva 23 (Switzerland); Institute for Particle, Nuclear and Astronomical Sciences, Physics Department, Virgina Tech, Blacksburg, VA 24062 (United States)], E-mail: pahuber@vt.edu
2008-10-09
We study how much the unique ability of the OPERA experiment to directly detect {nu}{sub {tau}} can help in probing new, non-standard contact interactions of the third family of neutrinos. We perform a combined analysis of future, high-statistics MINOS and OPERA data. For the case of non-standard interactions in {nu}{sub {mu}} to {nu}{sub e} transitions we also include the impact of possible Double Chooz data. In all cases we find that the {nu}{sub {tau}} sample of OPERA is too small to be statistically significant, even if one doubles the nominal exposure of OPERA to 9x10{sup 19} pot. OPERA's real benefit for this measurement lies in its very high neutrino energy and hence very different L/E compared to MINOS.
Reliable and efficient solution of genome-scale models of Metabolism and macromolecular Expression
DEFF Research Database (Denmark)
Ma, Ding; Yang, Laurence; Fleming, Ronan M. T.
2017-01-01
orders of magnitude. Data values also have greatly varying magnitudes. Standard double-precision solvers may return inaccurate solutions or report that no solution exists. Exact simplex solvers based on rational arithmetic require a near-optimal warm start to be practical on large problems (current ME......Constraint-Based Reconstruction and Analysis (COBRA) is currently the only methodology that permits integrated modeling of Metabolism and macromolecular Expression (ME) at genome-scale. Linear optimization computes steady-state flux solutions to ME models, but flux values are spread over many...... models have 70,000 constraints and variables and will grow larger). We have developed a quadrupleprecision version of our linear and nonlinear optimizer MINOS, and a solution procedure (DQQ) involving Double and Quad MINOS that achieves reliability and efficiency for ME models and other challenging...
Energy Technology Data Exchange (ETDEWEB)
Bhattarai, Bishnu P.; Gentle, Jake P.; Hill, Porter; McJunkin, Tim; Myers, Kurt S.; Abbound, Alex; Renwick, Rodger; Hengst, David
2017-07-01
Abstract—Overhead transmission lines (TLs) are conventionally given seasonal ratings based on conservative environmental assumptions. Such an approach often results in underutilization of the line ampacity as the worst conditions prevail only for a short period over a year/season. We presents dynamic line rating (DLR) as an enabling smart grid technology that adaptively computes ratings of TLs based on local weather conditions to utilize additional headroom of existing lines. In particular, general line ampacity state solver utilizes measured weather data for computing the real-time thermal rating of the TLs. The performance of the presented method is demonstrated from a field study of DLR technology implementation on four TL segments at AltaLink, Canada. The performance is evaluated and quantified by comparing the existing static and proposed dynamic line ratings, and the potential benefits of DLR for enhanced transmission assets utilization. For the given line segments, the proposed DLR results in real-time ratings above the seasonal static ratings for most of the time; up to 95.1% of the time, with a mean increase of 72% over static rating.
Application of the HGPT methodology of reactor operation problems with a nodal mixed method
International Nuclear Information System (INIS)
Baudron, A.M.; Bruna, G.B.; Gandini, A.; Lautard, J.J.; Monti, S.; Pizzigati, G.
1998-01-01
The heuristically based generalized perturbation theory (HGPT), to first and higher order, applied to the neutron field of a reactor system, is discussed in relation to quasistatic problems. This methodology is of particular interest in reactor operation. In this application it may allow an on-line appraisal of the main physical responses of the reactor system when subject to alterations relevant to normal system exploitation, e.g. control rod movement, and/or soluble boron concentration changes to be introduced, for instance, for compensating power level variations following electrical network demands. In this paper, after describing the main features of the theory, its implementation into the diffusion, 3D mixed dual nodal code MINOS of the SAPHYR system is presented. The results from a small scale investigation performed on a simplified PWR system corroborate the validity of the methodology proposed
International Nuclear Information System (INIS)
Kamien, R.D.
1992-01-01
This thesis is devoted to the study of ensembles of dense directed lines. These lines are principally to be thought of as polymers, though they also have the morphology of flux lines in high temperature superconductors, strings of colloidal spheres in electrorheological fluids and the world lines of quantum mechanical bosons. The authors discuss how directed polymer melts, string-like formations in electrorheological and ferro-fluids, flux lines in high temperature superconductors and the world lines of quantum mechanical bosons all share similar descriptions. They study a continuous transition in all of these systems, and then study the critical mixing properties of binary mixtures of directed polymers through the renormalization group. They predict the exponents for a directed polymer blend consolute point and a novel two-phase superfluid liquid-gas critical point
2013-05-01
The rapidly changing racial and ethnic composition of the : U.S. population is important to traffic safety specialists : because involvement in fatal traffic crashes varies across : racial and ethnic groups. Some research suggests that certain : mino...
Directory of Open Access Journals (Sweden)
Caio Marcio Barros de Oliveira
2009-08-01
Full Text Available JUSTIFICATIVA E OBJETIVOS: A neuralgia do nervo trigêmeo é uma condição intensamente dolorosa, caracterizada por surtos de dor lancinante e súbita, tipo choque, com duração de poucos segundos a dois minutos e geralmente unilateral. Sua incidência anual é de cerca de 4,3 em 100.000 na população geral, tendo manifestação bilateral em apenas 3% desses casos. O objetivo deste artigo foi descrever um caso raro de neuralgia do trigêmeo primário bilateral. RELATO DO CASO: Paciente de 61 anos, maranhense, casada, do lar, com antecedente de hipertensão arterial e há seis anos com queixa de dor intensa em V2-V3 à esquerda, com duração de 5 a 10 segundos, em região lateral do nariz e mandibular, com piora ao falar, mastigar e com diminuição da temperatura. Já havia utilizado clorpromazina (3 mg a cada oito horas e carbamazepina (200 mg a cada oito horas durante seis meses sem alívio da dor. Ao exame físico apresentava alodinia térmica e mecânica em regiões de V2-V3. Estava em uso de gabapentina (1.200 mg ao dia com alívio parcial da dor. Foi então aumentada a gabapentina para 1500 mg ao dia e introduzida amitriptilina 12,5 mg à noite. Evoluiu com dor leve e esporádica com diminuição da intensidade da dor ao longo de 10 meses de tratamento, sendo reduzida progressivamente a gabapentina para 600 mg ao dia e mantida a amitriptilina 12,5 mg ao dia. Após um ano, começou a apresentar dor de característica semelhante em região mandibular à direita, tendo melhorado com aumento de gabapentina para 900 mg ao dia. Não apresentava exames alterados de tomografia ou ressonância magnética de encéfalo. CONCLUSÕES: A carbamazepina é o fármaco de primeira escolha para tratamento de neuralgia trigeminal, porém a gabapentina tem sido cada vez mais utilizada como primeira medida farmacológica ou em casos refratários à terapia convencional.JUSTIFICATIVA Y OBJETIVOS: La neuralgia del nervio trigémino es una condici
MICROLENSING OF QUASAR BROAD EMISSION LINES: CONSTRAINTS ON BROAD LINE REGION SIZE
Energy Technology Data Exchange (ETDEWEB)
Guerras, E.; Mediavilla, E. [Instituto de Astrofisica de Canarias, Via Lactea S/N, La Laguna E-38200, Tenerife (Spain); Jimenez-Vicente, J. [Departamento de Fisica Teorica y del Cosmos, Universidad de Granada, Campus de Fuentenueva, E-18071 Granada (Spain); Kochanek, C. S. [Department of Astronomy and the Center for Cosmology and Astroparticle Physics, The Ohio State University, 4055 McPherson Lab, 140 West 18th Avenue, Columbus, OH 43221 (United States); Munoz, J. A. [Departamento de Astronomia y Astrofisica, Universidad de Valencia, E-46100 Burjassot, Valencia (Spain); Falco, E. [Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Motta, V. [Departamento de Fisica y Astronomia, Universidad de Valparaiso, Avda. Gran Bretana 1111, Valparaiso (Chile)
2013-02-20
We measure the differential microlensing of the broad emission lines between 18 quasar image pairs in 16 gravitational lenses. We find that the broad emission lines are in general weakly microlensed. The results show, at a modest level of confidence (1.8{sigma}), that high ionization lines such as C IV are more strongly microlensed than low ionization lines such as H{beta}, indicating that the high ionization line emission regions are more compact. If we statistically model the distribution of microlensing magnifications, we obtain estimates for the broad line region size of r{sub s} = 24{sup +22} {sub -15} and r{sub s} = 55{sup +150} {sub -35} lt-day (90% confidence) for the high and low ionization lines, respectively. When the samples are divided into higher and lower luminosity quasars, we find that the line emission regions of more luminous quasars are larger, with a slope consistent with the expected scaling from photoionization models. Our estimates also agree well with the results from local reveberation mapping studies.
Lining seam elimination algorithm and surface crack detection in concrete tunnel lining
Qu, Zhong; Bai, Ling; An, Shi-Quan; Ju, Fang-Rong; Liu, Ling
2016-11-01
Due to the particularity of the surface of concrete tunnel lining and the diversity of detection environments such as uneven illumination, smudges, localized rock falls, water leakage, and the inherent seams of the lining structure, existing crack detection algorithms cannot detect real cracks accurately. This paper proposed an algorithm that combines lining seam elimination with the improved percolation detection algorithm based on grid cell analysis for surface crack detection in concrete tunnel lining. First, check the characteristics of pixels within the overlapping grid to remove the background noise and generate the percolation seed map (PSM). Second, cracks are detected based on the PSM by the accelerated percolation algorithm so that the fracture unit areas can be scanned and connected. Finally, the real surface cracks in concrete tunnel lining can be obtained by removing the lining seam and performing percolation denoising. Experimental results show that the proposed algorithm can accurately, quickly, and effectively detect the real surface cracks. Furthermore, it can fill the gap in the existing concrete tunnel lining surface crack detection by removing the lining seam.
DEFF Research Database (Denmark)
Kiib, Hans
2015-01-01
At just over 10 meters above street level, the High Line extends three kilometers through three districts of Southwestern Manhattan in New York. It consists of simple steel construction, and previously served as an elevated rail line connection between Penn Station on 34th Street and the many....... The High Line project has been carried out as part of an open conversion strategy. The result is a remarkable urban architectural project, which works as a catalyst for the urban development of Western Manhattan. The greater project includes the restoration and reuse of many old industrial buildings...
An ultrafast line-by-line algorithm for calculating spectral transmittance and radiance
International Nuclear Information System (INIS)
Tan, X.
2013-01-01
An ultrafast line-by-line algorithm for calculating spectral transmittance and radiance of gases is presented. The algorithm is based on fast convolution of the Voigt line profile using Fourier transform and a binning technique. The algorithm breaks a radiative transfer calculation into two steps: a one-time pre-computation step in which a set of pressure independent coefficients are computed using the spectral line information; a normal calculation step in which the Fourier transform coefficients of the optical depth are calculated using the line of sight information and the coefficients pre-computed in the first step, the optical depth is then calculated using an inverse Fourier transform and the spectral transmittance and radiance are calculated. The algorithm is significantly faster than line-by-line algorithms that do not employ special speedup techniques by a factor of 10 3 –10 6 . A case study of the 2.7 μm band of H 2 O vapor is presented. -- Highlights: •An ultrafast line-by-line model based on FFT and a binning technique is presented. •Computationally expensive calculations are factored out into a pre-computation step. •It is 10 3 –10 8 times faster than LBL algorithms that do not employ speedup techniques. •Good agreement with experimental data for the 2.7 μm band of H 2 O
Covariant electromagnetic field lines
Hadad, Y.; Cohen, E.; Kaminer, I.; Elitzur, A. C.
2017-08-01
Faraday introduced electric field lines as a powerful tool for understanding the electric force, and these field lines are still used today in classrooms and textbooks teaching the basics of electromagnetism within the electrostatic limit. However, despite attempts at generalizing this concept beyond the electrostatic limit, such a fully relativistic field line theory still appears to be missing. In this work, we propose such a theory and define covariant electromagnetic field lines that naturally extend electric field lines to relativistic systems and general electromagnetic fields. We derive a closed-form formula for the field lines curvature in the vicinity of a charge, and show that it is related to the world line of the charge. This demonstrates how the kinematics of a charge can be derived from the geometry of the electromagnetic field lines. Such a theory may also provide new tools in modeling and analyzing electromagnetic phenomena, and may entail new insights regarding long-standing problems such as radiation-reaction and self-force. In particular, the electromagnetic field lines curvature has the attractive property of being non-singular everywhere, thus eliminating all self-field singularities without using renormalization techniques.
The End of the Lines for OX 169: No Binary Broad-Line Region
Halpern, J. P.; Eracleous, M.
2000-03-01
We show that unusual Balmer emission-line profiles of the quasar OX 169, frequently described as either self-absorbed or double peaked, are actually neither. The effect is an illusion resulting from two coincidences. First, the forbidden lines are quite strong and broad. Consequently, the [N II] λ6583 line and the associated narrow-line component of Hα present the appearance of twin Hα peaks. Second, the redshift of 0.2110 brings Hβ into coincidence with Na I D at zero redshift, and ISM absorption in Na I D divides the Hβ emission line. In spectra obtained over the past decade, we see no substantial change in the character of the line profiles and no indication of intrinsic double-peaked structure. The Hγ, Mg II, and Lyα emission lines are single peaked, and all of the emission-line redshifts are consistent once they are correctly attributed to their permitted and forbidden-line identifications. A systematic shift of up to 700 km s-1 between broad and narrow lines is seen, but such differences are common and could be due to gravitational and transverse redshift in a low-inclination disk. Stockton & Farnham had called attention to an apparent tidal tail in the host galaxy of OX 169 and speculated that a recent merger had supplied the nucleus with a coalescing pair of black holes that was now revealing its existence in the form of two physically distinct broad-line regions. Although there is no longer any evidence for two broad emission-line regions in OX 169, binary black holes should form frequently in galaxy mergers, and it is still worthwhile to monitor the radial velocities of emission lines that could supply evidence of their existence in certain objects.
Experimental Research at the Intensity Frontier in High Energy Physics
Energy Technology Data Exchange (ETDEWEB)
Marshak, Marvin L. [Univ. of Minnesota, Minneapolis, MN (United States)
2014-06-30
This Final Report describes DOE-supported Intensity Frontier research by the University of Minnesota during the interval April 1, 2011 to March 31, 2014. Primary activities included the MINOS, NOvA and LBNE Experiments and Heavy Quark studies at BES III.
Scheeren, HA; Lelieveld, J; Roelofs, GJ; Williams, J; Fischer, H; de Reus, M; de Gouw, JA; Warneke, C; Holzinger, R; Schlager, H; Klupfel, T; Bolder, M; van der Veen, C; Lawrence, M
2003-01-01
A major objective of the Mediterranean INtensive Oxidant Study (MINOS) was to investigate long-range transport of pollutants ( notably ozone precursor species). Here we present trace gas measurements from the DLR ( German Aerospace Organization) Falcon aircraft in the eastern Mediterranean
2001-01-01
The Nasca Lines are located in the Pampa region of Peru, the desolate plain of the Peruvian coast 400 km south of Lima. The Lines were first spotted when commercial airlines began flying across the Peruvian desert in the 1920's. Passengers reported seeing 'primitive landing strips' on the ground below. The Lines were made by removing the iron-oxide coated pebbles which cover the surface of the desert. When the gravel is removed, they contrast with the light color underneath. In this way the lines were drawn as furrows of a lighter color. On the pampa, south of the Nasca Lines, archaeologists have now uncovered the lost city of the line-builders, Cahuachi. It was built nearly two thousand years ago and was mysteriously abandoned 500 years later. This ASTER sub-image covers an area of 14 x 18 km, was acquired on December 22, 2000, and is located at 14.7 degrees south latitude and 75.1 degrees west longitude. The U.S. science team is located at NASA's Jet Propulsion Laboratory, Pasadena, Calif. The Terra mission is part of NASA's Science Mission Directorate.
An OCD perspective of line edge and line width roughness metrology
Bonam, Ravi; Muthinti, Raja; Breton, Mary; Liu, Chi-Chun; Sieg, Stuart; Seshadri, Indira; Saulnier, Nicole; Shearer, Jeffrey; Patlolla, Raghuveer; Huang, Huai
2017-03-01
Metrology of nanoscale patterns poses multiple challenges that range from measurement noise, metrology errors, probe size etc. Optical Metrology has gained a lot of significance in the semiconductor industry due to its fast turn around and reliable accuracy, particularly to monitor in-line process variations. Apart from monitoring critical dimension, thickness of films, there are multiple parameters that can be extracted from Optical Metrology models3. Sidewall angles, material compositions etc., can also be modeled to acceptable accuracy. Line edge and Line Width roughness are much sought of metrology following critical dimension and its uniformity, although there has not been much development in them with optical metrology. Scanning Electron Microscopy is still used as a standard metrology technique for assessment of Line Edge and Line Width roughness. In this work we present an assessment of Optical Metrology and its ability to model roughness from a set of structures with intentional jogs to simulate both Line edge and Line width roughness at multiple amplitudes and frequencies. We also present multiple models to represent roughness and extract relevant parameters from Optical metrology. Another critical aspect of optical metrology setup is correlation of measurement to a complementary technique to calibrate models. In this work, we also present comparison of roughness parameters extracted and measured with variation of image processing conditions on a commercially available CD-SEM tool.
Modification of the U-line of the RHIC injection line
International Nuclear Information System (INIS)
Xu, Jianming.
1991-09-01
The parameters of the U-line of the RHIC injection line with low β waist are described. In that lattice, the location of SA is not dispersion free and 14 quadrupoles are needed. This line has been modified to move SA to a dispersion free region (after the 8-degree bend), the length and maximum gradient of quadrupoles have been adjusted to fit the existing quadrupole parameters and the number of quadrupoles is reduced to 12. 2 refs., 3 tabs
Difference in membrane repair capacity between cancer cell lines and a normal cell line
DEFF Research Database (Denmark)
Frandsen, Stine Krog; McNeil, Anna K.; Novak, Ivana
2016-01-01
repair was investigated by disrupting the plasma membrane using laser followed by monitoring fluorescent dye entry over time in seven cancer cell lines, an immortalized cell line, and a normal primary cell line. The kinetics of repair in living cells can be directly recorded using this technique...... cancer cell lines (p immortalized cell line (p
Purity, adulteration and price of drugs bought on-line versus off-line in the Netherlands.
van der Gouwe, Daan; Brunt, Tibor M; van Laar, Margriet; van der Pol, Peggy
2017-04-01
On-line drug markets flourish and consumers have high expectations of on-line quality and drug value. The aim of this study was to (i) describe on-line drug purchases and (ii) compare on-line with off-line purchased drugs regarding purity, adulteration and price. Comparison of laboratory analyses of 32 663 drug consumer samples (stimulants and hallucinogens) purchased between January 2013 and January 2016, 928 of which were bought on-line. The Netherlands. Primary outcome measures were (i) the percentage of samples purchased on-line and (ii) the chemical purity of powders (or dosage per tablet); adulteration; and the price per gram, blotter or tablet of drugs bought on-line compared with drugs bought off-line. The proportion of drug samples purchased on-line increased from 1.4% in 2013 to 4.1% in 2015. The frequency varied widely, from a maximum of 6% for controlled, traditional substances [ecstasy tablets, 3,4-methylenedioxy-methamphetamine (MDMA) powder, amphetamine powder, cocaine powder, 4-bromo-2,5-dimethoxyphenethylamine (2C-B) and lysergic acid diethylamide (LSD)] to more than a third for new psychoactive substances (NPS) [4-fluoroamphetamine (4-FA), 5/6-(2-aminopropyl)benzofuran (5/6-APB) and methoxetamine (MXE)]. There were no large differences in drug purity, yet small but statistically significant differences were found for 4-FA (on-line 59% versus off-line 52% purity for 4-FA on average, P = 0.001), MDMA powders (45 versus 61% purity for MDMA, P = 0.02), 2C-B tablets (21 versus 10 mg 2C-B/tablet dosage, P = 0.49) and ecstasy tablets (131 versus 121 mg MDMA/tablet dosage, P = 0.05). The proportion of adulterated samples purchased on-line and off-line did not differ, except for 4-FA powder, being less adulterated on-line (χ 2 = 8.3; P < 0.02). Drug prices were mainly higher on-line, ranging for various drugs from 10 to 23% higher than that of drugs purchased off-line (six of 10 substances: P < 0.05). Dutch drug users increasingly
Crossing the LINE toward genomic instability: LINE-1 retrotransposition in cancer
Kemp, Jacqueline; Longworth, Michelle
2015-12-01
Retrotransposons are repetitive DNA sequences that are positioned throughout the human genome. Retrotransposons are capable of copying themselves and mobilizing new copies to novel genomic locations in a process called retrotransposition. While most retrotransposon sequences in the human genome are incomplete and incapable of mobilization, the LINE-1 retrotransposon, which comprises approximately 17% of the human genome, remains active. The disruption of cellular mechanisms that suppress retrotransposon activity is linked to the generation of aneuploidy, a potential driver of tumor development. When retrotransposons insert into a novel genomic region, they have the potential to disrupt the coding sequence of endogenous genes and alter gene expression, which can lead to deleterious consequences for the organism. Additionally, increased LINE-1 copy numbers provide more chances for recombination events to occur between retrotransposons, which can lead to chromosomal breaks and rearrangements. LINE-1 activity is increased in various cancer cell lines and in patient tissues resected from primary tumors. LINE-1 activity also correlates with increased cancer metastasis. This review aims to give a brief overview of the connections between LINE-1 retrotransposition and the loss of genome stability. We will also discuss the mechanisms that repress retrotransposition in human cells and their links to cancer.
Theoretical Atomic Physics code development IV: LINES, A code for computing atomic line spectra
International Nuclear Information System (INIS)
Abdallah, J. Jr.; Clark, R.E.H.
1988-12-01
A new computer program, LINES, has been developed for simulating atomic line emission and absorption spectra using the accurate fine structure energy levels and transition strengths calculated by the (CATS) Cowan Atomic Structure code. Population distributions for the ion stages are obtained in LINES by using the Local Thermodynamic Equilibrium (LTE) model. LINES is also useful for displaying the pertinent atomic data generated by CATS. This report describes the use of LINES. Both CATS and LINES are part of the Theoretical Atomic PhysicS (TAPS) code development effort at Los Alamos. 11 refs., 9 figs., 1 tab
Application of multi-thread computing and domain decomposition to the 3-D neutronics Fem code Cronos
International Nuclear Information System (INIS)
Ragusa, J.C.
2003-01-01
The purpose of this paper is to present the parallelization of the flux solver and the isotopic depletion module of the code, either using Message Passing Interface (MPI) or OpenMP. Thread parallelism using OpenMP was used to parallelize the mixed dual FEM (finite element method) flux solver MINOS. Investigations regarding the opportunity of mixing parallelism paradigms will be discussed. The isotopic depletion module was parallelized using domain decomposition and MPI. An attempt at using OpenMP was unsuccessful and will be explained. This paper is organized as follows: the first section recalls the different types of parallelism. The mixed dual flux solver and its parallelization are then presented. In the third section, we describe the isotopic depletion solver and its parallelization; and finally conclude with some future perspectives. Parallel applications are mandatory for fine mesh 3-dimensional transport and simplified transport multigroup calculations. The MINOS solver of the FEM neutronics code CRONOS2 was parallelized using the directive based standard OpenMP. An efficiency of 80% (resp. 60%) was achieved with 2 (resp. 4) threads. Parallelization of the isotopic depletion solver was obtained using domain decomposition principles and MPI. Efficiencies greater than 90% were reached. These parallel implementations were tested on a shared memory symmetric multiprocessor (SMP) cluster machine. The OpenMP implementation in the solver MINOS is only the first step towards fully using the SMPs cluster potential with a mixed mode parallelism. Mixed mode parallelism can be achieved by combining message passing interface between clusters with OpenMP implicit parallelism within a cluster
Application of multi-thread computing and domain decomposition to the 3-D neutronics Fem code Cronos
Energy Technology Data Exchange (ETDEWEB)
Ragusa, J.C. [CEA Saclay, Direction de l' Energie Nucleaire, Service d' Etudes des Reacteurs et de Modelisations Avancees (DEN/SERMA), 91 - Gif sur Yvette (France)
2003-07-01
The purpose of this paper is to present the parallelization of the flux solver and the isotopic depletion module of the code, either using Message Passing Interface (MPI) or OpenMP. Thread parallelism using OpenMP was used to parallelize the mixed dual FEM (finite element method) flux solver MINOS. Investigations regarding the opportunity of mixing parallelism paradigms will be discussed. The isotopic depletion module was parallelized using domain decomposition and MPI. An attempt at using OpenMP was unsuccessful and will be explained. This paper is organized as follows: the first section recalls the different types of parallelism. The mixed dual flux solver and its parallelization are then presented. In the third section, we describe the isotopic depletion solver and its parallelization; and finally conclude with some future perspectives. Parallel applications are mandatory for fine mesh 3-dimensional transport and simplified transport multigroup calculations. The MINOS solver of the FEM neutronics code CRONOS2 was parallelized using the directive based standard OpenMP. An efficiency of 80% (resp. 60%) was achieved with 2 (resp. 4) threads. Parallelization of the isotopic depletion solver was obtained using domain decomposition principles and MPI. Efficiencies greater than 90% were reached. These parallel implementations were tested on a shared memory symmetric multiprocessor (SMP) cluster machine. The OpenMP implementation in the solver MINOS is only the first step towards fully using the SMPs cluster potential with a mixed mode parallelism. Mixed mode parallelism can be achieved by combining message passing interface between clusters with OpenMP implicit parallelism within a cluster.
Second-line failure and first experience with third-line antiretroviral therapy in Mumbai, India
Directory of Open Access Journals (Sweden)
Samsuddin Khan
2014-07-01
Full Text Available Background: There are limited data on the failure of second-line antiretroviral therapy (ART and the use of third-line ART in people living with HIV in resource-limited settings. Since 2011, the Médecins Sans Frontières (MSF HIV/tuberculosis programme in Mumbai, India, has been providing third-line ART to patients in care. Objective: To describe the experiences and programmatic challenges during management of suspected second-line ART failure and third-line ART therapy for patients living with HIV, including the use of HIV viral load (VL testing. Design: This was a retrospective, observational cohort study of patients with suspected second-line ART treatment failure, who were followed for at least 12 months between January 2011 and March 2014. Results: A total of 47 patients with suspected second-line failure met the inclusion criteria during the study period. Twenty-nine of them (62% responded to enhanced adherence support, had a subsequent undetectable VL after a median duration of 3 months and remained on second-line ART. The other 18 patients had to be initiated on a third-line ART regimen, which consisted of darunavir–ritonavir, raltegravir, and one or more appropriate nucleoside or nucleotide reverse transcriptase inhibitors, based on the results of HIV genotype testing. Of the 13 patients for whom follow-up VL results were available, 11 achieved virological suppression after a median duration of 3 months on third-line ART (interquartile range: 2.5–3.0. No serious treatment-related adverse events were recorded. Conclusions: With intensive counselling and adherence support in those suspected of failing second-line ART, unnecessary switching to more expensive third-line ART can be averted in the majority of cases. However, there is an increasing need for access to third-line ART medications such as darunavir and raltegravir, for which national ART programmes should be prepared. The cost of such medications and inadequate access to VL
Survey of transmission line corridors. [Data on delays in transmission line construction
Energy Technology Data Exchange (ETDEWEB)
1979-01-05
The intent of this study is to determine the extent of delays experienced in planning and constructing transmission lines in the continental United States. The reasons for the delays are identified for each line studied and their effect on the total electrical system is sought. Data was collected for 136 different lines either recently built or currently under study. Statistics were developed for each line in several categories and comparisons of lines delayed were made by company, area served and generation capacity. From the study presented here it was found that: right-of-way acquisition procedures including condemnation and easement negotiation practices delay more projects than local, state and federal regulatory requirements combined; load growth reductions particularly in the east have reduced the impact of regulatory delays; the south, southeast and southwestern areas of the country experience fewer delays in constructing transmission lines than the more populated states, and the cost for corridor delays was responded to for only 17 of the 142 projects surveyed. By far the most costly delay is the expense of condemning land for transmission right-of-way.
Directory of Open Access Journals (Sweden)
Minas Bakalchev
2015-10-01
Full Text Available The perception of elements in a system often creates their interdependence, interconditionality, and suppression. The lines from a basic geometrical element have become the model of a reductive world based on isolation according to certain criteria such as function, structure, and social organization. Their traces are experienced in the contemporary world as fragments or ruins of a system of domination of an assumed hierarchical unity. How can one release oneself from such dependence or determinism? How can the lines become less “systematic” and forms more autonomous, and less reductive? How is a form released from modernistic determinism on the new controversial ground? How can these elements or forms of representation become forms of action in the present complex world? In this paper, the meaning of lines through the ideas of Le Corbusier, Leonidov, Picasso, and Hitchcock is presented. Spatial research was made through a series of examples arising from the projects of the architectural studio “Residential Transformations”, which was a backbone for mapping the possibilities ranging from playfulness to exactness, as tactics of transformation in the different contexts of the contemporary world.
Transmission Lines or Poles, Electric - VOLUSIA COUNTY MAJOR POWER LINES (Arcs)
NSGIC Local Govt | GIS Inventory — Volusia County Power Line data was aggregated by using parcel data and visual inspection of 2005 aerial photography to determine centerline of Power Lines Right of...
Long baseline neutrino oscillation experiments
International Nuclear Information System (INIS)
Gallagher, H.
2006-01-01
In this paper I will review briefly the experimental results which established the existence of neutrino mixing, the current generation of long baseline accelerator experiments, and the prospects for the future. In particular I will focus on the recent analysis of the MINOS experiment. (author)
Energy Technology Data Exchange (ETDEWEB)
Serodio, Conrado Jose Morbach [GDK Engenharia, Salvador, BA (Brazil)
2003-07-01
The construction of the natural gas flow lines and export lines system of the Sabalo field, in the far South of Bolivia is an unique job in the pipeline construction area. Its execution is a turning point in terms of engineering and construction technology in this industry. Among the Aguarague Cordillera (mountains), it runs across rocky canyons for more than 5 km, a 2.100 mt long narrow tunnel to overcome the mountains and steep hills along all the ROW length, with a total extension of 70 km, in line pipes ranging from 10'' and 12'' for the flow lines, 28'' for the gas export line and 8' for the condensate line. An integrated construction work plan was settled in order to face and overcome the complex construction situations found in every feet of the pipeline. Four simultaneous work sites were mobilized, 8 independent work fronts, 700 professionals and more than 150 pieces of heavy construction equipment, brought from 3 different countries. Special techniques were adopted also to handle the challenging detail engineering . All in all, the correct conjunction of a sound engineering work, planning, human resources and equipment and the managing flexibility to create alternatives and solutions at the fast pace required by a dynamic work schedule were essential to succeed, in a job with no room for mistakes. The successfully job completion open new possibilities to other challenging projects alike.(author)
Alternate Double Single Track Lines
Energy Technology Data Exchange (ETDEWEB)
Moraga Contreras, P.; Grande Andrade, Z.; Castillo Ron, E.
2016-07-01
The paper discusses the advantages and shortcomings of alternate double single track (ADST) lines with respect to double track lines for high speed lines. ADST lines consists of sequences of double and single track segments optimally selected in order to reduce the construction and maintenance costs of railway lines and to optimize the timetables used to satisfy a given demand. The single tracks are selected to coincide with expensive segments (tunnels and viaducts) and the double tracks are chosen to coincide with flat areas and only where they are necessary. At the same time, departure times are adjusted for trains to cross at the cheap double track segments. This alternative can be used for new lines and also for existing conventional lines where some new tracks are to be constructed to reduce travel time (increase speed). The ADST proposal is illustrated with some examples of both types (new lines and where conventional lines exist), including the Palencia-Santander, the Santiago-Valparaíso-Viña del Mar and the Dublin-Belfast lines, where very important reductions (90 %) are obtained, especially where a railway infrastructure already exist. (Author)
DEFF Research Database (Denmark)
Desmonde, Sophie; Eboua, François T; Malateste, Karen
2015-01-01
BACKGROUND: We described reasons for switching to second-line antiretroviral treatment (ART) and time to switch in HIV-infected children failing first-line ART in West Africa. METHODS: We included all children aged 15 years or less, starting ART (at least three drugs) in the paediatric Ie...... post-ART initiation, 188 (7%) had switched to second-line. The most frequent reasons were drug stock outs (20%), toxicity (18%), treatment failure (16%) and poor adherence (8%). Over the 24-month follow-up period, 322 (12%) children failed first-line ART after a median time of 7 months...... rare and switches after an immunological failure were insufficient. These gaps reveal that it is crucial to advocate for both sustainable access to first-line and alternative regimens to provide adequate roll-out of paediatric ART programmes....
Homotopic Polygonal Line Simplification
DEFF Research Database (Denmark)
Deleuran, Lasse Kosetski
This thesis presents three contributions to the area of polygonal line simplification, or simply line simplification. A polygonal path, or simply a path is a list of points with line segments between the points. A path can be simplified by morphing it in order to minimize some objective function...
On-line adaptive line frequency noise cancellation from a nuclear power measuring channel
Directory of Open Access Journals (Sweden)
Qadir Javed
2011-01-01
Full Text Available On-line software for adaptively canceling 50 Hz line frequency noise has been designed and tested at Pakistan Research Reactor 1. Line frequency noise causes much problem in weak signals acquisition. Sometimes this noise is so dominant that original signal is totally corrupted. Although notch filter can be used for eliminating this noise, but if signal of interest is in close vicinity of 50 Hz, then original signal is also attenuated and hence overall performance is degraded. Adaptive noise removal is a technique which could be employed for removing line frequency without degrading the desired signal. In this paper line frequency noise has been eliminated on-line from a nuclear power measuring channel. The adaptive LMS algorithm has been used to cancel 50 Hz noise. The algorithm has been implemented in labVIEW with NI 6024 data acquisition card. The quality of the acquired signal has been improved much as can be seen in experimental results.
Radiosensitivity of mesothelioma cell lines
International Nuclear Information System (INIS)
Haekkinen, A.M.; Laasonen, A.; Linnainmaa, K.; Mattson, K.; Pyrhoenen, S.
1996-01-01
The present study was carried out in order to examine the radiosensitivity of malignant pleural mesothelioma cell lines. Cell kinetics, radiation-induced delay of the cell cycle and DNA ploidy of the cell lines were also determined. For comparison an HeLa and a human foetal fibroblast cell line were simultaneously explored. Six previously cytogenetically and histologically characterized mesothelioma tumor cell lines were applied. A rapid tiazolyl blue microtiter (MTT) assay was used to analyze radiosensitivity and cell kinetics and DNA ploidy of the cultured cells were determined by flow cytometry. The survival fraction after a dose of 2 Gy (SF2), parameters α and β of the linear quadratic model (LQ-model) and mean inactivation dose (D MID ) were also estimated. The DNA index of four cell lines equaled 1.0 and two cell lines equaled 1.5 and 1.6. Different mesothelioma cell lines showed a great variation in radiosensitivity. Mean survival fraction after a radiation dose of 2 Gy (SF2) was 0.60 and ranged from 0.36 to 0.81 and mean α value was 0.26 (range 0.48-0.083). The SF2 of the most sensitive diploid mesothelioma cell line was 0.36: Less than that of the foetal fibroblast cell line (0.49). The survival fractions (0.81 and 0.74) of the two most resistant cell lines, which also were aneuploid, were equal to that of the HeLa cell line (0.78). The α/β ratios of the most sensitive cell lines were almost an order of magnitude greater than those of the two most resistant cell lines. Radiation-induced delay of the most resistant aneuploid cell line was similar to that of HeLa cells but in the most sensitive (diploid cells) there was practically no entry into the G1 phase following the 2 Gy radiation dose during 36 h. (orig.)
Radiosensitivity of mesothelioma cell lines
Energy Technology Data Exchange (ETDEWEB)
Haekkinen, A.M. [Dept. of Oncology, Univ. Central Hospital, Helsinki (Finland); Laasonen, A. [Dept. of Pathology, Central Hospital of Etelae-Pohjanmaa, Seinaejoki (Finland); Linnainmaa, K. [Dept. of Industrial Hygiene and Toxicology, Inst. of Occupational Health, Helsinki (Finland); Mattson, K. [Dept. Pulmonary Medicine, Univ. Central Hospital, Helsinki (Finland); Pyrhoenen, S. [Dept. of Oncology, Univ. Central Hospital, Helsinki (Finland)
1996-10-01
The present study was carried out in order to examine the radiosensitivity of malignant pleural mesothelioma cell lines. Cell kinetics, radiation-induced delay of the cell cycle and DNA ploidy of the cell lines were also determined. For comparison an HeLa and a human foetal fibroblast cell line were simultaneously explored. Six previously cytogenetically and histologically characterized mesothelioma tumor cell lines were applied. A rapid tiazolyl blue microtiter (MTT) assay was used to analyze radiosensitivity and cell kinetics and DNA ploidy of the cultured cells were determined by flow cytometry. The survival fraction after a dose of 2 Gy (SF2), parameters {alpha} and {beta} of the linear quadratic model (LQ-model) and mean inactivation dose (D{sub MID}) were also estimated. The DNA index of four cell lines equaled 1.0 and two cell lines equaled 1.5 and 1.6. Different mesothelioma cell lines showed a great variation in radiosensitivity. Mean survival fraction after a radiation dose of 2 Gy (SF2) was 0.60 and ranged from 0.36 to 0.81 and mean {alpha} value was 0.26 (range 0.48-0.083). The SF2 of the most sensitive diploid mesothelioma cell line was 0.36: Less than that of the foetal fibroblast cell line (0.49). The survival fractions (0.81 and 0.74) of the two most resistant cell lines, which also were aneuploid, were equal to that of the HeLa cell line (0.78). The {alpha}/{beta} ratios of the most sensitive cell lines were almost an order of magnitude greater than those of the two most resistant cell lines. Radiation-induced delay of the most resistant aneuploid cell line was similar to that of HeLa cells but in the most sensitive (diploid cells) there was practically no entry into the G1 phase following the 2 Gy radiation dose during 36 h. (orig.).
Theischinger, Günther
1982-01-01
13 new species and two new subspecies of Lunatipula Edwards are described. The new taxa are: Tipula (Lunatipula) mallorca from Mallorca, T. (L.) bimacula minos from Crete, T. (L.) simova from Thasos, T. (L.) artemis asiaeminoris, T. (L.) christophi, T. (L.) franzressli, T. (L.) horsti, T. (L.)
DEFF Research Database (Denmark)
Lenneis, Verena; Pfister, Gertrud Ursula
2017-01-01
Statistics about the recreational physical activity (PA) of minority ethnic Muslim women reveal very low participation rates. Drawing on approaches to socialization and Bourdieu’s concepts of habitus and taste, the aim of this study was to investigate the (lack of) PA participation of Muslim mino...
Waser Jürgen; Fuchs Raphael; Ribicic Hrvoje; Schindler Benjamin; Blöschl Günther; Gröller Eduard
2010-01-01
In this paper we present World Lines as a novel interactive visualization that provides complete control over multiple heterogeneous simulation runs. In many application areas decisions can only be made by exploring alternative scenarios. The goal of the suggested approach is to support users in this decision making process. In this setting the data domain is extended to a set of alternative worlds where only one outcome will actually happen. World Lines integrate simulation visualization and...
Research for the Influence of Distribution Network Line Reclosing Current on Line Protection
Directory of Open Access Journals (Sweden)
Yu Kansheng
2016-01-01
Full Text Available According to the distribution network line structure and reclosing control strategy, the system simulation model of distribution network lines has established based on the real-time digital simulation RTDS. Based on this, distribution network switching impulse current characteristic has researched with different capacity, different distribution and different load power factor under the different voltage switching angles. The results of the study provide a scientific basis for distribution network line protection setting, in order to further lay the foundation for improvement the validity and reliability of distribution network line protection action.
The last line effect explained
Beller, M. (Moritz); Zaidman, A. (Andy); Karpov, A. (Andrey); R.A. Zwaan (Rolf)
2017-01-01
textabstractMicro-clones are tiny duplicated pieces of code; they typically comprise only few statements or lines. In this paper, we study the “Last Line Effect,” the phenomenon that the last line or statement in a micro-clone is much more likely to contain an error than the previous lines or
Symposium in Honor of Minoru M. Freund
Langhoff, Stephanie
2014-01-01
The presentations at this NASA-hosted Symposium in honor of Mino Freund will touch upon the fields, to which his prolific mind has made significant contributions. These include low temperature physics, cosmology, and nanotechnology with its wide-ranging applicability to material science, neuroscience, Earth sciences and satellite technology. To learn more about Mino’s career you can download the "Tribute" , which outlines his journey from (i) low-temperature physics and superconductivity at the ETH Zürich to (ii) building one remarkable milliKelvin refrigerator for the US-Japan IRTS mission at UC Berkeley and ISAS in Japan to (iii) a decade in cosmology, to (iv) being on the micro-bolometer team at NASA Goddard for the HAWC instrument on SOFIA, to (v) developing at AFRL the nanotechnology portfolio for the entire Air Force. This was followed by six years at the NASA Ames Research Center, where Mino formulated his far-ahead ideas about swarms of capable nanosats circling the Earth, which have since star...
Dynamic Line Rating - Technologies and Challenges of PMU on Overhead Lines
DEFF Research Database (Denmark)
Alvarez, David; Rosero, Javier; Silva, Filipe Miguel Faria da
2016-01-01
for line rating computation and monitoring are identified, these are: sensors, communications, management information system and information analysis tools, which are part of integral dynamic line rating systems. Finally, the benefits and challenges of using phasor measurement units for real time capacity...
The last line effect explained
Beller, M.M.; Zaidman, A.E.; Karpov, Andrey; Zwaan, Rolf A.
Micro-clones are tiny duplicated pieces of code; they typically comprise only few statements or lines. In this paper, we study the “Last Line Effect,” the phenomenon that the last line or statement in a micro-clone is much more likely to contain an error than the previous lines or statements. We do
Numerical simulations of sheared magnetic lines at the solar null line
Kuźma, B.; Murawski, K.; Solov'ev, A.
2015-05-01
Aims: We perform numerical simulations of sheared magnetic lines at the magnetic null line configuration of two magnetic arcades that are settled in a gravitationally stratified and magnetically confined solar corona. Methods: We developed a general analytical model of a 2.5D solar atmospheric structure. As a particular application of this model, we adopted it for the curved magnetic field lines with an inverted Y shape that compose the null line above two magnetic arcades, which are embedded in the solar atmosphere that is specified by the realistic temperature distribution. The physical system is described by 2.5D magnetohydrodynamic equations that are numerically solved by the FLASH code. Results: The magnetic field line shearing, implemented about 200 km below the transition region, results in Alfvén and magnetoacoustic waves that are able to penetrate solar coronal regions above the magnetic null line. As a result of the coupling of these waves, partial reflection from the transition region and scattering from inhomogeneous regions the Alfvén waves experience fast attenuation on time scales comparable to their wave periods, and the physical system relaxes in time. The attenuation time grows with the large amplitude and characteristic growing time of the shearing. Conclusions: By having chosen a different magnetic flux function, the analytical model we devised can be adopted to derive equilibrium conditions for a diversity of 2.5D magnetic structures in the solar atmosphere. Movie associated to Fig. 5 is available in electronic form at http://www.aanda.org
Incentive-Compatible Robust Line Planning
Bessas, Apostolos; Kontogiannis, Spyros; Zaroliagis, Christos
The problem of robust line planning requests for a set of origin-destination paths (lines) along with their frequencies in an underlying railway network infrastructure, which are robust to fluctuations of real-time parameters of the solution. In this work, we investigate a variant of robust line planning stemming from recent regulations in the railway sector that introduce competition and free railway markets, and set up a new application scenario: there is a (potentially large) number of line operators that have their lines fixed and operate as competing entities issuing frequency requests, while the management of the infrastructure itself remains the responsibility of a single entity, the network operator. The line operators are typically unwilling to reveal their true incentives, while the network operator strives to ensure a fair (or socially optimal) usage of the infrastructure, e.g., by maximizing the (unknown to him) aggregate incentives of the line operators.
Lee, Jaeyul; Kwon, Hyungwoo; Song, Jaewon; Jeon, Mansik; Kim, Jeehyun
2017-08-24
A handheld line information reader and a line information generator were developed for the efficient management of optical communication lines. The line information reader consists of a photo diode, trans-impedance amplifier, voltage amplifier, microcontroller unit, display panel, and communication modules. The line information generator consists of a laser diode, laser driving circuits, microcontroller unit, and communication modules. The line information reader can detect the optical radiation field of the test line by bending the optical fiber. To enhance the sensitivity of the line information reader, an additional lens was used with a focal length of 4.51 mm. Moreover, the simulation results obtained through BeamPROP ® software from Synopsys, Inc. demonstrated a stronger optical radiation field of the fiber due to a longer transmission wavelength and larger bending angle of the fiber. Therefore, the developed devices can be considered as useful tools for the efficient management of optical communication lines.
GOSAT-2014 methane spectral line list
International Nuclear Information System (INIS)
Nikitin, A.V.; Lyulin, O.M.; Mikhailenko, S.N.; Perevalov, V.I.; Filippov, N.N.; Grigoriev, I.M.; Morino, I.; Yoshida, Y.; Matsunaga, T.
2015-01-01
The updated methane spectral line list GOSAT-2014 for the 5550–6240 cm −1 region with the intensity cutoff of 5×10 –25 cm/molecule at 296 K is presented. The line list is based on the extensive measurements of the methane spectral line parameters performed at different temperatures and pressures of methane without and with buffer gases N 2 , O 2 and air. It contains the following spectral line parameters of about 12150 transitions: line position, line intensity, energy of lower state, air-induced and self-pressure-induced broadening and shift coefficients and temperature exponent of air-broadening coefficient. The accuracy of the line positions and intensities are considerably improved in comparison with the previous version GOSAT-2009. The improvement of the line list is done mainly due to the involving to the line position and intensity retrieval of six new spectra recorded with short path way (8.75 cm). The air-broadening and air-shift coefficients for the J-manifolds of the 2ν 3 (F 2 ) band are refitted using the new more precise values of the line positions and intensities. The line assignment is considerably extended. The lower state J-value was assigned to 6397 lines representing 94.4% of integrated intensity of the considering wavenumber region. The complete assignment was done for 2750 lines. - Highlights: • The upgrade of the GOSAT methane line list in the 5550–6240 cm −1 region is done. • 12,146 experimental methane line positions and intensities are retrieved. • 6376 lower energy levels for methane lines are determined
Rapid line scan MR angiography
International Nuclear Information System (INIS)
Frahm, J.; Merboldt, K.D.; Hanicke, W.; Bruhn, H.
1987-01-01
Direct MR angiography may be performed using line scan imaging techniques combined with presaturation of stationary spins. Thus, a single line scan echo yields a projection of vessels due to the signal from reflowing unsaturated spins. Reconstruction of an angiographic image is performed line by line at slightly incremented positions. In particular, line scan angiography is direct and fast without a sensitivity to artifacts even for high flow rates. Image resolution and field of view may be chosen without restrictions, and zoom images using enhanced gradients may be recorded without aliasing artifacts. The method is robust with respect to eddy currents and pulsatile flow. Line scan MR angiograms of phantoms, animals, and human volunteers have been recorded using 90 0 radio frequency pulses and gradient-recalled echoes
Spotting Separator Points at Line Terminals in Compressed Document Images for Text-line Segmentation
R, Amarnath; Nagabhushan, P.
2017-01-01
Line separators are used to segregate text-lines from one another in document image analysis. Finding the separator points at every line terminal in a document image would enable text-line segmentation. In particular, identifying the separators in handwritten text could be a thrilling exercise. Obviously it would be challenging to perform this in the compressed version of a document image and that is the proposed objective in this research. Such an effort would prevent the computational burde...
VT Electric Transmission Line Corridors - corridor lines
Vermont Center for Geographic Information — (Link to Metadata) The ELTRN layer depicts electric transmission line corridors in Vermont. Various methods have been used to digitize features. The data layer...
High-resolution Laboratory Measurements of Coronal Lines near the Fe IX Line at 171 Å
Beiersdorfer, Peter; Träbert, Elmar
2018-02-01
We present high-resolution laboratory measurements in the spectral region between 165 and 175 Å that focus on the emission from various ions of C, O, F, Ne, S, Ar, Fe, and Ni. This wavelength region is centered on the λ171 Fe IX channel of the Atmospheric Imaging Assembly on the Solar Dynamics Observatory, and we place special emphasis on the weaker emission lines of Fe IX predicted in this region. In general, our measurements show a multitude of weak lines missing in the current databases, where the emission lines of Ni are probably most in need of further identification and reclassification. We also find that the wavelengths of some of the known lines need updating. Using the multi-reference Møller–Plesset method for wavelength predictions and collisional-radiative modeling of the line intensities, we have made tentative assignments of more than a dozen lines to the spectrum of Fe IX, some of which have formerly been identified as Fe VII, Fe XIV, or Fe XVI lines. Several Fe features remain unassigned, although they appear to be either Fe VII or Fe X lines. Further work will be needed to complete and correct the spectral line lists in this wavelength region.
VT Digital Line Graph Railroads
Vermont Center for Geographic Information — (Link to Metadata) This datalayer is comprised of major railroad lines for the state of Vermont. These railroad lines line up well along quadrangle boundaries, but...
The line makes the difference: line managers as effective HRM partners
Bos-Nehles, Anna Christina
2010-01-01
The HR role of line managers is highly discussed and criticized but little empirically researched. It is argued that line managers are not able to effectively implement HR practices because they do not have the desire, capacity and competences needed to perform well and lack support and policies &
Ferreira, Hendrik C; Newbury, John; Swart, Theo G
2010-01-01
Power Line Communications (PLC) is a promising emerging technology, which has attracted much attention due to the wide availability of power distribution lines. This book provides a thorough introduction to the use of power lines for communication purposes, ranging from channel characterization, communications on the physical layer and electromagnetic interference, through to protocols, networks, standards and up to systems and implementations. With contributions from many of the most prominent international PLC experts from academia and industry, Power Line Communications brings togeth
Optical Variability of Narrow-line and Broad-line Seyfert 1 Galaxies
Rakshit, Suvendu; Stalin, C. S.
2017-06-01
We studied the optical variability (OV) of a large sample of narrow-line Seyfert 1 (NLSy1) and broad-line Seyfert 1 (BLSy1) galaxies with z anti-correlated with Fe II strength but correlated with the width of the Hβ line. The well-known anti-correlation of variability-luminosity and the variability-Eddington ratio is present in our data. Among the radio-loud sample, variability amplitude is found to be correlated with radio-loudness and radio-power, suggesting that jets also play an important role in the OV in radio-loud objects, in addition to the Eddington ratio, which is the main driving factor of OV in radio-quiet sources.
Line Shape Variability in a Sample of AGN with Broad Lines
Indian Academy of Sciences (India)
2016-01-27
Jan 27, 2016 ... We give here a comparative review of the line shape variability in a sample of five type 1 AGNs, those with broad emission lines in their spectra, of the data obtained from the international long-term optical monitoring campaign coordinated by the Special Astrophysical Observatory of the Russian Academy ...
Atlas transmission line breakdown analysis
Nielsen, K E; Ballard, E O; Elizondo, J M; Gribble, R F; McCuistian, B T; Parsons, W M
1999-01-01
The Atlas facility will use 24 radially converging, vertically oriented and tapered, oil insulated, triplate transmission lines between the Marx generators and the central load region. Among the requirements of the transmission lines are low inductance and high reliability. The inter-conductor gap is nominally 2 cm and the lines taper from a height of 1.75 m at the Marx end to 0.32 m at the output end. The aluminum conductors, held together by 20 insulating spacers, are assembled and inserted as a unit into radial oil-filled steel tanks. The negative, high-voltage, center conductor is 2.54-cm thick and the outer ground conductors are 1.59-cm thick. All 24 triplate transmission lines connect to a transition section at near 1 m radius that couples the transmission lines to a disk/conical solid- dielectric-insulated power flow channel transmission line terminating at the load. Peak operating voltage on the lines can be as high as 240 kV with an effective stress time of 0.8 mu s. Testing of small sections of the ...
Optimization of antibody immobilization for on-line or off-line immunoaffinity chromatography
DEFF Research Database (Denmark)
Beyer, Natascha Helena; Schou, Christian; Højrup, Peter
2009-01-01
-POROS. Protein G-based matrices are very stable showing essentially no decline in performance after 50 application-wash-elution-reequilibration cycles and being easily prepared within 2-3 h of working time with a typical antibody coupling yield of above 80%. In off-line applications where constant flow....... A systematic study was conducted to determine the most versatile antibody immobilization method for use in on-line and off-line IA chromatography applications using commonly accessible immobilization methods. Four chemistries were examined using polyclonal and monoclonal antibodies and antibody fragments. We...
Line-shape asymmetry of water vapor absorption lines in the 720-nm wavelength region
Grossmann, Benoist E.; Browell, Edward V.
1991-01-01
Spectral line-shape analyses were performed for water vapor lines broadened by argon, oxygen, and xenon in the 720-nm wavelength region. A line-shape asymmetry was observed, which is attributed to statistical dependence or correlation between velocity- and state-changing collisions. The generalized (asymmetric) Galatry profile, which results from the soft-collision profile and includes correlation between velocity- and state-changing collisions, was fitted to the observed line shapes and was found to compare favorably with the observed data. The most prominent asymmetries were observed with xenon as the buffer gas.
China's Bilateral Currency Swap Lines
Zhitao, Lin; Wenjie, Zhan; Cheung, Yin-Wong
2016-01-01
We study the determinants of China’s bilateral local currency swap lines that were established since the recent global finance crisis. It is found that economic factors, political considerations, and institutional characteristics including trade intensity, economic size, strategic partnership, free trade agreement, corruption, and stability affect the decision of signing a swap line agreement. Once a swap line agreement decision is made, the size of the swap line is then mainly affected by tr...
Series Transmission Line Transformer
Buckles, Robert A.; Booth, Rex; Yen, Boris T.
2004-06-29
A series transmission line transformer is set forth which includes two or more of impedance matched sets of at least two transmissions lines such as shielded cables, connected in parallel at one end ans series at the other in a cascading fashion. The cables are wound about a magnetic core. The series transmission line transformer (STLT) which can provide for higher impedance ratios and bandwidths, which is scalable, and which is of simpler design and construction.
Romano, Paolo; Manniello, Assunta; Aresu, Ottavia; Armento, Massimiliano; Cesaro, Michela; Parodi, Barbara
2009-01-01
The Cell Line Data Base (CLDB) is a well-known reference information source on human and animal cell lines including information on more than 6000 cell lines. Main biological features are coded according to controlled vocabularies derived from international lists and taxonomies. HyperCLDB (http://bioinformatics.istge.it/hypercldb/) is a hypertext version of CLDB that improves data accessibility by also allowing information retrieval through web spiders. Access to HyperCLDB is provided through indexes of biological characteristics and navigation in the hypertext is granted by many internal links. HyperCLDB also includes links to external resources. Recently, an interest was raised for a reference nomenclature for cell lines and CLDB was seen as an authoritative system. Furthermore, to overcome the cell line misidentification problem, molecular authentication methods, such as fingerprinting, single-locus short tandem repeat (STR) profile and single nucleotide polymorphisms validation, were proposed. Since this data is distributed, a reference portal on authentication of human cell lines is needed. We present here the architecture and contents of CLDB, its recent enhancements and perspectives. We also present a new related database, the Cell Line Integrated Molecular Authentication (CLIMA) database (http://bioinformatics.istge.it/clima/), that allows to link authentication data to actual cell lines.
Corral-Vázquez, C; Aguilar-Quesada, R; Catalina, P; Lucena-Aguilar, G; Ligero, G; Miranda, B; Carrillo-Ávila, J A
2017-06-01
Establishment of continuous cell lines from human normal and tumor tissues is an extended and useful methodology for molecular characterization of cancer pathophysiology and drug development in research laboratories. The exchange of these cell lines between different labs is a common practice that can compromise assays reliability due to contamination with microorganism such as mycoplasma or cells from different flasks that compromise experiment reproducibility and reliability. Great proportions of cell lines are contaminated with mycoplasma and/or are replaced by cells derived for a different origin during processing or distribution process. The scientific community has underestimated this problem and thousand of research experiment has been done with cell lines that are incorrectly identified and wrong scientific conclusions have been published. Regular contamination and authentication tests are necessary in order to avoid negative consequences of widespread misidentified and contaminated cell lines. Cell banks generate, store and distribute cell lines for research, being mandatory a consistent and continuous quality program. Methods implementation for guaranteeing both, the absence of mycoplasma and authentication in the supplied cell lines, has been performed in the Andalusian Health System Biobank. Specifically, precise results were obtained using real time PCR detection for mycoplasma and 10 STRs identification by capillary electrophoresis for cell line authentication. Advantages and disadvantages of these protocols are discussed.
Energy Technology Data Exchange (ETDEWEB)
Seo, Seong-Ho; Chang, Seok-Bue [Yooshin Engineering Corporation, Seoul(Korea); Lee, Sang-Duk [Ajou University, Suwon(Korea)
2002-06-30
It is the common practice to over design the reinforcement for the secondary tunnel lining due to the lack of rational insight into the ground loosening loads, and due to the conservative application of the empirical design methods. The main loads of the secondary lining are the ground loosening loads and the ground water pressure, and the ground load is critical in the reinforcement design of the secondary lining in the case of drained tunnel. If the external load is absent around a tunnel. the reasons of the load for secondary tunnel lining are the deterioration of the primary supports such as shotcrete, steel rib, and rock bolts. Accordingly, the analysis method considering the ground-primary supports-secondary lining interaction should be required for the rational design of the secondary tunnel lining. In this paper, the interaction was conceptually described by the simple mass-spring model and the load transfer from the ground and primary supports to the secondary lining is showed by the ground-primary supports-secondary lining reaction curves for the theoretical solution of a circular tunnel, And also, the application of this proposed model to numerical analysis is verified in order to check the potential for the tunnel with the complex analysis conditions. (author). 8 refs., 2 tabs., 7 figs.
International Nuclear Information System (INIS)
Nikiskov, A.I.; Ritus, V.I.
1993-01-01
The concept of Stokes line width is introduced for the asymptotic expansions of functions near an essential singularity. Explicit expressions are found for functions (switching functions) that switch on the exponentially small terms for the Dawson integral, Airy function, and the gamma function. A different, more natural representation of a function, not associated with expansion in an asymptotic series, in the form of dominant and recessive terms is obtained by a special division of the contour integral which represents the function into contributions of higher and lower saddle points. This division leads to a narrower, natural Stokes line width and a switching function of an argument that depends on the topology of the lines of steepest descent from the saddle point
Directory of Open Access Journals (Sweden)
Jin-quan LI
2007-06-01
Full Text Available Four sets of rice isonuclear-alloplasmic lines including 16 male sterile lines and their maintainer lines were analyzed by using 91 pairs of SSR primers to study the genetic diversity of nuclear genome and their relative relationships. A total of 169 alleles were detected in the 16 lines, with a frequency of polymorphic loci of 53.85% and an average number of alleles per locus of 1.8, and the average gene diversity was 0.228. Four sets of the isonuclear-alloplasmic male sterile lines shared 146 identical alleles, corresponding to 86.39% of the total alleles; meanwhile, there are 23 different alleles among the tested materials, being 13.61% of the total alleles. On average, 78.70% identical alleles and 21.30% different alleles of the total alleles were detected between the isonuclear-alloplasmic male sterile lines and their maintainer lines. There were 53.85% identical alleles and 46.15% different alleles of the total alleles among the homozygous allonucleus male sterile lines. The fingerprints were established for some male sterile lines and maintainer lines. All the materials tested were divided into three groups at the 0.2 genetic distance based on the cluster analysis. Eight lines of Huanong A and Huayu A (including Huanong B and Huayu B were in the first group, four lines of Kezhen A (including Kezhen B in the second group, and four lines of Zhenshan 97A (including Zhenshan 97B in the third group. For the isonuclear-alloplasmic male sterile lines, the similarity coefficient between Y (Yegong type and WA (wild abortive type or between CW (Raoping wild rice and WA type reached 87–98%.
A new technique for on-line and off-line high speed computation
International Nuclear Information System (INIS)
Hartouni, E.P.; Jensen, D.A.; Klima, B.; Kreisler, M.N.; Rabin, M.S.Z.; Uribe, J.; Gottschalk, E.; Gara, A.; Knapp, B.C.
1989-01-01
A new technique for both on-line and off-line computation has been developed. With this technique, a reconstruction analysis in Elementary Particle Physics, otherwise prohibitively long, has been accomplished. It will be used on-line in an upcoming Fermilab experiment to reconstruct more than 100,000 events per second and to trigger on the basis of that information. The technique delivers 40 Giga operations per second, has a bandwidth on the order of Gigabytes per second and has a modest cost. An overview of the program, details of the system, and performance measurements are presented in this paper
Sarntivijai, Sirarat; Lin, Yu; Xiang, Zuoshuang; Meehan, Terrence F.; Diehl, Alexander D.; Vempati, Uma D.; Schuerer, Stephan C.; Pang, Chao; Malone, James; Parkinson, Helen; Liu, Yue; Takatsuki, Terue; Saijo, Kaoru; Masuya, Hiroshi; Nakamura, Yukio; Brush, Matthew H.; Haendel, Melissa A.; Zheng, Jie; Stoeckert, Christian J.; Peters, Bjoern; Mungall, Christopher J.; Carey, Thomas E.; States, David J.; Athey, Brian D.; He, Yongqun
2014-01-01
Background: Cell lines have been widely used in biomedical research. The community-based Cell Line Ontology (CLO) is a member of the OBO Foundry library that covers the domain of cell lines. Since its publication two years ago, significant updates have been made, including new groups joining the CLO
Microwave transmission-line impedance data
Gunston, M A R
1996-01-01
A compendium of data for computing the characteristic impedance of transmission lines based on physical dimensions. Covers both conventional structures and unusual geometries, including coaxial, eccentric and elliptic coaxial, twin-wire, wire-above-ground, microstrip and derivatives, stripline, slabline and trough line. Also details numerous configurations of coupled lines.
Parallel plate transmission line transformer
Voeten, S.J.; Brussaard, G.J.H.; Pemen, A.J.M.
2011-01-01
A Transmission Line Transformer (TLT) can be used to transform high-voltage nanosecond pulses. These transformers rely on the fact that the length of the pulse is shorter than the transmission lines used. This allows connecting the transmission lines in parallel at the input and in series at the
Wareing, Brian
2005-01-01
This new book concentrates on the mechanical aspects of distribution wood pole lines, including live line working, environmental influences, climate change and international standards. Other topics include statutory requirements, safety, profiling, traditional and probabilistic design, weather loads, bare and covered conductors, different types of overhead systems, conductor choice, construction and maintenance. A section has also been devoted to the topic of lightning, which is one of the major sources of faults on overhead lines. The book focuses on the effects of this problem and the strate
Parallel field line and stream line tracing algorithms for space physics applications
Toth, G.; de Zeeuw, D.; Monostori, G.
2004-05-01
Field line and stream line tracing is required in various space physics applications, such as the coupling of the global magnetosphere and inner magnetosphere models, the coupling of the solar energetic particle and heliosphere models, or the modeling of comets, where the multispecies chemical equations are solved along stream lines of a steady state solution obtained with single fluid MHD model. Tracing a vector field is an inherently serial process, which is difficult to parallelize. This is especially true when the data corresponding to the vector field is distributed over a large number of processors. We designed algorithms for the various applications, which scale well to a large number of processors. In the first algorithm the computational domain is divided into blocks. Each block is on a single processor. The algorithm folows the vector field inside the blocks, and calculates a mapping of the block surfaces. The blocks communicate the values at the coinciding surfaces, and the results are interpolated. Finally all block surfaces are defined and values inside the blocks are obtained. In the second algorithm all processors start integrating along the vector field inside the accessible volume. When the field line leaves the local subdomain, the position and other information is stored in a buffer. Periodically the processors exchange the buffers, and continue integration of the field lines until they reach a boundary. At that point the results are sent back to the originating processor. Efficiency is achieved by a careful phasing of computation and communication. In the third algorithm the results of a steady state simulation are stored on a hard drive. The vector field is contained in blocks. All processors read in all the grid and vector field data and the stream lines are integrated in parallel. If a stream line enters a block, which has already been integrated, the results can be interpolated. By a clever ordering of the blocks the execution speed can be
Minnesota County Boundaries - lines
Minnesota Department of Natural Resources — Minnesota county boundaries derived from a combination of 1:24,000 scale PLS lines, 1:100,000 scale TIGER, 1:100,000 scale DLG, and 1:24,000 scale hydrography lines....
A tangent subsolar merging line
International Nuclear Information System (INIS)
Crooker, N.U.; Siscoe, G.L.; Toffoletto, F.R.
1990-01-01
The authors describe a global magnetospheric model with a single subsolar merging line whose position is determined neither locally by the relative orientations and strengths of the merging fields nor globally by the orientation of a separator line--the governing parameters of most previous models--but by the condition of tangential contact between the external field and the magnetopause. As in previous models, the tilt of the merging line varies with IMF orientation, but here it also depends upon the ratio of Earth's magnetic flux that leaks out of the magnetopause to IMF flux that penetrates in. In the limiting case treated by Alekseyev and Belen'kaya, with no leakage of Earth's field and total IMF penetration, the merging line forms a great circle around a spherical magnetosphere where undeviated IMF lines lie tangent to its surface. This tangent merging line lies perpendicular to the IMF. They extend their work to the case of finite leakage and partial penetration, which distort the IMF into a draped pattern, thus changing the locus of tangency to the sphere. In the special case where the penetrating IMF flux is balanced by an equal amount of Earth flux leakage, the tangent merging line bisects the angle between the IMF and Earth's northward subsolar field. This result is identical to the local merging line model result for merging fields with equal magnitude. Here a global flux balance condition replaces the local equal magnitude condition
Transmission line capital costs
International Nuclear Information System (INIS)
Hughes, K.R.; Brown, D.R.
1995-05-01
The displacement or deferral of conventional AC transmission line installation is a key benefit associated with several technologies being developed with the support of the U.S. Department of Energy's Office of Energy Management (OEM). Previous benefits assessments conducted within OEM have been based on significantly different assumptions for the average cost per mile of AC transmission line. In response to this uncertainty, an investigation of transmission line capital cost data was initiated. The objective of this study was to develop a database for preparing preliminary estimates of transmission line costs. An extensive search of potential data sources identified databases maintained by the Bonneville Power Administration (BPA) and the Western Area Power Administration (WAPA) as superior sources of transmission line cost data. The BPA and WAPA data were adjusted to a common basis and combined together. The composite database covers voltage levels from 13.8 to 765 W, with cost estimates for a given voltage level varying depending on conductor size, tower material type, tower frame type, and number of circuits. Reported transmission line costs vary significantly, even for a given voltage level. This can usually be explained by variation in the design factors noted above and variation in environmental and land (right-of-way) costs, which are extremely site-specific. Cost estimates prepared from the composite database were compared to cost data collected by the Federal Energy Regulatory Commission (FERC) for investor-owned utilities from across the United States. The comparison was hampered because the only design specifications included with the FERC data were voltage level and line length. Working within this limitation, the FERC data were not found to differ significantly from the composite database. Therefore, the composite database was judged to be a reasonable proxy for estimating national average costs
MEMS-based transmission lines for microwave applications
Wu, Qun; Fu, Jiahui; Gu, Xuemai; Shi, Huajuan; Lee, Jongchul
2003-04-01
This paper mainly presents a briefly review for recent progress in MEMS-based transmission lines for use in microwave and millimeterwave range. MEMS-based transmission lines including different transmission line structure such as membrane-supported microstrip line microstrip line, coplanar microshield transmission line, LIGA micromachined planar transmission line, micromachined waveguides and coplanar waveguide are discussed. MEMS-based transmission lines are characterized by low propagation loss, wide operation frequency band, low dispersion and high quality factor, in addition, the fabrication is compatible with traditional processing of integrated circuits (IC"s). The emergence of MEMS-based transmission lines provided a solution for miniaturizing microwave system and monolithic microwave integrated circuits.
A novel Y-xylosidase, nucleotide sequence encoding it and use thereof.
Graaff, de L.H.; Peij, van N.N.M.E.; Broeck, van den H.C.; Visser, J.
1996-01-01
A nucleotide sequence is provided which encodes a peptide having beta-xylosidase activity and exhibits at least 30mino acid identity with the amino acid sequence shown in SEQ ID NO. 1 or hybridises under stringent conditions with a nucleotide sequence shown in SEQ ID NO. 1, or a part thereof having
Alkylation of toluene with isopropyl alcohol over SAPO-5 catalyst
Indian Academy of Sciences (India)
Administrator
Abstract. Isopropylation of toluene with isopropyl alcohol was studied over the large pore silicon alu- mino phosphate molecular sieves (SAPO-5) with varying Si content. Toluene conversion was found to increase with increase in the Si of the catalysts. The effect of temperature on yields of cymene was studied in the range ...
Bultas, Margaret W; Pohlman, Shawn
2014-01-01
The purpose of this interpretive phenomenological study was to gain a better understanding of the experiences of 11 mothers of preschool children with autism spectrum disorder (ASD). Mothers were interviewed three times over a 6 week period. Interviews were analyzed using interpretive methods. This manuscript highlights one particular theme-a positive perspective mothers described as the "silver lining." This "silver lining" represents optimism despite the adversities associated with parenting a child with ASD. A deeper understanding of this side of mothering children with ASD may help health care providers improve rapport, communication, and result in more authentic family centered care. Copyright © 2014 Elsevier Inc. All rights reserved.
Constancy of spectral-line bisectors
International Nuclear Information System (INIS)
Gray, D.F.
1983-01-01
Bisectors of spectral line profiles in cool stars indicate the strength of convection in the photospheres of these objects. The present investigation is concerned with the feasibility of studying time variations in line bisectors, the reality of apparent line-to-line differences within the same stellar spectrum, and bisector differences between stars of identical spectral types. The differences considered pertain to the shape of the bisector. The material used in the investigation was acquired at the McDonald Observatory using a 1728 diode Reticon array at the coudefocus of the 2.1-m telescope. Observed bisector errors are discussed. It is established that different lines in the same star show significantly different bisectors. The observed error bands are shown by the shaded regions. The slope and curvature are unique for each case
International Nuclear Information System (INIS)
Raihani Wahdah; Gusti Rumayadi; Rahmi Zulhidiani
2016-01-01
The preference of farmer in tidal swamp on local rice varieties are quite high, but local varieties have a long life and low yield characters, so it needs to be improved for the trait. This study is part of activities of the local rice varieties improvement to generate promising lines were short-moderate aged, but the slimming and pera (high amylose content) grains maintained. The aims of this study were to determine the intra lines uniformity and the inter lines variation of M5 generation of rice mutant lines. The experiment was carried out in the Experimental Station of Agriculture Faculty, Lambung Mangkurat University from March to September 2014. The experiment used 150 earliest flowering lines of 300 M5 mutant lines that were planted. Intra lines uniformity were analysed by comparing the variance of each mutant lines with variance of its parent, while the variation among lines were analyzed by comparing the variance of all lines with variance of its parent. More than 85 % M5 mutant lines from Siam Harli as parent and > 79 % of Siam Kuatek as parent are uniform. The uniform character at all M5 mutant lines, both of Siam Harli or Siam Kuatek parent are the harvest age, the filled grains number, and the empty grains number. There is no variability between M5 mutant lines, but some of M5 mutant lines from Siam Harli and Siam Kuatek have some better characters than their parents, so there is an opportunity for selection. (author)
Mjollnir Rotational Line Scan Diagnostics.
1981-05-19
using long cavity. M8 Removable Pellicle Beam Splitter for He-Ne Lineup Beam. Removed before HF or DF laser is turned on. 27 A 27 * A r of the chopper...three probe laser lines, however three lines were sequentially measured to verify the diagnostic equipment. Two of the three lines have been monitored
QSOs with narrow emission lines
International Nuclear Information System (INIS)
Baldwin, J.A.; Mcmahon, R.; Hazard, C.; Williams, R.E.
1988-01-01
Observations of two new high-redshift, narrow-lined QSOs (NLQSOs) are presented and discussed together with observations of similar objects reported in the literature. Gravitational lensing is ruled out as a possible means of amplifying the luminosity for one of these objects. It is found that the NLQSOs have broad bases on their emission lines as well as the prominent narrow cores which define this class. Thus, these are not pole-on QSOs. The FWHM of the emission lines fits onto the smoothly falling tail of the lower end of the line-width distribution for complete QSO samples. The equivalent widths of the combined broad and narrow components of the lines are normal for QSOs of the luminosity range under study. However, the NLQSOs do show ionization differences from broader-lined QSOs; most significant, the semiforbidden C III/C IV intensity ratio is unusually low. The N/C abundance ratio in these objects is found to be normal; the Al/C abundance ratio may be quite high. 38 references
Teaching Braille Line Tracking Using Stimulus Fading
Scheithauer, Mindy C.; Tiger, Jeffrey H.
2014-01-01
Line tracking is a prerequisite skill for braille literacy that involves moving one's finger horizontally across a line of braille text and identifying when a line ends so the reader may reset his or her finger on the subsequent line. Current procedures for teaching line tracking are incomplete, because they focus on tracking lines with only…
Line ratios and wavelengths of helium-like argon n=2 satellite transitions and resonance lines
International Nuclear Information System (INIS)
Biedermann, C.; Radtke, R.; Fournier, K.
2003-01-01
The characteristic X-ray emission from helium-like argon was investigated as a mean to diagnose hot plasmas. We have measured the radiation from n=2-1 parent lines and from KLn dielectronic recombination satellites with high wavelength resolution as function of the excitation energy using the Berlin Electron Beam Ion Trap. Values of wavelength relative to the resonance and forbidden line are tabulated and compared with references. The line intensity observed over a wide range of excitation energies is weighted with a Maxwellian electron-energy distribution to analyze line ratios as function of plasma temperature. Line ratios (j+z)/w and k/w compare nicely with theoretical predictions and demonstrate their applicability as temperature diagnostic. The ratio z/(x+y) shows not to depend on the electron density
LED-Based High-Voltage Lines Warning System
Directory of Open Access Journals (Sweden)
Eldar MUSA
2013-04-01
Full Text Available LED-based system, running with the current of high-voltage lines and converting the current flowing through the line into the light by using a toroid transformer, has been developed. The transformer’s primary winding is constituted by the high voltage power line. Toroidal core consists of two equal parts and the secondary windings are evenly placed on these two parts. The system is mounted on the high-voltage lines as a clamp. The secondary winding ends are connected in series by the connector on the clamp. LEDs are supplied by the voltage at the ends of secondary. Current flowing through highvoltage transmission lines is converted to voltage by the toroidal transformer and the light emitting LEDs are supplied with this voltage. The theory of the conversion of the current flowing through the line into the light is given. The system, running with the current of the line and converting the current into the light, has been developed. System has many application areas such as warning high voltage lines (warning winches to not hinder the high-voltage lines when working under the lines, warning planes to not touch the high-voltage lines, remote measurement of high-voltage line currents, and local illumination of the line area
Zhang, Donghao; Matsuura, Haruki; Asada, Akiko
2017-04-01
Some automobile factories have segmented mixed-model production lines into shorter sub-lines according to part group, such as engine, trim, and powertrain. The effects of splitting a line into sub-lines have been reported from the standpoints of worker motivation, productivity improvement, and autonomy based on risk spreading. There has been no mention of the possibility of shortening the line length by altering the product sequence using sub-lines. The purpose of the present paper is to determine the conditions under which sub-lines reduce the line length and the degree to which the line length may be shortened. The line lengths for a non-split line and a line that has been split into sub-lines are compared using three methods for determining the working area, the standard closed boundary, the optimized open boundary, and real-life constant-length stations. The results are discussed by analyzing the upper and lower bounds of the line length. Based on these results, a procedure for deciding whether or not to split a production line is proposed.
Development of Elite BPH-Resistant Wide-Spectrum Restorer Lines for Three and Two Line Hybrid Rice.
Fan, Fengfeng; Li, Nengwu; Chen, Yunping; Liu, Xingdan; Sun, Heng; Wang, Jie; He, Guangcun; Zhu, Yingguo; Li, Shaoqing
2017-01-01
Hybrid rice has contributed significantly to the world food security. Breeding of elite high-yield, strong-resistant broad-spectrum restorer line is an important strategy for hybrid rice in commercial breeding programs. Here, we developed three elite brown planthopper (BPH)-resistant wide-spectrum restorer lines by pyramiding big-panicle gene Gn8.1 , BPH-resistant genes Bph6 and Bph9 , fertility restorer genes Rf3, Rf4, Rf5 , and Rf6 through molecular marker assisted selection. Resistance analysis revealed that the newly developed restorer lines showed stronger BPH-resistance than any of the single-gene donor parent Luoyang-6 and Luoyang-9. Moreover, the three new restorer lines had broad spectrum recovery capabilities for Honglian CMS, Wild abortive CMS and two-line GMS sterile lines, and higher grain yields than that of the recurrent parent 9,311 under nature field conditions. Importantly, the hybrid crosses also showed good performance for grain yield and BPH-resistance. Thus, the development of elite BPH-resistant wide-spectrum restorer lines has a promising future for breeding of broad spectrum BPH-resistant high-yield varieties.
Cluster Analysis of Maize Inbred Lines
Directory of Open Access Journals (Sweden)
Jiban Shrestha
2016-12-01
Full Text Available The determination of diversity among inbred lines is important for heterosis breeding. Sixty maize inbred lines were evaluated for their eight agro morphological traits during winter season of 2011 to analyze their genetic diversity. Clustering was done by average linkage method. The inbred lines were grouped into six clusters. Inbred lines grouped into Clusters II had taller plants with maximum number of leaves. The cluster III was characterized with shorter plants with minimum number of leaves. The inbred lines categorized into cluster V had early flowering whereas the group into cluster VI had late flowering time. The inbred lines grouped into the cluster III were characterized by higher value of anthesis silking interval (ASI and those of cluster VI had lower value of ASI. These results showed that the inbred lines having widely divergent clusters can be utilized in hybrid breeding programme.
Korch, Christopher; Hall, Erin M.; Dirks, Wilhelm G.; Ewing, Margaret; Faries, Mark; Varella‐Garcia, Marileila; Robinson, Steven; Storts, Douglas; Turner, Jacqueline A.; Wang, Ying; Burnett, Edward C.; Healy, Lyn; Kniss, Douglas; Neve, Richard M.; Nims, Raymond W.; Reid, Yvonne A.; Robinson, William A.
2017-01-01
A variety of analytical approaches have indicated that melanoma cell line UCLA‐SO‐M14 (M14) and breast carcinoma cell line MDA‐MB‐435 originate from a common donor. This indicates that at some point in the past, one of these cell lines became misidentified, meaning that it ceased to correspond to the reported donor and instead became falsely identified (through cross‐contamination or other means) as a cell line from a different donor. Initial studies concluded that MDA‐MB‐435 was the misidentified cell line and M14 was the authentic cell line, although contradictory evidence has been published, resulting in further confusion. To address this question, we obtained early samples of the melanoma cell line (M14), a lymphoblastoid cell line from the same donor (ML14), and donor serum preserved at the originator's institution. M14 samples were cryopreserved in December 1975, before MDA‐MB‐435 cells were established in culture. Through a series of molecular characterizations, including short tandem repeat (STR) profiling and cytogenetic analysis, we demonstrated that later samples of M14 and MDA‐MB‐435 correspond to samples of M14 frozen in 1975, to the lymphoblastoid cell line ML14, and to the melanoma donor's STR profile, sex and blood type. This work demonstrates conclusively that M14 is the authentic cell line and MDA‐MB‐435 is misidentified. With clear provenance information and authentication testing of early samples, it is possible to resolve debates regarding the origins of problematic cell lines that are widely used in cancer research. PMID:28940260
Line lessons: Enbridge's Northern Line provides valuable information
Energy Technology Data Exchange (ETDEWEB)
Ross, E.
2000-02-01
Experiences gained from the 14-year old Norman Wells crude oil pipeline in the Northwest Territories may provide operators with valuable insights in natural gas pipeline developments in northern Canada. The Norman Wells line is the first and only long-distance pipeline in North America buried in permafrost and has proven to be a veritable laboratory on pipeline behaviour in extremely cold climates which also happen to be discontinuous at the same time. The line was built by Enbridge with a 'limit state' design, i e. it was built to move within the permafrost within certain limits, the amount of movement depending upon the area in which the line was built. This technology, which is still cutting edge, allows the pipeline to react to the freeze-thaw cycle without being affected by the heaving and resettling. The knowledge gained from the Norman Wells Line has come in very useful in the more recent AltaGas Services project transporting natural gas from a nearby well into the the town of Inuvik. Enbridge also contributed to the development of various pipeline inspection tools such as the 'Geopig' which travels within the pipeline and can pinpoint the location of problems practically within a matter of inches, and the 'Rolligon' an amphibious vehicle with five-foot diameter rubber tires that displaces only two pounds per square inch, leaving barely a track as it travels along the right-of-way during times other than winter.
International Nuclear Information System (INIS)
Faires, L.M.; Palmer, B.A.; Brault, J.W.
1984-01-01
High resolution Fourier transform spectrometry has been used to perform line width and line shape analysis of eighty-one iron I emision lines in the spectral range 290 to 390nm originating in the normal analytical zone of an inductively coupled plasma. Computer programs using non-linear least squares fitting techniques for line shape analysis were applied to the fully resolved spectra to determine Gaussian and Lorentzian components of the total observed line width. The effect of noise in the spectrum on the precision of the line fitting technique was assessed, and the importance of signal to noise ratio for line shape analysis is discussed. Translational (Doppler) temperatures were calculated from the Gaussian components of the line width and were found to be on the order of 6300 0 K. The excitation temperature of iron I was also determined from the same spectral data by the spectroscopic slope method based on the Einstein-Boltzmann expression for spectral intensity and was found to be on the order of 4700 0 K. 31 references
Environmental assessment -- Proposed neutrino beams at the Main Injector project
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-12-01
The US Department of Energy (DOE) proposes to build a beamline on the Fermi National Accelerator Laboratory (Fermilab) site to accommodate an experimental research program in neutrino physics. The proposed action, called Neutrino Beams at the Main Injector (NuMI), is to design, construct, operate and decommission a facility for producing and studying a high flux beam of neutrinos in the energy range of 1 to 40 GeV (1 GeV is one billion or 10{sup 9} electron volts). The proposed facility would initially be dedicated to two experiments, COSMOS (Cosmologically Significant Mass Oscillations) and MINOS (Main Injector Neutrino Oscillation Search). The neutrino beam would pass underground from Fermilab to northern Minnesota. A tunnel would not be built in this intervening region because the neutrinos easily pass through the earth, not interacting, similar to the way that light passes through a pane of glass. The beam is pointed towards the MINOS detector in the Soudan Underground Laboratory in Minnesota. Thus, the proposed project also includes construction, operation and decommissioning of the facility located in the Soudan Underground Laboratory in Minnesota that houses this MINOS detector. This environmental assessment (EA) has been prepared by the US Department of Energy (DOE) in accordance with the DOE`s National Environmental Policy Act (NEPA) Implementing Procedures (10 CFR 1021). This EA documents DOE`s evaluation of potential environmental impacts associated with the proposed construction and operation of NuMI at Fermilab and its far detector facility located in the Soudan Underground Laboratory in Minnesota. Any future use of the facilities on the Fermilab site would require the administrative approval of the Director of Fermilab and would undergo a separate NEPA review. Fermilab is a Federal high-energy physics research laboratory in Batavia, Illinois operated on behalf of the DOE by Universities Research Association, Inc.
Environmental assessment -- Proposed neutrino beams at the Main Injector project
International Nuclear Information System (INIS)
1997-12-01
The US Department of Energy (DOE) proposes to build a beamline on the Fermi National Accelerator Laboratory (Fermilab) site to accommodate an experimental research program in neutrino physics. The proposed action, called Neutrino Beams at the Main Injector (NuMI), is to design, construct, operate and decommission a facility for producing and studying a high flux beam of neutrinos in the energy range of 1 to 40 GeV (1 GeV is one billion or 10 9 electron volts). The proposed facility would initially be dedicated to two experiments, COSMOS (Cosmologically Significant Mass Oscillations) and MINOS (Main Injector Neutrino Oscillation Search). The neutrino beam would pass underground from Fermilab to northern Minnesota. A tunnel would not be built in this intervening region because the neutrinos easily pass through the earth, not interacting, similar to the way that light passes through a pane of glass. The beam is pointed towards the MINOS detector in the Soudan Underground Laboratory in Minnesota. Thus, the proposed project also includes construction, operation and decommissioning of the facility located in the Soudan Underground Laboratory in Minnesota that houses this MINOS detector. This environmental assessment (EA) has been prepared by the US Department of Energy (DOE) in accordance with the DOE's National Environmental Policy Act (NEPA) Implementing Procedures (10 CFR 1021). This EA documents DOE's evaluation of potential environmental impacts associated with the proposed construction and operation of NuMI at Fermilab and its far detector facility located in the Soudan Underground Laboratory in Minnesota. Any future use of the facilities on the Fermilab site would require the administrative approval of the Director of Fermilab and would undergo a separate NEPA review. Fermilab is a Federal high-energy physics research laboratory in Batavia, Illinois operated on behalf of the DOE by Universities Research Association, Inc
Nuclear gamma ray lines from supernovae
International Nuclear Information System (INIS)
Jardim, J.O.D.
1980-01-01
From theoretical considerations of the behaviour of gamma ray line fluxes occurring after a supernova explosion, the 1.156 and 0.847 MeV lines are seen to be the most likely to be observed. The 1.156 MeV line has been previously observed by other investigators. Observations of the 0.847 MeV line, and 1.332, 1.173 and 0.059 MeV lines using a Ge(Li) telescope aboard a stratospheric balloon which was flown in Brazil in 1977 are reported. The observation using a NaI(Tl) detector of a line in the energy interval 1.5 - 1.6 MeV, which may be due to 0 18 (p,p') 0 18 sup (*) reaction is also reported. (Author) [pt
Line profile variations in selected Seyfert galaxies
International Nuclear Information System (INIS)
Kollatschny, W; Zetzl, M; Ulbrich, K
2010-01-01
Continua as well as the broad emission lines in Seyfert 1 galaxies vary in different galaxies with different amplitudes on typical timescales of days to years. We present the results of two independent variability campaigns taken with the Hobby-Eberly Telescope. We studied in detail the integrated line and continuum variations in the optical spectra of the narrow-line Seyfert galaxy Mrk 110 and the very broad-line Seyfert galaxy Mrk 926. The broad-line emitting region in Mrk 110 has radii of four to 33 light-days as a function of the ionization degree of the emission lines. The line-profile variations are matched by Keplerian disk models with some accretion disk wind. The broad-line region in Mrk 926 is very small showing an extension of two to three light-days only. We could detect a structure in the rms line-profiles as well as in the response of the line profile segments of Mrk 926 indicating the BLR is structured.
A Gene in the Process of Endosymbiotic Transfer
Czech Academy of Sciences Publication Activity Database
Jiroutová, Kateřina; Kořený, Luděk; Bowler, Ch.; Oborník, Miroslav
2010-01-01
Roč. 5, č. 10 (2010), e13234 E-ISSN 1932-6203 R&D Projects: GA AV ČR IAA601410907 Institutional research plan: CEZ:AV0Z60220518 Keywords : MINO-ACID REPLACEMENT * DIATOM THALASSIOSIRA-PSEUDONANA * PHAEODACTYLUM-TRICORNUTUM * PHOTOSYSTEM-II * NUCLEOTIDE-SEQUENCE Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.411, year: 2010
Corporate Governance Country Assessment : Malaysia
World Bank
2012-01-01
This report assesses Ghana s corporate governance policy framework. It highlights recent improvements in corporate governance regulation, makes policy recommendations, and provides investors with a benchmark against which to measure corporate governance in Ghana. It is an update of the 2005 Corporate Governance ROSC. Good corporate governance enhances investor trust, helps to protects mino...
Second-Line Therapy for Advanced NSCLC.
Weiss, Jared M; Stinchcombe, Thomas E
2013-01-01
Most patients with lung cancer have non-small cell lung cancer (NSCLC) subtype and have advanced disease at the time of diagnosis. Improvements in both first-line and subsequent therapies are allowing longer survival and enhanced quality of life for these patients. The median overall survival observed in many second-line trials is approximately 9 months, and many patients receive further therapy after second-line therapy. The cytotoxic agents pemetrexed and docetaxel and the epidermal growth factor receptor (EGFR) tyrosine kinase inhibitors (TKIs) erlotinib and gefitinib are standard second-line therapies. For patients with EGFR mutation, a TKI is the favored second-line therapy if not already used in first-line therapy. For patients without the EGFR mutation, TKIs are an option, but many oncologists favor cytotoxic therapy. The inhibitor of the EML4/ALK fusion protein, crizotinib, has recently become a standard second-line treatment for patients with the gene rearrangement and has promise for patients with the ROS1 rearrangement.
PIXE analysis of U and Pu from hot particles: K-lines vs L-lines
DEFF Research Database (Denmark)
Jiménez-Ramos, M.C.; García López, J.; Eriksson, M.
2012-01-01
. (2007) [1] and Jiménez-Ramos et al. (2010) [2], radioactive particles from aircraft accidents in Palomares and Thule have been characterized. Using micro-Proton Induced X-ray Emission (μ-PIXE) and confocal X-ray fluorescence microprobe (μ-XRF), the L-lines of the main components in these particles, U......-lines present not overlapping between the main peaks in the spectra and the X-ray absorption in the sample is much lower than for L-lines....
Transmission Line Security Monitor: Final Report
Energy Technology Data Exchange (ETDEWEB)
John Svoboda
2011-04-01
The Electric Power Transmission Line Security Monitor System Operational Test is a project funded by the Technical Support Working Group (TSWG). TSWG operates under the Combating Terrorism Technical Support Office that functions under the Department of Defense. The Transmission Line Security Monitor System is based on technology developed by Idaho National Laboratory. The technology provides a means for real-time monitoring of physical threats and/or damage to electrical transmission line towers and conductors as well as providing operational parameters to transmission line operators to optimize transmission line operation. The end use is for monitoring long stretches of transmission lines that deliver electrical power from remote generating stations to cities and industry. These transmission lines are generally located in remote transmission line corridors where security infrastructure may not exist. Security and operational sensors in the sensor platform on the conductors take power from the transmission line and relay security and operational information to operations personnel hundreds of miles away without relying on existing infrastructure. Initiated on May 25, 2007, this project resulted in pre-production units tested in realistic operational environments during 2010. A technology licensee, Lindsey Manufacturing of Azusa California, is assisting in design, testing, and ultimately production. The platform was originally designed for a security monitoring mission, but it has been enhanced to include important operational features desired by electrical utilities.
CAPTAIN-Miner@@a. Neutrino-Argon Scattering in a Medium-Energy Neutrino Beam
International Nuclear Information System (INIS)
Mauger, Christopher M.
2015-01-01
The NuMI facility at Fermilab is currently providing an extremely intense beam of neutrinos for the NO@@A, MINER@@A and MINOS+ experiments. By installing the 5-ton CAPTAIN liquid argon TPC in front of the MINER@@A detector in the NuMI beamline and combining the data from the CAPTAIN, MINER@@A and MINOS+ detectors, a broad program of few-GeV neutrino cross section measurements on argon can be pursued. These measurements will be extremely helpful for future oscillation experiments. By directly comparing the cross sections on argon to MINER@@A@@@s scintillator (CH) target, a new level of precision can be achieved in the measurements of the effects of the nucleus on neutrino interactions. These effects are of interest to not only the particle physics but also the nuclear physics community. This document describes in detail the physics goals of the CAPTAIN-MINER@@A experiment, in addition to a first estimate of the technical resources required to install, commission and operate the CAPTAIN detector in front of the MINERVA detector.
Kopp, Joachim; Welter, Johannes
2014-12-01
Sterile neutrino models with new gauge interactions in the sterile sector are phenomenologically interesting since they can lead to novel effects in neutrino oscillation experiments, in cosmology and in dark matter detectors, possibly even explaining some of the observed anomalies in these experiments. Here, we use data from neutrino oscillation experiments, in particular from MiniBooNE, MINOS and solar neutrino experiments, to constrain such models. We focus in particular on the case where the sterile sector gauge boson A ' couples also to Standard Model particles (for instance to the baryon number current) and thus induces a large Mikheyev-Smirnov-Wolfenstein potential. For eV-scale sterile neutrinos, we obtain strong constraints especially from MINOS, which restricts the strength of the new interaction to be less than ˜ 10 times that of the Standard Model weak interaction unless active-sterile neutrino mixing is very small (sin2 θ 24 ≲ 10-3). This rules out gauge forces large enough to affect short-baseline experiments like MiniBooNE and it imposes nontrivial constraints on signals from sterile neutrino scattering in dark matter experiments.
CAPTAIN-Minerνa. Neutrino-Argon Scattering in a Medium-Energy Neutrino Beam
Energy Technology Data Exchange (ETDEWEB)
Mauger, Christopher M. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2015-10-29
The NuMI facility at Fermilab is currently providing an extremely intense beam of neutrinos for the NOνA, MINERνA and MINOS+ experiments. By installing the 5-ton CAPTAIN liquid argon TPC in front of the MINERνA detector in the NuMI beamline and combining the data from the CAPTAIN, MINERνA and MINOS+ detectors, a broad program of few-GeV neutrino cross section measurements on argon can be pursued. These measurements will be extremely helpful for future oscillation experiments. By directly comparing the cross sections on argon to MINERνA’s scintillator (CH) target, a new level of precision can be achieved in the measurements of the effects of the nucleus on neutrino interactions. These effects are of interest to not only the particle physics but also the nuclear physics community. This document describes in detail the physics goals of the CAPTAIN-MINERνA experiment, in addition to a first estimate of the technical resources required to install, commission and operate the CAPTAIN detector in front of the MINERVA detector.
Comparison of open-source linear programming solvers.
Energy Technology Data Exchange (ETDEWEB)
Gearhart, Jared Lee; Adair, Kristin Lynn; Durfee, Justin David.; Jones, Katherine A.; Martin, Nathaniel; Detry, Richard Joseph
2013-10-01
When developing linear programming models, issues such as budget limitations, customer requirements, or licensing may preclude the use of commercial linear programming solvers. In such cases, one option is to use an open-source linear programming solver. A survey of linear programming tools was conducted to identify potential open-source solvers. From this survey, four open-source solvers were tested using a collection of linear programming test problems and the results were compared to IBM ILOG CPLEX Optimizer (CPLEX) [1], an industry standard. The solvers considered were: COIN-OR Linear Programming (CLP) [2], [3], GNU Linear Programming Kit (GLPK) [4], lp_solve [5] and Modular In-core Nonlinear Optimization System (MINOS) [6]. As no open-source solver outperforms CPLEX, this study demonstrates the power of commercial linear programming software. CLP was found to be the top performing open-source solver considered in terms of capability and speed. GLPK also performed well but cannot match the speed of CLP or CPLEX. lp_solve and MINOS were considerably slower and encountered issues when solving several test problems.
DEFF Research Database (Denmark)
Sørensen, Thomas Kjærsgaard; Holbøll, Joachim
2008-01-01
with the Technical University of Denmark, on how to lessen the visual impact of 400 kV overhead line transmission systems. In this paper omission of shield wires combined with installation of a suitable number of line surge arresters is investigated as a possible alternative to transmission lines equipped...... with shielding wires thereby reducing tower height, allowing more compact designs of towers thus minimizing the visual environment impact of the lines. Omission of shield wires in the system and instead utilizing a larger number of surge arresters in the (upper) phases of an overhead line without reduction...... will be investigated by transient simulations on a 400 kV line with either shield wires or line surge arresters. These simulations will also be used to estimate number and location of the line surge arresters in the line to ensure a satisfactory performance of the line when omitting shield wires in the tower top...
Transmission of radioiodine through sampling lines
International Nuclear Information System (INIS)
Unrein, P.J.; Pelletier, C.A.; Cline, J.E.; Voilleque, P.G.
1985-01-01
An experimental program to measure radioiodine transmission through sampling lines is described. The transmission depends upon both deposition on and resuspension from the walls of the line. The deposition and resuspension processes are themselves controlled by the length, diameter, and material of the line and the conditions under which it is operated. The operating conditions under study are sampling flow rate, temperature and relative humidity. Measurement results have been interpreted in terms of a four-compartment model of radioiodine deposition and resuspension. The model is applied to each of twenty or more segments of the line. Experimental measurements of short-term transmission fractions and the deposition velocities derived from them are presented for six lines. Data on resuspension rates for the same lines were obtained and are also discussed
DETECTION OF REST-FRAME OPTICAL LINES FROM X-SHOOTER SPECTROSCOPY OF WEAK EMISSION-LINE QUASARS
International Nuclear Information System (INIS)
Plotkin, Richard M.; Gallo, Elena; Shemmer, Ohad; Trakhtenbrot, Benny; Anderson, Scott F.; Brandt, W. N.; Luo, Bin; Schneider, Donald P.; Fan, Xiaohui; Lira, Paulina; Richards, Gordon T.; Strauss, Michael A.; Wu, Jianfeng
2015-01-01
Over the past 15 yr, examples of exotic radio-quiet quasars with intrinsically weak or absent broad emission line regions (BELRs) have emerged from large-scale spectroscopic sky surveys. Here, we present spectroscopy of seven such weak emission line quasars (WLQs) at moderate redshifts (z = 1.4–1.7) using the X-shooter spectrograph, which provides simultaneous optical and near-infrared spectroscopy covering the rest-frame ultraviolet (UV) through optical. These new observations effectively double the number of WLQs with spectroscopy in the optical rest-frame, and they allow us to compare the strengths of (weak) high-ionization emission lines (e.g., C iv) to low-ionization lines (e.g., Mg ii, Hβ, Hα) in individual objects. We detect broad Hβ and Hα emission in all objects, and these lines are generally toward the weaker end of the distribution expected for typical quasars (e.g., Hβ has rest-frame equivalent widths ranging from 15–40 Å). However, these low-ionization lines are not exceptionally weak, as is the case for high-ionization lines in WLQs. The X-shooter spectra also display relatively strong optical Fe ii emission, Hβ FWHM ≲ 4000 km s −1 , and significant C iv blueshifts (≈1000–5500 km s −1 ) relative to the systemic redshift; two spectra also show elevated UV Fe ii emission, and an outflowing component to their (weak) Mg ii emission lines. These properties suggest that WLQs are exotic versions of “wind-dominated” quasars. Their BELRs either have unusual high-ionization components, or their BELRs are in an atypical photoionization state because of an unusually soft continuum
Spectral Line Shapes. Proceedings
International Nuclear Information System (INIS)
Zoppi, M.; Ulivi, L.
1997-01-01
These proceedings represent papers presented at the 13th International Conference on Spectral Line Shapes which was held in Firenze,Italy from June 16-21, 1996. The topics covered a wide range of subjects emphasizing the physical processes associated with the formation of line profiles: high and low density plasma; atoms and molecules in strong laser fields, Dopple-free and ultra-fine spectroscopy; the line shapes generated by the interaction of neutrals, atoms and molecules, where the relavant quantities are single particle properties, and the interaction-induced spectroscopy. There were 131 papers presented at the conference, out of these, 6 have been abstracted for the Energy Science and Technology database
Binette, L.; Ortiz, P.; Joguet, B.; Rola, C.
1998-11-01
A widely accessible data bank (available through Netscape) and consiting of all (or most) of the emission lines reported in the litterature is being built. It will comprise objects as diverse as HII regions, PN, AGN, HHO. One of its use will be to define/refine existing diagnostic emission line diagrams.
Directory of Open Access Journals (Sweden)
Weizi Liang
Full Text Available Human long interspersed elements 1 (LINE-1 or L1 is the only autonomous non-LTR retroelement in humans and has been associated with genome instability, inherited genetic diseases, and the development of cancer. Certain human APOBEC3 family proteins are known to have LINE-1 restriction activity. The mechanisms by which APOBEC3 affects LINE-1 retrotransposition are not all well characterized; here, we confirm that both A3B and A3DE have a strong ability to inhibit LINE-1 retrotransposition. A3DE interacts with LINE-1 ORF1p to target LINE-1 ribonucleoprotein particles in an RNA-dependent manner. Moreover, A3DE binds to LINE-1 RNA and ORF1 protein in cell culture system. Fluorescence microscopy demonstrated that A3DE co-localizes with ORF1p in cytoplasm. Furthermore, A3DE inhibits LINE-1 reverse transcriptase activity in LINE-1 ribonucleoprotein particles in a cytidine deaminase-independent manner. In contrast, A3B has less inhibitory effects on LINE-1 reverse transcriptase activity despite its strong inhibition of LINE-1 retrotransposition. This study demonstrates that different A3 proteins have been evolved to inhibit LINE-1 activity through distinct mechanisms.
Building Bridges One Line at a Time
Grigsby, Cathy Murray
2012-01-01
In this article, first-grade students were taught the different kinds of lines that were part of the construction of various bridges--the curved lines of the arches of stone bridges, straight lines connecting the cables of a suspension bridge, vertical lines, horizontal lines, and so on. They gained practice in drawing structures and in fine brush…
DEFF Research Database (Denmark)
Dinesen, Cort Ross
2011-01-01
Embarking on a work of art constitutes a reduction of information – because we grasp the diversity and plurality of the manifestations we encounter by abstracting them and transforming them into manageable concepts; as we do when we draw contour lines on the landscape – they are imaginary...... and invisible but an abstraction essential for noting a difference or marking a place on a map. In the same way, a stroke in a sketch or a line in the sand is a manifestation of our ability to draw a boundary that both includes and excludes information. Where the line makes the birth of an idea visible......, it expresses through movement our tendency to mark a difference by drawing attention to and enclosing a whole series of relations that confront our preconceived notions. It is in the process of transformation in which we reduce the complexity of how we work, and rethink our ideas anew by refining the very same...
Program of telluric lines monitoring
Directory of Open Access Journals (Sweden)
Vince I.
2006-01-01
Full Text Available A new observational program of telluric lines monitoring was introduced at Belgrade Astronomical Observatory. The ultimate goal of this program is to investigate the properties of Earth’s atmosphere through modeling the observed profiles of telluric lines. The program is intend to observe infrared molecular oxygen lines that were selected according to spectral sensitivity of the available CCD camera. In this paper we give the initial and the final selection criteria for spectral lines included in the program the description of equipment and procedures used for observations and reduction, a review of preliminary observational results with the estimated precision, and a short discussion on the comparison of the theoretical predictions and the measurements.
[The smile line, a literature search].
van der Geld, P A; van Waas, M A
2003-09-01
Beautiful teeth, visible when smiling, are in line with the present ideal of beauty. The display of teeth when smiling is determined by the smile line: the projection of the lower border of the upper lip on the maxillary teeth when smiling. On the basis of a literature search the determining methods of the smile line are discussed, demographic data of the position of the smile line are given, and factors of influence are examined. There is no unequivocal method for determining the position of the smile line. A rough distinction can be made between qualitative and (semi)-quantitative methods. The (semi)-quantitative methods have clear advantages for research purposes, but their reliability is unknown. It was demonstrated that among minimally 40% of subjects the maxillary gingiva was not visible when smiling. The mandibular gingiva was not visible when smiling among more than 90% of subjects. Furthermore, it appeared that among women the smile line was on average higher situated than among men and that it has not yet been proven that the smile line will be situated lower when growing older.
A specialized bioengineering ion beam line
International Nuclear Information System (INIS)
Yu, L.D.; Sangyuenyongpipat, S.; Sriprom, C.; Thongleurm, C.; Suwanksum, R.; Tondee, N.; Prakrajang, K.; Vilaithong, T.; Brown, I.G.; Wiedemann, H.
2007-01-01
A specialized bioengineering ion beam line has recently been completed at Chiang Mai University to meet rapidly growing needs of research and application development in low-energy ion beam biotechnology. This beam line possesses special features: vertical main beam line, low-energy (30 keV) ion beams, double swerve of the beam, a fast pumped target chamber, and an in-situ atomic force microscope (AFM) system chamber. The whole beam line is situated in a bioclean environment, occupying two stories. The quality of the ion beam has been studied. It has proved that this beam line has significantly contributed to our research work on low-energy ion beam biotechnology
Illustrative Line Styles for Flow Visualization
Everts, Maarten H.; Bekker, Hendrik; Roerdink, Jos B. T. M.; Isenberg, Tobias
2011-01-01
We present a flexible illustrative line style model for the visualization of streamline data. Our model partitions view-oriented line strips into parallel bands whose basic visual properties can be controlled independently. We thus extend previous line stylization techniques specifically for
Flow Visualization using Illustrative Line Styles
Everts, Maarten H.; Bekker, Hendrik; Roerdink, Jos B. T. M.; Isenberg, Tobias; Bekker, Paulus
2011-01-01
We present a flexible illustrative line style model for the visualization of streamline data. Our model partitions view- oriented line strips into parallel bands whose basic visual properties can be controlled independently. We thus extend previous line stylization techniques specifically for
Computer-based mechanical design of overhead lines
Rusinaru, D.; Bratu, C.; Dinu, R. C.; Manescu, L. G.
2016-02-01
Beside the performance, the safety level according to the actual standards is a compulsory condition for distribution grids’ operation. Some of the measures leading to improvement of the overhead lines reliability ask for installations’ modernization. The constraints imposed to the new lines components refer to the technical aspects as thermal stress or voltage drop, and look for economic efficiency, too. The mechanical sizing of the overhead lines is after all an optimization problem. More precisely, the task in designing of the overhead line profile is to size poles, cross-arms and stays and locate poles along a line route so that the total costs of the line's structure to be minimized and the technical and safety constraints to be fulfilled.The authors present in this paper an application for the Computer-Based Mechanical Design of the Overhead Lines and the features of the corresponding Visual Basic program, adjusted to the distribution lines. The constraints of the optimization problem are adjusted to the existing weather and loading conditions of Romania. The outputs of the software application for mechanical design of overhead lines are: the list of components chosen for the line: poles, cross-arms, stays; the list of conductor tension and forces for each pole, cross-arm and stay for different weather conditions; the line profile drawings.The main features of the mechanical overhead lines design software are interactivity, local optimization function and high-level user-interface
Veterans Crisis Line: 1-800-273-8255
Veterans Crisis Line Skip to Main Content SuicidePreventionLifeline.org Get Help Materials Get Involved Crisis Centers About Be There ... Line FAQs Veteran Suicide Welcome to the Veterans Crisis Line Website The Veterans Crisis Line connects Veterans ...
Reddening and He i{sup ∗} λ 10830 Absorption Lines in Three Narrow-line Seyfert 1 Galaxies
Energy Technology Data Exchange (ETDEWEB)
Zhang, Shaohua; Zhou, Hongyan; Shi, Xiheng; Pan, Xiang; Ji, Tuo; Jiang, Peng; Wang, Shufen [Polar Research Institute of China, 451 Jinqiao Road, Shanghai, 200136 (China); Liu, Wenjuan [Key Laboratory for the Structure and Evolution of Celestial Objects, Yunnan Observatories, Chinese Academy of Sciences, Kunming, Yunnan 650011 (China); Jiang, Ning, E-mail: zhangshaohua@pric.org.cn, E-mail: zhouhongyan@pric.org.cn [Key Laboratory for Researches in Galaxies and Cosmology, Department of Astronomy, University of Sciences and Technology of China, Chinese Academy of Sciences, Hefei, Anhui, 230026 (China)
2017-08-20
We report the detection of heavy reddening and the He i* λ 10830 absorption lines at the active galactic nucleus (AGN) redshift in three narrow-line Seyfert 1 galaxies: SDSS J091848.61+211717.0, SDSS J111354.66+124439.0, and SDSS J122749.13+321458.9. They exhibit very red optical to near-infrared colors, narrow Balmer/Paschen broad emission lines and He i* λ 10830 absorption lines. The ultraviolet-optical-infrared nucleus continua are reddened by the SMC extinction law of E ( B − V ) ∼ 0.74, 1.17, and 1.24 mag for three objects, which are highly consistent with the values obtained from the broad-line Balmer decrements, but larger than those of narrow emission lines. The reddening analysis suggests that the extinction dust simultaneously obscures the accretion disk, the broad emission-line region, and the hot dust from the inner edge of the torus. It is possible that the dust obscuring the AGN structures is the dusty torus itself. Furthermore, the Cloudy analysis of the He i* λ 10830 absorption lines proposes the distance of the absorption materials to be the extend scale of the torus, which greatly increases probabilities of the obscure and absorption materials being the dusty torus.
Magnetic pulse sharpener and delay-line
International Nuclear Information System (INIS)
Li Jin; Dai Guangsen; Xia Liansheng
2002-01-01
This paper describes a method to achieve short rise time pulse which has been delayed with a delay-line and magnetic pulse sharpener. A delay-line and two shock-lines are designed to carry pulsed signal with a maximum voltage magnitude up to 80 kV. A pulse of High voltage with arise time of 48 ns at a level of 0.1%-0.9% were achieved, and the attenuation in the line is very small
Research on Line Patrol Strategy of 110kV Transmission Line after Lightning Strike
Directory of Open Access Journals (Sweden)
Li Mingjun
2016-01-01
Full Text Available Lightning faults occupy in the majority of instantaneous fault and reclosing can usually be successful, so power supply can be restored without immediate patrol in many cases. Firstly, this paper introduces the lightning fault positioning and identifying method. Then test electrical performance of insulators after lightning strike from 110kV lines. Data shows that lightning strike has little effect on the electric performance of insulator. Finally, illustrating disposal process of the 110 kV transmission line after lightning fault, certifying that the power supply reliability be ensured without line patrol.
Infrared line intensities of chlorine monoxide
Kostiuk, T.; Faris, J. L.; Mumma, M. J.; Deming, D.; Hillman, J. J.
1986-01-01
Absolute infrared line intensities of several ClO lines in the rotational-vibrational (1-0) band were measured using infrared heterodyne spectroscopy near 12 microns. A measurement technique using combined ultraviolet absorption and infrared line measurements near 9.5 microns and 12 microns permitted an accurate determination of the column densities of O3 and ClO in the absorption cell and thus improved ClO line intensities. Results indicate ClO line and band intensities approximately 2.4 times lower than previous experimental results. Effects of possible failure of local thermodynamic equilibrium conditions in the absorption cell and the implication of the results for stratospheric ClO measurements in the infrared are discussed.
Plasma line observations in the auroral oval
International Nuclear Information System (INIS)
Valladares, C.E.; Kelley, M.C.; Vickrey, J.F.
1988-01-01
We report here a series of experiments conducted at the Sondre Stromfjord incoherent scatter radar, aimed at detected enhanced plasma lines associated with midnight sector auroral arcs. Using different receivers, we detected both ion and plasma lines simultaneously. The plasma line signal was recorded with the use of a filter bank of eight frequencies. Plasma lines were found to originate mainly from the topside of the particle-produced E layer. The enhanced plasma lines are sometimes a factor of 100 times larger than the thermal level. Our data show a rapid decay of the plasma lines, however. In some cases, only a 30-s integration time was needed in order to unambiguously detect both upshifted and downshifted lines. The level of the plasma lines reaches values of, for the larger cases, up to 40 0 K above the noise temperature. These are considerably higher than results from prior auroral zone plasma line experiments. In situ observations of enhanced plasma waves in this same region are reported in a companion paper. copyright American Geophysical Union 1988
Asymmetries of the solar Ca II lines
International Nuclear Information System (INIS)
Heasley, J.N.
1975-01-01
A theoretical study of the influence of propagating acoustic pulses in the solar chromosphere upon the line profiles of the Ca II resonance and infrared triplet lines has been made. The major objective has been to explain the observed asymmetries seen in the cores of the H and K lines and to predict the temporal behavior of the infrared lines caused by passing acoustic or shock pulses. The velocities in the pulses, calculated from weak shock theory, have been included consistently in the non-LTE calculations. The results of the calculations show that these lines are very sensitive to perturbations in the background atmosphere caused by the pulses. Only minor changes in the line shapes result from including the velocities consistently in the line source function calculations. The qualitative changes in the line profiles vary markedly with the strength of the shock pulses. The observed differences in the K line profiles seen on the quiet Sun can be explained in terms of a spectrum of pulses with different wavelengths and initial amplitudes in the photosphere. (Auth.)
Simultaneous influence of Stark effect and excessive line broadening on the Hα line
Cvetanović, Nikola; Ivković, Saša S.; Obradović, Bratislav M.; Kuraica, Milorad M.
2017-12-01
The aim of this paper is to study the combined influence of the Stark effect and the excessive Doppler broadening on the Balmer alpha line in hydrogen discharges. Since this line is a good candidate for measuring electric field in various types of discharges with different gas compositions, a simple method for field measurement based on polarization spectroscopy is developed, that includes all the excitation mechanisms. To simultaneously test the flexibility of the fitting procedure and investigate the excessive broadening, we applied the fitting procedure on line profiles obtained at a range of conditions from two different discharges. The range of pressures and voltages was examined in an abnormal glow and in dielectric barrier discharge operating with hydrogen gas. The model fitting function was able to respond and follow the change in the line profile caused by the change of conditions. This procedure can therefore be recommended for electric field measurement. Contribution to the "Topical Issue: Physics of Ionized Gases (SPIG 2016)", edited by Goran Poparic, Bratislav Obradovic, Dragana Maric and Aleksandar Milosavljevic.
Eccentric vision : adverse interactions between line segments
Andriessen, J.J.; Bouma, H.
1976-01-01
The paper deals with adverse interactions between line stimuli ineccentric vision. Bothcontrast thresholdandjust noticeable difference of slanthave been measured for a test line as a function of the distance from a number of surrounding lines. Test lines were either parallel or perpendicular to the
Polarization of Coronal Forbidden Lines
Energy Technology Data Exchange (ETDEWEB)
Li, Hao; Qu, Zhongquan [Yunnan Observatories, Chinese Academy of Sciences, Kunming, Yunnan 650011 (China); Landi Degl’Innocenti, Egidio, E-mail: sayahoro@ynao.ac.cn [Dipartimento di Astronomia e Scienza dello Spazio, Università di Firenze, Largo E. Fermi 2, I-50125 Firenze (Italy)
2017-03-20
Since the magnetic field is responsible for most manifestations of solar activity, one of the most challenging problems in solar physics is the diagnostics of solar magnetic fields, particularly in the outer atmosphere. To this end, it is important to develop rigorous diagnostic tools to interpret polarimetric observations in suitable spectral lines. This paper is devoted to analyzing the diagnostic content of linear polarization imaging observations in coronal forbidden lines. Although this technique is restricted to off-limb observations, it represents a significant tool to diagnose the magnetic field structure in the solar corona, where the magnetic field is intrinsically weak and still poorly known. We adopt the quantum theory of polarized line formation developed in the framework of the density matrix formalism, and synthesize images of the emergent linear polarization signal in coronal forbidden lines using potential-field source-surface magnetic field models. The influence of electronic collisions, active regions, and Thomson scattering on the linear polarization of coronal forbidden lines is also examined. It is found that active regions and Thomson scattering are capable of conspicuously influencing the orientation of the linear polarization. These effects have to be carefully taken into account to increase the accuracy of the field diagnostics. We also found that linear polarization observation in suitable lines can give valuable information on the long-term evolution of the magnetic field in the solar corona.
service line analytics in the new era.
Spence, Jay; Seargeant, Dan
2015-08-01
To succeed under the value-based business model, hospitals and health systems require effective service line analytics that combine inpatient and outpatient data and that incorporate quality metrics for evaluating clinical operations. When developing a framework for collection, analysis, and dissemination of service line data, healthcare organizations should focus on five key aspects of effective service line analytics: Updated service line definitions. Ability to analyze and trend service line net patient revenues by payment source. Access to accurate service line cost information across multiple dimensions with drill-through capabilities. Ability to redesign key reports based on changing requirements. Clear assignment of accountability.
Eliminating harmonics in line to line voltage using genetic algorithm using multilevel inverter
Energy Technology Data Exchange (ETDEWEB)
Gunasekaran, R. [Excel College of Engineering and Technology, Komarapalayam (India). Electrical and Electronics Engineering; Karthikeyan, C. [K.S. Rangasamy College of Engineering, Tamil Nadu (India). Electrical and Electronics Engineering
2017-04-15
In this project the total harmonic distortion (THD) minimization of the multilevel inverters output voltage is discussed. The approach in reducing harmonics contents in inverters output voltage is THD elimination. The switching angles are varied with the fundamental frequency so the output THD is minimized. In three phase applications, the line voltage harmonics are of the main concern from the load point of view. Using a genetic algorithm, a THD minimization process is directly applied to the line to line voltage of the inverter. Genetic (GA) algorithm allows the determination of the optimized parameters and consequently an optimal operating point of the circuit and a wide pass band with a unity gain is obtained.
Isoeffect lines using TDF and CRE concepts
International Nuclear Information System (INIS)
Supe, S.J.; Sasane, J.B.; Gupta, M.K.; Supe, D.S.
1979-01-01
In most of the radiotherapy centres the treatment planning is based on isodose lines. Isoeffect lines are also being drawn based on the concepts of TDFs and CREs. A study has been made of whether the isoeffect lines based on the concepts of TDFs, CRes and the physical isodose lines are identical in all the treatment situations. Isoeffects lines for a few treatment schedules involving treatment of carcinoma of the bladder, treatment of cancer of the uterine cervix by combined intracavitary and external beam therapies and intracavitary therapy alone have been obtained and compared. The effect of treatment mode on the isoeffect lines has also been studied. It was found that the isodose curves and the isoeffect lines using the TDF and CRE concepts were not identical in all situations. Therefore, the ultimate treatment plans based on these isoeffect lines will not be exactly the same. The dependence of the isoeffect lines with the variation of the exponents of time and number of fractions used in the empirical relationship for NSD have also been investigated. Clinical trials have been initiated in the case of cancer of the bladder and cervix uterus based on the isodose curves and isoeffect lines using CRE and TDF concepts. (author)
2008 TIGER/Line Nationwide Dataset
California Natural Resource Agency — This dataset contains a nationwide build of the 2008 TIGER/Line datasets from the US Census Bureau downloaded in April 2009. The TIGER/Line Shapefiles are an extract...
Optical Variability of Narrow-line and Broad-line Seyfert 1 Galaxies
Energy Technology Data Exchange (ETDEWEB)
Rakshit, Suvendu; Stalin, C. S., E-mail: suvenduat@gmail.com [Indian Institute of Astrophysics, Block II, Koramangala, Bangalore-560034 (India)
2017-06-20
We studied the optical variability (OV) of a large sample of narrow-line Seyfert 1 (NLSy1) and broad-line Seyfert 1 (BLSy1) galaxies with z < 0.8 to investigate any differences in their OV properties. Using archival optical V -band light curves from the Catalina Real Time Transient Survey that span 5–9 years and modeling them using damped random walk, we estimated the amplitude of variability. We found that NLSy1 galaxies as a class show lower amplitude of variability than their broad-line counterparts. In the sample of both NLSy1 and BLSy1 galaxies, radio-loud sources are found to have higher variability amplitude than radio-quiet sources. Considering only sources that are detected in the X-ray band, NLSy1 galaxies are less optically variable than BLSy1 galaxies. The amplitude of variability in the sample of both NLSy1 and BLSy1 galaxies is found to be anti-correlated with Fe ii strength but correlated with the width of the H β line. The well-known anti-correlation of variability–luminosity and the variability–Eddington ratio is present in our data. Among the radio-loud sample, variability amplitude is found to be correlated with radio-loudness and radio-power, suggesting that jets also play an important role in the OV in radio-loud objects, in addition to the Eddington ratio, which is the main driving factor of OV in radio-quiet sources.
An Asian poverty line? Issues and options
Klasen, Stephan
2016-01-01
Given Asia's record of rapid economic growth and the conceptual and empirical problems of the current international income poverty line ('dollar-a-day'), this paper discusses whether there is merit to develop an Asia-specific poverty line that addresses some of the shortcomings of the dollar-a-day line and additionally considers Asia's particular economic situation. We consider various ways of creating an Asia-specific poverty line, including an Asia-specific international income poverty line...
Schreier, Franz; Gimeno García, Sebastián; Hedelt, Pascal; Hess, Michael; Mendrok, Jana; Vasquez, Mayte; Xu, Jian
2014-04-01
A suite of programs for high resolution infrared-microwave atmospheric radiative transfer modeling has been developed with emphasis on efficient and reliable numerical algorithms and a modular approach appropriate for simulation and/or retrieval in a variety of applications. The Generic Atmospheric Radiation Line-by-line Infrared Code - GARLIC - is suitable for arbitrary observation geometry, instrumental field-of-view, and line shape. The core of GARLIC's subroutines constitutes the basis of forward models used to implement inversion codes to retrieve atmospheric state parameters from limb and nadir sounding instruments. This paper briefly introduces the physical and mathematical basics of GARLIC and its descendants and continues with an in-depth presentation of various implementation aspects: An optimized Voigt function algorithm combined with a two-grid approach is used to accelerate the line-by-line modeling of molecular cross sections; various quadrature methods are implemented to evaluate the Schwarzschild and Beer integrals; and Jacobians, i.e. derivatives with respect to the unknowns of the atmospheric inverse problem, are implemented by means of automatic differentiation. For an assessment of GARLIC's performance, a comparison of the quadrature methods for solution of the path integral is provided. Verification and validation are demonstrated using intercomparisons with other line-by-line codes and comparisons of synthetic spectra with spectra observed on Earth and from Venus.
Carli, Ch; Hemery, J-Y
2002-01-01
The LEIR transfer lines are designed to transport the ion beam from the Linac 3 to LEIR and, after accumulation and acceleration from LEIR to the PS. A part of the transfer line is used for both, injection and extraction. Thus, it is natural to design injection and extraction optics in common. Beside optics constraints, the geometry of the existing machines (Linac 3, LEIR and PS) and transfer tunnels have to be respected. A new proposal for the LEIR transfer lines is presented.
Conceptual design for transmission line inspection robot
International Nuclear Information System (INIS)
Jalal, M F Abdul; Sahari, K S Mohamed; Anuar, A; Arshad, A D Mohd; Idris, M S
2013-01-01
Power transmission line is used for power distribution purposes due to their cost effective measure compared to underlying cable. However, prolonged exposure to natural weather may cause fatigue stress to the lines as well as induce material failure. Therefore, periodical line inspection is considered uttermost important as a preventive measure to avoid power outage. However, transmission line inspection has always been a high risk and expensive work. Hazardous works that may harm operator as well as routine that requires precise handling can be performed by robots. Various types of robots have been designed and developed for line inspection but only perform well on a straight and continuous line. As these robots encounter an obstacle during the inspection, then the real problem in terms of robot stability and smooth operation arises. In this paper, conceptual design and evaluation for transmission line inspection robot is presented. The inspection robot mobile robot must be able to bypass or avoid obstacles as it travels along the power transmission line.
Iron forbidden lines in tokamak discharges
International Nuclear Information System (INIS)
Suckewer, S.; Hinnov, E.
1979-03-01
Several spectrum lines from forbidden transitions in the ground configurations of highly ionized atoms have been observed in the PLT tokamak discharges. Such lines allow localized observations, in the high-temperature regions of the plasma, of ion-temperatures, plasma motions, and spatial distributions of ions. Measured absolute intensities of the forbidden lines have been compared with simultaneous observations of the ion resonance lines and with model calculations in order to deduce the mechanism of level populaions by means of electron collisions and radiative transitions
Iron forbidden lines in tokamak discharges
Energy Technology Data Exchange (ETDEWEB)
Suckewer, S.; Hinnov, E.
1979-03-01
Several spectrum lines from forbidden transitions in the ground configurations of highly ionized atoms have been observed in the PLT tokamak discharges. Such lines allow localized observations, in the high-temperature regions of the plasma, of ion-temperatures, plasma motions, and spatial distributions of ions. Measured absolute intensities of the forbidden lines have been compared with simultaneous observations of the ion resonance lines and with model calculations in order to deduce the mechanism of level populaions by means of electron collisions and radiative transitions.
UV line emission of symbiotic stars
International Nuclear Information System (INIS)
Nussbaumer, H.
1982-01-01
General characteristics of emission line spectra from symbiotic stars are outlined. Data from some special line ratios in the 1000 A - 3000 A range, and others connecting the visual and the far UV lines are presented, and their application to symbiotic stars is discussed. Integrated fractional abundances for ions easily observed in the far UV are given to facilitate abundance determinations for nebular conditions. It is found that the physical conditions of the regions emitting the emission line spectra differ considerably among different symbiotic stars. (Auth.)
Line radiative transfer and statistical equilibrium*
Directory of Open Access Journals (Sweden)
Kamp Inga
2015-01-01
Full Text Available Atomic and molecular line emission from protoplanetary disks contains key information of their detailed physical and chemical structures. To unravel those structures, we need to understand line radiative transfer in dusty media and the statistical equilibrium, especially of molecules. I describe here the basic principles of statistical equilibrium and illustrate them through the two-level atom. In a second part, the fundamentals of line radiative transfer are introduced along with the various broadening mechanisms. I explain general solution methods with their drawbacks and also specific difficulties encountered in solving the line radiative transfer equation in disks (e.g. velocity gradients. I am closing with a few special cases of line emission from disks: Radiative pumping, masers and resonance scattering.
Composite Materials in Overhead Lines
DEFF Research Database (Denmark)
Sørensen, Thomas Kjærsgaard; Holbøll, Joachim
2009-01-01
towers and recently conductors based on composite materials are available at transmission levels. In this paper it is investigated which composite based solutions are available in connection with complete overhead line systems including insulators, towers and conductors. The components are reviewed......The use of composite materials, e.g. fibreglass materials, in overhead transmission line systems is nothing new. Composite based insulators have been applied to transmission lines for over 30 years, mainly as suspension and post insulators and often as an option for special applications. Also...... with respect to solved and persisting known failures/problems of both mechanical and electrical nature. Major challenges related to extensive use of composite materials in an overhead line system are identified, as are possible benefits - both when using standard as well as customised composite components, e...
WEAK LINE QUASARS AT HIGH REDSHIFT: EXTREMELY HIGH ACCRETION RATES OR ANEMIC BROAD-LINE REGIONS?
International Nuclear Information System (INIS)
Shemmer, Ohad; Trakhtenbrot, Benny; Netzer, Hagai; Anderson, Scott F.; Brandt, W. N.; Schneider, Donald P.; Diamond-Stanic, Aleksandar M.; Fan Xiaohui; Lira, Paulina; Plotkin, Richard M.; Richards, Gordon T.; Strauss, Michael A.
2010-01-01
We present Gemini-North K-band spectra of two representative members of the class of high-redshift quasars with exceptionally weak rest-frame ultraviolet emission lines (WLQs), SDSS J114153.34+021924.3 at z = 3.55 and SDSS J123743.08+630144.9 at z = 3.49. In both sources, we detect an unusually weak broad Hβ line and place tight upper limits on the strengths of their [O III] lines. Virial, Hβ-based black hole mass determinations indicate normalized accretion rates of L/L Edd =0.4 for these sources, which is well within the range observed for typical quasars with similar luminosities and redshifts. We also present high-quality XMM-Newton imaging spectroscopy of SDSS J114153.34+021924.3 and find a hard-X-ray photon index of Γ = 1.91 +0.24 -0.22 , which supports the virial L/L Edd determination in this source. Our results suggest that the weakness of the broad emission lines in WLQs is not a consequence of an extreme continuum-emission source but instead due to abnormal broad emission line region properties.
Applying TPM on Production Line of Huanwei
Directory of Open Access Journals (Sweden)
Zhai Yunkai
2017-01-01
The study based on the study and analysis of the TPM theory, based on my practice in the SMT2 production line of Victoria Electronics of Huanwei. Then it studied the promotion and implementation steps of TPM on SMT2 line. And it also introduced the improvement instance of SMT2 line. By contrasting the utilization of equipment on SMT2 line before and after the comprehensive of TPM, the necessity of implementing TPM is derived. For how to apply TPM on the production lines, and how to improve equipment comprehensive utilization, finish the order on time, provide high quality products to our customers, these are the main part of production line equipment management work. This article provides the reference for how to promote TPM on other production lines.
Atmospheric structure deduced from disturbed line profiles application to Ca II lines
International Nuclear Information System (INIS)
Mein, N.; Mein, P.; Malherbe, J.-M.; Dame, L.; Dumont, S.; CNRS, Laboratoire de Physique Stellaire et Planetaire, Verrieres-le-Buisson, France; College de France, Paris)
1985-01-01
A new method is described in order to derive physical quantities (temperature, pressure, radial velocities) from the observation of disturbed line profiles. A method of Fourier analysis is suggested with double profiles and a nonlinear expansion of the coefficient of the Fourier terms. An application to a sequence of H-Ca II lines is attempted. The method is a powerful tool allowing for the simultaneous determination of at least four physical quantities. 9 references
2010-07-01
... Continuous Lamination Lines and Continuous Casting Lines Complying With a Lbs/Ton Organic HAP Emissions Limit... Requirements for New and Existing Continuous Lamination Lines and Continuous Casting Lines Complying With a Lbs... with a lbs/ton organic HAP emissions limit for continuous lamination lines and continuous casting lines...
X-ray spectral line coincidences between fluorine VIII (and IX) and transition metal lines
International Nuclear Information System (INIS)
Charatis, G.; Rockett, P.D.; Burkhalter, P.G.
1983-01-01
X-ray spectroscopy was performed in the 12 to 15 A region, recording L-shell lines from selected laser-irradiated transition metals. Line coincidences and near coincidences were identified between Fe, Cr, Mn, and Ni L-spectra, and F VIII and F IX K-shell lines. Wavelengths were determined to accuracies of 1 to 3 mA and will be utilized in selecting potential pumping candidates in future x-ray lasing schemes. High-resolution x-ray spectra were collected under controlled illumination and target conditions using 1.05 μm and 0.527 μm laser excitation with the KMS CHROMA laser
Multiple gamma lines from semi-annihilation
International Nuclear Information System (INIS)
D'Eramo, Francesco; McCullough, Matthew; Thaler, Jesse
2013-01-01
Hints in the Fermi data for a 130 GeV gamma line from the galactic center have ignited interest in potential gamma line signatures of dark matter. Explanations of this line based on dark matter annihilation face a parametric tension since they often rely on large enhancements of loop-suppressed cross sections. In this paper, we pursue an alternative possibility that dark matter gamma lines could arise from ''semi-annihilation'' among multiple dark sector states. The semi-annihilation reaction ψ i ψ j → ψ k γ with a single final state photon is typically enhanced relative to ordinary annihilation ψ i ψ-bar i → γγ into photon pairs. Semi-annihilation allows for a wide range of dark matter masses compared to the fixed mass value required by annihilation, opening the possibility to explain potential dark matter signatures at higher energies. The most striking prediction of semi-annihilation is the presence of multiple gamma lines, with as many as order N 3 lines possible for N dark sector states, allowing for dark sector spectroscopy. A smoking gun signature arises in the simplest case of degenerate dark matter, where a strong semi-annihilation line at 130 GeV would be accompanied by a weaker annihilation line at 173 GeV. As a proof of principle, we construct two explicit models of dark matter semi-annihilation, one based on non-Abelian vector dark matter and the other based on retrofitting Rayleigh dark matter
33 CFR 183.562 - Metallic fuel lines.
2010-07-01
...) BOATING SAFETY BOATS AND ASSOCIATED EQUIPMENT Fuel Systems Manufacturer Requirements § 183.562 Metallic fuel lines. (a) Each metallic fuel line that is mounted to the boat structure must be connected to the engine by a flexible fuel line. (b) Each metallic fuel line must be attached to the boat's structure...
Cooper, David A
2014-01-01
WHO standard of care for failure of a first regimen, usually 2N(t)RTI's and an NNRTI, consists of a ritonavir-boosted protease inhibitor with a change in N(t)RTI's. Until recently, there was no evidence to support these recommendations which were based on expert opinion. Two large randomized clinical trials, SECOND LINE and EARNEST both showed excellent response rates (>80%) for the WHO standard of care and indicated that a novel regimen of a boosted protease inhibitor with an integrase inhibitor had equal efficacy with no difference in toxicity. In EARNEST, a third arm consisting of induction with the combined protease and integrase inhibitor followed by protease inhibitor monotherapy maintenance was inferior and led to substantial (20%) protease inhibitor resistance. These studies confirm the validity of the current recommendations of WHO and point to a novel public health approach of using two new classes for second line when standard first-line therapy has failed, which avoids resistance genotyping. Notwithstanding, adherence must be stressed in those failing first-line treatments. Protease inhibitor monotherapy is not suitable for a public health approach in low- and middle-income countries.
A Product Line Enhanced Unified Process
DEFF Research Database (Denmark)
Zhang, Weishan; Kunz, Thomas
2006-01-01
The Unified Process facilitates reuse for a single system, but falls short handling multiple similar products. In this paper we present an enhanced Unified Process, called UPEPL, integrating the product line technology in order to alleviate this problem. In UPEPL, the product line related activit...... activities are added and could be conducted side by side with other classical UP activities. In this way both the advantages of Unified Process and software product lines could co-exist in UPEPL. We show how to use UPEPL with an industrial mobile device product line in our case study....
Earthquake free design of pipe lines
International Nuclear Information System (INIS)
Kurihara, Chizuko; Sakurai, Akio
1974-01-01
Long structures such as cooling sea water pipe lines of nuclear power plants have a wide range of extent along the ground surface, and are incurred by not only the inertia forces but also forces due to ground deformations or the seismic wave propagation during earthquakes. Since previous reports indicated the earthquake free design of underground pipe lines, it is discussed in this report on behaviors of pipe lines on the ground during earthquakes and is proposed the aseismic design of pipe lines considering the effects of both inertia forces and ground deformations. (author)
ALFA: an automated line fitting algorithm
Wesson, R.
2016-03-01
I present the automated line fitting algorithm, ALFA, a new code which can fit emission line spectra of arbitrary wavelength coverage and resolution, fully automatically. In contrast to traditional emission line fitting methods which require the identification of spectral features suspected to be emission lines, ALFA instead uses a list of lines which are expected to be present to construct a synthetic spectrum. The parameters used to construct the synthetic spectrum are optimized by means of a genetic algorithm. Uncertainties are estimated using the noise structure of the residuals. An emission line spectrum containing several hundred lines can be fitted in a few seconds using a single processor of a typical contemporary desktop or laptop PC. I show that the results are in excellent agreement with those measured manually for a number of spectra. Where discrepancies exist, the manually measured fluxes are found to be less accurate than those returned by ALFA. Together with the code NEAT, ALFA provides a powerful way to rapidly extract physical information from observations, an increasingly vital function in the era of highly multiplexed spectroscopy. The two codes can deliver a reliable and comprehensive analysis of very large data sets in a few hours with little or no user interaction.
Ground-based transmission line conductor motion sensor
International Nuclear Information System (INIS)
Jacobs, M.L.; Milano, U.
1988-01-01
A ground-based-conductor motion-sensing apparatus is provided for remotely sensing movement of electric-power transmission lines, particularly as would occur during the wind-induced condition known as galloping. The apparatus is comprised of a motion sensor and signal-generating means which are placed underneath a transmission line and will sense changes in the electric field around the line due to excessive line motion. The detector then signals a remote station when a conditioning of galloping is sensed. The apparatus of the present invention is advantageous over the line-mounted sensors of the prior art in that it is easier and less hazardous to install. The system can also be modified so that a signal will only be given when particular conditions, such as specific temperature range, large-amplitude line motion, or excessive duration of the line motion, are occurring
Energy Technology Data Exchange (ETDEWEB)
Hindle, D.
1999-12-01
Sprayed concrete, or shotcrete, was invented in the 1920s for preserving dinosaur skeletons and was used underground initially in coalmines for the preservation and fine proofing of timber supports. Its use as a support lining in rock tunnelling was developed in the 1950s and 60s. The article surveys equipment available from major manufacturers and suppliers of concrete spraying equipment (Aliva, Cifa, GIA, Industri, Ingersoll Rand, etc.), specialist cement and additive manufacturers (Castle, Cement, Moria Carbotech). manufacturers of lattice girders and fibre reinforcement, and manufacturers of instrumentation for tunnel linings. 5 tabs., 9 photos.
Capital Improvements Business Line
2012-08-08
NAVFAC Southwest Dan Waid Program & Business Mgmt NAVFAC SW Capital Improvements Business Line NAVFAC SW 8 August 2012 1 Report...REPORT TYPE 3. DATES COVERED 00-00-2012 to 00-00-2012 4. TITLE AND SUBTITLE Capital Improvements Business Line 5a. CONTRACT NUMBER 5b. GRANT...AVAILABILITY STATEMENT Approved for public release; distribution unlimited 13. SUPPLEMENTARY NOTES Presented at the 2012 Navy Gold Coast Small Business
Cavity lining after excavating caries lesions
DEFF Research Database (Denmark)
Schwendicke, Falk; Göstemeyer, Gerd; Gluud, Christian
2015-01-01
OBJECTIVES: After removal of dentin caries lesions, cavity lining has been advocated. Non-clinical data support this approach, but clinical data are sparse and ambiguous. We aimed at evaluating the benefits and harms of cavity lining using meta-analysis and Trial Sequential Analysis. DATA: We...... included randomized clinical trials comparing restorations without versus with cavity lining for treating primary caries lesions. Only trials reporting failure (defined as need to re-retreat) after ≥1 year follow-up were included. Trial selection, data extraction, and risk of bias assessment were conducted....... STUDY SELECTION: From 128 studies, three randomized trials (89/130 patients or teeth), all treating primary teeth, were included. The trials had high risk of bias. All trials compared no lining versus calcium hydroxide lining after selective caries removal followed by adhesive restoration. Follow...
New Stokes' line in WKB theory
International Nuclear Information System (INIS)
Berk, H.L.; Nevins, W.M.; Roberts, K.V.
1982-01-01
The WKB theory for differential equations of arbitrary order or integral equations in one dimension is investigated. The rules previously stated for the construction of Stokes' lines for Nth-order differential equations, N> or =3, or integral equations are found to be incomplete because these rules lead to asymptotic forms of the solutions that depend on path. This paradox is resolved by the demonstration that new Stokes' lines can arise when previously defined Stokes' lines cross. A new formulation of the WKB problem is given to justify the new Stokes' lines. With the new Stokes' lines, the asymptotic forms can be shown to be independent of path. In addition, the WKB eigenvalue problem is formulated, and the global dispersion relation is shown to be a functional of loop integrals of the action
Ayres, D; Guarino, V; Joffe-Minor, T M; Reyna, D; Talaga, R; Thron, J
2003-01-01
The question of neutrino masses is of fundamental importance. Neutrino oscillations seem to be the only tool available to us to unravel the pattern of neutrino masses and, perhaps, shed some light on the origin of masses in general. The NuMI neutrino beam line and the MINOS experiment represent a major investment of US High Energy Physics in the area of neutrino physics. the forthcoming results could decisively establish neutrino oscillations as the underlying physics mechanism for the atmospheric nu submu deficit and provide a precise measurement of the corresponding oscillation parameters, DELTA m sub 3 sub 2 sup 2 and sin sup 2 2 theta sub 2 sub 3. This, however, is just a beginning of a long journey into uncharted territories. The key to these new territories is the detection of nu submu -> nu sub e oscillations associated with the atmospheric nu submu deficit, controlled by the little known mixing angle sin sup 2 2 theta sub 1 sub 3. A precise measurement of the amplitude of these oscillations will enabl...
Energy Technology Data Exchange (ETDEWEB)
Amidan, Brett G. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Venzin, Alexander M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Bramer, Lisa M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2015-06-03
This paper discusses the process of identifying factors that influence the contamination level of a given decision area and then determining the likelihood that the area remains unacceptable. This process is referred to as lines of evidence. These lines of evidence then serve as inputs for the stratified compliance sampling (SCS) method, which requires a decision area to be divided into strata based upon contamination expectations. This is done in order to focus sampling efforts more within stratum where contamination is more likely and to use the domain knowledge about these likelihoods of the stratum remaining unacceptable to buy down the number of samples necessary, if possible. Two different building scenarios were considered as an example (see Table 3.1). SME expertise was elicited concerning four lines of evidence factors (see Table 3.2): 1) amount of contamination that was seen before decontamination, 2) post-decontamination air sampling information, 3) the applied decontaminant information, and 4) the surface material. Statistical experimental design and logistic regression modelling were used to help determine the likelihood that example stratum remained unacceptable for a given example scenario. The number of samples necessary for clearance was calculated by applying the SCS method to the example scenario, using the estimated likelihood of each stratum remaining unacceptable as was determined using the lines of evidence approach. The commonly used simple random sampling (SRS) method was also used to calculate the number of samples necessary for clearance for comparison purposes. The lines of evidence with SCS approach resulted in a 19% to 43% reduction in total number of samples necessary for clearance (see Table 3.6). The reduction depended upon the building scenario, as well as the level of percent clean criteria. A sensitivity analysis was also performed showing how changing the estimated likelihoods of stratum remaining unacceptable affect the number
Tubular lining material for pipelines having bends
Energy Technology Data Exchange (ETDEWEB)
Moringa, A.; Sakaguchi, Y.; Hyodo, M.; Yagi, I.
1987-03-24
A tubular lining material for pipelines having bends or curved portions comprises a tubular textile jacket made of warps and wefts woven in a tubular form overlaid with a coating of a flexible synthetic resin. It is applicable onto the inner surface of a pipeline having bends or curved portions in such manner that the tubular lining material with a binder onto the inner surface thereof is inserted into the pipeline and allowed to advance within the pipeline, with or without the aid of a leading rope-like elongated element, while turning the tubular lining material inside out under fluid pressure. In this manner the tubular lining material is applied onto the inner surface of the pipeline with the binder being interposed between the pipeline and the tubular lining material. The lining material is characterized in that a part of all of the warps are comprised of an elastic yarn around which, over the full length thereof, a synthetic fiber yarn or yarns have been left-and/or right-handedly coiled. This tubular lining material is particularly suitable for lining a pipeline having an inner diameter of 25-200 mm and a plurality of bends, such as gas service pipelines or house pipelines, without occurrence of wrinkles in the lining material in a bend.
International Nuclear Information System (INIS)
L'vov, B.V.; Polzik, L.K.; Katskov, D.A.; Kruglikova, L.P.
1975-01-01
This paper is concerned with interferometric measuring of the line shift in flames in the view of interpretation of absorption lines in the atomic absorption spectroscopy. The newly measured line shifts were compared to the known data on Lorentz broadening of the same lines obtained by methods free of the systematic errors. The resonant lines of the alkaline earth elements (Sr, Ca, Ba) were investigated. To reduce self-absorption in the flame the solutions with minimum concentrations of the elements were used. The computation scheme includes the spectrometer apparatus width and line broadening due to the self-absorption. Formulae are given for computing the values studied. Good agreement was observed between the computed and experimental results. Error analysis was performed. It was concluded that any line shifts in the hydrocarbons were correctly taken into an account in the absolute computations of absorption
Line Emission and X-ray Line Polarization of Multiply Ionized Mo Ions
Petkov, E. E.; Safronova, A. S.; Kantsyrev, V. L.; Shlyaptseva, V. V.; Stafford, A.; Safronova, U. I.; Shrestha, I. K.; Schultz, K. A.; Childers, R.; Cooper, M. C.; Beiersdorfer, P.; Hell, N.; Brown, G. V.
2016-10-01
We present a comprehensive experimental and theoretical study of the line emission from multiply ionized Mo ions produced by two different sets of experiments: at LLNL EBIT and the pulsed power generator Zebra at UNR. Mo line emission and polarization measurements were accomplished at EBIT for the first time. In particular, benchmarking experiments at the LLNL EBIT with Mo ions produced at electron beam energies from 2.75 keV up to 15 keV allowed us to break down these very complicated spectra into spectra with only few ionization stages and to select processes that influence them as well as to measure line polarization. The EBIT data were recorded using the EBIT Calorimeter Spectrometer and a crystal spectrometer with a Ge crystal. X-ray Mo spectra and pinhole images were collected from Z-pinch plasmas produced from various wire loads. Non-LTE modeling, high-precision relativistic atomic and polarization data were used to analyze L-shell Mo spectra. The influence of different plasma processes including electron beams on Mo line radiation is summarized. This work was supported by NNSA under DOE Grant DE-NA0002954. Experiments at the NTF/UNR were funded in part by DE-NA0002075. Work at LLNL was performed under the auspices of the U.S. DOE under contract DE-AC52-07NA27344.
Magnetization of topological line-node semimetals
Mikitik, G. P.; Sharlai, Yu. V.
2018-02-01
Using an approximate expression for the Landau levels of the electrons located near a nodal line of a topological line-node semimetal, we obtain formulas for the magnetization of this semimetal at an arbitrary shape of its line. It is also shown that the dependence of the chemical potential on the magnetic field can be strong in these materials, and this dependence can essentially influence the de Haas-van Alphen oscillations. The obtained results are applied to the rhombohedral graphite, which is one of the line-node semimetals. For this material, we find temperature and magnetic field dependencies of its magnetic susceptibility.
International Nuclear Information System (INIS)
Frederickson, J.R.; Horgos, R.M.
1983-10-01
An automated nuclear fuel fabrication line is being designed for installation in the Fuels and Materials Examination Facility (FMEF) near Richland, Washington. The fabrication line will consist of seven major process systems: Receiving and Powder Preparation; Powder Conditioning; Pressing and Boat Loading; Debinding, Sintering, and Property Adjustment; Boat Transport; Pellet Inspection and Finishing; and Pin Operations. Fuel powder processing through pellet pressing will be discussed in this paper
Energy Technology Data Exchange (ETDEWEB)
Kitaguchi, Y.; Yokotani, K. [Hitachi Zosen Corp., Osaka (Japan)
1994-11-01
This paper describes the laser cutting system established at a new advanced plant that was constructed by Hitachi Shipbuilding and Engineering Co., Ltd. in 1993. At the plant, the cutting line consists of four NC cutting lines: the plasma cutting machine, gas cutting machine, frame planer, and laser cutting machine. The laser cutting machine is used to cut complex shapes of relatively thin (6 - 16 mm) materials with high accuracy. The machine consists of a 3 kW CO2 laser oscillator mounted gantry type NC cutter and a slat conveyor of about 30 m long, with the maximum cutting width of 3.6 m. The NC cutting machine is provided with the automatic printing function using NC data, marking function, scheduled operation function, steel plate detector, and coordinate rotation function, etc. These functions enable unattended operation of the machine to cut multiple materials. This NC laser cutting line has the same performance data collection function for data during the operating time as other production lines. Therefore, the NC laser cutting line can be subjected to the realtime centralized control together with the other lines. All these technologies have provided high accuracy and efficiency for production as well as an environment in which many female operators can successfully work. 10 figs., 4 tabs.
Marine line fish research programme
CSIR Research Space (South Africa)
SANCOR
1979-04-01
Full Text Available This report outlines the framework for a marine line fish programme under the aegis of the South African National Committee for Oceanographic Research (SANCOR). An attempt is made to assess the state of knowledge about South African marine line...
Line-mode browser development days
Anna Pantelia
2013-01-01
Twelve talented web developers have travelled to CERN from all over the world to recreate a piece of web history: the line-mode browser. See the line-mode browser simulator that they created here. Read more about the birth of the web here.
Historical Research and Narrative Inquiry: Striking Similarities, Notable Differences
Craig, Cheryl J.
2005-01-01
When Theseus sailed from Athens to the island of Crete to slay the Minotaur, a fearsome monster whose food was human flesh and whose home was the labyrinth, Ariadne, the daughter of the Cretan King Minos, gave her new found love, Theseus, a ball of thread to assist him in maneuvering his way through the great maze of winding passages. "Unwind it…
Noskov, A N; Kravchenko, T B; Noskova, V P
1996-01-01
Three functional domains were revealed in the molecule of the lethal factor of B. anthracis. They are located in the linear structure of the molecula as follows: the associative domain occupies the area from Lys39 to Met242, the stabilizing domain from Leu517 to Lys614, and the effector domain still further to the COOH-terminal Lys mino acid.
Formation of extremely narrow metallic lines
International Nuclear Information System (INIS)
Harris, E.P.; Keyes, R.W.
1979-01-01
A method for forming metal lines, particularly lines which are superconductive, involves delineating a pattern on a thin metal film on a substrate by masking techniques, ion implanting the metal film to a desired depth, removing the mask and etching away the unimplanted portion of the metal film to leave the line whose width is equal to the implanted depth. (U.K.)
Revised Line Profile Function for Hydrogenic Species
Directory of Open Access Journals (Sweden)
Sapar A.
2012-09-01
Full Text Available Analytical series expansions for the hydrogenic spectral line profile functions are derived starting from the three single expressions, obtained by integrating twice the convolution of the Holtsmark, Lorentz and Doppler line profile functions. We get well converging series expansions for the line wings and centers by reducing the number of arguments in the profile function by one, introducing the module of the Holtsmark and Lorentz profiles as a new argument. In the intermediate part of the line, the parabolic cylinder functions expressed via the confluent hypergeometric series, are used. The multi-component Stark splitting of the hydrogenic spectral lines and the modeled stochastic electron transitions in the electric field of the adjacent ions generate wide Doppler plateaux at the line centers, with the characteristic widths estimated from the fit to the characteristic width of the Holtsmark profile. This additional Doppler broadening of the line profile function removes the central dip typical to the Holtsmark profile.
Modeling operational behavior of a disassembly line
Kizilkaya, Elif A.; Gupta, Surendra M.
2004-12-01
In this paper we present a dynamic kanban (pull) system specifically developed for disassembly lines. This type of kanban system is much more complex than the traditional kanban system used in assembly lines. For instance, unlike the assembly line where the external demand occurs only at the last station, the demands in the disassembly case also occur at any of the intermittent stations. The reason is that as a product moves on the disassembly line, various parts are disassembled at every station and accumulated at that station. Therefore, there are as many demand sources as there are number of parts. We consider a case example involving the end-of-life products. Based on the precedence relationships and other criteria such as hazardous properties of the parts, we balance the disassembly line. The results of the disassembly line-balancing problem (DLBP) are used as input to the proposed dynamic kanban system for disassembly line (DKSDL). We compare the performance of the DKSDL to the modified kanban system for disassembly line (MKSDL), which was previously introduced by the authors. We show, via simulation, that the DKSDL is far superior to MKSDL considered.
Autoionization spectral line shapes in dense plasmas
International Nuclear Information System (INIS)
Rosmej, F.B.; Hoffmann, D.H.H.; Faenov, A.Ya.; Pikuz, T.A.; Suess, W.; Geissel, M.
2001-01-01
The distortion of resonance line shapes due to the accumulation of a large number of satellite transitions is discovered by means of X-ray optical methods with simultaneous high spectral (λ/δλ≅8000) and spatial resolution (δx≅7 μm). Disappearance of the He α resonance line emission near the target surface is observed while Rydberg satellite intensity accumulates near the resonance line position. He β and He γ resonance line shapes are also shown to be seriously affected by opacity, higher-order line emissions from autoionizing states and inhomogeneous spatial emission. Opposite to resonance line emissions the He β satellites originate only from a very narrow spatial interval. New temperature and density diagnostics employing the 1s2131' and 1s3131'-satellites are developed. Moreover, even-J components of the satellite line emissions were resolved in the present high resolution experiments. Line transitions from the autoionizing states 1s2131' are therefore also proposed for space resolved Stark broadening analysis and local high density probing. Theorists are encouraged to provide accurate Stark broadening data for the transitions 1s2131 ' →1s 2 21+hv
Displacement of location in illusory line motion.
Hubbard, Timothy L; Ruppel, Susan E
2013-05-01
Six experiments examined displacement in memory for the location of the line in illusory line motion (ILM; appearance or disappearance of a stationary cue is followed by appearance of a stationary line that is presented all at once, but the stationary line is perceived to "unfold" or "be drawn" from the end closest to the cue to the end most distant from the cue). If ILM was induced by having a single cue appear, then memory for the location of the line was displaced toward the cue, and displacement was larger if the line was closer to the cue. If ILM was induced by having one of two previously visible cues vanish, then memory for the location of the line was displaced away from the cue that vanished. In general, the magnitude of displacement increased and then decreased as retention interval increased from 50 to 250 ms and from 250 to 450 ms, respectively. Displacement of the line (a) is consistent with a combination of a spatial averaging of the locations of the cue and the line with a relatively weaker dynamic in the direction of illusory motion, (b) might be implemented in a spreading activation network similar to networks previously suggested to implement displacement resulting from implied or apparent motion, and (c) provides constraints and challenges for theories of ILM.
Mechanical Behaviour of Lined Pipe
Hilberink, A.
2011-01-01
Installing lined pipe by means of the reeling installation method seems to be an attractive combination, because it provides the opportunity of eliminating the demanding welds from the critical time offshore and instead preparing them onshore. However, reeling of lined pipe is not yet proven
Rodin, A M; Bogdanov, D D; Golovkov, M S; Fomichev, A S; Sidorchuk, S I; Slepnev, R S; Wolski, R; Ter-Akopian, G M; Oganessian, Yu T; Yukhimchuk, A A; Perevozchikov, V V; Vinogradov, Yu I; Grishenchkin, S K; Demin, A M; Zlatoustovskii, S V; Kuryakin, A V; Filchagin, S V; Ilkaev, R I
2003-01-01
The separator ACCULINNA was upgraded to achieve new experimental requirements. The beam line was extended by new ion-optical elements beyond the cyclotron hall. The new arrangements yield much better background conditions. The intensities of sup 6 He and sup 8 He radioactive beams produced in fragmentation of 35 A MeV sup 1 sup 1 B ions were increased up to a factor of 10. The upgraded beam line was used in experiments to study the sup 5 H resonance states populated in the t+t reaction. A cryogenic liquid tritium target was designed and installed at the separator beam line.
Collisionless reconnection: magnetic field line interaction
Directory of Open Access Journals (Sweden)
R. A. Treumann
2012-10-01
Full Text Available Magnetic field lines are quantum objects carrying one quantum Φ0 = 2πh/e of magnetic flux and have finite radius λm. Here we argue that they possess a very specific dynamical interaction. Parallel field lines reject each other. When confined to a certain area they form two-dimensional lattices of hexagonal structure. We estimate the filling factor of such an area. Anti-parallel field lines, on the other hand, attract each other. We identify the physical mechanism as being due to the action of the gauge potential field, which we determine quantum mechanically for two parallel and two anti-parallel field lines. The distortion of the quantum electrodynamic vacuum causes a cloud of virtual pairs. We calculate the virtual pair production rate from quantum electrodynamics and estimate the virtual pair cloud density, pair current and Lorentz force density acting on the field lines via the pair cloud. These properties of field line dynamics become important in collisionless reconnection, consistently explaining why and how reconnection can spontaneously set on in the field-free centre of a current sheet below the electron-inertial scale.
The Pulse Line Ion Accelerator Concept
Energy Technology Data Exchange (ETDEWEB)
Briggs, Richard J.
2006-02-15
The Pulse Line Ion Accelerator concept was motivated by the desire for an inexpensive way to accelerate intense short pulse heavy ion beams to regimes of interest for studies of High Energy Density Physics and Warm Dense Matter. A pulse power driver applied at one end of a helical pulse line creates a traveling wave pulse that accelerates and axially confines the heavy ion beam pulse. Acceleration scenarios with constant parameter helical lines are described which result in output energies of a single stage much larger than the several hundred kilovolt peak voltages on the line, with a goal of 3-5 MeV/meter acceleration gradients. The concept might be described crudely as an ''air core'' induction linac where the PFN is integrated into the beam line so the accelerating voltage pulse can move along with the ions to get voltage multiplication.
Stability of the LHC transfer lines
Kain, V; Bartmann, W; Bracco, C; Goddard, B; Meddahi, M; Uythoven, J; Wenninger, J
2011-01-01
The LHC is filled from the SPS through two 3 km transfer lines. The injected beam parameters need to be well under control for luminosity performance, machine protection and operational efficiency. Small fractions of beam loss on the transfer line collimation system create showers which can trigger the sensitive LHC beam loss monitor system nearby and cause a beam abort during filling. The stability of the transfer line trajectory through the collimators is particularly critical in this respect. This paper will report on the transfer line trajectory stability during the proton run in 2011, correlations with injection losses, correction frequency and the most likely sources for the observed oscillations.
Correlation between the line width and the line flux of the double-peaked broad Hα of 3C390.3
Zhang, Xue-Guang
2013-03-01
In this paper, we carefully check the correlation between the line width (second moment) and the line flux of the double-peaked broad Hα of the well-known mapped active galactic nucleus (AGN) 3C390.3 in order to show some further distinctions between double-peaked emitters and normal broad-line AGN. Based on the virialization assumption MBH ∝ RBLR × V2(BLR) and the empirical relation RBLR ∝ L˜0.5, one strong negative correlation between the line width and the line flux of the double-peaked broad lines should be expected for 3C390.3, such as the negative correlation confirmed for the mapped broad-line object NGC 5548, RBLR × V2(BLR) ∝ L˜0.5 × σ2 = constant. Moreover, based on the public spectra around 1995 from the AGN WATCH project for 3C390.3, one reliable positive correlation is found between the line width and the line flux of the double-peaked broad Hα. In the context of the proposed theoretical accretion disc model for double-peaked emitters, the unexpected positive correlation can be naturally explained, due to different time delays for the inner and outer parts of the disc-like broad-line region (BLR) of 3C390.3. Moreover, the virialization assumption is checked and found to be still available for 3C390.3. However, the time-varying size of the BLR of 3C390.3 cannot be expected by the empirical relation RBLR ∝ L˜0.5. In other words, the mean size of the BLR of 3C390.3 can be estimated by the continuum luminosity (line luminosity), while the continuum emission strengthening leads to the size of BLR decreasing (not increasing) in different moments for 3C390.3. Then, we compared our results of 3C390.3 with the previous results reported in the literature for the other double-peaked emitters, and found that before to clearly correct the effects from disc physical parameters varying (such as the effects of disc precession) for long-term observed line spectra, it is not so meaningful to discuss the correlation of the line parameters of double
Design of the Yang magnetically-insulated transmission line
International Nuclear Information System (INIS)
Gu Yuanchao; Song Shenyi
2002-01-01
The authors have designed a new magnetically insulated transmission line (MITL) for the Yang accelerator. The differences between the existing line and the designing one are given. The electric strength of some special regions on the lines and the inductance of the lines have been calculated. The authors have checked the states of magnetic insulation on the designing line
Ghost lines in Moessbauer relaxation spectra
International Nuclear Information System (INIS)
Price, D.C.
1985-01-01
The appearance in Moessbauer relaxation spectra of 'ghost' lines, which are narrow lines that do not correspond to transitions between real hyperfine energy levels of the resonant system, is examined. It is shown that in many cases of interest, the appearance of these 'ghost' lines can be interpreted in terms of the relaxational averaging of one or more of the static interactions of the ion. (orig.)
Line outage contingency analysis including the system islanding scenario
Energy Technology Data Exchange (ETDEWEB)
Hazarika, D.; Bhuyan, S. [Assam Engineering College, Jalukbari, Guwahati 781013 (India); Chowdhury, S.P. [Jadavpur University, Jadavpur, Kolkata 700 032 (India)
2006-05-15
The paper describes an algorithm for determining the line outage contingency of a line taking into account of line over load effect in remaining lines and subsequent tripping of over loaded line(s) leading to possible system split or islanding of a power system. The optimally ordered sparse [B'], [B'] matrices for the integrated system are used for load flow analysis to determine modified values of voltage phase angles [{delta}] and bus voltages [V] to determine the over loading effect on the remaining lines due to outage of a selected line outage contingency. In case of over loading in remaining line(s), the over loaded lines are removed from the system and a topology processor is used to find the islands. A fast decoupled load flow (FDLF) analysis is carried out for finding out the system variables for the islanded (or single island) system by incorporating appropriate modification in the [B'] and [B'] matrices of the integrated system. Line outage indices based on line overload, loss of load, loss of generation and static voltage stability are computed to indicate severity of a line outage of a selected line. (author)
ExoMol line lists - VIII. A variationally computed line list for hot formaldehyde
Al-Refaie, Ahmed F.; Yachmenev, Andrey; Tennyson, Jonathan; Yurchenko, Sergei N.
2015-04-01
A computed line list for formaldehyde, H212C16O, applicable to temperatures up to T = 1500 K is presented. An empirical potential energy and ab initio dipole moment surfaces are used as the input to the nuclear motion program TROVE. The resulting line list, referred to as AYTY, contains 10.3 million rotational-vibrational states and around 10 billion transition frequencies. Each transition includes associated Einstein-A coefficients and absolute transition intensities, for wavenumbers below 10 000 cm-1 and rotational excitations up to J = 70. Room-temperature spectra are compared with laboratory measurements and data currently available in the HITRAN data base. These spectra show excellent agreement with experimental spectra and highlight the gaps and limitations of the HITRAN data. The full line list is available from the CDS data base as well as at www.exomol.com.
On-line and off-line data analysis for the EUSO-TA experiment
International Nuclear Information System (INIS)
Piotrowski, Lech Wiktor; Casolino, Marco; Conti, Livio; Ebisuzaki, Toshikazu; Fornaro, Claudio; Kawasaki, Yoshiya; Hachisu, Yusuke; Ohmori, Hitoshi; De Santis, Cristian; Shinozaki, Kenji; Takizawa, Yoshiyuki; Uehara, Yoshihiro
2015-01-01
We show the principles of the communication protocol, on-line calibration, off-line data format as well as basic visualisation and data analysis software implemented for the EUSO-TA on-ground experiment, being the first step towards implementation in a future space based mission. EUSO-TA is an on-ground detector for measuring UV (290–430 nm) light from extensive air showers induced by cosmic rays. It is a prototype experiment for the JEM-EUSO space-borne mission, built according to the same constraints of low mass, low power consumption and thus low computing power. Nevertheless, it needs to process a huge amount of data in short time, taking 2.5μs exposures for 2304 channels. The low processing power and high time resolution require an efficient communication protocol and simple yet powerful algorithms for on-line analysis. The off-line data format is designed for storing a huge amount of data, at the same time allowing easy access, analysis and sharing. Its structure is scalable and adjustable to different experimental designs. It is independent of the data origin, whether it is hardware or a Monte-Carlo simulator. Use of object-oriented techniques and the ROOT framework allows rapid development of dedicated analysis software, such as a Python based quick-view program described herein. Basic capabilities of the software, such as display of the focal surface, light curves and calibration data are shown in this paper
On-line and off-line data analysis for the EUSO-TA experiment
Energy Technology Data Exchange (ETDEWEB)
Piotrowski, Lech Wiktor, E-mail: lech.piotrowski@riken.jp [RIKEN, Wako (Japan); Casolino, Marco [RIKEN, Wako (Japan); INFN and Univ. Rome Tor Vergata, Rome (Italy); Conti, Livio [International Telematic University UNINETTUNO, Rome (Italy); Ebisuzaki, Toshikazu [RIKEN, Wako (Japan); Fornaro, Claudio [International Telematic University UNINETTUNO, Rome (Italy); Kawasaki, Yoshiya; Hachisu, Yusuke; Ohmori, Hitoshi [RIKEN, Wako (Japan); De Santis, Cristian [INFN and Univ. Rome Tor Vergata, Rome (Italy); Shinozaki, Kenji [Institute for Astronomy and Astrophysics, Kepler Center, University of Tübingen, Sand 6, D-72076 Tübingen (Germany); RIKEN, Wako (Japan); Takizawa, Yoshiyuki; Uehara, Yoshihiro [RIKEN, Wako (Japan)
2015-02-11
We show the principles of the communication protocol, on-line calibration, off-line data format as well as basic visualisation and data analysis software implemented for the EUSO-TA on-ground experiment, being the first step towards implementation in a future space based mission. EUSO-TA is an on-ground detector for measuring UV (290–430 nm) light from extensive air showers induced by cosmic rays. It is a prototype experiment for the JEM-EUSO space-borne mission, built according to the same constraints of low mass, low power consumption and thus low computing power. Nevertheless, it needs to process a huge amount of data in short time, taking 2.5μs exposures for 2304 channels. The low processing power and high time resolution require an efficient communication protocol and simple yet powerful algorithms for on-line analysis. The off-line data format is designed for storing a huge amount of data, at the same time allowing easy access, analysis and sharing. Its structure is scalable and adjustable to different experimental designs. It is independent of the data origin, whether it is hardware or a Monte-Carlo simulator. Use of object-oriented techniques and the ROOT framework allows rapid development of dedicated analysis software, such as a Python based quick-view program described herein. Basic capabilities of the software, such as display of the focal surface, light curves and calibration data are shown in this paper.
2013-12-18
... current ownership of Quick, and its wholly owned subsidiary Quick Coach Lines USA Inc. (Quick USA... Charter Coach Lines Ltd.--Acquisition of Control-- Quick Coach Lines Ltd. d/b/a Quick Shuttle Service.... SUMMARY: On November 18, 2013, Royal City Charter Coach Lines Ltd. (Royal, or Applicant) filed an...
International Nuclear Information System (INIS)
Klofai, Yerima; Essimbi, B Z; Jaeger, D
2011-01-01
Pulse propagation on high-frequency dissipative nonlinear transmission lines (NLTLs)/resonant tunneling diode line cascaded maps is investigated for long-distance propagation of short pulses. Applying perturbative analysis, we show that the dynamics of each line is reduced to an expanded Korteweg-de Vries-Burgers equation. Moreover, it is found by computer experiments that the soliton developed in NLTLs experiences an exponential amplitude decay on the one hand and an exponential amplitude growth on the other. As a result, the behavior of a pulse in special electrical networks made of concatenated pieces of lines is closely similar to the transmission of information in optical/electrical communication systems.
Energy Technology Data Exchange (ETDEWEB)
Klofai, Yerima [Department of Physics, Higher Teacher Training College, University of Maroua, PO Box 46 Maroua (Cameroon); Essimbi, B Z [Department of Physics, Faculty of Science, University of Yaounde 1, PO Box 812 Yaounde (Cameroon); Jaeger, D, E-mail: bessimb@yahoo.fr [ZHO, Optoelectronik, Universitaet Duisburg-Essen, D-47048 Duisburg (Germany)
2011-10-15
Pulse propagation on high-frequency dissipative nonlinear transmission lines (NLTLs)/resonant tunneling diode line cascaded maps is investigated for long-distance propagation of short pulses. Applying perturbative analysis, we show that the dynamics of each line is reduced to an expanded Korteweg-de Vries-Burgers equation. Moreover, it is found by computer experiments that the soliton developed in NLTLs experiences an exponential amplitude decay on the one hand and an exponential amplitude growth on the other. As a result, the behavior of a pulse in special electrical networks made of concatenated pieces of lines is closely similar to the transmission of information in optical/electrical communication systems.
Altering graphene line defect properties using chemistry
Vasudevan, Smitha; White, Carter; Gunlycke, Daniel
2012-02-01
First-principles calculations are presented of a fundamental topological line defect in graphene that was observed and reported in Nature Nanotech. 5, 326 (2010). These calculations show that atoms and smaller molecules can bind covalently to the surface in the vicinity of the graphene line defect. It is also shown that the chemistry at the line defect has a strong effect on its electronic and magnetic properties, e.g. the ferromagnetically aligned moments along the line defect can be quenched by some adsorbates. The strong effect of the adsorbates on the line defect properties can be understood by examining how these adsorbates affect the boundary-localized states in the vicinity of the Fermi level. We also expect that the line defect chemistry will significantly affect the scattering properties of incident low-energy particles approaching it from graphene.
Response analysis on nonuniform transmission line
Directory of Open Access Journals (Sweden)
Cvetković Zlata
2005-01-01
Full Text Available Transients on a loss less exponential transmission line with a pure resistance load are presented in this paper. The approach is based on the two-port presentation of the transmission line. Using Picard-Carson's method the transmission line equations are solved. The relationship between source voltage and the load voltage in s-domain is derived. All the results are plotted using program package Mathematica 3.0.
The Cellosaurus, a Cell-Line Knowledge Resource
Bairoch, Amos
2018-01-01
The Cellosaurus is a knowledge resource on cell lines. It aims to describe all cell lines used in biomedical research. Its scope encompasses both vertebrates and invertebrates. Currently, information for >100,000 cell lines is provided. For each cell line, it provides a wealth of information, cross-references, and literature citations. The Cellosaurus is available on the ExPASy server (https://web.expasy.org/cellosaurus/) and can be downloaded in a variety of formats. Among its many uses, the Cellosaurus is a key resource to help researchers identify potentially contaminated/misidentified cell lines, thus contributing to improving the quality of research in the life sciences. PMID:29805321
UAV Low Altitude Photogrammetry for Power Line Inspection
Directory of Open Access Journals (Sweden)
Yong Zhang
2017-01-01
Full Text Available When the distance between an obstacle and a power line is less than the discharge distance, a discharge arc can be generated, resulting in the interruption of power supplies. Therefore, regular safety inspections are necessary to ensure the safe operation of power grids. Tall vegetation and buildings are the key factors threatening the safe operation of extra high voltage transmission lines within a power line corridor. Manual or laser intensity direction and ranging (LiDAR based inspections are time consuming and expensive. To make safety inspections more efficient and flexible, a low-altitude unmanned aerial vehicle (UAV remote-sensing platform, equipped with an optical digital camera, was used to inspect power line corridors. We propose a semi-patch matching algorithm based on epipolar constraints, using both the correlation coefficient (CC and the shape of its curve to extract three dimensional (3D point clouds for a power line corridor. We use a stereo image pair from inter-strip to improve power line measurement accuracy by transforming the power line direction to an approximately perpendicular to epipolar line. The distance between the power lines and the 3D point cloud is taken as a criterion for locating obstacles within the power line corridor automatically. Experimental results show that our proposed method is a reliable, cost effective, and applicable way for practical power line inspection and can locate obstacles within the power line corridor with accuracy better than ±0.5 m.
DEFF Research Database (Denmark)
Kongsted, Per; Svane, Inge M; Lindberg, Henriette
2016-01-01
To compare treatment outcomes in patients with metastatic castration-resistant prostate cancer treated with cabazitaxel (CA) as second-line or third-line therapy in the everyday clinical setting. Charts from 94 patients treated with CA as second-line (n=28) or third-line therapy (n=66) were...... evaluated. Common Terminology Criteria for Adverse Events were used to register grade 3-4 nonhematological toxicity during treatment with CA. Baseline metastatic castration-resistant prostate cancer-related prognostic factors, duration of therapy, and maximum prostate-specific antigen (PSA) percentage...... change were registered during treatment with CA and previous/subsequent novel androgen receptor targeting therapies. Progression-free survival (PFS) and overall survival (OS) were calculated using the Kaplan-Meier method. A median of 6 versus 5 treatment cycles was administered in patients treated...
On the analysis of the thermal line shift and thermal line width of ions in solids
Energy Technology Data Exchange (ETDEWEB)
Walsh, Brian M., E-mail: brian.m.walsh@nasa.gov [NASA Langley Research Center, Hampton, VA 23681 (United States); Di Bartolo, Baldassare, E-mail: baldassare.dibartolo@bc.edu [Boston College, Department of Physics, Chestnut Hill, MA 23667 (United States)
2015-02-15
A method of analysis for the thermally induced line shift and line width of spectral lines regarding the Raman process of ions in solids utilizing rational approximations for the Debye functions is presented. The {sup 2}E level unsplit R-line in V{sup 2+}:MgO is used as an example to illustrate the utility of the methods discussed here in providing a new analytical tool for researchers. - Highlights: • We use rational approximations for Debye functions. • We discuss limits and ranges of applicability of the rational approximations. • We formulate expressions for thermal shift and thermal linewidth for Raman processes using the rational approximations of the Debye functions. • We present an application of the methods to analyze the temperature dependent linewidth and lineshift in V2+:MgO.
Line Generalization and AutoCAD Map
Directory of Open Access Journals (Sweden)
Nada Vučetić
2001-01-01
Full Text Available The paper offers the results of original research made on the application of AutoCAD Map in line generalisation. The differences and similarities have been found out between the Douglas-Peucker method and the method of line simplification that is incorporated in AutoCAD Map. There have been also the inaccuracies found out in AutoCAD Map manual relating to the issues of buffer width and tolerance, and the line width before and after simplification. The paper gives recommendations about pseudo nodes dissolving. It has been noticed that AutoCAD Map simplification method is not independent of the order of points. The application of the method is illustrated by an example of coastal line of Istria.
International Nuclear Information System (INIS)
Schwarz, H.D.; Weaver, J.N.
1979-03-01
A rf phase reference line in 6 segments around the 2200 meter circumference PEP storage ring is described. Each segment of the reference line is phase stabilized by its own independent feedback system, which uses an amplitude modulated reflection from the end of each line. The modulation is kept small and decoupled from the next segment to avoid crosstalk and significant modulation of the rf drive signal. An error evaluation of the system is made. The technical implementation and prototype performance are described. Prototype tests indicate that the phase error around the ring can be held below 1 degree with this relatively simple system
Energy Technology Data Exchange (ETDEWEB)
Schwarz, H.D.; Weaver, J.N.
1979-03-01
A rf phase reference line in 6 segments around the 2200 meter circumference PEP storage ring is described. Each segment of the reference line is phase stabilized by its own independent feedback system, which uses an amplitude modulated reflection from the end of each line. The modulation is kept small and decoupled from the next segment to avoid crosstalk and significant modulation of the rf drive signal. An error evaluation of the system is made. The technical implementation and prototype performance are described. Prototype tests indicate that the phase error around the ring can be held below 1 degree with this relatively simple system.
TLINES: A Computer Program for Circuits of Transmission Lines.
1983-12-01
of various lengths are handled by stringing together many short lines, with the assumption that each of the longer lines has a length approximated as...expressed in terms of transmission lines numbered from 2 through CAPM , connected in numerical sequence as in figure 3. Line 1 is a dummy element disconnected...from line 2 and the rest of the circuit. Lines 2 through CAPM can each be set to any impedance the user desires. Line CAPM +1 is a zero-impedance line
Chenail, Ronald J.
2012-01-01
In the first of a series of "how-to" essays on conducting qualitative data analysis, Ron Chenail points out the challenges of determining units to analyze qualitatively when dealing with text. He acknowledges that although we may read a document word-by-word or line-by-line, we need to adjust our focus when processing the text for purposes of…
Modeling and interpretation of line observations*
Directory of Open Access Journals (Sweden)
Kamp Inga
2015-01-01
Full Text Available Models for the interpretation of line observations from protoplanetary disks are summarized. The spectrum ranges from 1D LTE slab models to 2D thermo-chemical radiative transfer models and their use depends largely on the type/nature of observational data that is analyzed. I discuss the various types of observational data and their interpretation in the context of disk physical and chemical properties. The most simple spatially and spectral unresolved data are line fluxes, which can be interpreted using so-called Boltzmann diagrams. The interpretation is often tricky due to optical depth and non-LTE effects and requires care. Line profiles contain kinematic information and thus indirectly the spatial origin of the emission. Using series of line profiles, we can for example deduce radial temperature gradients in disks (CO pure rotational ladder. Spectro-astrometry of e.g. CO ro-vibrational line profiles probes the disk structure in the 1–30 AU region, where planet formation through core accretion should be most efficient. Spatially and spectrally resolved line images from (submm interferometers are the richest datasets we have to date and they enable us to unravel exciting details of the radial and vertical disk structure such as winds and asymmetries.
Morphological variation in maize inbred lines
Directory of Open Access Journals (Sweden)
Jiban Shrestha
2014-05-01
Full Text Available In order to identify morphological variation in maize inbred lines, one hundred five inbred lines were planted under randomized complete block design with two replications at research field of National Maize Research Program, Rampur, Chitwan, Nepal during summer season (March to June, 2010. Descriptive statistics and cluster analysis were done. The results revealed a wide range of morphological variation among the tested inbred lines. The inbred lines grouped in cluster 4 namely PUTU-13, L-9, RL-105, RL-197, RL-103, RML-9, RML-41, RL-165, RL-36, RL-76, RL-125, RL-30-3, L-6, RL-107, RL-174, RL-41, L-13, RML-76 and L-5 had 0.833 days anthesis-silking interval and earlier in flowering (tasseling in 54.50 days and silking in 55.33 days. Moreover they consisted of 1.16 plant aspect, 1.25 ear aspect, 33.08 cm tassel length and 13.5 tassel branch number. Among tested lines, the above inbred lines had better morphological traits, so it was concluded that they were good candidates for development of hybrids and synthetic varieties. DOI: http://dx.doi.org/10.3126/ije.v3i2.10521 International Journal of the Environment Vol.3(2 2014: 98-107
INIS retrieval service, towards on-line
International Nuclear Information System (INIS)
Ebinuma, Yukio; Komatsubara, Yasutoshi
1983-01-01
Japan Atomic Energy Research Institute executes the retrieval service of INIS atomic energy information by batch system in cooperation with Genshiryoku Kozaikai. This service is very popular to the users in whole Japan, but the demand of on-line service has increased recently. Therefore, it was decided to begin the INIS on-line service from January, 1984, through the on-line information retrieval system of the Japan Information Center of Science and Technology. It is expected that when the operation will be started, the utilization of INIS atomic energy information in Japan will drastically increase. Also Japan Atomic Energy Research Institute has carried out the retrieval service by on-line system for those in the institute besides the batch system, accordingly, at this opportunity, the state of utilization of both systems and their distinction to use effectively, and the operation and the method of utilization of the on-line information retrieval system of JICST are explained. In the on-line system, the users are accessible to the data base themselves, and immediate information retrieval is possible, while in the batch system, the related information can be retrieved without fail, and the troublesome operation of equipment is not necessary. (Kako, I.)
Signatures of triaxiality in low-spin spectra of 86Ge
Lettmann, M.; Werner, V.; Pietralla, N.; Doornenbal, P.; Obertelli, A.; Rodríguez, T. R.; Sieja, K.; Authelet, G.; Baba, H.; Calvet, D.; Château, F.; Chen, S.; Corsi, A.; Delbart, A.; Gheller, J.-M.; Giganon, A.; Gillibert, A.; Lapoux, V.; Motobayashi, T.; Niikura, M.; Paul, N.; Roussé, J.-Y.; Sakurai, H.; Santamaria, C.; Steppenbeck, D.; Taniuchi, R.; Uesaka, T.; Ando, T.; Arici, T.; Blazhev, A.; Browne, F.; Bruce, A.; Caroll, R. J.; Chung, L. X.; Cortés, M. L.; Dewald, M.; Ding, B.; Flavigny, F.; Franchoo, S.; Górska, M.; Gottardo, A.; Jungclaus, A.; Lee, J.; Linh, B. D.; Liu, J.; Liu, Z.; Lizarazo, C.; Momiyama, S.; Moschner, K.; Nagamine, S.; Nakatsuka, N.; Nita, C.; Nobs, C. R.; Olivier, L.; Patel, Z.; Podolyák, Zs.; Rudigier, M.; Saito, T.; Shand, C.; Söderström, P.-A.; Stefan, I.; Vaquero, V.; Wimmer, K.; Xu, Z.
2018-05-01
Low-spin states of neutron-rich 84,86,88Ge were measured by in-flight γ-ray spectroscopy at 270 MeV/u at the RIKEN-RIBF facility. The exotic beams have been produced by primary 238U in-flight fission reactions and impinged on the MINOS device. MINOS combines a 10-cm long LH2 target with a Time Projection Chamber (TPC) to reconstruct the reaction vertices. The reactions were selected by the BigRIPS and the ZeroDegree spectrometers for the incoming and outgoing channels, respectively. Emitted γ radiation was detected by the NaI-array DALI2. De-excitations from the {6}1+, {4}1,2+, and {2}1,2+ states of 84,86Ge and {4}1+ and {2}1,2+ states of 88Ge were observed. The data are compared to state-of-the-art shell model and beyond-mean-field calculations. Furthermore, a candidate for a {3}1+ state of 86Ge was identified. This state plays a key role in the discussion of ground-state triaxiality of 86Ge, along with other features of the low-energy level scheme. This work was published in [1].
Management information systems. [United Kingdom
Energy Technology Data Exchange (ETDEWEB)
Hartley, D.; Spence, A.C.
1985-02-01
The successful application in the United Kingdom of the real time monitoring and control systems (MINOS) for underground mining operations, particularly in coal transport and the development of coalface monitoring (FIDO) in 1980 led naturally to the design of an operational data base for management. A User Group of experienced colliery managers produced a Management Information System (MIS) requirements specification and began the evolution of the systems of today. Twenty-four mines operate MIS in different ways from total dependency to a means of checking their manual reporting system. MIS collects useful data from all the major MINOS applications and provides a means of manually inputting other, relevant information. A wide variety of displays and reports are available to management, adjusted to meet individual requirements. The benefits from the use of MIS are difficult to quantify, since they become part of the management process. Further developments are taking place based on operational experience and requirements and taking advantage of the recent advances in computer technology. MIS is the modern management tool in British coal mining, collecting, storing, analysing and presenting accurate information upon which management decision making is based.
High performance 3D neutron transport on peta scale and hybrid architectures within APOLLO3 code
International Nuclear Information System (INIS)
Jamelot, E.; Dubois, J.; Lautard, J-J.; Calvin, C.; Baudron, A-M.
2011-01-01
APOLLO3 code is a common project of CEA, AREVA and EDF for the development of a new generation system for core physics analysis. We present here the parallelization of two deterministic transport solvers of APOLLO3: MINOS, a simplified 3D transport solver on structured Cartesian and hexagonal grids, and MINARET, a transport solver based on triangular meshes on 2D and prismatic ones in 3D. We used two different techniques to accelerate MINOS: a domain decomposition method, combined with an accelerated algorithm using GPU. The domain decomposition is based on the Schwarz iterative algorithm, with Robin boundary conditions to exchange information. The Robin parameters influence the convergence and we detail how we optimized the choice of these parameters. MINARET parallelization is based on angular directions calculation using explicit message passing. Fine grain parallelization is also available for each angular direction using shared memory multithreaded acceleration. Many performance results are presented on massively parallel architectures using more than 103 cores and on hybrid architectures using some tens of GPUs. This work contributes to the HPC development in reactor physics at the CEA Nuclear Energy Division. (author)
Tschöpe, Kati; Schøning, Cristian; Rutlin, Jørn; Grande, Tor
2012-04-01
Cathode autopsies are used frequently in the aluminum industry to investigate pot failure and the degradation of the cathode lining. The materials observed in spent pot lining (SPL) has so far been assumed to reflect the sequence of layers from the cathode to the nonreacted refractory lining as present during the operation of the cell. Here, we demonstrate that the thermal gradient in the lining is reversed during cooling and that the physical appearance of the SPL is caused both by processes taking place during operation and cooling of the shutdown cell. X-ray diffraction and microscopy of the SPL from three shutdown cells revealed that sodium metal is the main component responsible for the chemical degradation of the refractory lining. Two distinct reaction fronts were identified in the three SPL showing that sodium is penetrating deeper down into the lining than the molten fluorides from the electrolyte. The mechanisms for the transport of sodium and bath components in the refractory lining are proposed based on the experimental observations. The sodium penetration is inhibited by the formation of a viscous barrier as suggested previously, but the current findings suggest that the barrier retards diffusion of O2- and F- anions rather than Na+ as proposed previously.
Cusps enable line attractors for neural computation
International Nuclear Information System (INIS)
Xiao, Zhuocheng; Zhang, Jiwei; Sornborger, Andrew T.; Tao, Louis
2017-01-01
Here, line attractors in neuronal networks have been suggested to be the basis of many brain functions, such as working memory, oculomotor control, head movement, locomotion, and sensory processing. In this paper, we make the connection between line attractors and pulse gating in feed-forward neuronal networks. In this context, because of their neutral stability along a one-dimensional manifold, line attractors are associated with a time-translational invariance that allows graded information to be propagated from one neuronal population to the next. To understand how pulse-gating manifests itself in a high-dimensional, nonlinear, feedforward integrate-and-fire network, we use a Fokker-Planck approach to analyze system dynamics. We make a connection between pulse-gated propagation in the Fokker-Planck and population-averaged mean-field (firing rate) models, and then identify an approximate line attractor in state space as the essential structure underlying graded information propagation. An analysis of the line attractor shows that it consists of three fixed points: a central saddle with an unstable manifold along the line and stable manifolds orthogonal to the line, which is surrounded on either side by stable fixed points. Along the manifold defined by the fixed points, slow dynamics give rise to a ghost. We show that this line attractor arises at a cusp catastrophe, where a fold bifurcation develops as a function of synaptic noise; and that the ghost dynamics near the fold of the cusp underly the robustness of the line attractor. Understanding the dynamical aspects of this cusp catastrophe allows us to show how line attractors can persist in biologically realistic neuronal networks and how the interplay of pulse gating, synaptic coupling, and neuronal stochasticity can be used to enable attracting one-dimensional manifolds and, thus, dynamically control the processing of graded information.
Cusps enable line attractors for neural computation
Xiao, Zhuocheng; Zhang, Jiwei; Sornborger, Andrew T.; Tao, Louis
2017-11-01
Line attractors in neuronal networks have been suggested to be the basis of many brain functions, such as working memory, oculomotor control, head movement, locomotion, and sensory processing. In this paper, we make the connection between line attractors and pulse gating in feed-forward neuronal networks. In this context, because of their neutral stability along a one-dimensional manifold, line attractors are associated with a time-translational invariance that allows graded information to be propagated from one neuronal population to the next. To understand how pulse-gating manifests itself in a high-dimensional, nonlinear, feedforward integrate-and-fire network, we use a Fokker-Planck approach to analyze system dynamics. We make a connection between pulse-gated propagation in the Fokker-Planck and population-averaged mean-field (firing rate) models, and then identify an approximate line attractor in state space as the essential structure underlying graded information propagation. An analysis of the line attractor shows that it consists of three fixed points: a central saddle with an unstable manifold along the line and stable manifolds orthogonal to the line, which is surrounded on either side by stable fixed points. Along the manifold defined by the fixed points, slow dynamics give rise to a ghost. We show that this line attractor arises at a cusp catastrophe, where a fold bifurcation develops as a function of synaptic noise; and that the ghost dynamics near the fold of the cusp underly the robustness of the line attractor. Understanding the dynamical aspects of this cusp catastrophe allows us to show how line attractors can persist in biologically realistic neuronal networks and how the interplay of pulse gating, synaptic coupling, and neuronal stochasticity can be used to enable attracting one-dimensional manifolds and, thus, dynamically control the processing of graded information.
Fractions, Number Lines, Third Graders
Cramer, Kathleen; Ahrendt, Sue; Monson, Debra; Wyberg, Terry; Colum, Karen
2017-01-01
The Common Core State Standards for Mathematics (CCSSM) (CCSSI 2010) outlines ambitious goals for fraction learning, starting in third grade, that include the use of the number line model. Understanding and constructing fractions on a number line are particularly complex tasks. The current work of the authors centers on ways to successfully…
US line-ups outperform UK line-ups
Seale-Carlisle, Travis M.; Mickes, Laura
2016-01-01
In the USA and the UK, many thousands of police suspects are identified by eyewitnesses every year. Unfortunately, many of those suspects are innocent, which becomes evident when they are exonerated by DNA testing, often after having been imprisoned for years. It is, therefore, imperative to use identification procedures that best enable eyewitnesses to discriminate innocent from guilty suspects. Although police investigators in both countries often administer line-up procedures, the details ...
Rynne, T J
1986-09-01
Many hospital administrators and boards of directors, having overcome their initial opposition to advertising and hired a marketing professional, are wondering why their marketing programs have not accomplished all that they had hoped. The answer lies in their perception of who is responsible for marketing. Marketing is not a specialty separate from the disciplines of management--it is a basic management skill. Its goal is to satisfy the customer by providing products and services that meet the customer's needs, wants, and preferences. Line managers must understand the hospital's customers and make the critical day-to-day differences in satisfying them. They are the hospital's front-line marketers, and the marketing department's role is to support them in this function. The marketing department should develop the line managers' marketing skills by furnishing them with the appropriate tools: formats, models, examples, and instructions. In addition, the marketing staff should provide such specialized services as marketing research, ad agency management, and development of communications.
32 CFR 644.7 - Acquisition lines.
2010-07-01
... HANDBOOK Project Planning Civil Works § 644.7 Acquisition lines. (a) Tentative acquisition lines. As..., in accordance with sound real estate practices. Accordingly, fringe tracts will not be acquired until...
International Nuclear Information System (INIS)
Alfter, I.; Bodenstedt, E.; Hamer, B.; Hoff, J. van den; Knichel, W.; Muenning, H.; Piel, S.; Schueth, J.; Sajok, R.
1992-01-01
A twelve detector γ-γ directional correlation setup is described which has been designed and constructed for high precision on-line and off-line IPAC measurements. A ring of twelve BaF 2 detectors which may be replaced by Ge detectors is arranged around a superconducting magnet providing a maximum magnetic field of 4.5 T. In on-line experiments the magnetic field has the direction of the beam which passes through a central bore of the magnet. The data acquisition system stores directly the Esub(γ 1 )-Esub(γ 2 ) coincidence matrices for all 66 two-detector combinations in two 8 Mbyte RAMs, one for each of the two field directions. This allows a very fast data evaluation with a small on-line computer. The apparatus got into operation one-and-a-halve years ago and revealed excellent properties. (orig.)
Quantum oscillations in nodal line systems
Yang, Hui; Moessner, Roderich; Lim, Lih-King
2018-04-01
We study signatures of magnetic quantum oscillations in three-dimensional nodal line semimetals at zero temperature. The extended nature of the degenerate bands can result in a Fermi surface geometry with topological genus one, as well as a Fermi surface of electron and hole pockets encapsulating the nodal line. Moreover, the underlying two-band model to describe a nodal line is not unique, in that there are two classes of Hamiltonian with distinct band topology giving rise to the same Fermi-surface geometry. After identifying the extremal cyclotron orbits in various magnetic field directions, we study their concomitant Landau levels and resulting quantum oscillation signatures. By Landau-fan-diagram analyses, we extract the nontrivial π Berry phase signature for extremal orbits linking the nodal line.
Controlled Compact High Voltage Power Lines
Directory of Open Access Journals (Sweden)
Postolati V.
2016-04-01
Full Text Available Nowadays modern overhead transmission lines (OHL constructions having several significant differences from conventional ones are being used in power grids more and more widely. Implementation of compact overhead lines equipped with FACTS devices, including phase angle regulator settings (compact controlled OHL, appears to be one of the most effective ways of power grid development. Compact controlled AC HV OHL represent a new generation of power transmission lines embodying recent advanced achievements in design solutions, including towers and insulation, together with interconnection schemes and control systems. Results of comprehensive research and development in relation to 110–500kV compact controlled power transmission lines together with theoretical basis, substantiation, and methodological approaches to their practical application are presented in the present paper.
Linear scleroderma following Blaschko′s lines
Directory of Open Access Journals (Sweden)
Mukhopadhyay Amiya
2005-01-01
Full Text Available Blaschko′s lines form a pattern, which many diseases are found to follow, but linear scleroderma following Blaschko′s lines is a controversial entity rarely reported in the literature. A 24-year-old man presented with multiple linear, atrophic, hyperpigmented lesions punctuated by areas of depigmentations on the left half of the trunk distributed on the anterior, lateral and posterior aspects. The lesions were distributed in a typical S-shaped line. Antinuclear antibody and antihistone antibody tests were negative. Histopathological examination of the skin from the affected area showed features suggestive of scleroderma. Here, we present a case of linear scleroderma following Blaschko′s lines in a male patient - an entity reported only three times so far.
International Nuclear Information System (INIS)
Peterson, B. M.; Denney, K. D.; De Rosa, G.; Grier, C. J.; Pogge, R. W.; Kochanek, C. S.; Bentz, M. C.; Vestergaard, M.; Kilerci-Eser, E.; G. Galilei, Università di Padova, Vicolo dell'Osservatorio 3 I-35122, Padova (Italy))" data-affiliation=" (Dipartimento di Fisica e Astronomia G. Galilei, Università di Padova, Vicolo dell'Osservatorio 3 I-35122, Padova (Italy))" >Dalla Bontà, E.; G. Galilei, Università di Padova, Vicolo dell'Osservatorio 3 I-35122, Padova (Italy))" data-affiliation=" (Dipartimento di Fisica e Astronomia G. Galilei, Università di Padova, Vicolo dell'Osservatorio 3 I-35122, Padova (Italy))" >Ciroi, S.
2013-01-01
The narrow [O III] λλ4959, 5007 emission-line fluxes in the spectrum of the well-studied Seyfert 1 galaxy NGC 5548 are shown to vary with time. From this we show that the narrow-line-emitting region has a radius of only 1-3 pc and is denser (n e ∼ 10 5 cm –3 ) than previously supposed. The [O III] line width is consistent with virial motions at this radius given previous determinations of the black hole mass. Since the [O III] emission-line flux is usually assumed to be constant and is therefore used to calibrate spectroscopic monitoring data, the variability has ramifications for the long-term secular variations of continuum and emission-line fluxes, though it has no effect on shorter-term reverberation studies. We present corrected optical continuum and broad Hβ emission-line light curves for the period 1988-2008.
Energy Technology Data Exchange (ETDEWEB)
Peterson, B. M.; Denney, K. D.; De Rosa, G.; Grier, C. J.; Pogge, R. W.; Kochanek, C. S. [Department of Astronomy, The Ohio State University, 140 W 18th Avenue, Columbus, OH 43210 (United States); Bentz, M. C. [Department of Physics and Astronomy, Georgia State University, 25 Park Place, Suite 610, Atlanta, GA 30303 (United States); Vestergaard, M.; Kilerci-Eser, E. [Dark Cosmology Centre, Niels Bohr Institute, University of Copenhagen, Juliane Maries Vej 30, DK-2100 Copenhagen (Denmark); Dalla Bontà, E.; Ciroi, S. [Dipartimento di Fisica e Astronomia " G. Galilei," Università di Padova, Vicolo dell' Osservatorio 3 I-35122, Padova (Italy)
2013-12-20
The narrow [O III] λλ4959, 5007 emission-line fluxes in the spectrum of the well-studied Seyfert 1 galaxy NGC 5548 are shown to vary with time. From this we show that the narrow-line-emitting region has a radius of only 1-3 pc and is denser (n {sub e} ∼ 10{sup 5} cm{sup –3}) than previously supposed. The [O III] line width is consistent with virial motions at this radius given previous determinations of the black hole mass. Since the [O III] emission-line flux is usually assumed to be constant and is therefore used to calibrate spectroscopic monitoring data, the variability has ramifications for the long-term secular variations of continuum and emission-line fluxes, though it has no effect on shorter-term reverberation studies. We present corrected optical continuum and broad Hβ emission-line light curves for the period 1988-2008.
49 CFR 192.377 - Service lines: Copper.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Service lines: Copper. 192.377 Section 192.377 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... § 192.377 Service lines: Copper. Each copper service line installed within a building must be protected...
Spectral Line Shapes in Plasmas and Gases
International Nuclear Information System (INIS)
Oks, E.; Dalimier, D.; Stamm, R.; Stehle, CH.; Gonzalez, M.A.
2011-01-01
The subject of spectral line shapes (SLS), a.k.a. spectral line broadening, which embraces both shapes and shifts of spectral lines, is of both fundamental and practical importance. On the fundamental side, the study of the spectral line profiles reveals the underlying atomic and molecular interactions. On the practical side, the spectral line profiles are employed as powerful diagnostic tools for various media, such as neutral gases, technological gas discharges, magnetically confined plasmas for fusion, laser- and Z-pinch-produced plasmas (for fusion and other purposes), astrophysical plasmas (most importantly, solar plasmas), and planetary atmospheres. The research area covered by this special issue includes both the SLS dominated by various electric fields (including electron and ion micro fields in strongly ionized plasmas) and the SLS controlled by neutral particles. In the physical slang, the former is called plasma broadening while the latter is called neutral broadening (of course, the results of neutral broadening apply also to the spectral line broadening in neutral gases)
Linear rotary optical delay lines
Guerboukha, Hichem; Qu, Hang; Skorobogatiy, Maksim
2016-03-01
We present a semi-analytical solution for the design of a high-speed rotary optical delay line that use a combination of two rotating curvilinear reflectors. We demonstrate that it is possible to design an infinite variety of the optical delay lines featuring linear dependence of the optical delay on the rotation angle. This is achieved via shape optimization of the rotating reflector surfaces. Moreover, a convenient spatial separation of the incoming and outgoing beams is possible. For the sake of example, we present blades that fit into a circle of 10cm diameter. Finally, a prototype of a rotary delay line is fabricated using CNC machining, and its optical properties are characterized.
International Nuclear Information System (INIS)
Schreier, Franz; Gimeno García, Sebastián; Hedelt, Pascal; Hess, Michael; Mendrok, Jana; Vasquez, Mayte; Xu, Jian
2014-01-01
A suite of programs for high resolution infrared-microwave atmospheric radiative transfer modeling has been developed with emphasis on efficient and reliable numerical algorithms and a modular approach appropriate for simulation and/or retrieval in a variety of applications. The Generic Atmospheric Radiation Line-by-line Infrared Code — GARLIC — is suitable for arbitrary observation geometry, instrumental field-of-view, and line shape. The core of GARLIC's subroutines constitutes the basis of forward models used to implement inversion codes to retrieve atmospheric state parameters from limb and nadir sounding instruments. This paper briefly introduces the physical and mathematical basics of GARLIC and its descendants and continues with an in-depth presentation of various implementation aspects: An optimized Voigt function algorithm combined with a two-grid approach is used to accelerate the line-by-line modeling of molecular cross sections; various quadrature methods are implemented to evaluate the Schwarzschild and Beer integrals; and Jacobians, i.e. derivatives with respect to the unknowns of the atmospheric inverse problem, are implemented by means of automatic differentiation. For an assessment of GARLIC's performance, a comparison of the quadrature methods for solution of the path integral is provided. Verification and validation are demonstrated using intercomparisons with other line-by-line codes and comparisons of synthetic spectra with spectra observed on Earth and from Venus. - Highlights: • High resolution infrared-microwave radiative transfer model. • Discussion of algorithmic and computational aspects. • Jacobians by automatic/algorithmic differentiation. • Performance evaluation by intercomparisons, verification, validation
Line Width Recovery after Vectorization of Engineering Drawings
Directory of Open Access Journals (Sweden)
Gramblička Matúš
2016-12-01
Full Text Available Vectorization is the conversion process of a raster image representation into a vector representation. The contemporary commercial vectorization software applications do not provide sufficiently high quality outputs for such images as do mechanical engineering drawings. Line width preservation is one of the problems. There are applications which need to know the line width after vectorization because this line attribute carries the important semantic information for the next 3D model generation. This article describes the algorithm that is able to recover line width of individual lines in the vectorized engineering drawings. Two approaches are proposed, one examines the line width at three points, whereas the second uses a variable number of points depending on the line length. The algorithm is tested on real mechanical engineering drawings.
The elettra beam line control system
International Nuclear Information System (INIS)
Mignacco, M.; Abrami, A.; Dequal, Z.
1994-01-01
Elettra is a third generation Synchrotron Light Source located in Trieste (Italy). It consists of a full energy linac injector and a storage ring with beam energies between 1.5 and 2 GeV. The facility is scheduled to be operational by end 1993. For the whole project 22 beam lines from insertion devices are foreseen, each of them is composed of a large number of measurement and controls instruments, most of them embedded in intelligent devices; in addition each beam line can be considered unique compared to the others, having been designed to provide a different kind of synchrotron radiation. This results in a large not homogenous environment where more than 200,000 physical points have to be controlled. A joint team composed of Softeco Sismat and Digital Equipment has developed a fully automated beam line control system able to give full remote controls, with different kind of access rights, to beam line users and beam line specialists as well as a full integration with experiment control systems. ((orig.))
Transfer line tests take centre stage
Katarina Anthony
2014-01-01
Last weekend, proton beams came knocking on the LHC's door. Shooting from the SPS and into the two LHC transfer lines, the proton beams were dumped just short of entering the accelerator. The upper plot shows the trajectory of the first TI2 beam, which reached the end of the transfer line in a single attempt after 18 months of technical stop. Below, a smoother beam trajectory in TI2 after some corrections. For the first time since Run 1, the SPS to LHC transfer lines (TI8 and TI2) transported proton beams just short of the LHC. "We tested the beam instrumentation, the devices that measure the beam intensity, transverse beam profile, position and losses, as well as the beam collimators along the transfer lines," says Reyes Alemany Fernandez, the engineer in charge of the LHC. "We were also able to spot possible bottle necks in the beam trajectory and to perform the first optics measurements." Once the beams arrived at the transfer line beam dumps...
International Nuclear Information System (INIS)
Marathe, S.G.; Sood, D.D.
1991-01-01
In-line/on-line monitoring of various parameters such as uranium-plutonium-fission product concentration, acidity, density etc. plays an important role in quickly understanding the efficiency of processes in a reprocessing plant. Efforts in studying and installation of such analytical instruments are going on since more than three decades with adaptation of newer methods and technologies. A review on the developement of in-line analytical instrumentation was carried out in this laboratory about two decades ago. This report presents a very short literature survey of the work in the last two decades. The report includes an outline of principles of the main techniques employed in the in-line/on-line monitoring. (author). 77 refs., 6 tabs
Specialized computer system to diagnose critical lined equipment
Yemelyanov, V. A.; Yemelyanova, N. Y.; Morozova, O. A.; Nedelkin, A. A.
2018-05-01
The paper presents data on the problem of diagnosing the lining condition at the iron and steel works. The authors propose and describe the structure of the specialized computer system to diagnose critical lined equipment. The relative results of diagnosing lining condition by the basic system and the proposed specialized computer system are presented. To automate evaluation of lining condition and support in making decisions regarding the operation mode of the lined equipment, the specialized software has been developed.
Moving contact lines on vibrating surfaces
Solomenko, Zlatko; Spelt, Peter; Scott, Julian
2017-11-01
Large-scale simulations of flows with moving contact lines for realistic conditions generally requires a subgrid scale model (analyses based on matched asymptotics) to account for the unresolved part of the flow, given the large range of length scales involved near contact lines. Existing models for the interface shape in the contact-line region are primarily for steady flows on homogeneous substrates, with encouraging results in 3D simulations. Introduction of complexities would require further investigation of the contact-line region, however. Here we study flows with moving contact lines on planar substrates subject to vibrations, with applications in controlling wetting/dewetting. The challenge here is to determine the change in interface shape near contact lines due to vibrations. To develop further insight, 2D direct numerical simulations (wherein the flow is resolved down to an imposed slip length) have been performed to enable comparison with asymptotic theory, which is also developed further. Perspectives will also be presented on the final objective of the work, which is to develop a subgrid scale model that can be utilized in large-scale simulations. The authors gratefully acknowledge the ANR for financial support (ANR-15-CE08-0031) and the meso-centre FLMSN for use of computational resources. This work was Granted access to the HPC resources of CINES under the allocation A0012B06893 made by GENCI.
Aristolactama y esteróles del tallo de piper chiadoense
Peña O., Luz Angela; P. de Díaz, Aura M.
2010-01-01
Del extracto etanólico del tallo de Piper chiadoense Junker (Piperaceae) fueron aislados por métodos cromatográficos la aristolactama identificada como lactama del ácido 10- mino-3,4-dimetoxifenantreno-l-carboxílico (cepharanone B); campesterol; estigmasterol y B-sitosterol. Sus estructuras fueron determinadas por métodos espectroscópicos y por comparación con datos reportados en la literatura.
Line formation in microturbulent magnetic fields
International Nuclear Information System (INIS)
Domke, H.; Pavlov, G.G.
1979-01-01
The formation of Zeeman lines in Gaussian microturbulent magnetic fields is considered assuming LTE. General formulae are derived for the local mean values of the transfer matrix elements. The cases of one-dimensional (longitudinal), isotropic, and two-dimensional (transversal) magnetic microturbulence are studied in some detail. Asymptotic formulae are given for small mean as well as for small microturbulent magnetic fields. Characteristic effects of magnetic microturbulence on the transfer coefficients are: (i) the broadening of the frequency contours, although only for the case of longitudinal Zeeman effect and longitudinal magnetic microturbulence this effect can be described analogous to Doppler broadening, (ii) the appearance of a pseudo-Zeeman structure for nonlongitudinal magnetic microturbulence, (iii) the reduction of maximal values of circular polarization, and (iv) the appearance of characteristic linear polarization effects due to the anisotropy of the magnetic microturbulence. Line contours and polarization of Zeeman triplets are computed for Milne-Eddington atmospheres. It is shown that magnetic intensification due to microturbulent magnetic fields may be much more efficient than that due to regular fields. The gravity center of a Zeeman line observed in circularly polarized light remains a reasonable measure of the line of sight component of the mean magnetic field for a line strength eta 0 < approx. 2. For saturated lines, the gravity center distance depends significantly on the magnetic microturbulence and its anisotropy. The influence of magnetic microturbulence on the ratio of longitudinal field magnetographic signals shows that unique conclusions about the magnetic microstructure can be drawn from the line ratio measurements only in combination with further spectroscopic data or physical reasoning. (orig.)
The H line: a brand new beam line for fundamental physics at the J-PARC muon facility
International Nuclear Information System (INIS)
Kawamura, N; Shimomura, K; Miyake, Y; Toyoda, A; Saito, N; Mihara, S; Aoki, M
2013-01-01
The muon facility, J-PARC (Muon Science Establishment; MUSE), has been operated since first beam in 2008. Starting with a 200 kW proton beam, the beam intensity has reached 3×10 6 / muons/s, the most intense pulsed muon beam in the world. A 2 cm thick graphite target permits the extraction of four secondary muon beams. A brand new beam line, the H line, is planned to be constructed. The new beam line is designed to have a large acceptance, will provide the ability to tune the momentum, and use a kicker magnet and/or Wien filter. This beam line will provide an intense beam for experiments that require high statistics and must occupy the experimental areas for a relatively long period.
Linear morphoea follows Blaschko's lines.
Weibel, L; Harper, J I
2008-07-01
The aetiology of morphoea (or localized scleroderma) remains unknown. It has previously been suggested that lesions of linear morphoea may follow Blaschko's lines and thus reflect an embryological development. However, the distribution of linear morphoea has never been accurately evaluated. We aimed to identify common patterns of clinical presentation in children with linear morphoea and to establish whether linear morphoea follows the lines of Blaschko. A retrospective chart review of 65 children with linear morphoea was performed. According to clinical photographs the skin lesions of these patients were plotted on to standardized head and body charts. With the aid of Adobe Illustrator a final figure was produced including an overlay of all individual lesions which was used for comparison with the published lines of Blaschko. Thirty-four (53%) patients had the en coup de sabre subtype, 27 (41%) presented with linear morphoea on the trunk and/or limbs and four (6%) children had a combination of the two. In 55 (85%) children the skin lesions were confined to one side of the body, showing no preference for either left or right side. On comparing the overlays of all body and head lesions with the original lines of Blaschko there was an excellent correlation. Our data indicate that linear morphoea follows the lines of Blaschko. We hypothesize that in patients with linear morphoea susceptible cells are present in a mosaic state and that exposure to some trigger factor may result in the development of this condition.
Dynamics of the Molten Contact Line
Sonin, Ain A.; Duthaler, Gregg; Liu, Michael; Torresola, Javier; Qiu, Taiqing
1999-01-01
The purpose of this program is to develop a basic understanding of how a molten material front spreads over a solid that is below its melting point, arrests, and freezes. Our hope is that the work will contribute toward a scientific knowledge base for certain new applications involving molten droplet deposition, including the "printing" of arbitrary three-dimensional objects by precise deposition of individual molten microdrops that solidify after impact. Little information is available at this time on the capillarity-driven motion and arrest of molten contact line regions. Schiaffino and Sonin investigated the arrest of the contact line of a molten microcrystalline wax spreading over a subcooled solid "target" of the same material. They found that contact line arrest takes place at an apparent liquid contact angle that depends primarily on the Stefan number S=c(T(sub f) -T(sub t)/L based on the temperature difference between the fusion point and the target temperature, and proposed that contact line arrest occurs when the liquid's dynamic contact angle approaches the angle of attack of the solidification front just behind the contact line. They also showed, however, that the conventional continuum equations and boundary conditions have no meaningful solution for this angle. The solidification front angle is determined by the heat flux just behind the contact line, and the heat flux is singular at that point. By comparing experiments with numerical computations, Schiaffino and Sonin estimated that the conventional solidification model must break down within a distance of order 0.1 - 1 microns of the contact line. The physical mechanism for this breakdown is as yet undetermined, and no first-principles theory exists for the contact angle at arrest. Schiaffino and Sonin also presented a framework for understanding how to moderate Weber number molten droplet deposition in terms of similarity laws and experimentation. The study is based on experiments with three molten
Modification of beam lines at VEC
Energy Technology Data Exchange (ETDEWEB)
Shoor, Bivas; Chakraborty, P S; Mallik, C; Bhandari, R K [Variable Energy Cyclotron Centre, Calcutta (India)
1997-12-01
From the experience of light ion beam transportation through the Variable Energy Cyclotron beam line, it was observed that the beam line performance has to be improved in view of heavy ion acceleration program at the centre. The aim of this work was to study the feasibility of reducing the number of operational parameters without hampering the beam transmission and at the same time, to improve the vacuum of the beam line by reducing the hardware 2 refs., 1 fig.
Department of Veterans Affairs — The caring responders at the Veterans Crisis Line are specially trained and experienced in helping Veterans of all ages and circumstances. Some of the responders are...
Strategic service-line planning. Building competitive advantage.
Greenspan, Elizabeth; Krentz, Susanna E; O'Neill, Molly K
2003-12-01
Service-line planning requires a healthcare organization to develop a business plan for each of its service lines. Successful service-line planning requires top leadership support, a willingness to allocate resources, the development of support mechanisms, the active support and involvement of physicians, and management commitment and accountability during implementation.
Power flow studies of magnetically insulated lines
International Nuclear Information System (INIS)
McDaniel, D.H.; Poukey, J.W.; Bergeron, K.D.; VanDevender, J.P.; Johnson, D.L.
1977-01-01
The designs for relativistic electron beam accelerators with power levels of 20 to 100 TW are greatly restricted by the inductance of a single diode of reasonable size. This fact leads to modular designs of very large accelerators. One concept uses several small insulators at a large radius arranged around the accelerator center. The total effective inductance is then low, but the energy must then be transported by self-magnetic insulated vacuum lines to the target volume. A triplate vacuum line configuration eases many mechanical support problems and allows more A-K gaps or feeds to be packaged around a given radius. This type of vacuum transmission line was chosen for initial experiments at Sandia. The experiments were conducted on the MITE (Magnetically Insulated Transmission Experiment) accelerator. The water pulse forming lines are connected to a vacuum triplate line through a conventional stacked insulator. Diagnostics on the experiment consisted of: (1) input V; (2) input I; (3) I monitors at the input, middle, and output of both the center conductor and ground plane of the transmission line; (4) magnetic energy analyzer to view peak electron energy in the A-K gap; (5) calorimetry; and (6) Faraday cups to look at electron current flowing across the transmission line. The main goal of the experiment is to obtain input impedance of the transmission line as a function of voltage and to measure electron loss currents. These measurements are compared to theoretical models for the input impedance and energy losses
Reconstruction of railway energy lines; Rekonstruktion von Bahnenergieleitungen
Energy Technology Data Exchange (ETDEWEB)
Rothe, Matthias [DB Energie Gmbh, Berlin (Germany); Wahlen, Manfred [DB Energie Gmbh, Koeln (Germany)
2013-06-15
As is the case for other overhead lines, 110 kV railway energy lines are assumed to have a service life of 80 years. When this service life ends or the lines are adapted to the state of the art as necessary, all components of the overhead line are renewed. For the reconstruction of railway energy lines, the specifications laid down in planning and environmental laws, operational management aspects and the local ambient and development situation are decisive project planning parameters. (orig.)
Copper isotope fractionation in acid mine drainage
Kimball, B.E.; Mathur, R.; Dohnalkova, A.C.; Wall, A.J.; Runkel, R.L.; Brantley, S.L.
2009-01-01
We measured the Cu isotopic composition of primary minerals and stream water affected by acid mine drainage in a mineralized watershed (Colorado, USA). The ??65Cu values (based on 65Cu/63Cu) of enargite (??65Cu = -0.01 ?? 0.10???; 2??) and chalcopyrite (??65Cu = 0.16 ?? 0.10???) are within the range of reported values for terrestrial primary Cu sulfides (-1??? waters (1.38??? ??? ??65Cu ??? 1.69???). The average isotopic fractionation (??aq-min = ??65Cuaq - ??65Cumin, where the latter is measured on mineral samples from the field system), equals 1.43 ?? 0.14??? and 1.60 ?? 0.14??? for chalcopyrite and enargite, respectively. To interpret this field survey, we leached chalcopyrite and enargite in batch experiments and found that, as in the field, the leachate is enriched in 65Cu relative to chalcopyrite (1.37 ?? 0.14???) and enargite (0.98 ?? 0.14???) when microorganisms are absent. Leaching of minerals in the presence of Acidithiobacillus ferrooxidans results in smaller average fractionation in the opposite direction for chalcopyrite (??aq-mino = - 0.57 ?? 0.14 ???, where mino refers to the starting mineral) and no apparent fractionation for enargite (??aq-mino = 0.14 ?? 0.14 ???). Abiotic fractionation is attributed to preferential oxidation of 65Cu+ at the interface of the isotopically homogeneous mineral and the surface oxidized layer, followed by solubilization. When microorganisms are present, the abiotic fractionation is most likely not seen due to preferential association of 65Cuaq with A. ferrooxidans cells and related precipitates. In the biotic experiments, Cu was observed under TEM to occur in precipitates around bacteria and in intracellular polyphosphate granules. Thus, the values of ??65Cu in the field and laboratory systems are presumably determined by the balance of Cu released abiotically and Cu that interacts with cells and related precipitates. Such isotopic signatures resulting from Cu sulfide dissolution should be useful for acid mine drainage
Signal integrity analysis on discontinuous microstrip line
International Nuclear Information System (INIS)
Qiao, Qingyang; Dai, Yawen; Chen, Zipeng
2013-01-01
In high speed PCB design, microstirp lines were used to control the impedance, however, the discontinuous microstrip line can cause signal integrity problems. In this paper, we use the transmission line theory to study the characteristics of microstrip lines. Research results indicate that the discontinuity such as truncation, gap and size change result in the problems such as radiation, reflection, delay and ground bounce. We change the discontinuities to distributed parameter circuits, analysed the steady-state response and transient response and the phase delay. The transient response cause radiation and voltage jump.
Moving droplets : The measurement of contact lines
Poelma, C.; Franken, M.J.Z.; Kim, H.; Westerweel, J.
2014-01-01
Contact lines are the locations where a gas, liquid and a solid meet. From everyday experience we know that such contact lines can be mobile, for example in the case of a water droplet sliding over a glass surface. However, the continuum description of the flow towards or away from a contact line
49 CFR 192.375 - Service lines: Plastic.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Service lines: Plastic. 192.375 Section 192.375... § 192.375 Service lines: Plastic. (a) Each plastic service line outside a building must be installed... terminate above ground level and outside the building, if— (i) The above ground level part of the plastic...
Variety of Polarized Line Profiles in Interacting Supernovae
Hoffman, Jennifer L.; Huk, L. N.; Peters, C. L.
2013-01-01
The dense circumstellar material that creates strong emission lines in the spectra of interacting supernovae also gives rise to complex line polarization behavior. Viewed in polarized light, the emission line profiles of these supernovae encode information about the geometrical and optical characteristics of their surrounding circumstellar material (CSM) that is inaccessible by other observational techniques. To facilitate quantitative interpretation of these spectropolarimetric signatures, we have created a large grid of model polarized line profiles using a three-dimensional radiative transfer code that simulates polarization via electron and resonant/fluorescent line scattering. The simulated polarized lines take on an array of profile shapes that vary with viewing angle and CSM properties. We present the major results from the grid and investigate the dependence of polarized line profiles on CSM characteristics including temperature, optical depth, and geometry. These results will allow more straightforward interpretation of polarized line profiles in interacting supernovae than has previously been possible. This research is supported by the National Science Foundation through the AAG program and the XSEDE collaboration, and uses the resources of the Texas Advanced Computing Center.
Stitch and hem and line and flight
Thorp, John Daniel
Stitch and hem and line and flight appears in four formats. There is this present one, which adheres to the manuscript design requirements as outlined by The Graduate School at The University of Utah; there is another which is a book six inches high by nine inches wide, printed in three colors, with text aligned to its gutter; and there is a broadside printed from the same forms of standing metal type on a single twelve-inch-high by nineteen-inch-wide page, where all spreads are registered to the same points so that all lines of all sections overlap exactly, excluding the last lines of the longest section, which are left immediately readable. The second and the third formats were produced in editions of fifty each, and copies are available to the reader through the Special Collections Library at the J. Willard Marriott Library. The text in the book you're holding is built from scans taken from the original letterpress pages, and so honors typos not caught before production during proofreading, but does not honor the final runs of production which overprint eight typos and overprint one duplicated "no." The text here stands as an uncorrected and reformatted transcript of the letterpress-printed pages, since all "characters must be clear and sharp. Smudged, indistinct, or blurred letters are not acceptable." The present format cannot ask (at least not in the same way) if the techniques and repetitive labor of hand printing can be read just as one might read any of the other more familiar small crises in a work: the line break, the influence of a culture or history on that work, anagnorisis, exegesis, etc. The present format doesn't seem to ask questions like: what happens to a love song when you can't read it or hear it? How does a line or letter make itself mean when cast in metal, stood up and pressed onto paper? Still, the present format is concerned with how a line sits on a page and how a line is like love is like highs is like sand. The text all these formats
International Nuclear Information System (INIS)
Vallee, O.; Ranson, P.; Chapelle, J.
1977-01-01
AI line broadening was studied from collisions between neutral argon atoms (3p 5 4p-3p 5 4s transitions) in a weakly ionised plasma jet (neutral atoms temperature T 0 approximately 4000K, electrons temperature Tsub(e) approximately 6000K, electronic density Nsub(e) 15 cm -3 , ionisation rate α -4 , and pressure range from 1 to 3 kg/cm 2 ). A satisfactory description of Van der Waals broadened lines is obtained by means of a Lennard-Jones potential. Measurement of line widths whose corresponding transitions occur on resonant levels, gives with relatively good accuracy the oscillator strength of the argon resonance lines [fr
Spent Pot Lining Characterization Framework
Ospina, Gustavo; Hassan, Mohamed I.
2017-09-01
Spent pot lining (SPL) management represents a major concern for aluminum smelters. There are two key elements for spent pot lining management: recycling and safe storage. Spent pot lining waste can potentially have beneficial uses in co-firing in cement plants. Also, safe storage of SPL is of utmost importance. Gas generation of SPL reaction with water and ignition sensitivity must be studied. However, determining the feasibility of SPL co-firing and developing the required procedures for safe storage rely on determining experimentally all the necessary SPL properties along with the appropriate test methods, recognized by emissions standards and fire safety design codes. The applicable regulations and relevant SPL properties for this purpose are presented along with the corresponding test methods.
Correction of UBV Photometry for Emission Lines
Directory of Open Access Journals (Sweden)
Skopal A.
2003-12-01
Full Text Available We investigate the effect on U,B,V magnitudes of the removal of emission lines from the spectra of some symbiotic stars and novae during their nebular phases. We approach this problem by the precise reconstruction of the composite UV/optical continuum and the line spectrum. The corrections ΔU, ΔB and ΔV are determined from the ratio of fluxes with and without emission lines. We demonstrate the effect for symbiotic nova V1016 Cyg during its nebular phase. We find that about 68%, 78% and 66% of the observed flux in the U, B and V filters is radiated in the emission lines. The effect should be taken into account before using the observed color indices of emission-line objects for diagnosis of their radiation in the continuum.
Response function of a moving contact line
Perrin, H.; Belardinelli, D.; Sbragaglia, M.; Andreotti, B.
2018-04-01
The hydrodynamics of a liquid-vapor interface in contact with a heterogeneous surface is largely impacted by the presence of defects at the smaller scales. Such defects introduce morphological disturbances on the contact line and ultimately determine the force exerted on the wedge of liquid in contact with the surface. From the mathematical point of view, defects introduce perturbation modes, whose space-time evolution is governed by the interfacial hydrodynamic equations of the contact line. In this paper we derive the response function of the contact line to such generic perturbations. The contact line response may be used to design simplified one-dimensional time-dependent models accounting for the complexity of interfacial flows coupled to nanoscale defects, yet offering a more tractable mathematical framework to explore contact line motion through a disordered energy landscape.
RF and microwave coupled-line circuits
Mongia, R K; Bhartia, P; Hong, J; Gupta, K C
2007-01-01
This extensively revised edition of the 1999 Artech House classic, RF and Microwave Coupled-Line Circuits, offers you a thoroughly up-to-date understanding of coupled line fundamentals, explaining their applications in designing microwave and millimeter-wave components used in today's communications, microwave, and radar systems. The Second Edition includes a wealth of new material, particularly relating to applications. You find brand new discussions on a novel simple design technique for multilayer coupled circuits, high pass filters using coupled lines, software packages used for filter des
FB Line Basis for Interim Operation
International Nuclear Information System (INIS)
Shedrow, B.
1998-01-01
The safety analysis of the FB-Line Facility indicates that the operation of FB-Line to support the current mission does not present undue risk to the facility and co-located workers, general public, or the environment
Line intensities for diagnosing laser-produced plasmas
International Nuclear Information System (INIS)
Kauffman, R.L.; Matthews, D.L.; Lee, R.W.; Whitten, B.L.; Kilkenny, J.D.
1983-01-01
We have measured relative line intensities of the K x-ray spectra of Si, Cl, and Ca from laser-produced plasmas to assess their usefulness as a plasma diagnostic. The different elements are added at low concentrations to CH disks which are irradiated at 5 x 10 14 W/cm 2 with a 0.53 μm laser pulse of 20 Joules at 1 nsec. The concentration of each element is kept low in order not to change the Z of the plasma, and therefore the plasma dynamics. The various spectra are measured with a time-resolved spectrograph to obtain line intensities as a function of time over the length of the laser pulse. These relative intensities of various He-like and H-like lines are compared with calculations from a steady-state level population code. The results give good consistency among the various line ratios. Agreement is not as good for analysis of the Li-like satellite lines. Modelling of the Li-like lines need further investigation. 10 references, 9 figures
HOT GAS LINES IN T TAURI STARS
International Nuclear Information System (INIS)
Ardila, David R.; Herczeg, Gregory J.; Gregory, Scott G.; Hillenbrand, Lynne A.; Ingleby, Laura; Bergin, Edwin; Bethell, Thomas; Calvet, Nuria; France, Kevin; Brown, Alexander; Edwards, Suzan; Johns-Krull, Christopher; Linsky, Jeffrey L.; Yang, Hao; Valenti, Jeff A.; Abgrall, Hervé; Alexander, Richard D.; Brown, Joanna M.; Espaillat, Catherine; Hussain, Gaitee
2013-01-01
For Classical T Tauri Stars (CTTSs), the resonance doublets of N V, Si IV, and C IV, as well as the He II 1640 Å line, trace hot gas flows and act as diagnostics of the accretion process. In this paper we assemble a large high-resolution, high-sensitivity data set of these lines in CTTSs and Weak T Tauri Stars (WTTSs). The sample comprises 35 stars: 1 Herbig Ae star, 28 CTTSs, and 6 WTTSs. We find that the C IV, Si IV, and N V lines in CTTSs all have similar shapes. We decompose the C IV and He II lines into broad and narrow Gaussian components (BC and NC). The most common (50%) C IV line morphology in CTTSs is that of a low-velocity NC together with a redshifted BC. For CTTSs, a strong BC is the result of the accretion process. The contribution fraction of the NC to the C IV line flux in CTTSs increases with accretion rate, from ∼20% to up to ∼80%. The velocity centroids of the BCs and NCs are such that V BC ∼> 4 V NC , consistent with the predictions of the accretion shock model, in at most 12 out of 22 CTTSs. We do not find evidence of the post-shock becoming buried in the stellar photosphere due to the pressure of the accretion flow. The He II CTTSs lines are generally symmetric and narrow, with FWHM and redshifts comparable to those of WTTSs. They are less redshifted than the CTTSs C IV lines, by ∼10 km s –1 . The amount of flux in the BC of the He II line is small compared to that of the C IV line, and we show that this is consistent with models of the pre-shock column emission. Overall, the observations are consistent with the presence of multiple accretion columns with different densities or with accretion models that predict a slow-moving, low-density region in the periphery of the accretion column. For HN Tau A and RW Aur A, most of the C IV line is blueshifted suggesting that the C IV emission is produced by shocks within outflow jets. In our sample, the Herbig Ae star DX Cha is the only object for which we find a P-Cygni profile in the C IV
Line-breaking algorithm enhancement in inverse typesetting paradigma
Directory of Open Access Journals (Sweden)
Jan Přichystal
2007-01-01
Full Text Available High quality text preparing using computer desktop publishing systems usually uses line-breaking algorithm which cannot make provision for line heights and typeset paragraph accurately when composition width, page break, line index or other object appears. This article deals with enhancing of line-breaking algorithm based on optimum-fit algorithm. This algorithm is enhanced with calculation of immediate typesetting width and thus solves problem of forced change. Line-breaking algorithm enhancement causes expansion potentialities of high-quality typesetting in cases that have not been yet covered with present typesetting systems.
Berk, Alexander; Conforti, Patrick; Hawes, Fred
2015-05-01
A Line-By-Line (LBL) option is being developed for MODTRAN6. The motivation for this development is two-fold. Firstly, when MODTRAN is validated against an independent LBL model, it is difficult to isolate the source of discrepancies. One must verify consistency between pressure, temperature and density profiles, between column density calculations, between continuum and particulate data, between spectral convolution methods, and more. Introducing a LBL option directly within MODTRAN will insure common elements for all calculations other than those used to compute molecular transmittances. The second motivation for the LBL upgrade is that it will enable users to compute high spectral resolution transmittances and radiances for the full range of current MODTRAN applications. In particular, introducing the LBL feature into MODTRAN will enable first-principle calculations of scattered radiances, an option that is often not readily available with LBL models. MODTRAN will compute LBL transmittances within one 0.1 cm-1 spectral bin at a time, marching through the full requested band pass. The LBL algorithm will use the highly accurate, pressure- and temperature-dependent MODTRAN Padé approximant fits of the contribution from line tails to define the absorption from all molecular transitions centered more than 0.05 cm-1 from each 0.1 cm-1 spectral bin. The beauty of this approach is that the on-the-fly computations for each 0.1 cm-1 bin will only require explicit LBL summing of transitions centered within a 0.2 cm-1 spectral region. That is, the contribution from the more distant lines will be pre-computed via the Padé approximants. The status of the LBL effort will be presented. This will include initial thermal and solar radiance calculations, validation calculations, and self-validations of the MODTRAN band model against its own LBL calculations.
Measurements of weak conversion lines
International Nuclear Information System (INIS)
Feoktistov, A.I.; Frantsev, Yu.E.
1979-01-01
Described is a new methods for measuring weak conversion lines with the help of the β spectrometer of the π √ 2 type which permits to increase the reliability of the results obtained. According to this method the measurements were carried out by short series with the storage of the information obtained on the punched tape. The spectrometer magnetic field was stabilized during the measuring of the conversion spectra with the help of three nmr recorders. Instead of the dependence of the pulse calculation rate on the magnetic field value was measured the dependence of the calculation rate on the value of the voltage applied between the source and the spectrometer chamber. A short description of the automatic set-up for measuring conversion lines according to the method proposed is given. The main set-up elements are the voltage multiplexer timer, printer, scaler and the pulse analyzer. With the help of the above methods obtained is the K 1035, 8 keV 182 Ta line. It is obtained as a result of the composition of 96 measurement series. Each measurement time constitutes 640 s 12 points are taken on the line
Handbook of spectral lines in diamond
Dischler, Bernhard
2012-01-01
This handbook is a breakthrough in the understanding of the large number of spectral lines in diamond. Data on more than 2000 lines and bands are presented in 200 tables, including many unpublished results. With a novel organization scheme, the search for a specific line is greatly simplified as a benefit for researchers and students. In order to meet the interest in the understanding of the spectra, structure assignments for 80 % of the lines are given, of which 15 % only were published before. The majority of the structures for the 300 centers is explained in most cases for the first time. A key instrument in the interpretation is the analysis by donor-acceptor pair transitions. In a special chapter 95 such centers are listed and discussed, of which only two have been published before, the first one by the present author in 1994.
DEFF Research Database (Denmark)
present proceedings from the UPGEM conference "Draw the Line!" in Copenhagen May 2008. The proceedings include contributions by UPGEM researchers, conference speeches by other researchers, politicians and gender equality officers in which they relate their work and research with the research done in UPGEM......Draw the Line! International Conference, Copenhagen 2008 Papers, proceedings and recommendations is the second publication of the international three year long project "Understanding Puzzles in the Gendered European Map" (UPGEM), which is financed by the European Commission. In this publication we....... The UPGEM research has previously been published in national reports from each of the partner countries (Denmark, Estonia, Finland, Italy and Poland). In these individual national reports of universities as workplaces for male and female researchers we discuss scientific cultures in physics embedded...
Microwave line of sight link engineering
Angueira, Pablo
2012-01-01
A comprehensive guide to the design, implementation, and operation of line of sight microwave link systems The microwave Line of Sight (LOS) transport network of any cellular operator requires at least as much planning effort as the cellular infrastructure itself. The knowledge behind this design has been kept private by most companies and has not been easy to find. Microwave Line of Sight Link Engineering solves this dilemma. It provides the latest revisions to ITU reports and recommendations, which are not only key to successful design but have changed dramatically in
Pipe line construction for reactor containment buildings
International Nuclear Information System (INIS)
Aoki, Masataka; Yoshinaga, Toshiaki
1978-01-01
Purpose: To prevent the missile phenomenon caused by broken fragments due to pipe whip phenomenon in a portion of pipe lines connected to a reactor containment from prevailing to other portions. Constitution: Various pipe lines connected to the pressure vessel are disposed at the outside of the containments and they are surrounded with a plurality of protection partition walls respectively independent from each other. This can eliminate the effect of missile phenomena upon pipe rupture from prevailing to the pipe lines and instruments. Furthermore this can afford sufficient spaces for the pipe lines, as well as for earthquake-proof supports. (Horiuchi, T.)
State Estimation-based Transmission line parameter identification
Directory of Open Access Journals (Sweden)
Fredy Andrés Olarte Dussán
2010-01-01
Full Text Available This article presents two state-estimation-based algorithms for identifying transmission line parameters. The identification technique used simultaneous state-parameter estimation on an artificial power system composed of several copies of the same transmission line, using measurements at different points in time. The first algorithm used active and reactive power measurements at both ends of the line. The second method used synchronised phasor voltage and current measurements at both ends. The algorithms were tested in simulated conditions on the 30-node IEEE test system. All line parameters for this system were estimated with errors below 1%.
49 CFR 192.487 - Remedial measures: Distribution lines other than cast iron or ductile iron lines.
2010-10-01
... cast iron or ductile iron lines. 192.487 Section 192.487 Transportation Other Regulations Relating to... iron or ductile iron lines. (a) General corrosion. Except for cast iron or ductile iron pipe, each... the purpose of this paragraph. (b) Localized corrosion pitting. Except for cast iron or ductile iron...
Czech Academy of Sciences Publication Activity Database
Anderson, S. P.; Celik, Levent
2015-01-01
Roč. 157, May (2015), s. 517-526 ISSN 0022-0531 Institutional support: RVO:67985998 Keywords : product line design * product differentiation * second-degree price discrimination Subject RIV: AH - Economics Impact factor: 1.097, year: 2015
Skills Associated with Line Breaks in Elite Rugby Union
Directory of Open Access Journals (Sweden)
Steve den Hollander, James Brown, Michael Lambert, Paul Treu, Sharief Hendricks
2016-09-01
Full Text Available The ability of the attacking team to break through the defensive line is a key indicator of success as it creates opportunities to score tries. The aim of this study was to analyse line breaks and identify the associated skills and playing characteristics. The 2013 Super Rugby season (125 games was analysed, in which 362 line breaks were identified and coded using variables that assessed team patterns and non-contact attacking skills in the phases preceding the line break. There was an average of 3 line breaks per game, with 39% of line breaks resulting in a try. Line breaks occurred when the ball-carrier was running fast [61%, x2(4 = 25.784, p = 0.000, Cramer’s v = 0.1922, weak]. At a moderate distance, short lateral passes (19% and skip passes (15% attributed to the highest percentage of line breaks [x2(26 = 50.899, p = 0.036, Cramer’s v = 0.2484, moderate]. Faster defensive line speeds resulted in more line breaks [x2(12 = 61.703, p < 0.001, Cramer’s v = 0.3026, moderate]. Line breaks are associated with overall team success and try scoring opportunities. Awareness of the defenders line speed and depth, fast running speed when receiving the ball and quick passing between attackers to the outside backs creates line break opportunities. During training, coaches should emphasise the movement speed of the ball between attackers and manipulate the speed and distance of the defenders.
Raising the acceptance of the AP2-line
International Nuclear Information System (INIS)
Trbojevic, D.
1989-01-01
The 120 GeV Main Ring proton beam collides with the target at the end of the AP-1 line and creates antiprotons and other secondary particles. The AP-2 line transfers the negative particles from the target to the Debuncher. To provide a bigger antiproton stack size in the Accumulator, both the Debuncher as well as the AP-2 line acceptance have to be raised. This is a proposal for the improvement of the AP-2 line acceptance. The first part of the memo presents an acceptance examination of the existing AP-2 line by computer simulation, while the second presents a short proposal for aperture corrections. The computer program TURTLE was used to trace antiprotons through the AP-2 line without taking into account other negative charged particles. Betatron functions were obtained from the output of the SYNCH computer program. The SYNCH program was also used to check the dispersion match between the AP-2 line and the Debuncher. 3 refs., 6 figs., 5 tabs
Line radiative transfer and statistical equilibrium
Kamp, Inga
Atomic and molecular line emission from protoplanetary disks contains key information of their detailed physical and chemical structures. To unravel those structures, we need to understand line radiative transfer in dusty media and the statistical equilibrium, especially of molecules. I describe
Galaxy emission line classification using three-dimensional line ratio diagrams
Energy Technology Data Exchange (ETDEWEB)
Vogt, Frédéric P. A.; Dopita, Michael A.; Kewley, Lisa J.; Sutherland, Ralph S. [Research School of Astronomy and Astrophysics, Australian National University, Canberra, ACT 2611 (Australia); Scharwächter, Julia [Observatoire de Paris, LERMA (CNRS: UMR8112), 61 Av. de l' Observatoire, F-75014 Paris (France); Basurah, Hassan M.; Ali, Alaa; Amer, Morsi A., E-mail: frederic.vogt@anu.edu.au [Astronomy Department, King Abdulaziz University, P.O. Box 80203, Jeddah (Saudi Arabia)
2014-10-01
Two-dimensional (2D) line ratio diagnostic diagrams have become a key tool in understanding the excitation mechanisms of galaxies. The curves used to separate the different regions—H II-like or excited by an active galactic nucleus (AGN)—have been refined over time but the core technique has not evolved significantly. However, the classification of galaxies based on their emission line ratios really is a multi-dimensional problem. Here we exploit recent software developments to explore the potential of three-dimensional (3D) line ratio diagnostic diagrams. We introduce the ZQE diagrams, which are a specific set of 3D diagrams that separate the oxygen abundance and the ionization parameter of H II region-like spectra and also enable us to probe the excitation mechanism of the gas. By examining these new 3D spaces interactively, we define the ZE diagnostics, a new set of 2D diagnostics that can provide the metallicity of objects excited by hot young stars and that cleanly separate H II region-like objects from the different classes of AGNs. We show that these ZE diagnostics are consistent with the key log [N II]/Hα versus log [O III]/Hβ diagnostic currently used by the community. They also have the advantage of attaching a probability that a given object belongs to one class or the other. Finally, we discuss briefly why ZQE diagrams can provide a new way to differentiate and study the different classes of AGNs in anticipation of a dedicated follow-up study.
Butterfly valve of all rubber lining type
International Nuclear Information System (INIS)
Shimada, Shosaku; Nakatsuma, Sumiya; Sasaki, Iwao; Aoki, Naoshi.
1982-01-01
The valves used for the circulating water pipes for condensers in nuclear and thermal power stations have become large with the increase of power output, and their specifications have become strict. The materials for the valves change from cast iron to steel plate construction. To cope with sea water corrosion, rubber lining has been applied to the internal surfaces of valve boxes, and the build-up welding of stainless steel has been made on the edges of valves. However, recently it is desired to develop butterfly valves, of which the whole valve disks are lined with hard rubber. For the purpose of confirming the performance of large bore valves, a 2600 mm bore butterfly valve of all rubber lining type was used, and the opening and closing test of 1100 times was carried out by applying thermal cycle and pressure difference and using artifical sea water. Also the bending test of hard rubber lining was performed with test pieces. Thus, it was confirmed that the butterfly valves of all rubber lining type have the performance exceeding that of the valves with build-up welding. The course of development of the valves of all rubber lining type, the construction and the items of confirmation by tests of these valves, and the tests of the valve and the hard rubber lining described above are reported. (Kako, I.)
Using Quartile-Quartile Lines as Linear Models
Gordon, Sheldon P.
2015-01-01
This article introduces the notion of the quartile-quartile line as an alternative to the regression line and the median-median line to produce a linear model based on a set of data. It is based on using the first and third quartiles of a set of (x, y) data. Dynamic spreadsheets are used as exploratory tools to compare the different approaches and…
D Central Line Extraction of Fossil Oyster Shells
Djuricic, A.; Puttonen, E.; Harzhauser, M.; Mandic, O.; Székely, B.; Pfeifer, N.
2016-06-01
Photogrammetry provides a powerful tool to digitally document protected, inaccessible, and rare fossils. This saves manpower in relation to current documentation practice and makes the fragile specimens more available for paleontological analysis and public education. In this study, high resolution orthophoto (0.5 mm) and digital surface models (1 mm) are used to define fossil boundaries that are then used as an input to automatically extract fossil length information via central lines. In general, central lines are widely used in geosciences as they ease observation, monitoring and evaluation of object dimensions. Here, the 3D central lines are used in a novel paleontological context to study fossilized oyster shells with photogrammetric and LiDAR-obtained 3D point cloud data. 3D central lines of 1121 Crassostrea gryphoides oysters of various shapes and sizes were computed in the study. Central line calculation included: i) Delaunay triangulation between the fossil shell boundary points and formation of the Voronoi diagram; ii) extraction of Voronoi vertices and construction of a connected graph tree from them; iii) reduction of the graph to the longest possible central line via Dijkstra's algorithm; iv) extension of longest central line to the shell boundary and smoothing by an adjustment of cubic spline curve; and v) integration of the central line into the corresponding 3D point cloud. The resulting longest path estimate for the 3D central line is a size parameter that can be applied in oyster shell age determination both in paleontological and biological applications. Our investigation evaluates ability and performance of the central line method to measure shell sizes accurately by comparing automatically extracted central lines with manually collected reference data used in paleontological analysis. Our results show that the automatically obtained central line length overestimated the manually collected reference by 1.5% in the test set, which is deemed
Energy Technology Data Exchange (ETDEWEB)
Bueckner, W.F.
2007-04-30
The power breakdowns we encountered in March 2006 due to extreme weather conditions and in November 2006 due to overload of overhead lines made overhead line techniques more interesting. After pausing for decades, technical development and investments for overhead lines in Germany become necessary again, meaning reconstructions and new constructions worth several millions of investment. An additional reason for this is given by the Federal Government's request for the construction of new power plants and overhead lines as well as by the energy plan of the EU-Commission. The power supplier have begun planning already. These plans require new and economical overhead lines. Proposals and practical examples are shown in the following article.
Vortex-line fluctuations in model high-temperature superconductors
International Nuclear Information System (INIS)
Li, Y.; Teitel, S.
1993-01-01
We carry out Monte Carlo simulations of the uniformly frustrated three-dimensional XY model, as a model for vortex-line fluctuations in a high-T c superconductor in an external magnetic field. A density of vortex lines of f=1/25 is considered. We find two sharp phase transitions. The low-T superconducting phase is an ordered vortex-line lattice. The high-T normal phase is a vortex-line liquid, with much entangling, cutting, and loop excitations. An intermediate phase is found, which is characterized as a vortex-line liquid of disentangled, approximately straight, lines. In this phase, the system displays superconducting properties in the direction parallel to the magnetic field, but normal behavior in planes perpendicular to the field. A detailed analysis of the vortex structure function is carried out
Natural radiation focused by power lines: new evidence
Energy Technology Data Exchange (ETDEWEB)
Hopwood, Anthony
1992-11-01
Scientists searching for a mechanism to explain increases in the incidence of cancer among those living in close proximity to power lines could have been looking in the wrong place. New evidence suggests that instead of trying to find an as yet unproven cellular reaction to the presence of the power-line's magnetic fields, researchers should investigate power lines as concentrators of potentially damaging natural sky radiation. If accepted, a clear link between a known biological cell damage mechanism and power lines will have been established, triggering a reassessment of the independent studies recording statistical increases in cancer incidence around power lines. The evidence stems from recordings showing concentrations of background solar radiation under power lines - a direction of enquiry prompted by a chance observation made during a British Astronomical Association experiment. (Author).
SAF line analytical chemistry system
International Nuclear Information System (INIS)
Gerber, E.W.; Sherrell, D.L.
1983-10-01
An analytical chemistry system dedicated to supporting the Secure Automated Fabrication (SAF) line is discussed. Several analyses are required prior to the fuel pellets being loaded into cladding tubes to assure certification requirements will be met. These analyses, which will take less than 15 minutes, are described. The automated sample transport system which will be used to move pellets from the fabriction line to the chemistry area is also described
Gamma-ray line intensities for depleted uranium
International Nuclear Information System (INIS)
Moss, C.E.
1985-01-01
Measurements of the gamma-ray line intensities from depleted uranium allowed us to determine which of two conflicting previous experiments was correct. For the 1001-keV line we obtain a branching ratio of 0.834 +- 0.007, in good agreement with one of the previous experiments. A table compares our intensities for several lines with those obtained in previous experiments. 5 refs., 2 figs., 1 tab
DOE-EPRI On-Line Monitoring Implementation Guidelines
International Nuclear Information System (INIS)
E. Davis, R. Bickford
2003-01-01
Industry and EPRI experience at several plants has shown on-line monitoring to be very effective in identifying out-of-calibration instrument channels or indications of equipment-degradation problems. The EPRI implementation project for on-line monitoring has demonstrated the feasibility of on-line monitoring at several participating nuclear plants. The results have been very encouraging, and substantial progress is anticipated in the coming years
Reliable Line Matching Algorithm for Stereo Images with Topological Relationship
Directory of Open Access Journals (Sweden)
WANG Jingxue
2017-11-01
Full Text Available Because of the lack of relationships between matching line and adjacent lines in the process of individual line matching, and the weak reliability of the individual line descriptor facing on discontinue texture, this paper presents a reliable line matching algorithm for stereo images with topological relationship. The algorithm firstly generates grouped line pairs from lines extracted from the reference image and searching image according to the basic topological relationships such as distance and angle between the lines. Then it takes the grouped line pairs as matching primitives, and matches these grouped line pairs by using epipolar constraint, homography constraint, quadrant constraint and gray correlation constraint of irregular triangle in order. And finally, it resolves the corresponding line pairs into two pairs of corresponding individual lines, and obtains one to one matching results after the post-processing of integrating, fitting, and checking. This paper adopts digital aerial images and close-range images with typical texture features to deal with the parameter analysis and line matching, and the experiment results demonstrate that the proposed algorithm in this paper can obtain reliable line matching results.
Geometry-Dependent Electrostatics near Contact Lines
International Nuclear Information System (INIS)
Chou, Tom
2001-01-01
Long-ranged electrostatic interactions in electrolytes modify contact angles on charged substrates in a scale and geometry-dependent manner. For angles measured at scales smaller than the typical Debye screening length, the wetting geometry near the contact line must be explicitly considered. Using variational and asymptotic methods, we derive new transcendental equations for the contact angle as functions of the electrostatic potential only at the three phase contact line. Analytic expressions are found in certain limits and compared with predictions for contact angles measured with lower resolution. An estimate for electrostatic contributions to line tension is also given
On-line monitoring for calibration reduction
International Nuclear Information System (INIS)
Hoffmann, Mario; Gran, Frauke Schmitt; Thunem, Harald P-J.
2004-04-01
On-Line Monitoring (OLM) of a channel's calibration state evaluates instrument channel performance by assessing its consistency with other plant indications. Industry and experience at several plants has shown this overall approach to be very effective in identifying instrument channels that are exhibiting degrading or inconsistent performance characteristics. The Halden Reactor Project has developed the signal validation system PEANO, which can be used to assist with the tasks of OLM. To further enhance the PEANO System for use as a calibration reduction tool, the following two additional modules have been developed; HRP Prox, which performs pre-processing and statistical analysis of signal data, Batch Monitoring Module (BMM), which is an off-line batch monitoring and reporting suite. The purpose and functionality of the HRP Prox and BMM modules are discussed in this report, as well as the improvements made to the PEANO Server to support these new modules. The Halden Reactor Project has established a Halden On-Line Monitoring User Group (HOLMUG), devoted to the discussion and implementation of on-line monitoring techniques in power plants. It is formed by utilities, vendors, regulatory bodies and research institutes that meet regularly to discuss implementation aspects of on-line monitoring, technical specification changes, cost-benefit analysis and regulatory issues. (Author)
Truncation correction for oblique filtering lines
International Nuclear Information System (INIS)
Hoppe, Stefan; Hornegger, Joachim; Lauritsch, Guenter; Dennerlein, Frank; Noo, Frederic
2008-01-01
State-of-the-art filtered backprojection (FBP) algorithms often define the filtering operation to be performed along oblique filtering lines in the detector. A limited scan field of view leads to the truncation of those filtering lines, which causes artifacts in the final reconstructed volume. In contrast to the case where filtering is performed solely along the detector rows, no methods are available for the case of oblique filtering lines. In this work, the authors present two novel truncation correction methods which effectively handle data truncation in this case. Method 1 (basic approach) handles data truncation in two successive preprocessing steps by applying a hybrid data extrapolation method, which is a combination of a water cylinder extrapolation and a Gaussian extrapolation. It is independent of any specific reconstruction algorithm. Method 2 (kink approach) uses similar concepts for data extrapolation as the basic approach but needs to be integrated into the reconstruction algorithm. Experiments are presented from simulated data of the FORBILD head phantom, acquired along a partial-circle-plus-arc trajectory. The theoretically exact M-line algorithm is used for reconstruction. Although the discussion is focused on theoretically exact algorithms, the proposed truncation correction methods can be applied to any FBP algorithm that exposes oblique filtering lines.
Roch, Benoît; Roth, Caroline; Mérel, Jean-Pierre
2018-01-01
Objective Treatment failures in advanced lung cancer are frequent events affecting patients during or after first-line chemotherapy. International guidelines recommend second-line chemotherapy. However, around one half of patients who experience disease progression enter a systemic second-line therapy. In the herein qualitative study, we investigated patients' thoughts and attitudes determining the decision to undergo a second-line chemotherapy. Methods Thirty-three purposively selected patients who recently accepted second-line or palliative chemotherapy were invited to participate in this survey consisting of semi-structured in-depth interviews. Grounded theory was applied to investigate participants’ perceptions of the context that have surrounded their decision to undergo palliative chemotherapy. Results For most patients, tumor burden and reduced quality of life in relation with lung cancer itself were major drivers of the decision-making process. There was a balance between two different attitudes: making a decision to undergo a new line of chemotherapy or starting a psychological process in order to accept end of life. Choosing between these two attitudes allowed the patient to keep the matter of palliative care at a distance. Even in case of low chance of success, many patients who worried about their life partner's future would accept a new chemotherapy line. Some patients experienced ambivalent thoughts regarding social network, particularly about their family as daily function impairment required an increased need for relative's support. The initial "Worrying about others" thoughts left place to in an increasing self-need of care as those provided by relatives; this phenomenon might increase patients' self- perception of being a burden for others. Confidence previously established with formal caregiver support was another major decision driver: some patients with sustained confidence in their medical staff may have privileged this formal support rather
Constantoudis, Vassilios; Papavieros, George; Lorusso, Gian; Rutigliani, Vito; Van Roey, Frieda; Gogolides, Evangelos
2018-03-01
The aim of this paper is to investigate the role of etch transfer in two challenges of LER metrology raised by recent evolutions in lithography: the effects of SEM noise and the cross-line and edge correlations. The first comes from the ongoing scaling down of linewidths, which dictates SEM imaging with less scanning frames to reduce specimen damage and hence with more noise. During the last decade, it has been shown that image noise can be an important budget of the measured LER while systematically affects and alter the PSD curve of LER at high frequencies. A recent method for unbiased LER measurement is based on the systematic Fourier or correlation analysis to decompose the effects of noise from true LER (Fourier-Correlation filtering method). The success of the method depends on the PSD and HHCF curve. Previous experimental and model works have revealed that etch transfer affects the PSD of LER reducing its high frequency values. In this work, we estimate the noise contribution to the biased LER through PSD flat floor at high frequencies and relate it with the differences between the PSDs of lithography and etched LER. Based on this comparison, we propose an improvement of the PSD/HHCF-based method for noise-free LER measurement to include the missed high frequency real LER. The second issue is related with the increased density of lithographic patterns and the special characteristics of DSA and MP lithography patterns exhibits. In a previous work, we presented an enlarged LER characterization methodology for such patterns, which includes updated versions of the old metrics along with new metrics defined and developed to capture cross-edge and cross-line correlations. The fundamental concept has been the Line Center Roughness (LCR), the edge c-factor and the line c-factor correlation function and length quantifying the line fluctuations and the extent of cross-edge and cross-line correlations. In this work, we focus on the role of etch steps on cross-edge and
Stainless steel submerged arc weld fusion line toughness
International Nuclear Information System (INIS)
Rosenfield, A.R.; Held, P.R.; Wilkowski, G.M.
1995-04-01
This effort evaluated the fracture toughness of austenitic steel submerged-arc weld (SAW) fusion lines. The incentive was to explain why cracks grow into the fusion line in many pipe tests conducted with cracks initially centered in SAWS. The concern was that the fusion line may have a lower toughness than the SAW. It was found that the fusion line, Ji. was greater than the SAW toughness but much less than the base metal. Of greater importance may be that the crack growth resistance (JD-R) of the fusion line appeared to reach a steady-state value, while the SAW had a continually increasing JD-R curve. This explains why the cracks eventually turn to the fusion line in the pipe experiments. A method of incorporating these results would be to use the weld metal J-R curve up to the fusion-line steady-state J value. These results may be more important to LBB analyses than the ASME flaw evaluation procedures, since there is more crack growth with through-wall cracks in LBB analyses than for surface cracks in pipe flaw evaluations
Town of Chapel Hill, North Carolina — Chapel Hill Bike Map Lines from KMZ file.This data came from the wiki comment board for the public, not an “official map” showing the Town of Chapel Hill's plans or...
Genetic variability among advanced lines of brassica
International Nuclear Information System (INIS)
Ullah, N.; Farhatullah, A.; Rahman, H.U.; Fayyaz, L.
2015-01-01
Genetic variability for morphological and biochemical traits among six advanced lines (F10:11) of brassica was studied at The University of Agriculture Peshawar during crop season of 2012-13. These lines were developed through interspecific hybridization. Significant differences at (p=0.01) for plant height, main, pods main raceme-1, pod length, seed yield plant-1 and protein content at (p=0.05) for 100-seed weight, oil content were recorded. The advanced line, AUP-05 produced the maximum seed yield plant-1 (19.73 g), protein content (24.56%), 100-seed weight (0.64 g). Advanced line AUP-04 had the highest erucic acid (50.31%), linolenic acid (10.60%) and was late maturing (179.33). Advanced line AUP-06 produced the high oil content (48.82%). Advanced line AUP-03 produced comparatively longer main raceme (69.32 cm). Environmental variance was smaller than genotypic variance for majority of the traits. Genotypic and phenotypic coefficients of variation ranged from 2.45 to 25.67% and 2.50 to 27.68%, respectively. Heritability was high for majority of the traits. The maximum heritability was recorded for plant height (0.61), main raceme length (0.81), pods main raceme-1 (0.74), seed yield plant-1 (0.86) and protein content (0.77). Moderate heritability was observed for oil (0.58) contents. Heritability for 100-seed weight (0.30) was the lowest. These lines may be released as new improved varieties for specific parameters. (author)
Lip line preference for variant face types.
Anwar, Nabila; Fida, Mubassar
2012-06-01
To determine the effect of altered lip line on attractiveness and to find preferred lip line for vertical face types in both genders. Cross-sectional analytical study. The Aga Khan University Hospital, Karachi, from May to July 2009. Photographs of two selected subjects were altered to produce three face types for the same individual with the aim of keeping the frame of the smile constant. Lip line was then altered for both the subjects as: both dentitions visible, upper incisors visible, upper incisors and 2 mm gum and 4 mm gum visible. The pictures were rated by different professionals for attractiveness. Descriptive statistics for the raters and multiple factor ANOVA was used to find the most attractive lip line. The total number of raters was 100 with the mean age of 30.3 ± 8 years. The alterations in the smile parameters produced statistically significant difference in the attractiveness of faces, whereas the perception difference was found to be insignificant amongst raters of different professions. Preferred lip line was the one showing only the upper incisors in dolico and mesofacial male and female genders whereas 2 mm gum show was preferred in brachyfacial subjects. The variability in lip line showed significant difference in the perceived attractiveness. Preferred lip lines as the one showing only the upper incisors in dolico and mesofacial male and female genders whereas 2 mm gum show was preferred in brachyfacial subjects.
Menzel, R.; Paynter, D.; Jones, A. L.
2017-12-01
Due to their relatively low computational cost, radiative transfer models in global climate models (GCMs) run on traditional CPU architectures generally consist of shortwave and longwave parameterizations over a small number of wavelength bands. With the rise of newer GPU and MIC architectures, however, the performance of high resolution line-by-line radiative transfer models may soon approach those of the physical parameterizations currently employed in GCMs. Here we present an analysis of the current performance of a new line-by-line radiative transfer model currently under development at GFDL. Although originally designed to specifically exploit GPU architectures through the use of CUDA, the radiative transfer model has recently been extended to include OpenMP in an effort to also effectively target MIC architectures such as Intel's Xeon Phi. Using input data provided by the upcoming Radiative Forcing Model Intercomparison Project (RFMIP, as part of CMIP 6), we compare model results and performance data for various model configurations and spectral resolutions run on both GPU and Intel Knights Landing architectures to analogous runs of the standard Oxford Reference Forward Model on traditional CPUs.
Animated construction of line drawings
Fu, Hongbo
2011-12-01
Revealing the sketching sequence of a line drawing can be visually intriguing and used for video-based storytelling. Typically this is enabled based on tedious recording of artists\\' drawing process. We demonstrate that it is often possible to estimate a reasonable drawing order from a static line drawing with clearly defined shape geometry, which looks plausible to a human viewer. We map the key principles of drawing order from drawing cognition to computational procedures in our framework. Our system produces plausible animated constructions of input line drawings, with no or little user intervention. We test our algorithm on a range of input sketches, with varying degree of complexity and structure, and evaluate the results via a user study. We also present applications to gesture drawing synthesis and drawing animation creation especially in the context of video scribing.
Animated construction of line drawings
Fu, Hongbo
2011-12-01
Revealing the sketching sequence of a line drawing can be visually intriguing and used for video-based storytelling. Typically this is enabled based on tedious recording of artists\\' drawing process. We demonstrate that it is often possible to estimate a reasonable drawing order from a static line drawing with clearly defined shape geometry, which looks plausible to a human viewer. We map the key principles of drawing order from drawing cognition to computational procedures in our framework. Our system produces plausible animated constructions of input line drawings, with no or little user intervention. We test our algorithm on a range of input sketches, with varying degree of complexity and structure, and evaluate the results via a user study. We also present applications to gesture drawing synthesis and drawing animation creation especially in the context of video scribing. © 2011 ACM.
Aristolactama y esteróles del tallo de Piper chiadoense
Directory of Open Access Journals (Sweden)
Luz Angela Peña O.
2010-07-01
Full Text Available Del extracto etanólico del tallo de Piper chiadoense Junker (Piperaceae fueron aislados por métodos cromatográficos la aristolactama identificada como lactama del ácido 10- mino-3,4-dimetoxifenantreno-l-carboxílico (cepharanone B; campesterol; estigmasterol y B-sitosterol. Sus estructuras fueron determinadas por métodos espectroscópicos y por comparación con datos reportados en la literatura.
Berkeley Off-line Radioisotope Generator (BORG)
Sudowe, R
2001-01-01
Development of chemical separations for the transactinides has traditionally been performed with longer-lived tracer activities purchased commercially. With these long-lived tracers, there is always the potential problem that the tracer atoms are not always in the same chemical form as the short-lived atoms produced in on-line experiments. This problem is especially severe for elements in groups 4 and 5 of the periodic table, where hydrolysis is present. The long-lived tracers usually are stored with a complexing agent to prevent sorption or precipitation. Chemistry experiments performed with these long-lived tracers are therefore not analogous to those chemical experiments performed in on-line experiments. One way to eliminate the differences between off-line and on-line chemistry experiments is through the use of a sup 2 sup 5 sup 2 Cf fission fragment collection device. A sup 2 sup 5 sup 2 Cf fission fragment collection device has already been constructed [1]. This device is limited in its capabilities. A ...
Transmission Line Adapted Analytical Power Charts Solution
Sakala, Japhet D.; Daka, James S. J.; Setlhaolo, Ditiro; Malichi, Alec Pulu
2017-08-01
The performance of a transmission line has been assessed over the years using power charts. These are graphical representations, drawn to scale, of the equations that describe the performance of transmission lines. Various quantities that describe the performance, such as sending end voltage, sending end power and compensation to give zero voltage regulation, may be deduced from the power charts. Usually required values are read off and then converted using the appropriate scales and known relationships. In this paper, the authors revisit this area of circle diagrams for transmission line performance. The work presented here formulates the mathematical model that analyses the transmission line performance from the power charts relationships and then uses them to calculate the transmission line performance. In this proposed approach, it is not necessary to draw the power charts for the solution. However the power charts may be drawn for the visual presentation. The method is based on applying derived equations and is simple to use since it does not require rigorous derivations.
Sport Management Taught On-Line: A Discussion
Directory of Open Access Journals (Sweden)
William F. Stier Jr
2009-01-01
Full Text Available An introduction to the world of on-line courses (distance education/learning is presented. In addition, the world of on-line learning, as it pertains to sport management, is examined within the framework of (a pedagogy, (b finances,(c assessment, and (d choosing to transition from the traditional classroom to on-line learning. Pertinent points relative to each of the four categories are presented from the literature. In an effort to stimulate thought and discussion to the subject of on-line learning for sport management programs/courses the authors provide their reactions to the literature points by presenting their comments/reactions from a sport management perspective. Sport management professors and administrators are encouraged to critically examine the feasibility of such on-line courses (distance education/learning within their own curricula while maintaining an appropriate framework revolving around sound theoretical instructional strategies, methods as well as appropriate use of instructional tools, including but not limited to, computersand the WWW.
International Nuclear Information System (INIS)
Nuttall, K.R.; Gardner, P.R.
1991-01-01
Westinghouse Hanford Company is developing a desk-top simulation based training program on the operation of the Remote Mechanical C (RMC) Line process in the Plutonium Finishing Plant on the Hanford site, Richland, Washington. Simulations display aod contioually update current values of system parameters on computer graphics of RMC line equipment. Students are able to operate a variety of controllers to maintain proper system status. Programmed faults, selectable by the course instructor, can be used to test student responses to off-normal events. Prior to operation of the simulation, students are given computer-based tutorials on the function, processes, operation, and error conditions associated with individual components. By including the capability of operating each individual component - valves, heaters, agitators, etc. - the computer-based training (CBT) lessons become an interactive training manual. From one perspective RMC represents one step in the diffusion of the well-known and well-documented simulator training activities for nuclear reactor operators to other training programs, equally critical, perhaps, but less well scrutinized in the past. Because of the slowly responding nature of the actual process, RMC can retain many of the capabilities of practice and testing in a simulated work environment while avoiding the cost of a full scale simulator and the exposure and waste developed by practice runs of the RMC line. From another perspective RMC suggests training advances even beyond the most faithful simulators. For example, by integrating CBT lessons with the simulation, RMC permits students to focus in on specific processes occurring inside chosen components. In effect, the interactive training manual is available on-line with the simulation itself. Cost are also discussed
Numerical Calculation of Overhead Power Lines Dynamics
Directory of Open Access Journals (Sweden)
Gogola Roman
2016-11-01
Full Text Available This paper contains results of transient analysis of airflow around the ACSR power line cross-section in unsymmetric multi-span. The forces applied to the power line are obtained from CFD simulations, where the wind induced vibration is studied. Effect of these forces to the maximal displacement of the power line and the maximal mechanical forces in the points of attachment are studied and evaluated.
Integrating robust timetabling in line plan optimization for railway systems
DEFF Research Database (Denmark)
Burggraeve, Sofie; Bull, Simon Henry; Vansteenwegen, Pieter
2017-01-01
We propose a heuristic algorithm to build a railway line plan from scratch that minimizes passenger travel time and operator cost and for which a feasible and robust timetable exists. A line planning module and a timetabling module work iteratively and interactively. The line planning module......, but is constrained by limited shunt capacity. While the operator and passenger cost remain close to those of the initially and (for these costs) optimally built line plan, the timetable corresponding to the finally developed robust line plan significantly improves the minimum buffer time, and thus the robustness...... creates an initial line plan. The timetabling module evaluates the line plan and identifies a critical line based on minimum buffer times between train pairs. The line planning module proposes a new line plan in which the time length of the critical line is modified in order to provide more flexibility...
Wiedey, Raphael; Šibanc, Rok; Kleinebudde, Peter
2018-06-06
Ribbon solid fraction is one of the most important quality attributes during roll compaction/dry granulation. Accurate and precise determination is challenging and no in-line measurement tool has been generally accepted, yet. In this study, a new analytical tool with potential off-line as well as in-line applicability is described. It is based on the thermo-conductivity of the compacted material, which is known to depend on the solid fraction. A laser diode was used to punctually heat the ribbon and the heat propagation monitored by infrared thermography. After performing a Gaussian fit of the transverse ribbon profile, the scale parameter σ showed correlation to ribbon solid fraction in off-line as well as in-line studies. Accurate predictions of the solid fraction were possible for a relevant range of process settings. Drug stability was not affected, as could be demonstrated for the model drug nifedipine. The application of this technique was limited when using certain fillers and working at higher roll speeds. This study showed the potentials of this new technique and is a starting point for additional work that has to be done to overcome these challenges. Copyright © 2018 Elsevier B.V. All rights reserved.
Two-line hybrid rice male sterile line 'NHR111S' with a marker of green-revertible albino leaves
International Nuclear Information System (INIS)
Wu Wei; Liu Xin; Shu Xiaoli; Shu Qingyao; Xia Yingwu; Wu Dianxing
2006-01-01
NHR111S is a new two-line male sterile line with a marker of green-revertible albino leave that was bred from in vitro mutagens is of the thermo/photoperiod-sensitive male sterile line 'Guangzhan63S' by 60 Co γ-rays. It has the same desired agronomic traits, fertility characteristics and combining ability as characteristics of the parent. It is convenient to develop leaf color marker-aided elimination strategy in the multiplication and production of hybrid rice seeds. (authors)
ExoMol line list - XXI. Nitric Oxide (NO)
Wong, Andy; Yurchenko, Sergei N.; Bernath, Peter; Müller, Holger S. P.; McConkey, Stephanie; Tennyson, Jonathan
2017-09-01
Line lists for the X 2Π electronic ground state for the parent isotopologue of nitric oxide (14N16O) and five other major isotopologues (14N17O, 14N18O, 15N16O, 15N17O and 15N18O) are presented. The line lists are constructed using empirical energy levels (and line positions) and high-level ab initio intensities. The energy levels were obtained using a combination of two approaches, from an effective Hamiltonian and from solving the rovibronic Schrödinger equation variationally. The effective Hamiltonian model was obtained through a fit to the experimental line positions of NO available in the literature for all six isotopologues using the programs spfit and spcat. The variational model was built through a least squares fit of the ab initio potential and spin-orbit curves to the experimentally derived energies and experimental line positions of the main isotopologue only using the duo program. The ab initio potential energy, spin-orbit and dipole moment curves (PEC, SOC and DMC) are computed using high-level ab initio methods and the marvel method is used to obtain energies of NO from experimental transition frequencies. The line lists are constructed for each isotopologue based on the use of the most accurate energy levels and the ab initio DMC. Each line list covers a wavenumber range from 0 to 40 000 cm-1 with approximately 22 000 rovibronic states and 2.3-2.6 million transitions extending to Jmax = 184.5 and vmax = 51. Partition functions are also calculated up to a temperature of 5000 K. The calculated absorption line intensities at 296 K using these line lists show excellent agreement with those included in the HITRAN and HITEMP data bases. The computed NO line lists are the most comprehensive to date, covering a wider wavenumber and temperature range compared to both the HITRAN and HITEMP data bases. These line lists are also more accurate than those used in HITEMP. The full line lists are available from the CDS http://cdsarc.u-strasbg.fr and ExoMol www
Sriwana, I. K.; Marie, I. A.; Mangala, D.
2017-12-01
Kencana Gemilang, Co. is one electronics industry engaging in the manufacture sector. This company manufactures and assembles household electronic products, such as rice cooker, fan, iron, blender, etc. The company deals with an issue of underachievement of an established production target on MCM products line 1. This study aimed to calculate line efficiencies, delay times, and initial line smoothness indexes. The research was carried out by means of depicting a precedence diagram and gathering time data of each work element followed by examination and calculation of standard time as well as line balancing using methods of Moodie Young and Generics Algorithm. Based on results of calculation, better line balancing than the existing initial conditions, i.e. improvement in the line efficiency by 18.39%, deterioration in balanced delay by 28.39%, and deterioration of a smoothness index by 23.85% was obtained.
Mg II Line Variation of 32 Cygni
Directory of Open Access Journals (Sweden)
Young Woon Kang
1992-12-01
Full Text Available The Mg II lines have been extracted from the IUE archival spectra of 32 Cygni to investigate the effect of the atmospheric eclipse. The UV light curve has been reduced from the continuum flux at the center wavelength of 2807.5 Å in the IUE spectra. The equivalent width of the Mg II k absoption line has been measured for each spectra. The results of the light variation and flux tracing of the absorption line at the vicinity of the primary eclipse confirmed the atmospheric eclipse. The atmospheric effect lasted until the phase 0.06 in the absorptin line tracing, while it lasted until the phase 0.02 in the UV light curve, respectively.
Observations of chromospheric lines from OSO-8
Grossmann-Doerth, U.; Kneer, F.; Uexkuell, M.; Artzner, G. E.; Vial, J. C.
1980-01-01
Results of OSO-8 measurements of the line profiles of the solar Lyman alpha, Ca II K and Mg II k lines are presented. Observations were obtained with the Laboratoire de Physique Stellaire et Planetaire spectrometer at spectral resolutions of 0.25 and 0.060 A for Lyman alpha and 0.025 A for the Mg II and Ca II lines. The Lyman alpha profiles are found to be highly variable according to spatial position with the intensities of the three lines well correlated, and confirm previous observations of the quiet solar chromosphere. Data suggest that the quiet chromosphere is a dynamical phenomenon whose description in terms of a static model atmosphere is only qualitatively valid at best.
Radiation sensitivity of Merkel cell carcinoma cell lines
Energy Technology Data Exchange (ETDEWEB)
Leonard, J.H.; Ramsay, J.R.; Birrell, G.W. [Queensland Institute of Medical Research (Australia)] [and others
1995-07-30
Merkel cell carcinoma (MCC), being a small cell carcinoma, would be expected to be sensitive to radiation. Clinical analysis of patients at our center, especially those with macroscopic disease, would suggest the response is quite variable. We have recently established a number of MCC cell lines from patients prior to radiotherapy, and for the first time are in a position to determine their sensitivity under controlled conditions. Some of the MCC lines grew as suspension cultures and could not be single cell cloned; therefore, it was not possible to use clonogenic survival for all cell lines. A tetrazolium based (MTT) assay was used for these lines, to estimate cell growth after {gamma} irradiation. Control experiments were conducted on lymphoblastoid cell lines (LCL) and the adherent MCC line, MCC13, to demonstrate that the two assays were comparable under the conditions used. We have examined cell lines from MCC, small cell lung cancer (SCLC), malignant melanomas, Epstein Barr virus (EBV) transformed lymphocytes (LCL), and skin fibroblasts for their sensitivity to {gamma} irradiation using both clonogenic cell survival and MTT assays. The results show that the tumor cell lines have a range of sensitivities, with melanoma being more resistant (surviving fraction at 2 Gy (SF2) 0.57 and 0.56) than the small cell carcinoma lines, MCC (SF2 range 0.21-0.45, mean SF2 0.30, n = 8) and SCLC (SF2 0.31). Fibroblasts were the most sensitive (SF2 0.13-0.20, mean 0.16, n = 5). The MTT assay, when compared to clonogenic assay for the MCC13 adherent line and the LCL, gave comparable results under the conditions used. Both assays gave a range of SF2 values for the MCC cell lines, suggesting that these cancers would give a heterogeneous response in vivo. The results with the two derivative clones of MCC14 (SF2 for MCC14/1 0.38, MCC14/2 0.45) would further suggest that some of them may develop resistance during clonogenic evolution. 25 refs., 3 figs., 1 tab.
Evaluation of Efficient Line Lengths for Better Readability
Directory of Open Access Journals (Sweden)
Zahid Hussain
2012-01-01
Full Text Available In this paper the major findings of a formal experiment about onscreen text line lengths are presented. The experiment examined the effects of four different line lengths on the reading speed and the reading efficiency. Efficiency is defined as a combination of reading speed and accuracy. Sixteen people between the age of 24 and 36 participated at the experiment. The subjects had to read four different texts with an average line length around 2000 characters. The texts contained substitution words, which had to be detected by the subjects to measure reading accuracy. Besides objective measures like reading speed and accuracy, the subjects were asked to subjectively vote on their reading experience. The results from our objective measures show strong similarities to those of the work done previously by different researchers. The absolute reading speed grows when the line length grows from CPL (Characters Per Line 30-120. The measured reading efficiency, however, doesn\\\\\\'t grow steadily, although a growing trend can be seen. This is due to the fact, that the test persons found in average more substitution words from the 60 CPL text than they did from the 30 and 90 CPL texts. The reading speed seems to increase while the line length increases but the overall comprehension seems to peak at medium line lengths. As in the previous studies, our test persons also prefer the medium (60 and 90 CPL line lengths, although they perform better when reading longer lines. In the overall subjective opinion 13 out of 16 test persons selected the 60 or 90 CPL line length as their favorite. The literature doesn\\\\\\'t truly provide a scientific explanation for the difference between the objective performance and the subjective preference. A natural hypothesis would be that the line length that is the fastest to read would also feel most comfortable to the readers but in the light of this and the earlier research it seems like this is not the case.
Radiation sensitivity of Merkell cell carcinoma cell lines
International Nuclear Information System (INIS)
Leonard, J. Helen; Ramsay, Jonathan R.; Kearsley, John H.; Birrell, Geoff W.
1995-01-01
Purpose: Merkel cell carcinoma (MCC), being a small cell carcinoma, would be expected to be sensitive to radiation. Clinical analysis of patients at our center, especially those with macroscopic disease, would suggest the response is quite variable. We have recently established a number of MCC cell lines from patients prior to radiotherapy, and for the first time are in a position to determine their sensitivity under controlled conditions. Methods and Materials: Some of the MCC lines grew as suspension cultures and could not be single cell cloned; therefore, it was not possible to use clonogenic survival for all cell lines. A tetrazolium based (MTT) assay was used for these lines, to estimate cell growth after γ irradiation. Control experiments were conducted on lymphoblastoid cell lines (LCL) and the adherent MCC line, MCC13, to demonstrate that the two assays were comparable under the conditions used. Results: We have examined cell lines from MCC, small cell lung cancer (SCLC), malignant melanomas, Epstein Barr virus (EBV) transformed lymphocytes (LCL), and skin fibroblasts for their sensitivity to γ irradiation using both clonogenic cell survival and MTT assays. The results show that the tumor cell lines have a range of sensitivities, with melanoma being more resistant (surviving fraction at 2 Gy (SF2) 0.57 and 0.56) than the small cell carcinoma lines, MCC (SF2 range 0.21-0.45, mean SF2 0.30, n = 8) and SCLC (SF2 0.31). Fibroblasts were the most sensitive (SF2 0.13-0.20, mean 0.16, n = 5). The MTT assay, when compared to clonogenic assay for the MCC13 adherent line and the LCL, gave comparable results under the conditions used. Conclusion: Both assays gave a range of SF2 values for the MCC cell lines, suggesting that these cancers would give a heterogeneous response in vivo. The results with the two derivative clones of MCC14 (SF2 for MCC14/1 0.38, MCC14/2 0.45) would further suggest that some of them may develop resistance during clonogenic evolution
Phase Grouping Line Extraction Algorithm Using Overlapped Partition
Directory of Open Access Journals (Sweden)
WANG Jingxue
2015-07-01
Full Text Available Aiming at solving the problem of fracture at the discontinuities area and the challenges of line fitting in each partition, an innovative line extraction algorithm is proposed based on phase grouping using overlapped partition. The proposed algorithm adopted dual partition steps, which will generate overlapped eight partitions. Between the two steps, the middle axis in the first step coincides with the border lines in the other step. Firstly, the connected edge points that share the same phase gradients are merged into the line candidates, and fitted into line segments. Then to remedy the break lines at the border areas, the break segments in the second partition steps are refitted. The proposed algorithm is robust and does not need any parameter tuning. Experiments with various datasets have confirmed that the method is not only capable of handling the linear features, but also powerful enough in handling the curve features.
Analyais of solar X-ray emission line profiles
International Nuclear Information System (INIS)
Burek, A.J.; Marrus, D.M.; Blake, R.L.; Fenimore, E.E.
1981-01-01
We report results of the analysis of the X-ray emission line profiles for the Ne X La and Fe XVII 4d 1 P 1 lines produced in an active region that was undergoing a radio and X-ray gradual rise and fall (GRF) in intensity. The spectra were obtained with collimated Bragg spectrometers launched on a rocket from White Sands Missile Range on 1976 March 26. Using a crystal of ammonium acid phthalate, we have fully resolved the Ne X La and Fe XVII 4d 1 P 1 lines, permitting an accurate determinination of the Ne X La intensity and allowing Doppler broadened profiles for lines formed from ions having greatly different atomic mass and charge to be measured. An isothermal model derived from the Ne IX/Ne X resonance line intensity ratio gives an electron temperature of 3.4 x 10 6 K. An isothermal model, however, fails to account for the intensities of all lines and continuum observed. All multitemperature models that do reproduce the observed relative line intensities require the presence of a hot plasma component with an electron temperature in excess of 5 x 10 6 K. The presence of a high temperature component is also suggested by the measured line to continuum ratio of 3.6 in the 12--15 A wavelength interval. Interpretation of the line profiles in terms of a multitemperature model requires an rms turbulence velocity of 48 +- 15 km s -1 for Fe XVII 1 P 1 and 74 +- 54 km s - 2exclamation for Ne X La at the 95% confidence level. Collimated scans across the active region show the presence of a compact source of intense X-ray emission close to the magnetic neutral line, which is very probably the GRF plasma
The allure of multi-line games in modern slot machines.
Dixon, Mike J; Graydon, Candice; Harrigan, Kevin A; Wojtowicz, Lisa; Siu, Vivian; Fugelsang, Jonathan A
2014-11-01
In multi-line slot machines, players can wager on more than one line per spin. We sought to show that players preferred multi-line over single-line games, and that certain game features could cause multi-line game play to feel more rewarding. Reward was measured using post-reinforcement pauses (PRPs) following each outcome (the time between outcome delivery and the next spin). Gamblers (n = 102) played 250 spins on a 20-line game and 250 spins on a one-line game (answering questions about game experiences following each session). Playing one-line, a small credit gain (e.g. 2 cents) was a net win. In the 20-line game it was a net loss of 18 credits but was still accompanied by 'winning' sights and sounds. Most players (94%) preferred the 20-line game. PRPs for small credit gains (net losses) in the 20-line game were equivalent, or larger than in the one-line game where such gains were wins. The largest increase in PRP size was between the 0 and 2 credit conditions for both games. Thus 20-line players reacted as though these net losses of 18 credits were rewarding. Players' estimates of the number of true wins were accurate in the one-line game, but they significantly over-estimated the number of true wins in the 20-line game (P game play. Multi-line games appear to be more appealing to gaming machine ('slots') players than single-line games. These games may be particularly absorbing for those with gambling problems. © 2014 Society for the Study of Addiction.
ASSEMBLY LINE BALANCING in a CLOTHING COMPANY
Directory of Open Access Journals (Sweden)
HASNALCACI Kubra
2017-05-01
Full Text Available Assembly lines take the attention of researchers and companies because of its great effect on efficiency. Efficiency in assembly lines has an important role on cost and quality which are the basic fundamentals of competition. Assembly lines contain a number of workstations and tasks (jobs are processed in these stations and are moved from station to station. The tasks are assigned to each station regarding a cycle time. The cycle time is the maximum available time for the production of a job at any workstation. The assingning of jobs to workstations is based on the objective of minimizing the workflow among the workstations, reducing the throughput time as well as the work in progress and thus increasing productivity. If the jobs are not allocated in balance, this will cause idle workstations and waste of workforce besides the loss of overall efficiency. In this study, an assebly line balancing problem was examined for a five pocket denim trousers in a clothing company. Firstly, priority associations and standard durations of operations of denim trousers were determined. Then, assembly line balancing study was carried out by using ranked positional weights assembly line balancing method developed by Helgeson and Birnie to increase the production in a clothing company manufacturing five pocket denim trousers.
Real quartic surfaces containing 16 skew lines
Directory of Open Access Journals (Sweden)
Isidro Nieto
2004-01-01
Full Text Available It is well known that there is an open three-dimensional subvariety Ms of the Grassmannian of lines in ℙ3 which parametrizes smooth irreducible complex surfaces of degree 4 which are Heisenberg invariant, and each quartic contains 32 lines but only 16 skew lines, being determined by its configuration of lines, are called a double 16. We consider here the problem of visualizing in a computer the real Heisenberg invariant quartic surface and the real double 16. We construct a family of points l∈Ms parametrized by a two-dimensional semialgebraic variety such that under a change of coordinates of l into its Plüecker, coordinates transform into the real coordinates for a line L in ℙ3, which is then used to construct a program in Maple 7. The program allows us to draw the quartic surface and the set of transversal lines to L. Additionally, we include a table of a group of examples. For each test example we specify a parameter, the viewing angle of the image, compilation time, and other visual properties of the real surface and its real double 16. We include at the end of the paper an example showing the surface containing the double 16.
Natural widths of atomic K and L levels, Kα X-ray lines and several KLL Auger lines
International Nuclear Information System (INIS)
Krause, M.O.; Oliver, J.H.
1979-01-01
Semi-empirical values of the natural widths of K, L 1 , L 2 , and L 3 levels, Kα 1 and Kα 2 x-ray lines, and KL 1 L 1 , KL 1 L 2 and KL 2 L 3 Auger lines for the elements 10 1 ,L 2 , L 3 ) is obtained from the relation GAMMA/sub i/=GAMMA/sub R/,i/ω/sub i/, using the theoretical radiative rate GAMMA/sub R/,i from Scofield's relativistic, relaxed Hartree-Fock calculation and the fluorescence yield ω/sub i/ from Krause's evaluation. X-ray and Auger lines widths are calculated as the sums of pertinent level widths. This tabulation of natural level and line widths is internally consistent, and is compatible with all relevant experimental and theoretical information. Present semi-empirical widths, especially those of Kα 1 and Kα 2 x-rays, are compared with measured widths. Uncertainties of semi-empirical values are estimated
Design of Miniaturized 10dB Wideband Branch Line Coupler Using Dual and T-Shape Transmission Lines
Directory of Open Access Journals (Sweden)
M. Kumar
2018-04-01
Full Text Available This paper presents a design mechanism of miniaturized wideband branch line coupler (BLC with loose coupling of 10 dB. Dual transmission lines are used as a feed network which provides a size reduction of 32% with a fractional bandwidth (FBW of 60% for 10±0.5 dB coupling but return loss performance is found to be poor in the operating band. For further improvement of return loss performance as well as for size reduction of the BLC, a T- shape transmission lines are used instead of series quarter wavelength transmission lines, and hence the overall size reduction of around 44% with FBW of 50.4% is achieved. The return loss and isolation performance is found to be les than 15 dB in the entire operating band (2.5–4.1 GHz with respect to design frequency 3G Hz. The proposed BLC is analyzed, fabricated and tested.
Starlight excitation of permitted lines in gaseous nebulae
International Nuclear Information System (INIS)
Grandi, S.A.
1975-01-01
The weak heavy element permitted lines observed in the spectra of gaseous nebula have, with only a few exceptions, been thought to be excited only by recombination. The accuracy of this assumption for individual lines in nebula spectra is investigated in detail via model nebula calculations. First, approximations and techniques of calculation are considered for the three possible excitation mechanisms: recombination, resonance fluorescence by the starlight continuum, and resonance fluorescence by other nebular emission lines. Next, the permitted lines of O I as observed in gaseous nebulae are discussed. Thirdly, it is shown that varying combinations of recombination, resonance fluorescence by starlight, and resonance fluorescence by other nebula lines can successfully account for the observed strengths in the Orion Nebula of lines of the following ions: C II, N I, N II, N III, O II, Ne II, Si II, Si III, and S III. A similar analysis is performed for the lines in the spectra of the planetary nebulae NGC7662 and NGC7027, and, with some exceptions, satisfactory agreement between the observed and predicted line strengths is found. Finally, observations of the far red spectra of the Orion Nebula, the planetary nebulae NGC3242, NGC6210, NGC2392, IC3568, IC4997, NGC7027, and MGC7662, and the reflection nebulae IC431 and NGC2068 are reported
Bird nesting on an Athabasca power line structure
International Nuclear Information System (INIS)
Stedwill, R.J.
1989-01-01
SaskPower has recently completed its 400 km Athabasca power line, and is evaluating the predicted environmental impact of the line on the resident population of bald eagles and other raptors. During construction of the line, five major types of impact associated with the line were addressed. Minor route adjustments were made to by-pass nests of bald eagles and osprey to minimize impact of construction on breeding. The proximity of the power line to cliff faces and the north shore of lake Athabasca was maximized, and frequency of stream crossings and proximity to rapids were minimized. Route adjustments were made to ensure that the line was at least 1.6 km from bald eagle nest sites. As structures of the main 115 kV power line allow a minimum separation between conductors and grounded spars of 1.6 m, and between conductors of 4.6 m, electrocution was not considered to be a significant risk. However, on the 25 kV power line in regions of known bald eagle activity and in close proximity to bodies of water, provision was made for special structures to allow birds to perch without danger of electrocution. It was concluded that the resident population of raptors will probably be enhanced, particularly in areas not previously utilized. 8 refs., 5 figs
International Nuclear Information System (INIS)
Chojnowski, S. Drew; Majewski, Steven R.; Hall, Matthew; Beaton, Rachael; Burton, Adam; Damke, Guillermo; Wilson, John; Whelan, David G.; Wisniewski, John P.; Shetrone, Matthew; Eikenberry, Steve; Hasselquist, Sten; Holtzman, Jon A.; Brewington, Howard; Brinkmann, J.; Mészáros, Szabolcs; Nidever, David; Schneider, Donald P.; Zasowski, Gail; Bizyaev, Dmitry
2015-01-01
The Apache Point Observatory Galactic Evolution Experiment (APOGEE) has amassed the largest ever collection of multi-epoch, high-resolution (R∼22,500), H-band spectra for B-type emission line (Be) stars. These stars were targeted by APOGEE as telluric standard stars and subsequently identified via visual inspection as Be stars based on H i Brackett series emission or shell absorption in addition to otherwise smooth continua and occasionally non-hydrogen emission features. The 128/238 APOGEE Be stars for which emission had never previously been reported serve to increase the total number of known Be stars by ∼6%. Because the H band is relatively unexplored compared to other wavelength regimes, we focus here on identification of the H-band lines and analysis of the emission peak velocity separations (Δv p ) and emission peak intensity ratios (V/R) of the usually double-peaked H i and non-hydrogen emission lines. H i Br11 emission is found to preferentially form in the circumstellar disks at an average distance of ∼2.2 stellar radii. Increasing Δv p toward the weaker Br12–Br20 lines suggests these lines are formed interior to Br11. By contrast, the observed IR Fe ii emission lines present evidence of having significantly larger formation radii; distinctive phase lags between IR Fe ii and H i Brackett emission lines further supports that these species arise from different radii in Be disks. Several emission lines have been identified for the first time including C i 16895, a prominent feature in the spectra for almost a fifth of the sample and, as inferred from relatively large Δv p compared to the Br11–Br20, a tracer of the inner regions of Be disks. Emission lines at 15760 Å and 16781 Å remain unidentified, but usually appear along with and always have similar line profile morphology to Fe ii 16878. Unlike the typical metallic lines observed for Be stars in the optical, the H-band metallic lines, such as Fe ii 16878, never exhibit any evidence of
Kreiss, Gunilla; Holmgren, Hanna; Kronbichler, Martin; Ge, Anthony; Brant, Luca
2017-11-01
The conventional no-slip boundary condition leads to a non-integrable stress singularity at a moving contact line. This makes numerical simulations of two-phase flow challenging, especially when capillarity of the contact point is essential for the dynamics of the flow. We will describe a modeling methodology, which is suitable for numerical simulations, and present results from numerical computations. The methodology is based on combining a relation between the apparent contact angle and the contact line velocity, with the similarity solution for Stokes flow at a planar interface. The relation between angle and velocity can be determined by theoretical arguments, or from simulations using a more detailed model. In our approach we have used results from phase field simulations in a small domain, but using a molecular dynamics model should also be possible. In both cases more physics is included and the stress singularity is removed.
Dimensioning of lining galleries in deep clays
International Nuclear Information System (INIS)
Bernaud, D.; Rousset, G.
1991-01-01
The aim of the work presented in this report is to study the mechanical behaviour of lining galleries in deep clays. This text constitutes a part of the researches on the feasibility of a geological disposal of radioactive waste, which the scope is to assure the gallery long term stabilization and also to optimize its dimensioning. In particular, we are interested here in the study of a closure controlled lining, that constitutes a direct application of the convergence-confinement method, especially well fitted to deep clays. The presentation and interpretation of the convergence controlled lining test, which was performed in the experimental gallery of Mol in Belgium, is given in this report. The instrumentation was conceived in order to find out the stress field exerced by the rockmass on the lining, the internal stress field inside the lining and the gallery closure. The analysis of all measurements results, obtained between november 1987 and December 1989, shows that they are all in good agreement and that the lining design was well chosen. Two years after the gallery construction, the average closure is of the order of 2% and the average confinement pressure is about 1.6 MPa (the third of the lithostatic pressure). The time dependent effects of the rockmass are very well modelled by the non linear elasto-viscoplastic law developed at L.M.S. with the laboratory tests. The elastic-plastic model of the lining are shown to be well fitted to simulate the sliding of the ribs. Finally, the numerical results have shown a very good agreement with the measurements results
The relationship among reference lines used for taking the extraoral radiography
International Nuclear Information System (INIS)
Lee, Sul Mi; Choi, Hang Moon
2001-01-01
The aim of present study is to estimate the relationship among reference lines used for taking the extraoral radiography and panoramic radiography. Lateral cephalographs of 40 adults, aged 22 to 30 years were taken. Angles between reference lines (Frankfort line, canthomeatal line, infraorbitomeatal line, and occlusal plane) were measured. Angles between Frankfort line and canthomeatal line, Frankfort line and infraorbitomeatal line, Frankfortline and occlusal plane, canthomeatal line and infraorbitomeatal line, canthomeatal line and occlusal plane, and infraorbitomeatal line and occlusal plane were 16.1 (±2.2), 5.8 (±2.4), 8.7 (±3.5), 10.3 (±1.3), 24.8 (±4.0), and 14.5 (±4.4), respectively. Angle between frankfort and canthomeatal line is very different with commonly known angle. Frankfort horizontal reference lines used for panoramic radiography need an exact definition and more accurate standard is needed for the taking of panoramic radiograph
On quadrisecant lines of threefolds in P^5
Directory of Open Access Journals (Sweden)
Emilia Mezzetti
2000-09-01
Full Text Available We study smooth threefolds of P^5 whose quadrisecant lines don't fill up the space. We give a complete classification of those threefolds X whose only quadrisecant lines are the lines contained in X . Then we prove that, if X admits "true" quadrisecant lines, but they don't fill up P^5 , then either X is contained in a cubic hypersurface, or it contains a family of dimension at least two of plane curves of degree at least four.
Apparatus and Method for Communication over Power Lines
Krasowski, Michael J. (Inventor); Prokop, Norman F. (Inventor); Greer, III, Lawrence C. (Inventor); Nappier, Jennifer M. (Inventor)
2017-01-01
An apparatus and method are provided for communicating over power lines. The apparatus includes a coupling modem that is situated between a power line and a device. The coupling modem is configured to demodulate a signal received from the power line into a sine signal and a cosine signal. The coupling modem is also configured to modulate a communicated bit stream received from the device into a transmitted signal in order to impose the transmitted signal onto the power line.
Intercomparison of three microwave/infrared high resolution line-by-line radiative transfer codes
Schreier, Franz; Milz, Mathias; Buehler, Stefan A.; von Clarmann, Thomas
2018-05-01
An intercomparison of three line-by-line (lbl) codes developed independently for atmospheric radiative transfer and remote sensing - ARTS, GARLIC, and KOPRA - has been performed for a thermal infrared nadir sounding application assuming a HIRS-like (High resolution Infrared Radiation Sounder) setup. Radiances for the 19 HIRS infrared channels and a set of 42 atmospheric profiles from the "Garand dataset" have been computed. The mutual differences of the equivalent brightness temperatures are presented and possible causes of disagreement are discussed. In particular, the impact of path integration schemes and atmospheric layer discretization is assessed. When the continuum absorption contribution is ignored because of the different implementations, residuals are generally in the sub-Kelvin range and smaller than 0.1 K for some window channels (and all atmospheric models and lbl codes). None of the three codes turned out to be perfect for all channels and atmospheres. Remaining discrepancies are attributed to different lbl optimization techniques. Lbl codes seem to have reached a maturity in the implementation of radiative transfer that the choice of the underlying physical models (line shape models, continua etc) becomes increasingly relevant.
Shaping the spectra of the line-to-line voltage using signal injection in the common mode voltage
DEFF Research Database (Denmark)
Mathe, Laszlo; Rasmussen, Peter Omand; Pedersen, John Kim
2009-01-01
A drawback of Pulse Width Modulation in electrical drives is the high harmonic content of the line to line voltages, which gives rise to Electro-Magnetic Interference and acoustic noise. By injection of a signal into the common mode voltage, the fundamental is not affected, but new frequency...
Directory of Open Access Journals (Sweden)
Omorov Turatbek
2017-01-01
Full Text Available The problem of protection of a three-phase four-wire distribution network (DEN with a voltage of 0.4 kV from the interruption of electric power lines is considered. On the basis of the analysis of the values of complex resistances of interpersonal sections of the main line of the network, criteria are proposed that allow detecting critical situations associated with discontinuities in power transmission lines. Using these criteria makes it possible to localize the places of breaks of phase and neutral wires. Mathematical models and methods that are used to evaluate the complex resistances of interpersonal sections of a three-phase network are briefly considered. The obtained results are oriented for use in the automated system of electricity control and accounting (ASMAE.
Electronic transport of bilayer graphene with asymmetry line defects
International Nuclear Information System (INIS)
Zhao Xiao-Ming; Chen Chan; Liang Ying; Kou Su-Peng; Wu Ya-Jie
2016-01-01
In this paper, we study the quantum properties of a bilayer graphene with (asymmetry) line defects. The localized states are found around the line defects. Thus, the line defects on one certain layer of the bilayer graphene can lead to an electric transport channel. By adding a bias potential along the direction of the line defects, we calculate the electric conductivity of bilayer graphene with line defects using the Landauer–Büttiker theory, and show that the channel affects the electric conductivity remarkably by comparing the results with those in a perfect bilayer graphene. This one-dimensional line electric channel has the potential to be applied in nanotechnology engineering. (paper)
Superconducting coherence in a vortex line liquid
International Nuclear Information System (INIS)
Chen, T.; Teitel, S.
1995-01-01
We carry out simulations of the anisotropic uniformly frustrated 3d XY model, as a model for vortex line fluctuations in high T c superconductors. We compute the phase diagram as a function of temperature and anisotropy, for a fixed applied magnetic field B. We find two distinct phase transitions. Upon heating, there is first a lower T c perpendicular where the vortex line lattice melts and super-conducting coherence perpendicular to the applied magnetic field vanishes. At a higher T cz , within the vortex line liquid, superconducting coherence parallel to the applied magnetic field vanishes. For finite anisotropy, both T c perpendicular and T cz lie well below the crossover from the vortex line liquid to the normal state
Coiled transmission line pulse generators
McDonald, Kenneth Fox
2010-11-09
Methods and apparatus are provided for fabricating and constructing solid dielectric "Coiled Transmission Line" pulse generators in radial or axial coiled geometries. The pour and cure fabrication process enables a wide variety of geometries and form factors. The volume between the conductors is filled with liquid blends of monomers, polymers, oligomers, and/or cross-linkers and dielectric powders; and then cured to form high field strength and high dielectric constant solid dielectric transmission lines that intrinsically produce ideal rectangular high voltage pulses when charged and switched into matched impedance loads. Voltage levels may be increased by Marx and/or Blumlein principles incorporating spark gap or, preferentially, solid state switches (such as optically triggered thyristors) which produce reliable, high repetition rate operation. Moreover, these Marxed pulse generators can be DC charged and do not require additional pulse forming circuitry, pulse forming lines, transformers, or an a high voltage spark gap output switch. The apparatus accommodates a wide range of voltages, impedances, pulse durations, pulse repetition rates, and duty cycles. The resulting mobile or flight platform friendly cylindrical geometric configuration is much more compact, light-weight, and robust than conventional linear geometries, or pulse generators constructed from conventional components. Installing additional circuitry may accommodate optional pulse shape improvements. The Coiled Transmission Lines can also be connected in parallel to decrease the impedance, or in series to increase the pulse length.
26 CFR 1.132-4 - Line of business limitation.
2010-04-01
... athletic facilities. (iii) Performance of substantial services in more than one line of business. An... one line of business, such lines of business will be treated as a single line of business where and to... business. For example, assume that on the same premises an employer sells both women's apparel and jewelry...
46 CFR 7.1 - General purpose of boundary lines.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false General purpose of boundary lines. 7.1 Section 7.1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY PROCEDURES APPLICABLE TO THE PUBLIC BOUNDARY LINES General § 7.1 General purpose of boundary lines. The lines in this part delineate the application of the...
Creation and evaluation of best cotton mutant lines
International Nuclear Information System (INIS)
Rastegari, S. J.; Hosseini, Z.
2001-01-01
During (1997-1999) a study was carried out to recognize the best mutant lines, which were already obtained from a mutation breeding project. A Triple Rectangular Latis Design (8 7) in form of randomized complete blocks (RCB) with fifty- six treatments and three replications, were used in Estahban, Kordkouy and Varamin, under different ecological conditions, rainfall (Kordkouy) desert (Varamin) hot and dry (Estahban). During growing season some important morphological characteristics were recorded. Some lines had specific characters, for example: line 3191 (Chirpan 150 gray) had a low leaf number per plant, line 3169 (Bakhtegan 200 gray) plants were clustered. The results of the data in Varamin station showed that Bakhtegan irradiated with 150 gray line 3485 and Tashkand with 300 gray line 3451 compared to check (Varamin with 4373 kg/ha) had highest yield with 4942 kg/ha, and 4871 kg/ha respectively. In view of boll weight line 3405 of Sahel irradiated with 200 gray had highest boll weight (6.5 g/boll). In Kordkouy station the best mutant line was Chirpan irradiated with 250 gray, line 3208, with 20% yield increase compared to Sahel and 30% yield increase compared to original Chirpan. In respect to irradiation effect on lint percentage and fiber quality, the results showed; there was a positive effect on lint percentage of all varieties, especially in Tashkant, Bakhtegan and Chirpan which are inherently weak in lint percentage. As a whole gamma radiation did not have any negative effect on fiber quality. Even in Estahban 1.6 to 2.4 mm fiber increase were observed in some Chirpan irradiated material (C150-3516) and (C200-3523)
International Nuclear Information System (INIS)
Clough, S.A.
1993-01-01
In the present study we are studying the effects of including carbon dioxide, ozone, methane, and the halocarbons in addition to water vapor in the radiating atmosphere. The study has focused on two principal issues: the effect on the spectral fluxes and cooling rates of carbon dioxide, ozone and the halocarbons at 1990 concentration levels and the change in fluxes and cooling rates as a consequence of the anticipated ten year change in the profiles of these species. For the latter study the water vapor profiles have been taken as invariant in time. The radiative line-by-line calculations using LBLRTM (Line-By-Line Radiative Transfer Model) have been performed for tropical (TRP), mid-latitude winter (MLW) and mid-latitude summer (MLS) model atmospheres. The halocarbons considered in the present study are CCl 4 , CFC-11, CFC-12 and CFC-22. In addition to considering the radiative effects of carbon dioxide at 355 ppM, the assumed current level, we have also obtained results for doubled carbon dioxide at 710 ppM. An important focus of the current research effort is the effect of the ozone depletion profile on atmospheric radiative effects
Ji, Tuo; Zhou, Hongyan; Jiang, Peng; Wang, Tinggui; Ge, Jian; Wang, Huiyuan; Komossa, S.; Hamann, Fred; Zuther, Jens; Liu, Wenjuan; Lu, Honglin; Zuo, Wenwen; Yang, Chenwei; Yuan, Weimin
2015-02-01
We report the identification of an unusual absorption-line system in the quasar SDSS J080248.18+551328.9 and present a detailed study of the system, incorporating follow-up optical and near-IR spectroscopy. A few tens of absorption lines are detected, including He I*, Fe II*, and Ni II*, which arise from metastable or excited levels, as well as resonant lines in Mg I, Mg II, Fe II, Mn II, and Ca II. All of the isolated absorption lines show the same profile of width Δv ~ 1500 km s-1 centered at a common redshift as that of the quasar emission lines, such as [O II], [S II], and hydrogen Paschen and Balmer series. With narrow Balmer lines, strong optical Fe II multiplets, and weak [O III] doublets, its emission-line spectrum is typical for that of a narrow-line Seyfert 1 galaxy (NLS1). We have derived reliable measurements of the gas-phase column densities of the absorbing ions/levels. Photoionization modeling indicates that the absorber has a density of n H ~ (1.0-2.5) × 105 cm-3 and a column density of N H ~ (1.0-3.2) × 1021 cm-2 and is located at R ~100-250 pc from the central supermassive black hole. The location of the absorber, the symmetric profile of the absorption lines, and the coincidence of the absorption- and emission-line centroid jointly suggest that the absorption gas originates from the host galaxy and is plausibly accelerated by stellar processes, such as stellar winds and/or supernova explosions. The implications for the detection of such a peculiar absorption-line system in an NLS1 are discussed in the context of coevolution between supermassive black hole growth and host galaxy buildup.
Overview of The Pulse Line Ion Accelerator
International Nuclear Information System (INIS)
Briggs, R.J.; Bieniosek, F.M.; Coleman, J.E.; Eylon, S.; Henestroza, E.; Leitner, M.; Logan, B.G.; Reginato, L.L.; Roy, P.K.; Seidl, P.A.; Waldron, W.L.; Yu, S.S.; Barnard, J.J.; Caporaso, G.J.; Friedman, A.; Grote, D.P.; Nelson, S.D.
2006-01-01
An overview of the Pulse Line Ion Accelerator (PLIA) concept and its development is presented. In the PLIA concept a pulse power driver applied to one end of a helical pulse line creates a traveling wave pulse that accelerates and axially confines a heavy ion beam pulse The motivation for its development at the IFE-VNL is the acceleration of intense, short pulse, heavy ion beams to regimes of interest for studies of High Energy Density Physics and Warm Dense Matter. Acceleration scenarios with constant parameter helical lines are described which result in output energies of a single stage much larger than the several hundred kilovolt peak voltages on the line, with a goal of 3-5 MeV/meter acceleration gradients. The main attraction of the concept is the very low cost it promises. It might be described crudely as an ''air core'' induction linac where the pulse-forming network is integrated into the beam line so the accelerating voltage pulse can move along with the ions to get voltage multiplication
The Ratio of the Resonance Line to Intercombination Line in Neonlike Ions
Panchenko, D.; Andrianarijaona, Vm; Brown, Gv; Hell, N.; Beiersdorfer, P.
2017-04-01
We present the measurement results of the intensity ratios of astrophysically important 1s22s22p1/2 53d3/2 -> 1s22s22p6 resonance line to the 1s2 2s2 2p3/253d5/2 -> 1s22s22p6 intercombination line for Ne-like Kr26+ and Mo32+. The experiment was done at the EBIT-I electron beam ion trap at Lawrence Livermore National Laboratory and utilized an x-ray microcalorimeter. The Mo32+ experiment is the highest Z-measurement of such type to date, where the dominant role of the intercombination line, known to increase with Z, puts our measurement firmly into the relativistic regime. Compared to the earlier measurements of ions with lower atomic numbers, the measurement for Mo32+ shows much a closer agreement with theory. Our results support the hypothesis that the disagreement should narrow with atomic number. This implies that the disagreement with theory may be confined to the range of atomic numbers where the correlation effects are largest. This work was performed under the auspices of the U.S. DoE by LLNL, contract DE-AC52-07NA27344, and was supported in part by NASA's APRA program and by the ESA, contract 4000114313/15/NL/CB.
State Wildlife Management Area Public Facilities - lines
Minnesota Department of Natural Resources — This line theme contains facilities and features for WMAs that are best represented as lines. WMAs are part of the Minnesota state recreation system created to...
25 CFR 226.33 - Line drilling.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Line drilling. 226.33 Section 226.33 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEASING OF OSAGE RESERVATION LANDS FOR OIL AND GAS MINING Requirements of Lessees § 226.33 Line drilling. Lessee shall not drill within 300 feet...
Roddy, Dermot
2013-01-01
Radio and Line Transmission, Volume 2 gives a detailed treatment of the subject as well as an introduction to additional advanced subject matter. Organized into 14 chapters, this book begins by explaining the radio wave propagation, signal frequencies, and bandwidth. Subsequent chapters describe the transmission lines and cables; the aerials; tuned and coupled circuits; bipolar transistor amplifiers; field-effect transistors and circuits; thermionic valve amplifiers; LC oscillators; the diode detectors and modulators; and the superheterodyne receiver. Other chapters explore noise and interfere
Energy Technology Data Exchange (ETDEWEB)
Schultz, D.R. [Oak Ridge National Lab., TN (United States); Nash, J.K. [Lawrence Livermore National Lab., CA (United States)
1996-04-01
The need for atomic data is one which continues to expand in a wide variety of applications including fusion energy, astrophysics, laser- produced plasma research, and plasma processing. Modern computer database and communications technology nables this data to be placed on-line and obtained by users of the Internet. Presented here is a summary of the observations and conclusions regarding such on-line atomic data access derived from a forum held at the Tenth APS Topical Conference on Atomic Processes in Plasmas.
Ethylene responses in three Hydrangea lines
DEFF Research Database (Denmark)
Lauridsen, Uffe Bjerre; Müller, Renate; Lütken, Henrik Vlk
2015-01-01
Abstract The ornamental scrub Hydrangea is generally not considered to be particularly sensitive to the phytohormone ethylene. The present study aimed at testing ethylene sensitivity in three different Hydrangea lines: 1, 2 and 3 taking into account the effect of temperature. Ethylene response...... was measured as leaf epinasty and leaf drop. Data indicated that higher temperature accelerates the effect of 2 μl L-1 ethylene over a 12-day period, and if the inhibitor 1-methylcyclopopene 1-MCP is able to attenuate this effect. Breeding line 1 and 3 dropped 3.8±0.6 and 5.0±0.4 leaves on average......, respectively, during the 12-day experimental period. Non-treated controls of line 1 and 3 dropped 1.8±0.6 and 1.8±0.4 leaves, respectively. In contrast, line 2 did not show a significant response to ethylene treatment with a leaf drop of 2.1±0.3 leaves, compared to a leaf drop of 0.8±0.3 in non...
Properties of Narrow line Seyfert 1 galaxies
Rakshit, Suvendu; Stalin, Chelliah Subramonian; Chand, Hum; Zhang, Xue-Guang
2018-04-01
Narrow line Seyfert 1 (NLSy1) galaxies constitute a class of active galactic nuclei characterized by the full width at half maximum (FWHM) of the Hα broad emission line 10 pixel-1. A strong correlation between the Hα and Hα emission lines is found both in the FWHM and flux. The nuclear continuum luminosity is found to be strongly correlated with the luminosity of Hα, Hα and [O III] emission lines. The black hole mass in NLSy1 galaxies is lower compared to their broad line counterparts. Compared to BLSy1 galaxies, NLSy1 galaxies have a stronger FeII emission and a higher Eddington ratio that place them in the extreme upper right corner of the R4570 - λEdd diagram. The distribution of the radio-loudness parameter (R) in NLSy1 galaxies drops rapidly at R>10 compared to the BLSy1 galaxies that have powerful radio jets. The soft X-ray photon index in NLSy1 galaxies is on average higher (2.9 ± 0.9) than BLSy1 galaxies (2.4 ± 0.8). It is anti-correlated with the Hα width but correlated with the FeII strength. NLSy1 galaxies on average have a lower amplitude of optical variability compared to their broad lines counterparts. These results suggest Eddington ratio as the main parameter that drives optical variability in these sources.
In-situ Blockage Monitoring of Sensing Line
Directory of Open Access Journals (Sweden)
Aijaz Ahmed Mangi
2016-02-01
Full Text Available A reactor vessel level monitoring system measures the water level in a reactor during normal operation and abnormal conditions. A drop in the water level can expose nuclear fuel, which may lead to fuel meltdown and radiation spread in accident conditions. A level monitoring system mainly consists of a sensing line and pressure transmitter. Over a period of time boron sediments or other impurities can clog the line which may degrade the accuracy of the monitoring system. The aim of this study is to determine blockage in a sensing line using the energy of the composite signal. An equivalent Pi circuit model is used to simulate blockages in the sensing line and the system's response is examined under different blockage levels. Composite signals obtained from the model and plant's unblocked and blocked channels are decomposed into six levels of details and approximations using a wavelet filter bank. The percentage of energy is calculated at each level for approximations. It is observed that the percentage of energy reduces as the blockage level in the sensing line increases. The results of the model and operational data are well correlated. Thus, in our opinion variation in the energy levels of approximations can be used as an index to determine the presence and degree of blockage in a sensing line.
Germline transformation of the western corn rootworm, Diabrotica virgifera virgifera.
Chu, F; Klobasa, W; Wu, P; Pinzi, S; Grubbs, N; Gorski, S; Cardoza, Y; Lorenzen, M D
2017-08-01
The western corn rootworm (WCR), a major pest of maize, is notorious for rapidly adapting biochemically, behaviourally and developmentally to a variety of control methods. Despite much effort, the genetic basis of WCR adaptation remains a mystery. Since transformation-based applications such as transposon tagging and enhancer trapping have facilitated genetic dissection of model species such as Drosophila melanogaster, we developed a germline-transformation system for WCR in an effort to gain a greater understanding of the basic biology of this economically important insect. Here we report the use of a fluorescent-marked Minos element to create transgenic WCR. We demonstrate that the transgenic strains express both an eye-specific fluorescent marker and piggyBac transposase. We identified insertion-site junction sequences via inverse PCR and assessed insertion copy number using digital droplet PCR (ddPCR). Interestingly, most WCR identified as transgenic via visual screening for DsRed fluorescence proved to carry multiple Minos insertions when tested via ddPCR. A total of eight unique insertion strains were created by outcrossing the initial transgenic strains to nontransgenic WCR mates. Establishing transgenic technologies for this beetle is the first step towards bringing a wide range of transformation-based tools to bear on understanding WCR biology. © 2017 The Royal Entomological Society.
Antineutrino Oscillations in the Atmospheric Sector
International Nuclear Information System (INIS)
Himmel, Alexander I.
2011-01-01
This thesis presents measurements of the oscillations of muon antineutrinos in the atmospheric sector, where world knowledge of antineutrino oscillations lags well behind the knowledge of neutrinos, as well as a search for ν μ → (bar ν) μ transitions. Differences between neutrino and antineutrino oscillations could be a sign of physics beyond the Standard Model, including non-standard matter interactions or the violation of CPT symmetry. These measurements leverage the sign-selecting capabilities of the magnetized steel-scintillator MINOS detectors to analyze antineutrinos from the NuMI beam, both when it is in neutrino-mode and when it is in antineutrino-mode. Antineutrino oscillations are observed at |Δ(bar m) atm 2 | = (3.36 -0.40 +0.46 (stat) ± 0.06(syst)) x 10 -3 eV 2 and sin 2 (2(bar θ) 23 ) = 0.860 -0.12 +0.11 (stat) ± 0.01(syst). The oscillation parameters measured for antineutrinos and those measured by MINOS for neutrinos differ by a large enough margin that the chance of obtaining two values as discrepant as those observed is only 2%, assuming the two measurements arise from the same underlying mechanism, with the same parameter values. No evidence is seen for neutrino-to-antineutrino transitions.
DEFF Research Database (Denmark)
Fuster-López, Laura; Andersen, Cecil Krarup; Bouillon, Nicolas
2017-01-01
Glue-paste linings of (Western) canvas paintings have been performed with a variety of materials throughout history and are present in a very significant amount of artworks in collections in Europe and elsewhere. Cereal flours and animal glues were usually the main ingredients because they were r...
Czech Academy of Sciences Publication Activity Database
Anderson, S. P.; Celik, Levent
2015-01-01
Roč. 157, May (2015), s. 517-526 ISSN 0022-0531 R&D Projects: GA ČR(CZ) GA15-22540S Institutional support: PRVOUK-P23 Keywords : product line design * product differentiation * second-degree price discrimination Subject RIV: AH - Economics Impact factor: 1.097, year: 2015
Radio recombination lines from H II regions
International Nuclear Information System (INIS)
Silverglate, P.R.
1978-01-01
Radio recombination lines have been observed from forty-six H II regions. The Arecibo 1000-foot radio telescope was used to provide high sensitivity and high angular resolution at 1400 MHz (gain approx. 7.7 0 K/Jy, HPBW = 3:2) and 2372 MHZ (gain approx. 6.3 0 K/Jy, HPBW = 2'). Observations were made at 1400 MHz in the frequency switching mode, and at 2372 MHz in the total power mode. Gaussians were fit to be observed lines to derive velocities, line widths, and line temperatures. From the velocities kinematic distances were derived. For eleven sources H I absorption measurements were also made. The absorption spectra enabled the kinematic distance ambiguity to be resolved for some sources. The absorption spectra themselves were found to have extremely sharp, non-gaussian edges. One explanation for these is a model where the interstellar medium contains many H I cloudlets with T/sub s/less than or equal to 100 0 K and turbulent velocities less than or equal to 3 km/s. The H I absorption spectrum is then a superposition of many narrow gaussian profiles. It was also found from a comparison of H I absorption velocities with radio recombination line velocities that peculiar motions exist in the interstellar medium with velocities of up to 10 km/s. Using the measured line temperatures and continuum temperatures, estimates were desired of emission measures, electron temperatures, and electron densities, using a non-LTE analysis. Non-LTE effects were important only for the hottest and densest H II regions. The non-LTE calculations were checked through a comparison derivation of electron temperatures using hydrogen beta lines
Line impedance estimation using model based identification technique
DEFF Research Database (Denmark)
Ciobotaru, Mihai; Agelidis, Vassilios; Teodorescu, Remus
2011-01-01
The estimation of the line impedance can be used by the control of numerous grid-connected systems, such as active filters, islanding detection techniques, non-linear current controllers, detection of the on/off grid operation mode. Therefore, estimating the line impedance can add extra functions...... into the operation of the grid-connected power converters. This paper describes a quasi passive method for estimating the line impedance of the distribution electricity network. The method uses the model based identification technique to obtain the resistive and inductive parts of the line impedance. The quasi...
2010-07-01
... Continuous Lamination Lines and Continuous Casting Lines Complying With a Percent Reduction Limit on a Per... SOURCE CATEGORIES National Emissions Standards for Hazardous Air Pollutants: Reinforced Plastic... Reduction Limit on a Per Line Basis As required in § 63.5865(a), in order to comply with a percent reduction...
Standardization of beam line representations
International Nuclear Information System (INIS)
Carey, David C.
1998-01-01
Standardization of beam line representations means that a single set of data can be used in many situations to represent a beam line. This set of data should be the same no matter what the program to be run or the calculation to be made. We have concerned ourselves with three types of standardization: (1) The same set of data should be usable by different programs. (2) The inclusion of other items in the data, such as calculations to be done, units to be used, or preliminary specifications, should be in a notation similar to the lattice specification. (3) A single set of data should be used to represent a given beam line, no matter what is being modified or calculated. The specifics of what is to be modified or calculated can be edited into the data as part of the calculation. These three requirements all have aspects not previously discussed in a public forum. Implementations into TRANSPORT will be discussed
Workshop on Radio Recombination Lines
1980-01-01
Since their first detection 15 years ago, radio recombination lines from several elements have been observed in a wide variety of objects including HII regions, planetary nebulae, molecular clouds, the diffuse interstellar medium, and recently, other galaxies. The observations span almost the entire range from 0.1 to 100 GHz, and employ both single djsh and aperture synthesis techniques. The theory of radio recombination lines has also advanced strongly, to the point where it is perhaps one of the best-understood in astro physics. In a parallel development, it has become possible over the last decade to study these same highly-excited atoms in the laboratory; this work provides further confirmation of the theoretical framework. However there has been continuing controversy over the astrophysical interpre tation of radio recombination line observations, especially regarding the role of stimulated emission. A workshop was held in Ottawa on 24-25 August, 1979, bringing together many of the active scientist...
Standardization of beam line representations
International Nuclear Information System (INIS)
Carey, David C.
1999-01-01
Standardization of beam line representations means that a single set of data can be used in many situations to represent a beam line. This set of data should be the same no matter what the program to be run or the calculation to be made. We have concerned ourselves with three types of standardization: (1) The same set of data should be usable by different programs. (2) The inclusion of other items in the data, such as calculations to be done, units to be used, or preliminary specifications, should be in a notation similar to the lattice specification. (3) A single set of data should be used to represent a given beam line, no matter what is being modified or calculated. The specifics of what is to be modified or calculated can be edited into the data as part of the calculation. These three requirements all have aspects not previously discussed in a public forum. Implementations into TRANSPORT will be discussed
Extruding plastic scintillator at Fermilab
International Nuclear Information System (INIS)
Pla-Dalmau, Anna; Bross, Alain D.; Rykalin, Viktor V.
2003-01-01
An understanding of the costs involved in the production of plastic scintillators and the development of a less expensive material have become necessary with the prospects of building very large plastic scintillation detectors. Several factors contribute to the high cost of plastic scintillating sheets, but the principal reason is the labor-intensive nature of the manufacturing process. In order to significantly lower the costs, the current casting procedures had to be abandoned. Since polystyrene is widely used in the consumer industry, the logical path was to investigate the extrusion of commercial-grade polystyrene pellets with dopants to yield high quality plastic scintillator. This concept was tested and high quality extruded plastic scintillator was produced. The D0 and MINOS experiments are already using extruded scintillator strips in their detectors. An extrusion line has recently been installed at Fermilab in collaboration with NICADD (Northern Illinois Center for Accelerator and Detector Development). This new facility will serve to further develop and improve extruded plastic scintillator. This paper will discuss the characteristics of extruded plastic scintillator and its raw materials, the different manufacturing techniques and the current R andD program at Fermilab
Extended emission-line regions in active galaxies
International Nuclear Information System (INIS)
Hutchings, J.B.; Hickson, P.
1988-01-01
Long-slit spectra of four active galaxies in the redshift range 0.06-0.10 are presented. Two have interacting companions. Spectra of the galaxies show extended narrow emission lines in all cases. Continuum color changes, emision-line ratio changes, and velocity changes with 1 arcsec resolution can be detected. Relative velocities between AGN and companion galaxies are also given. These objects appear to lie in galaxies in which there is considerable star-formation activity, and very extended line emision. 20 references
26 CFR 1.167(b)-1 - Straight line method.
2010-04-01
... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Straight line method. 1.167(b)-1 Section 1.167(b... Straight line method. (a) In general. Under the straight line method the cost or other basis of the... may be reduced to a percentage or fraction. The straight line method may be used in determining a...
Ferkinhoff, Carl; Brisbin, Drew; Nikola, Thomas; Parshley, Stephen C.; Stacey, Gordon J.; Phillips, Thomas G.; Falgarone, Edith; Benford, Dominic J.; Staguhn, Johannes G.; Tucker, Carol E.
2011-01-01
We report the first detections of the [NIl] 122 {\\mu} m line from a high redshift galaxy. The line was strongly (> 6{\\sigma}) detected from SMMJ02399-0136, and HI413+ 117 (the Cloverleaf QSO) using the Redshift(z) and Early Universe Spectrometer (ZEUS) on the CSO. The lines from both sources are quite bright with line-to-FIR continuum luminosity ratios that are approx.7.0x10(exp -4) (Cloverleaf) and 2.1x10(exp -3) (SMMJ02399). With ratios 2-10 times larger than the average value for nearby galaxies, neither source exhibits the line-to-continuum deficits seen in nearby sources. The line strengths also indicate large ionized gas fractions, approx.8 to 17% of the molecular gas mass. The [OIII]/[NII] line ratio is very sensitive to the effective temperature of ionizing stars and the ionization parameter for emission arising in the narrow-line region (NLR) of an AGN. Using our previous detection of the [01II] 88 {\\mu}m line, the [OIII]/ [NIl] line ratio for SMMJ02399-0136 indicates the dominant source of the line emission is either stellar HII regions ionized by 09.5 stars, or the NLR of the AGN with ionization parameter 10g(U) = -3.3 to -4.0. A composite system, where 30 to 50% of the FIR lines arise in the NLR also matches the data. The Cloverleaf is best modeled by a superposition of approx.200 M82like starbursts accounting for all of the FIR emission and 43% of the [NIl] line. The remainder may come from the NLR. This work demonstrates the utility of the [NIl] and [OIII] lines in constraining properties of the ionized medium.
Yellow Rust Resistance in Advanced Lines and Commercial ...
African Journals Online (AJOL)
The objective of this study was to characterize seedling yellow rust resistance in 21 advanced bread wheat lines and 20 cultivars from Ethiopia. Yellow rust infection types (ITs) produced on test wheat lines and cultivars from nine yellow rust races were compared with ITs produced on standard differential lines that differed ...
DEFF Research Database (Denmark)
Salomonsen, Hans Anton; Nielsen, Holger Andreas
Notesæt til anvendelse i kurserne Calculus 1 og 2. Den elementære lineære algebra præsenteres gennem en række gennemregnede eksempler.......Notesæt til anvendelse i kurserne Calculus 1 og 2. Den elementære lineære algebra præsenteres gennem en række gennemregnede eksempler....
Basic Stand Alone Carrier Line Items PUF
U.S. Department of Health & Human Services — This release contains the Basic Stand Alone (BSA) Carrier Line Items Public Use Files (PUF) with information from Medicare Carrier claims. The CMS BSA Carrier Line...
HB-Line Plutonium Oxide Data Collection Strategy
Energy Technology Data Exchange (ETDEWEB)
Watkins, R. [Savannah River Nuclear Solutions; Varble, J. [Savannah River Nuclear Solutions; Jordan, J. [Savannah River Nuclear Solutions
2015-05-26
HB-Line and H-Canyon will handle and process plutonium material to produce plutonium oxide for feed to the Mixed Oxide Fuel Fabrication Facility (MFFF). However, the plutonium oxide product will not be transferred to the MFFF directly from HB-Line until it is packaged into a qualified DOE-STD-3013-2012 container. In the interim, HB-Line will load plutonium oxide into an inner, filtered can. The inner can will be placed in a filtered bag, which will be loaded into a filtered outer can. The outer can will be loaded into a certified 9975 with getter assembly in compliance with onsite transportation requirement, for subsequent storage and transfer to the K-Area Complex (KAC). After DOE-STD-3013-2012 container packaging capabilities are established, the product will be returned to HB-Line to be packaged into a qualified DOE-STD-3013-2012 container. To support the transfer of plutonium oxide to KAC and then eventually to MFFF, various material and packaging data will have to be collected and retained. In addition, data from initial HB-Line processing operations will be needed to support future DOE-STD-3013-2012 qualification as amended by the HB-Line DOE Standard equivalency. As production increases, the volume of data to collect will increase. The HB-Line data collected will be in the form of paper copies and electronic media. Paper copy data will, at a minimum, consist of facility procedures, nonconformance reports (NCRs), and DCS print outs. Electronic data will be in the form of Adobe portable document formats (PDFs). Collecting all the required data for each plutonium oxide can will be no small effort for HB-Line, and will become more challenging once the maximum annual oxide production throughput is achieved due to the sheer volume of data to be collected. The majority of the data collected will be in the form of facility procedures, DCS print outs, and laboratory results. To facilitate complete collection of this data, a traveler form will be developed which