Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLF442 (Link to dictyBase) slf442 - - Contig-U16022-1 SLF442P ...(Link to Original site) SLF442F 294 SLF442Z 570 SLF442P 864 - - Show SLF442 Library SL (Link to library) Clone ID SLF4...42 (Link to dictyBase) Atlas ID slf442 NBRP ID - dictyBase ID - Link to Contig Contig-U16022-1 Ori...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLF4-B/SLF442Q.Seq.d/ Re...presentative seq. ID SLF442P (Link to Original site) Representative DNA sequence >SLF442 (SLF442Q) /CSM/SL/SLF4-B/SLF4
Propagation of SLF/ELF electromagnetic waves
Pan, Weiyan
2014-01-01
This book deals with the SLF/ELF wave propagation, an important branch of electromagnetic theory. The SLF/ELF wave propagation theory is well applied in earthquake electromagnetic radiation, submarine communication, thunderstorm detection, and geophysical prospecting and diagnostics. The propagation of SLF/ELF electromagnetic waves is introduced in various media like the earth-ionospheric waveguide, ionospheric plasma, sea water, earth, and the boundary between two different media or the stratified media. Applications in the earthquake electromagnetic radiation and the submarine communications are also addressed. This book is intended for scientists and engineers in the fields of radio propagation and EM theory and applications. Prof. Pan is a professor at China Research Institute of Radiowave Propagation in Qingdao (China). Dr. Li is a professor at Zhejiang University in Hangzhou (China).
LINEAR2007, Linear-Linear Interpolation of ENDF Format Cross-Sections
International Nuclear Information System (INIS)
2007-01-01
1 - Description of program or function: LINEAR converts evaluated cross sections in the ENDF/B format into a tabular form that is subject to linear-linear interpolation in energy and cross section. The code also thins tables of cross sections already in that form. Codes used subsequently need thus to consider only linear-linear data. IAEA1311/15: This version include the updates up to January 30, 2007. Changes in ENDF/B-VII Format and procedures, as well as the evaluations themselves, make it impossible for versions of the ENDF/B pre-processing codes earlier than PREPRO 2007 (2007 Version) to accurately process current ENDF/B-VII evaluations. The present code can handle all existing ENDF/B-VI evaluations through release 8, which will be the last release of ENDF/B-VI. Modifications from previous versions: - Linear VERS. 2007-1 (JAN. 2007): checked against all ENDF/B-VII; increased page size from 60,000 to 600,000 points 2 - Method of solution: Each section of data is considered separately. Each section of File 3, 23, and 27 data consists of a table of cross section versus energy with any of five interpolation laws. LINEAR will replace each section with a new table of energy versus cross section data in which the interpolation law is always linear in energy and cross section. The histogram (constant cross section between two energies) interpolation law is converted to linear-linear by substituting two points for each initial point. The linear-linear is not altered. For the log-linear, linear-log and log- log laws, the cross section data are converted to linear by an interval halving algorithm. Each interval is divided in half until the value at the middle of the interval can be approximated by linear-linear interpolation to within a given accuracy. The LINEAR program uses a multipoint fractional error thinning algorithm to minimize the size of each cross section table
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLF689 (Link to dictyBase) - - - Contig-U16284-1 SLF689Z (Link... to Original site) - - SLF689Z 320 - - - - Show SLF689 Library SL (Link to library) Clone ID SLF689 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16284-1 Original site URL http://dict...DNA Score E Sequences producing significant alignments: (bits) Value N ( AC116305 ) Dictyostelium discoideum... chromosome 2 map 1005175... 478 e-131 1 ( AU053477 ) Dictyostelium discoideum slug cDNA, clone SLI726. 478 e-131 1 ( AU053102 ) Dict
Energy Technology Data Exchange (ETDEWEB)
Hofmann, Gaston
2011-07-15
In this paper the suitability of the stationary fluidised bed combustion as a treatment option for shredder light fractions (SLF) is discussed. This SLF, SLF coarse grain and SLF generated in a further mechanical treatment were burned. The results show a strong change in grain size distribution of the bed material during the combustion the SLF and SLF-coarse fractions. The formation of agglomerates significantly impaired the fluidization. The main reason for this effect is the high content of alkali and alkaline earth metals in the SLF. During the incineration of SLF generated by further mechanical treatment the change in grain size distribution declines much more slowly. This results from the separation of hard plastics with higher calcium contents during further mechanical processing. The tests also showed a complete burnout and a significant enrichment of metals in the solid combustion residues (fabric filter ash bed ash, cyclone ash). These residues represent a recycling concentrate, which needs to be open in the future. (orig.)
Fourier imaging of non-linear structure formation
International Nuclear Information System (INIS)
Brandbyge, Jacob; Hannestad, Steen
2017-01-01
We perform a Fourier space decomposition of the dynamics of non-linear cosmological structure formation in ΛCDM models. From N -body simulations involving only cold dark matter we calculate 3-dimensional non-linear density, velocity divergence and vorticity Fourier realizations, and use these to calculate the fully non-linear mode coupling integrals in the corresponding fluid equations. Our approach allows for a reconstruction of the amount of mode coupling between any two wavenumbers as a function of redshift. With our Fourier decomposition method we identify the transfer of power from larger to smaller scales, the stable clustering regime, the scale where vorticity becomes important, and the suppression of the non-linear divergence power spectrum as compared to linear theory. Our results can be used to improve and calibrate semi-analytical structure formation models.
Fourier imaging of non-linear structure formation
Energy Technology Data Exchange (ETDEWEB)
Brandbyge, Jacob; Hannestad, Steen, E-mail: jacobb@phys.au.dk, E-mail: sth@phys.au.dk [Department of Physics and Astronomy, University of Aarhus, Ny Munkegade 120, DK-8000 Aarhus C (Denmark)
2017-04-01
We perform a Fourier space decomposition of the dynamics of non-linear cosmological structure formation in ΛCDM models. From N -body simulations involving only cold dark matter we calculate 3-dimensional non-linear density, velocity divergence and vorticity Fourier realizations, and use these to calculate the fully non-linear mode coupling integrals in the corresponding fluid equations. Our approach allows for a reconstruction of the amount of mode coupling between any two wavenumbers as a function of redshift. With our Fourier decomposition method we identify the transfer of power from larger to smaller scales, the stable clustering regime, the scale where vorticity becomes important, and the suppression of the non-linear divergence power spectrum as compared to linear theory. Our results can be used to improve and calibrate semi-analytical structure formation models.
SIGMA1-2007, Doppler Broadening ENDF Format Linear-Linear. Interpolated Point Cross Section
International Nuclear Information System (INIS)
2007-01-01
1 - Description of problem or function: SIGMA-1 Doppler broadens evaluated Cross sections given in the linear-linear interpolation form of the ENDF/B Format to one final temperature. The data is Doppler broadened, thinned, and output in the ENDF/B Format. IAEA0854/15: This version include the updates up to January 30, 2007. Changes in ENDF/B-VII Format and procedures, as well as the evaluations themselves, make it impossible for versions of the ENDF/B pre-processing codes earlier than PREPRO 2007 (2007 Version) to accurately process current ENDF/B-VII evaluations. The present code can handle all existing ENDF/B-VI evaluations through release 8, which will be the last release of ENDF/B-VI. 2 - Modifications from previous versions: Sigma-1 VERS. 2007-1 (Jan. 2007): checked against all ENDF/B-VII; increased page size from 60,000 to 360,000 energy points 3 - Method of solution: The energy grid is selected to ensure that the broadened data is linear-linear interpolable. SIGMA-1 starts from the free-atom Doppler broadening equations and adds the assumptions of linear data within the table and constant data outside the range of the table. If the Original data is not at zero Kelvin, the data is broadened by the effective temperature difference to the final temperature. If the data is already at a temperature higher than the final temperature, Doppler broadening is not performed. 4 - Restrictions on the complexity of the problem: The input to SIGMA-1 must be data which vary linearly in energy and cross section between tabulated points. The LINEAR program provides such data. LINEAR uses only the ENDF/B BCD Format tape and copies all sections except File 3 as read. Since File 3 data are in identical Format for ENDF/B Versions I through VI, the program can be used with all these versions. - The present version Doppler broadens only to one final temperature
KTOE, KEDAK to ENDF/B Format Conversion with Linear Linear Interpolation
International Nuclear Information System (INIS)
Panini, Gian Carlo
1985-01-01
1 - Nature of physical problem solved: This code performs a fully automated translation from KEDAK into ENDF-4 or -5 format. Output is on tape in card image format. 2 - Method of solution: Before translation the reactions are sorted in the ENDF format order. Linear-linear interpolation rule is preserved. The resonance parameters for both resolved and unresolved, could also be translated and a background cross section is formed as the difference of the calculated contribution from the parameters and the point-wise data given in the original file. Elastic angular distributions originally given in tabulated form are converted into Legendre polynomial coefficients. Energy distributions are calculated using a simple evaporation model with the temperature expressed as a function of the incident mass. 3 - Restrictions on the complexity of the problem: The existing restrictions both on KEDAK and ENDF have been applied to the array sizes used in the code, except for the number of points in a section which in the ENDF format are limited to 5000 points. The code only translates one material at a time
A linear process-algebraic format for probabilistic systems with data (extended version)
Katoen, Joost P.; van de Pol, Jan Cornelis; Stoelinga, Mariëlle Ida Antoinette; Timmer, Mark
2010-01-01
This paper presents a novel linear process-algebraic format for probabilistic automata. The key ingredient is a symbolic transformation of probabilistic process algebra terms that incorporate data into this linear format while preserving strong probabilistic bisimulation. This generalises similar
A linear process-algebraic format for probabilistic systems with data
Katoen, Joost P.; van de Pol, Jan Cornelis; Stoelinga, Mariëlle Ida Antoinette; Timmer, Mark; Gomes, L.; Khomenko, V.; Fernandes, J.M.
This paper presents a novel linear process algebraic format for probabilistic automata. The key ingredient is a symbolic transformation of probabilistic process algebra terms that incorporate data into this linear format while preserving strong probabilistic bisimulation. This generalises similar
Non-linear pattern formation in bone growth and architecture.
Salmon, Phil
2014-01-01
The three-dimensional morphology of bone arises through adaptation to its required engineering performance. Genetically and adaptively bone travels along a complex spatiotemporal trajectory to acquire optimal architecture. On a cellular, micro-anatomical scale, what mechanisms coordinate the activity of osteoblasts and osteoclasts to produce complex and efficient bone architectures? One mechanism is examined here - chaotic non-linear pattern formation (NPF) - which underlies in a unifying way natural structures as disparate as trabecular bone, swarms of birds flying, island formation, fluid turbulence, and others. At the heart of NPF is the fact that simple rules operating between interacting elements, and Turing-like interaction between global and local signals, lead to complex and structured patterns. The study of "group intelligence" exhibited by swarming birds or shoaling fish has led to an embodiment of NPF called "particle swarm optimization" (PSO). This theoretical model could be applicable to the behavior of osteoblasts, osteoclasts, and osteocytes, seeing them operating "socially" in response simultaneously to both global and local signals (endocrine, cytokine, mechanical), resulting in their clustered activity at formation and resorption sites. This represents problem-solving by social intelligence, and could potentially add further realism to in silico computer simulation of bone modeling. What insights has NPF provided to bone biology? One example concerns the genetic disorder juvenile Pagets disease or idiopathic hyperphosphatasia, where the anomalous parallel trabecular architecture characteristic of this pathology is consistent with an NPF paradigm by analogy with known experimental NPF systems. Here, coupling or "feedback" between osteoblasts and osteoclasts is the critical element. This NPF paradigm implies a profound link between bone regulation and its architecture: in bone the architecture is the regulation. The former is the emergent
Linear approximation model network and its formation via ...
Indian Academy of Sciences (India)
To overcome the deficiency of `local model network' (LMN) techniques, an alternative `linear approximation model' (LAM) network approach is proposed. Such a network models a nonlinear or practical system with multiple linear models fitted along operating trajectories, where individual models are simply networked ...
Linear approximation model network and its formation via ...
Indian Academy of Sciences (India)
niques, an alternative `linear approximation model' (LAM) network approach is .... network is LPV, existing LTI theory is difficult to apply (Kailath 1980). ..... Beck J V, Arnold K J 1977 Parameter estimation in engineering and science (New York: ...
Pattern formation due to non-linear vortex diffusion
Wijngaarden, Rinke J.; Surdeanu, R.; Huijbregtse, J. M.; Rector, J. H.; Dam, B.; Einfeld, J.; Wördenweber, R.; Griessen, R.
Penetration of magnetic flux in YBa 2Cu 3O 7 superconducting thin films in an external magnetic field is visualized using a magneto-optic technique. A variety of flux patterns due to non-linear vortex diffusion is observed: (1) Roughening of the flux front with scaling exponents identical to those observed in burning paper including two distinct regimes where respectively spatial disorder and temporal disorder dominate. In the latter regime Kardar-Parisi-Zhang behavior is found. (2) Fractal penetration of flux with Hausdorff dimension depending on the critical current anisotropy. (3) Penetration as ‘flux-rivers’. (4) The occurrence of commensurate and incommensurate channels in films with anti-dots as predicted in numerical simulations by Reichhardt, Olson and Nori. It is shown that most of the observed behavior is related to the non-linear diffusion of vortices by comparison with simulations of the non-linear diffusion equation appropriate for vortices.
Structure formation with massive neutrinos. Going beyond linear theory
International Nuclear Information System (INIS)
Blas, Diego; Garny, Mathias; Konstandin, Thomas; Lesgourgues, Julien; Institut de Theorie Phenomenes Physiques EPFL, Lausanne; Savoie Univ., CNRS, Annecy-le-Vieux
2014-08-01
We compute non-linear corrections to the matter power spectrum taking the time- and scale-dependent free-streaming length of neutrinos into account. We adopt a hybrid scheme that matches the full Boltzmann hierarchy to an effective two-fluid description at an intermediate redshift. The non-linearities in the neutrino component are taken into account by using an extension of the time-flow framework. We point out that this remedies a spurious behaviour that occurs when neglecting non-linear terms for neutrinos. This behaviour is related to how efficiently short modes decouple from long modes and can be traced back to the violation of momentum conservation if neutrinos are treated linearly. Furthermore, we compare our results at next to leading order to various other methods and quantify the accuracy of the fluid description. Due to the correct decoupling behaviour of short modes, the two-fluid scheme is a suitable starting point to compute higher orders in perturbations or for resummation methods.
Structure formation with massive neutrinos: going beyond linear theory
Blas, Diego; Konstandin, Thomas; Lesgourgues, Julien
2014-01-01
We compute non-linear corrections to the matter power spectrum taking the time- and scale-dependent free-streaming length of neutrinos into account. We adopt a hybrid scheme that matches the full Boltzmann hierarchy to an effective two-fluid description at an intermediate redshift. The non-linearities in the neutrino component are taken into account by using an extension of the time-flow framework. We point out that this remedies a spurious behaviour that occurs when neglecting non-linear terms for neutrinos. This behaviour is related to how efficiently short modes decouple from long modes and can be traced back to the violation of momentum conservation if neutrinos are treated linearly. Furthermore, we compare our results at next to leading order to various other methods and quantify the accuracy of the fluid description. Due to the correct decoupling behaviour of short modes, the two-fluid scheme is a suitable starting point to compute higher orders in perturbations or for resummation methods.
Non-linear diffusion and pattern formation in vortex matter
Wijngaarden, Rinke J.; Surdeanu, R.; Huijbregtse, J. M.; Rector, J. H.; Dam, B.; Griessen, R.; Einfeld, J.; Woerdenweber, R.
2000-03-01
Penetration of magnetic flux in YBa_2Cu_3O7 superconducting thin films and crystals in externally applied magnetic fields is visualized with a magneto-optical technique. A variety of flux patterns due to non-linear vortex behavior is observed: 1. Roughening of the flux front^1 with scaling exponents identical to those observed in burning paper^2. Two regimes are found where respectively spatial disorder and temporal disorder dominate. In the latter regime Kardar-Parisi-Zhang behavior is found. 2. Roughening of the flux profile similar to the Oslo model for rice-piles. 3. Fractal penetration of flux^3 with Hausdorff dimension depending on the critical current anisotropy. 4. Penetration as 'flux-rivers'. 5. The occurrence of commensurate and incommensurate channels in films with anti-dots as predicted in numerical simulations by Reichhardt, Olson and Nori^4. By comparison with numerical simulations, it is shown that most of the observed behavior can be explained in terms of non-linear diffusion of vortices. ^1R. Surdeanu, R.J. Wijngaarden, E. Visser, J.M. Huijbregtse, J.H. Rector, B. Dam and R. Griessen, Phys.Rev. Lett. 83 (1999) 2054 ^2J. Maunuksela, M. Myllys, O.-P. Kähkönen, J. Timonen, N. Provatas, M.J. Alava, T. Ala-Nissila, Phys. Rev. Lett. 79, 1515 (1997) ^3R. Surdeanu, R.J. Wijngaarden, B. Dam, J. Rector, R. Griessen, C. Rossel, Z.F. Ren and J.H. Wang, Phys Rev B 58 (1998) 12467 ^4C. Reichhardt, C.J. Olson and F. Nori, Phys. Rev. B 58, 6534 (1998)
International Nuclear Information System (INIS)
Cullen, D.E.
1979-01-01
Program LINEAR converts evaluated cross sections in the ENDF/B format into a tabular form that is subject to linear-linear interpolation in energy and cross section. The code also thins tables of cross sections already in that form (i.e., removes points not needed for linear interpolability). The main advantage of the code is that it allows subsequent codes to consider only linear-linear data. A listing of the source deck is available on request
Rheokinetics and effect of shear rate on the kinetics of linear polyurethane formation
Navarchian, AH; Picchioni, F; Janssen, LPBM
In this article, the rheokinetics of polyurethane formation and the influence of shear rate on its kinetics have been studied. Two different linear polyurethane systems with 0% and 100% hard segments are examined in a cone and plate rheometer. The isothermal increase of viscosity during polyurethane
Modeling the influence of storms on sand wave formation : A linear stability approach
Campmans, G.H.P.; Roos, P.C.; de Vriend, H.J.; Hulscher, S.J.M.H.
2017-01-01
We present an idealized process-based morphodynamic model to study the effect of storms on sand wave formation. To this end, we include wind waves, wind-driven flow and, in addition to bed load transport, suspended load sediment transport. A linear stability analysis is applied to systematically
Juin, Amélie; Billottet, Clotilde; Moreau, Violaine; Destaing, Olivier; Albiges-Rizo, Corinne; Rosenbaum, Jean; Génot, Elisabeth; Saltel, Frédéric
2012-01-01
Invadosomes are F-actin structures capable of degrading the matrix through the activation of matrix metalloproteases. As fibrillar type I collagen promotes pro-matrix metalloproteinase 2 activation by membrane type 1 matrix metalloproteinase, we aimed at investigating the functional relationships between collagen I organization and invadosome induction. We found that fibrillar collagen I induced linear F-actin structures, distributed along the fibrils, on endothelial cells, macrophages, fibroblasts, and tumor cells. These structures share features with conventional invadosomes, as they express cortactin and N-WASP and accumulate the scaffold protein Tks5, which proved essential for their formation. On the basis of their ability to degrade extracellular matrix elements and their original architecture, we named these structures “linear invadosomes.” Interestingly, podosomes or invadopodia were replaced by linear invadosomes upon contact of the cells with fibrillar collagen I. However, linear invadosomes clearly differ from classical invadosomes, as they do not contain paxillin, vinculin, and β1/β3 integrins. Using knockout mouse embryonic fibroblasts and RGD peptide, we demonstrate that linear invadosome formation and activity are independent of β1 and β3 integrins. Finally, linear invadosomes also formed in a three-dimensional collagen matrix. This study demonstrates that fibrillar collagen I is the physiological inducer of a novel class of invadosomes. PMID:22114353
2D and 3D Matrices to Study Linear Invadosome Formation and Activity.
Di Martino, Julie; Henriet, Elodie; Ezzoukhry, Zakaria; Mondal, Chandrani; Bravo-Cordero, Jose Javier; Moreau, Violaine; Saltel, Frederic
2017-06-02
Cell adhesion, migration, and invasion are involved in many physiological and pathological processes. For example, during metastasis formation, tumor cells have to cross anatomical barriers to invade and migrate through the surrounding tissue in order to reach blood or lymphatic vessels. This requires the interaction between cells and the extracellular matrix (ECM). At the cellular level, many cells, including the majority of cancer cells, are able to form invadosomes, which are F-actin-based structures capable of degrading ECM. Invadosomes are protrusive actin structures that recruit and activate matrix metalloproteinases (MMPs). The molecular composition, density, organization, and stiffness of the ECM are crucial in regulating invadosome formation and activation. In vitro, a gelatin assay is the standard assay used to observe and quantify invadosome degradation activity. However, gelatin, which is denatured collagen I, is not a physiological matrix element. A novel assay using type I collagen fibrils was developed and used to demonstrate that this physiological matrix is a potent inducer of invadosomes. Invadosomes that form along the collagen fibrils are known as linear invadosomes due to their linear organization on the fibers. Moreover, molecular analysis of linear invadosomes showed that the discoidin domain receptor 1 (DDR1) is the receptor involved in their formation. These data clearly demonstrate the importance of using a physiologically relevant matrix in order to understand the complex interactions between cells and the ECM.
Experimental study of the initial plasma formation stage in a linear theta pinch of inverted field
International Nuclear Information System (INIS)
Casin, G.C.; Alvarez, Ricardo; Rojkind, R.H.; Rodrigo, A.B.
1986-01-01
The initial stage of the plasma formation was studied in a linear theta pinch. Experiments were made to determine the machine operating conditions for good shot-to-shot reproducibility. Spectroscopic measurements of electron density and of electron and ion temperature were made afterwards to characterize the plasma at different stages of its heating process. The results obtained indicate that shot-to-shot reproducibility is strongly influenced by the presence of impurities and by the plasma preionization technique used. Under proper operating conditions, excellent reproducibility was observed. The measured values of the plasma parameters are compatible with those determined for similar machines. (Author) [es
A novel endophytic Huperzine A-producing fungus, Shiraia sp. Slf14, isolated from Huperzia serrata.
Zhu, D; Wang, J; Zeng, Q; Zhang, Z; Yan, R
2010-10-01
To characterize and identify a novel Huperzine A (HupA)-producing fungal strain Slf14 isolated from Huperzia serrata (Thunb. ex Murray) Trev. in China. The isolation, identification and characterization of a novel endophytic fungus producing HupA specifically and consistently from the leaves of H. serrata were investigated. The fungus was identified as Shiraia sp. Slf14 by molecular and morphological methods. The HupA produced by this endophytic fungus was shown to be identical to authentic HupA analysed by thin layer chromatographic, High-performance liquid chromatography (HPLC), LC-MS, (1) H NMR and acetylcholinesterase (AChE) inhibition activity in vitro. The amount of HupA produced by Shiraia sp. Slf14 was quantified to be 327.8 μg l(-1) by HPLC, which was far higher than that of the reported endophytic fungi, Acremonium sp., Blastomyces sp. and Botrytis sp. The production of HupA by endophyte Shiraia sp. Slf14 is an enigmatic observation. It would be interesting to further study the HupA production and regulation by the cultured endophyte in H. serrata and in axenic cultures. Although the current accumulation of HupA by the endophyte is not very high, it could provide a promising alterative approach for large-scale production of HupA. However, further strain improvement and the fermentation process optimization are required to result in the consistent and dependable production. © 2010 The Authors. Journal compilation © 2010 The Society for Applied Microbiology.
Analysis of the static properties of cluster formations in symmetric linear multiblock copolymers
International Nuclear Information System (INIS)
Fytas, N G; Theodorakis, P E
2011-01-01
We use molecular dynamics simulations to study the static properties of a single linear multiblock copolymer chain under poor solvent conditions varying the block length N, the number of blocks n, and the solvent quality by variation of the temperature T. We study the most symmetrical case, where the number of blocks of monomers of type A, n A , equals that of monomers B, n B (n A = n B = n/2), the length of all blocks is the same irrespective of their type, and the potential parameters are also chosen symmetrically, as for a standard Lennard-Jones fluid. Under poor solvent conditions the chains collapse and blocks with monomers of the same type form clusters, which are phase separated from the clusters with monomers of the other type. We study the dependence of the size of the clusters formed on n, N and T. Furthermore, we discuss our results with respect to recent simulation data on the phase behaviour of such macromolecules, providing a complete picture for the cluster formations in single multiblock copolymer chains under poor solvent conditions.
Structure formation by a fifth force: N-body versus linear simulations
Li, Baojiu; Zhao, Hongsheng
2009-08-01
We lay out the frameworks to numerically study the structure formation in both linear and nonlinear regimes in general dark-matter-coupled scalar field models, and give an explicit example where the scalar field serves as a dynamical dark energy. Adopting parameters of the scalar field which yield a realistic cosmic microwave background (CMB) spectrum, we generate the initial conditions for our N-body simulations, which follow the spatial distributions of the dark matter and the scalar field by solving their equations of motion using the multilevel adaptive grid technique. We show that the spatial configuration of the scalar field tracks well the voids and clusters of dark matter. Indeed, the propagation of scalar degree of freedom effectively acts as a fifth force on dark matter particles, whose range and magnitude are determined by the two model parameters (μ,γ), local dark matter density as well as the background value for the scalar field. The model behaves like the ΛCDM paradigm on scales relevant to the CMB spectrum, which are well beyond the probe of the local fifth force and thus not significantly affected by the matter-scalar coupling. On scales comparable or shorter than the range of the local fifth force, the fifth force is perfectly parallel to gravity and their strengths have a fixed ratio 2γ2 determined by the matter-scalar coupling, provided that the chameleon effect is weak; if on the other hand there is a strong chameleon effect (i.e., the scalar field almost resides at its effective potential minimum everywhere in the space), the fifth force indeed has suppressed effects in high density regions and shows no obvious correlation with gravity, which means that the dark-matter-scalar-field coupling is not simply equivalent to a rescaling of the gravitational constant or the mass of the dark matter particles. We show these spatial distributions and (lack of) correlations at typical redshifts (z=0,1,5.5) in our multigrid million-particle simulations
Structure formation by a fifth force: N-body versus linear simulations
International Nuclear Information System (INIS)
Li Baojiu; Zhao Hongsheng
2009-01-01
We lay out the frameworks to numerically study the structure formation in both linear and nonlinear regimes in general dark-matter-coupled scalar field models, and give an explicit example where the scalar field serves as a dynamical dark energy. Adopting parameters of the scalar field which yield a realistic cosmic microwave background (CMB) spectrum, we generate the initial conditions for our N-body simulations, which follow the spatial distributions of the dark matter and the scalar field by solving their equations of motion using the multilevel adaptive grid technique. We show that the spatial configuration of the scalar field tracks well the voids and clusters of dark matter. Indeed, the propagation of scalar degree of freedom effectively acts as a fifth force on dark matter particles, whose range and magnitude are determined by the two model parameters (μ,γ), local dark matter density as well as the background value for the scalar field. The model behaves like the ΛCDM paradigm on scales relevant to the CMB spectrum, which are well beyond the probe of the local fifth force and thus not significantly affected by the matter-scalar coupling. On scales comparable or shorter than the range of the local fifth force, the fifth force is perfectly parallel to gravity and their strengths have a fixed ratio 2γ 2 determined by the matter-scalar coupling, provided that the chameleon effect is weak; if on the other hand there is a strong chameleon effect (i.e., the scalar field almost resides at its effective potential minimum everywhere in the space), the fifth force indeed has suppressed effects in high density regions and shows no obvious correlation with gravity, which means that the dark-matter-scalar-field coupling is not simply equivalent to a rescaling of the gravitational constant or the mass of the dark matter particles. We show these spatial distributions and (lack of) correlations at typical redshifts (z=0,1,5.5) in our multigrid million
Statistical properties of the linear σ model used in dynamical simulations of DCC formation
International Nuclear Information System (INIS)
Randrup, J.
1997-01-01
The present work develops a simple approximate framework for initializing and interpreting dynamical simulations with the linear σ model exploring the formation of disoriented chiral condensates in high-energy collisions. By enclosing the system in a rectangular box with periodic boundary conditions, it is possible to decompose uniquely the chiral field into its spatial average (the order parameter) and its fluctuations (the quasiparticles) which can be treated in the Hartree approximation. The quasiparticle modes are then described approximately by Klein-Gordon dispersion relations containing an effective mass depending on both the temperature and the magnitude of the order parameter; their fluctuations are instrumental in shaping the effective potential governing the order parameter, and the emerging statistical description is thermodynamicially consistent. The temperature dependence of the statistical distribution of the order parameter is discussed, as is the behavior of the associated effective masses; as the system is cooled, the field fluctuations subside, causing a smooth change from the high-temperature phase in which chiral symmetry is approximately restored towards the normal phase. Of practical interest is the fact that the equilibrium field configurations can be sampled in a simple manner, thus providing a convenient means for specifying the initial conditions in dynamical simulations of the nonequilibrium relaxation of the chiral field; in particular, the correlation function is much more realistic than those emerging in previous initialization methods. It is illustrated how such samples remain approximately invariant under propagation by the unapproximated equation of motion over times that are long on the scale of interest, thereby suggesting that the treatment is sufficiently accurate to be of practical utility. copyright 1997 The American Physical Society
Paul, Shibashis; Ghosh, Shyamolina; Ray, Deb Shankar
2018-02-01
We consider a reaction-diffusion system with linear, stochastic activator-inhibitor kinetics where the time evolution of concentration of a species at any spatial location depends on the relative average concentration of its neighbors. This self-regulating nature of kinetics brings in spatial correlation between the activator and the inhibitor. An interplay of this correlation in kinetics and disparity of diffusivities of the two species leads to symmetry breaking non-equilibrium transition resulting in stationary pattern formation. The role of initial noise strength and the linear reaction terms has been analyzed for pattern selection.
Studying the formation of non-linear bursts in fully turbulent channel flows
Encinar, Miguel P.; Jimenez, Javier
2017-11-01
Linear transient growth has been suggested as a possible explanation for the intermittent behaviour, or `bursting', in shear flows with a stable mean velocity profile. Analysing fully non-linear DNS databases yields a similar Orr+lift-up mechanism, but acting on spatially localised wave packets rather than on monochromatic infinite wavetrains. The Orr mechanism requires the presence of backwards-leaning wall-normal velocity perturbations as initial condition, but the linear theory fails to clarify how these perturbations are formed. We investigate the latter in a time-resolved wavelet-filtered turbulent channel database, which allows us to assign an amplitude and an inclination angle to a flow region of selected size. This yields regions that match the dynamics of linear Orr for short times. We find that a short streamwise velocity (u) perturbation (i.e. a streak meander) consistently appears before the burst, but disappears before the burst reaches its maximum amplitude. Lift-up then generates a longer streamwise velocity perturbation. The initial streamwise velocity is also found to be backwards-leaning, contrary to the averaged energy-containing scales, which are known to be tilted forward. Funded by the ERC COTURB project.
Kim, Seunggyu; Lee, Seokhun; Jeon, Jessie S.
2017-11-01
To determine the most effective antimicrobial treatments of infectious pathogen, high-throughput antibiotic susceptibility test (AST) is critically required. However, the conventional AST requires at least 16 hours to reach the minimum observable population. Therefore, we developed a microfluidic system that allows maintenance of linear antibiotic concentration and measurement of local bacterial density. Based on the Stokes-Einstein equation, the flow rate in the microchannel was optimized so that linearization was achieved within 10 minutes, taking into account the diffusion coefficient of each antibiotic in the agar gel. As a result, the minimum inhibitory concentration (MIC) of each antibiotic against P. aeruginosa could be immediately determined 6 hours after treatment of the linear antibiotic concentration. In conclusion, our system proved the efficacy of a high-throughput AST platform through MIC comparison with Clinical and Laboratory Standards Institute (CLSI) range of antibiotics. This work was supported by the Climate Change Research Hub (Grant No. N11170060) of the KAIST and by the Brain Korea 21 Plus project.
Linear waves on fixed Kerr background and their relevance in jet formation
Energy Technology Data Exchange (ETDEWEB)
Csizmadia, Peter; Laszlo, Andras; Racz, Istvan, E-mail: laszloa@rmki.kfki.h, E-mail: iracz@rmki.kfki.h [RMKI, Budapest, Konkoly Thege Miklos ut 29-33, H-1121 (Hungary)
2010-03-01
In the conventional models of astrophysical jets magnetohydrodynamics is believed to play the most role. Recently there were several qualitative arguments emphasizing that the role of pure gravitational effects might be more important than expected before. Here we present some preliminary but quantitate results clarifying the role of gravity in the formation of astrophysical jets.
Borisov, S. P.; Kudryavtsev, A. N.
2017-10-01
Linear and nonlinear stages of the instability of a plane detonation wave (DW) and the subsequent process of formation of cellular detonation structure are investigated. A simple model with one-step irreversible chemical reaction is used. The linear analysis is employed to predict the DW front structure at the early stages of its formation. An emerging eigenvalue problem is solved with a global method using a Chebyshev pseudospectral method and the LAPACK software library. A local iterative shooting procedure is used for eigenvalue refinement. Numerical simulations of a propagation of a DW in plane and rectangular channels are performed with a shock capturing WENO scheme of 5th order. A special method of a computational domain shift is implemented in order to maintain the DW in the domain. It is shown that the linear analysis gives certain predictions about the DW structure that are in agreement with the numerical simulations of early stages of DW propagation. However, at later stages, a merger of detonation cells occurs so that their number is approximately halved. Computations of DW propagation in a square channel reveal two different types of spatial structure of the DW front, "rectangular" and "diagonal" types. A spontaneous transition from the rectangular to diagonal type of structure is observed during propagation of the DW.
Hua, Yongzhao; Dong, Xiwang; Li, Qingdong; Ren, Zhang
2017-05-18
This paper investigates the time-varying formation robust tracking problems for high-order linear multiagent systems with a leader of unknown control input in the presence of heterogeneous parameter uncertainties and external disturbances. The followers need to accomplish an expected time-varying formation in the state space and track the state trajectory produced by the leader simultaneously. First, a time-varying formation robust tracking protocol with a totally distributed form is proposed utilizing the neighborhood state information. With the adaptive updating mechanism, neither any global knowledge about the communication topology nor the upper bounds of the parameter uncertainties, external disturbances and leader's unknown input are required in the proposed protocol. Then, in order to determine the control parameters, an algorithm with four steps is presented, where feasible conditions for the followers to accomplish the expected time-varying formation tracking are provided. Furthermore, based on the Lyapunov-like analysis theory, it is proved that the formation tracking error can converge to zero asymptotically. Finally, the effectiveness of the theoretical results is verified by simulation examples.
International Nuclear Information System (INIS)
Coste, Ph.; Aubert, J.; Lejeune, C.
1991-01-01
The extensive development of ion beam technologies in the last years, in particular for thin film deposition and etching, poses the problem of predicting the behaviour of the ion beam from convenient models. One of the existing models, the 'perfect linear model', is easy to use and provides information about the geometrical parameters of the ion beam envelope. In this model, however, the plasma potential must be close to the plasma electrode potential. Now, ion sources with electrostatic containment of the ionizing electrons -very attractive because of their improved ionization efficiency - have a plasma potential higher than the plasma electrode potential. Thus, a space-charge sheath with a non-negligible thickness exists, which modifies the equilibrium conditions of the plasma meniscus and, therefore, the initial divergence of the ion beam. In this paper an adaptation of the perfect linear model for ion beam formation to the case of plasma sources with electron electrostatic containment is presented. (author)
Potential formation in the plasma confinement region of a radio-frequency plugged linear device
International Nuclear Information System (INIS)
Fujita, Hideki; Kumazawa, Ryuhei; Howald, A.M.; Okamura, Shoichi; Sato, Teruyuki; Adati, Keizo; Garner, H.R.; Nishimura, Kiyohiko.
1987-08-01
Plasma potential formation in an open-ended plasma confinement system with RF plugging (the RFC-XX-M device) is investigated. The plasma potential in the central confinement region is measured with a heavy ion beam probe system and potentials at the RF plug section are measured with multi-grid energy analyzers. The measured plasma potential is compared with that deduced from the generalized Pastukhov formula. Results show that the plasma potential develops as an ambipolar potential to equate ion and electron end losses. During RF plugging, electrons are heated by Landau damping, while ions are not heated since adiabatic conditions apply during ion plugging in this experiment. (author)
Energy Technology Data Exchange (ETDEWEB)
Revesz, A.; Lendvai, J. [Eoetvoes Lorand Tudomanyegyeten, Budapest (Hungary). Dept. for General Physics; Cziraki, A. [Eoetvoes Univ. (Hungary). Dept. of Solid State Physics; Liebermann, H.H. [Honeywell Amorphous Metals, Morristown, NJ (United States); Bakonyi, I. [Hungarian Academy of Sciences (Hungary). Research Inst. for Solid State Physics and Optics
2001-05-01
Differential scanning calorimetry (DSC), powder diffraction and high-resolution X-ray diffraction (XRD), and transmission electron microscopy (TEM) investigations have been performed on melt-quenched amorphous Ni-P alloys with compositions of 18 to 22 at.% P. The calorimetric results revealed different crystallization routes during linear heating below, at and above the eutectic point (19 at.% P) but with the same general transformation scheme as reported previously for electrodeposited and electroless Ni-P amorphous alloys. The composition dependence of the activation energy of the crystallization and the heats evolved during the structural transformations were determined from DSC measurements. The average grain size was derived from XRD line broadening and important information on the crystallization products and their microstructure could be revealed also from the TEM studies. All these findings will have special significance when analysing the results of isothermal annealing experiments to be described in a forthcoming paper. (orig.)
Galaxy bias and non-linear structure formation in general relativity
International Nuclear Information System (INIS)
Baldauf, Tobias; Seljak, Uroš; Senatore, Leonardo; Zaldarriaga, Matias
2011-01-01
Length scales probed by the large scale structure surveys are becoming closer and closer to the horizon scale. Further, it has been recently understood that non-Gaussianity in the initial conditions could show up in a scale dependence of the bias of galaxies at the largest possible distances. It is therefore important to take General Relativistic effects into account. Here we provide a General Relativistic generalization of the bias that is valid both for Gaussian and for non-Gaussian initial conditions. The collapse of objects happens on very small scales, while long-wavelength modes are always in the quasi linear regime. Around every small collapsing region, it is therefore possible to find a reference frame that is valid for arbitrary times and where the space time is almost flat: the Fermi frame. Here the Newtonian approximation is applicable and the equations of motion are the ones of the standard N-body codes. The effects of long-wavelength modes are encoded in the mapping from the cosmological frame to the local Fermi frame. At the level of the linear bias, the effect of the long-wavelength modes on the dynamics of the short scales is all encoded in the local curvature of the Universe, which allows us to define a General Relativistic generalization of the bias in the standard Newtonian setting. We show that the bias due to this effect goes to zero as the square of the ratio between the physical wavenumber and the Hubble scale for modes longer than the horizon, confirming the intuitive picture that modes longer than the horizon do not have any dynamical effect. On the other hand, the bias due to non-Gaussianities does not need to vanish for modes longer than the Hubble scale, and for non-Gaussianities of the local kind it goes to a constant. As a further application of our setup, we show that it is not necessary to perform large N-body simulations to extract information about long-wavelength modes: N-body simulations can be done on small scales and long
Directory of Open Access Journals (Sweden)
Sergey G. Chefranov
2012-11-01
Full Text Available Aims This paper deals with solving of a century-old paradox of linear stability for the Hagen-Poiseuille flow. A new mechanism of dissipative hydrodynamic instability has been established herein, and a basis for the forming of helical structural organization of bloodstream and respective energy effectiveness of the cardiovascular system functioning has been defined by the authors. Materials and methods Theory of hydrodynamic instability, Galerkin’s approximation. Results A new condition Re > Reth-min ≈ 124 of linear (exponential instability of the Hagen-Poisseuille (HP flow with respect to extremely small by magnitude axially-symmetric disturbances of the tangential component of the velocity field is obtained. The disturbances necessarily shall have quasi-periodic longitudinal variability along the pipe axis that corresponds to the observed data. Conclusion We show that the obtained estimate of value of Reth-min corresponds to the condition of independence of the main result (on the linear instability of the HP flow when Re > Reth-min from the procedure of averaging used in the Galerkin approximation. Thus, we obtain the possible natural mechanism for the blood swirling flows formations observed in the aorta and the large blood vessels.
Label-Free Analysis of Cellular Lipid Droplet Formation by Non-Linear Microscopy
Schie, Iwan W.
Cellular lipid droplets (LD) are cellular organelles that can be found in every cell type. Recent research indicates that cellular LD are involved in a large number of cellular metabolic functions, such as lipid metabolism, protection from lipotoxicity, protein storage and degradation, and many more. LD formation is frequently associated with adverse health effects, i.e. alcoholic and non-alcoholic fatty liver disease, diabetes type-2, as well as many cardiovascular disorders. Despite their wide presence, LDs are the least studied and most poorly understood cellular organelles. Typically, LDs are investigated using fluorescence-based techniques that require staining with exogenous fluorophores. Other techniques, e.g. biochemical assays, require the destruction of cells that prohibit the analysis of living cells. Therefore, in my thesis research I developed a novel compound fast-scanning nonlinear optical microscope equipped with the ability to also acquire Raman spectra at specific image locations. This system allows us to image label-free cellular LD formation in living cells and analyze the composition of single cellular LDs. Images can be acquired at near video-rate (˜16 frames/s). Furthermore, the system has the ability to acquire very large images of tissue of up to 7.5x15 cm2 total area by stitching together scans with dimensions of 1x1 mm2 in less than 1 minute. The system also enables the user to acquire Raman spectra from points of interest in the multiphoton images and provides chemically-specific data from sample volumes as small as 1 femtoliter. In my thesis I used this setup to determine the effects of VLDL lipolysis products on primary rat hepatocytes. By analyzing the Raman spectra and comparing the peak ratios for saturated and unsaturated fatty acid it was determined that the small cellular LD are highly saturated, while large cellular LDs contain mostly unsaturated lipids. Furthermore, I established a method to determine the specific contribution
Energy Technology Data Exchange (ETDEWEB)
Laguardia, L., E-mail: laguardia@ifp.cnr.it [CNR, Istituto di Fisica del Plasma“P. Caldirola”, Milan (Italy); Caniello, R.; Cremona, A. [CNR, Istituto di Fisica del Plasma“P. Caldirola”, Milan (Italy); Dellasega, D. [CNR, Istituto di Fisica del Plasma“P. Caldirola”, Milan (Italy); Politecnico di Milano, Dipartimento di Energia, Milan (Italy); Dell’Era, F.; Ghezzi, F.; Gittini, G.; Granucci, G.; Mellera, V.; Minelli, D.; Pallotta, F. [CNR, Istituto di Fisica del Plasma“P. Caldirola”, Milan (Italy); Passoni, M. [CNR, Istituto di Fisica del Plasma“P. Caldirola”, Milan (Italy); Politecnico di Milano, Dipartimento di Energia, Milan (Italy); Ricci, D.; Vassallo, E. [CNR, Istituto di Fisica del Plasma“P. Caldirola”, Milan (Italy)
2015-08-15
In this work results of the first D{sub 2}/N{sub 2} experiments in GyM, a linear device able to produce plasmas of interest for the ITER divertor (n{sub e} 5 ⋅ 10{sup 10} cm{sup −3}, Te 5 eV, ion flux 3–5 ⋅ 10{sup 20} m{sup −2}s{sup −1}) are presented. Plasmas simulating a N-seeding scenario have been performed to evaluate ammonia formation and its effect on exposed W coatings. The presence of ND emission lines in the plasma can be correlated with the formation of ammonia, further directly detected and quantified by chromatography analysis of the exhaust. Four different W specimens were exposed in GyM to a plasma fluence of 8.78 ⋅ 10{sup 23} m{sup −2}. XPS analysis evidenced the formation of W{sub x}N{sub y} layers with nitrogen concentration in the range of 1–10% depending on the initial morphology and structure of the W samples. In all analyzed cases, nitrogen was bound and retained within the first 6 nm below the surface and no further diffusion of N into the bulk was observed.
Wang, Lei; Zhang, Chongyin; Cong, Houluo; Li, Lei; Zheng, Sixun; Li, Xiuhong; Wang, Jie
2013-07-11
In this work, we investigated the effect of topological structures of block copolymers on the formation of the nanophase in epoxy thermosets containing amphiphilic block copolymers. Two block copolymers composed of poly(ε-caprolactone) (PCL) and poly(2,2,2-trifluoroethyl acrylate) (PTFEA) blocks were synthesized to possess linear and star-shaped topologies. The star-shaped block copolymer composed a polyhedral oligomeric silsesquioxane (POSS) core and eight poly(ε-caprolactone)-block-poly(2,2,2-trifluoroethyl acrylate) (PCL-b-PTFEA) diblock copolymer arms. Both block copolymers were synthesized via the combination of ring-opening polymerization and reversible addition-fragmentation chain transfer/macromolecular design via the interchange of xanthate (RAFT/MADIX) process; they were controlled to have identical compositions of copolymerization and lengths of blocks. Upon incorporating both block copolymers into epoxy thermosets, the spherical PTFEA nanophases were formed in all the cases. However, the sizes of PTFEA nanophases from the star-like block copolymer were significantly lower than those from the linear diblock copolymer. The difference in the nanostructures gave rise to the different glass transition behavior of the nanostructured thermosets. The dependence of PTFEA nanophases on the topologies of block copolymers is interpreted in terms of the conformation of the miscible subchain (viz. PCL) at the surface of PTFEA microdomains and the restriction of POSS cages on the demixing of the thermoset-philic block (viz. PCL).
Harmon, Tyler S.; Holehouse, Alex S.; Pappu, Rohit V.
2018-04-01
Intracellular biomolecular condensates are membraneless organelles that encompass large numbers of multivalent protein and nucleic acid molecules. The bodies assemble via a combination of liquid–liquid phase separation and gelation. A majority of condensates included multiple components and show multilayered organization as opposed to being well-mixed unitary liquids. Here, we put forward a simple thermodynamic framework to describe the emergence of spatially organized droplets in multicomponent systems comprising of linear multivalent polymers also known as associative polymers. These polymers, which mimic proteins and/or RNA have the architecture of domains or motifs known as stickers that are interspersed by flexible spacers known as linkers. Using a minimalist numerical model for a four-component system, we have identified features of linear multivalent molecules that are necessary and sufficient for generating spatially organized droplets. We show that differences in sequence-specific effective solvation volumes of disordered linkers between interaction domains enable the formation of spatially organized droplets. Molecules with linkers that are preferentially solvated are driven to the interface with the bulk solvent, whereas molecules that have linkers with negligible effective solvation volumes form cores in the core–shell architectures that emerge in the minimalist four-component systems. Our modeling has relevance for understanding the physical determinants of spatially organized membraneless organelles.
Yan, Riming; Zhang, Zhibin; Wang, Ya; Yang, Huilin; Zeng, Qinggui; Zhu, Du
2014-07-01
Huperzine A (HupA), a naturally occurring lycopodium alkaloid, is a potent, highly specific and reversible inhibitor of acetylcholinesterase and is a potential treatment for Alzheimer's disease. However, isolating HupA from Huperziaceae plants is inefficient; thus, extracting this compound from endophytic fungi may be more controllable and sustainable. However, the large-scale production of this chemical from endophytes is limited by the innate instability of endophytic fungi. In this study, we maintained the stability and viability of the HupA-producing endophytic fungus Shiraia sp. Slf14 and enhanced the HupA titers during fermentation by adding Huperzia serrata extracts (HSE), L-lysine, and acetic acid into the culture as inducers. Adding trace amounts of HupA clearly improved the HupA production of Shiraia sp. Slf14, reaching a maximum content of approximately 40 μg g(-1). Moreover, the addition of HSE and L-lysine promoted HupA production in the flask fermentation. The aforementioned bioprocessing strategy may be potentially applied to other endophytic fungal culture systems for the efficient production of plant secondary metabolites.
Massa, P T; Szuchet, S; Mugnaini, E
1984-12-01
Oligodendrocytes were isolated from lamb brain. Freshly isolated cells and cultured cells, either 1- to 4-day-old unattached or 1- to 5-week-old attached, were examined by thin section and freeze-fracture electron microscopy. Freeze-fracture of freshly isolated oligodendrocytes showed globular and elongated intramembrane particles similar to those previously described in oligodendrocytes in situ. Enrichment of these particles was seen at sites of inter-oligodendrocyte contact. Numerous gap junctions and scattered linear tight junctional arrays were apparent. Gap junctions were connected to blebs of astrocytic plasma membrane sheared off during isolation, whereas tight junctions were facing extracellular space or blebs of oligodendrocytic plasma membrane. Thin sections of cultured, unattached oligodendrocytes showed rounded cell bodies touching one another at points without forming specialized cell junctions. Cells plated on polylysine-coated aclar dishes attached, emanated numerous, pleomorphic processes, and expressed galactocerebroside and myelin basic protein, characteristic markers for oligodendrocytes. Thin sections showed typical oligodendrocyte ultrastructure but also intermediate filaments not present in unattached cultures. Freeze-fracture showed intramembrane particles similar to but more numerous, and with a different fracture face repartition, than those seen in oligodendrocytes, freshly isolated or in situ. Gap junctions were small and rare. Apposed oligodendrocyte plasma membrane formed linear tight junctions which became more numerous with time in culture. Thus, cultured oligodendrocytes isolated from ovine brains develop and maintain features characteristic of mature oligodendrocytes in situ and can be used to explore formation and maintenance of tight junctions and possibly other classes of cell-cell interactions important in the process of myelination.
DEFF Research Database (Denmark)
Maram, Reza; Kong, Deming; Galili, Michael
2016-01-01
We propose a novel approach for all-optical return-to-zero (RZ) to non-return-to-zero (NRZ) telecommunication data format conversion based on linear spectral phase manipulation of an RZ data signal. The operation principle is numerically analyzed and experimentally validated through successful fo...
Hua, Yongzhao; Dong, Xiwang; Li, Qingdong; Ren, Zhang
2017-11-01
This paper investigates the fault-tolerant time-varying formation control problems for high-order linear multi-agent systems in the presence of actuator failures. Firstly, a fully distributed formation control protocol is presented to compensate for the influences of both bias fault and loss of effectiveness fault. Using the adaptive online updating strategies, no global knowledge about the communication topology is required and the bounds of actuator failures can be unknown. Then an algorithm is proposed to determine the control parameters of the fault-tolerant formation protocol, where the time-varying formation feasible conditions and an approach to expand the feasible formation set are given. Furthermore, the stability of the proposed algorithm is proven based on the Lyapunov-like theory. Finally, two simulation examples are given to demonstrate the effectiveness of the theoretical results. Copyright © 2017 ISA. Published by Elsevier Ltd. All rights reserved.
DEFF Research Database (Denmark)
Mogensen, Anders Skibsted; Ahring, Birgitte Kiær
2002-01-01
Biodegradation of linear alkylbenzene sulfonate (LAS) was shown in an upflow anaerobic sludge blanket reactor under thermophilic conditions. The reactor was inoculated with granular biomass and fed with a synthetic medium and 3 mumol/L of a mixture of LAS with alkylchain length of 10 to 13 carbon...
Eleftheriou, E.; Karatasos, K.
2012-10-01
Models of mixtures of peripherally charged dendrimers with oppositely charged linear polyelectrolytes in the presence of explicit solvent are studied by means of molecular dynamics simulations. Under the influence of varying strength of electrostatic interactions, these systems appear to form dynamically arrested film-like interconnected structures in the polymer-rich phase. Acting like a pseudo-thermodynamic inverse temperature, the increase of the strength of the Coulombic interactions drive the polymeric constituents of the mixture to a gradual dynamic freezing-in. The timescale of the average density fluctuations of the formed complexes initially increases in the weak electrostatic regime reaching a finite limit as the strength of electrostatic interactions grow. Although the models are overall electrically neutral, during this process the dendrimer/linear complexes develop a polar character with an excess charge mainly close to the periphery of the dendrimers. The morphological characteristics of the resulted pattern are found to depend on the size of the polymer chains on account of the distinct conformational features assumed by the complexed linear polyelectrolytes of different length. In addition, the length of the polymer chain appears to affect the dynamics of the counterions, thus affecting the ionic transport properties of the system. It appears, therefore, that the strength of electrostatic interactions together with the length of the linear polyelectrolytes are parameters to which these systems are particularly responsive, offering thus the possibility for a better control of the resulted structure and the electric properties of these soft-colloidal systems.
Bit-rate-transparent optical RZ-to-NRZ format conversion based on linear spectral phase filtering
DEFF Research Database (Denmark)
Maram, Reza; Da Ros, Francesco; Guan, Pengyu
2017-01-01
We propose a novel and strikingly simple design for all-optical bit-rate-transparent RZ-to-NRZ conversion based on optical phase filtering. The proposed concept is experimentally validated through format conversion of a 640 Gbit/s coherent RZ signal to NRZ signal.......We propose a novel and strikingly simple design for all-optical bit-rate-transparent RZ-to-NRZ conversion based on optical phase filtering. The proposed concept is experimentally validated through format conversion of a 640 Gbit/s coherent RZ signal to NRZ signal....
International Nuclear Information System (INIS)
Kontorovich, V.M.; Kochanov, A.E.
1980-01-01
It is demonstrated that in the case of hard injection of relativistic electrons accompanied by the joint action of synchrotron (Compton) losses and energy-dependent spatial diffusion, a spectrum with 'breaks' is formed containing universal (with index γ = 2) and diffusion regions, both independent of the injection spectrum. The effect from non-linearity of the electron spectrum is considered in averaged electromagnetic spectra for various geometries of sources (sphere, disk, arm). It is shown that an universal region (with index α = 0.5) can occur in the radiation spectrum. (orig.)
International Nuclear Information System (INIS)
Xu, H.; Wang, Y.
1999-01-01
In this letter, a linear free energy relationship is used to predict the Gibbs free energies of formation of crystalline phases of pyrochlore and zirconolite families with stoichiometry of MCaTi 2 O 7 (or, CaMTi 2 O 7 ,) from the known thermodynamic properties of aqueous tetravalent cations (M 4+ ). The linear free energy relationship for tetravalent cations is expressed as ΔG f,M v X 0 =a M v X ΔG n,M 4+ 0 +b M v X +β M v X r M 4+ , where the coefficients a M v X , b M v X , and β M v X characterize a particular structural family of M v X, r M 4+ is the ionic radius of M 4+ cation, ΔG f,M v X 0 is the standard Gibbs free energy of formation of M v X, and ΔG n,M 4+ 0 is the standard non-solvation energy of cation M 4+ . The coefficients for the structural family of zirconolite with the stoichiometry of M 4+ CaTi 2 O 7 are estimated to be: a M v X =0.5717, b M v X =-4284.67 (kJ/mol), and β M v X =27.2 (kJ/mol nm). The coefficients for the structural family of pyrochlore with the stoichiometry of M 4+ CaTi 2 O 7 are estimated to be: a M v X =0.5717, b M v X =-4174.25 (kJ/mol), and β M v X =13.4 (kJ/mol nm). Using the linear free energy relationship, the Gibbs free energies of formation of various zirconolite and pyrochlore phases are calculated. (orig.)
3D Modelling of Flash Formation in Linear Friction Welded 30CrNiMo8 Steel Chain
Directory of Open Access Journals (Sweden)
Pedro Effertz
2017-10-01
Full Text Available Linear friction welding (LFW is a solid-state welding process that has been thoroughly investigated for chain welding in recent years in order to replace the currently in use Flash Butt Welding (FBW process. Modelling has proven to be an indispensable tool in LFW, thus providing necessary insight to the process, regardless of its final application. This article describes a 3D model developed in the commercial software DEFORM to study the LFW process of 30CrNiMo8 high strength steel in the Hero chain. Hence, a weakly coupled thermal and mechanical model were used, by means of the process experimental input such as displacement histories. The flash morphology and intervening mechanisms were analyzed. A thermal evaluation of different regions in the studied geometry was considered, and a correlation of the modeled and experimental width of the extrusion zone was established.
International Nuclear Information System (INIS)
Haines, M.G.; Bond, D.J.; Chuaqui, H.H.
1983-01-01
The paper reports experimental and theoretical contributions to the understanding of non-linear heat flow and the phenomenon of jet-like filamentary structures in inertial-confinement fusion. When lateral heat flow is minimized, through applying more carefully a radially symmetric irradiation at 1.05 and 0.53 μm on a spherical target, it is found that a heat flux in excess of 10% of the free-streaming limit is consistent with simulations and experimental measurements with particle and X-ray diagnostics. A similar result has been found in a scaled experiment in a plasma of electron density 4x10 16 cm - 3 when the condition Tsub(e) approx.=Tsub(i) is satisfied. These results are in marked contrast to earlier assertions, mainly from plane-target measurements, that the flux limiter is 3%, but in agreement with theoretical calculations of steady non-linear heat flow using a discrete-ordinate method. Thus, no anomalous inhibition of heat flow is found, consistent with theoretical predictions that ion-acoustic turbulence is of no importance in dense (n>=10 21 cm - 3 , T approx.= 1 keV) plasmas. However, in the low-density scaled experiment, under conditions where Tsub(e)>>Tsub(i) is found that ion-acoustic turbulence is present, and the flux limiter is 4%. By using shadowgraphic and schlieren techniques with an optical diagnostic probe, fine-scale jet-like structures have been observed on a scale-length of approx. 10 μm on spherical targets. They occur even outside the laser-irradiated region, and are not connected with irregularities in the laser beam; they are more pronounced with higher-Z materials and with shorter-wavelength lasers, and have megagauss magnetic fields associated with them. Electromagnetic instabilities driven by heat flow are the probable cause of the jets, and of the three known modes the thermal instability, enhanced by radiation loss, agrees more closely with the experiments than the Weibel and thermomagnetic modes, since the latter only occur
Peng, Silu; Yang, Huilin; Zhu, Du; Zhang, Zhibin; Yan, Riming; Wang, Ya
2016-04-14
Huperzine A (HupA) was approved as a drug for the treatment of Alzheimer's disease. The HupA biosynthetic pathway was started from lysine decarboxylase (LDC), which catalyzes lysine to cadaverine. In this study, we cloned and expressed an LDC gene from a HupA-producing endophytic fungus, and tested LDC activities. An endophytic fungus Shiraia sp. Slf14 from Huperzia serrata was used. LDC gene was obtained by RT-PCR, and cloned into pET-22b(+) and pET-32a(+) vectors to construct recombinant plasmids pET- 22b-LDC and pET-32a-LDC. These two recombinant plasmids were transformed into E. coli BL21, cultured for 8 h at 24 °C, 200 r/min with 1×10–3 mol/L IPTG into medium to express the LDC proteins, respectively. LDC proteins were purified by Ni2+ affinity chromatography. Catalytic activities were measured by Thin Layer Chromatography. At last, the physicochemical properties and structures of these two LDCs were obtained by bioinformatics software. LDC and Trx-LDC were expressed in E. coli BL21 successfully. SDS-PAGE analysis shows that the molecular weight of LDC and Trx-LDC were 24.4 kDa and 42.7 kDa respectively, which are consistent with bioinformatics analysis. In addition, TLC analysis reveals that both LDC and Trx-LDC had catalytic abilities. This work can provide fundamental data for enriching LDC molecular information and reveal the HupA biosynthetic pathway in endophytic fungi.
Taschek, Marco; Egermann, Jan; Schwarz, Sabrina; Leipertz, Alfred
2005-11-01
Optimum fuel preparation and mixture formation are core issues in the development of modern direct-injection (DI) Diesel engines, as these are crucial for defining the border conditions for the subsequent combustion and pollutant formation process. The local fuel/air ratio can be seen as one of the key parameters for this optimization process, as it allows the characterization and comparison of the mixture formation quality. For what is the first time to the best of our knowledge, linear Raman spectroscopy is used to detect the fuel/air ratio and its change along a line of a few millimeters directly and nonintrusively inside the combustion bowl of a DI Diesel engine. By a careful optimization of the measurement setup, the weak Raman signals could be separated successfully from disturbing interferences. A simultaneous measurement of the densities of air and fuel was possible along a line of about 10 mm length, allowing a time- and space-resolved measurement of the local fuel/air ratio. This could be performed in a nonreacting atmosphere as well as during fired operating conditions. The positioning of the measurement volume next to the interaction point of one of the spray jets with the wall of the combustion bowl allowed a near-wall analysis of the mixture formation process for a six-hole nozzle under varying injection and engine conditions. The results clearly show the influence of the nozzle geometry and preinjection on the mixing process. In contrast, modulation of the intake air temperature merely led to minor changes of the fuel concentration in the measurement volume.
Yu, Jianwei; Liu, Juan; An, Wei; Wang, Yongjing; Zhang, Junzhi; Wei, Wei; Su, Ming; Yang, Min
2015-01-01
A total of 86 source water samples from 38 cities across major watersheds of China were collected for a bromide (Br(-)) survey, and the bromate (BrO3 (-)) formation potentials (BFPs) of 41 samples with Br(-) concentration >20 μg L(-1) were evaluated using a batch ozonation reactor. Statistical analyses indicated that higher alkalinity, hardness, and pH of water samples could lead to higher BFPs, with alkalinity as the most important factor. Based on the survey data, a multiple linear regression (MLR) model including three parameters (alkalinity, ozone dose, and total organic carbon (TOC)) was established with a relatively good prediction performance (model selection criterion = 2.01, R (2) = 0.724), using logarithmic transformation of the variables. Furthermore, a contour plot was used to interpret the influence of alkalinity and TOC on BrO3 (-) formation with prediction accuracy as high as 71 %, suggesting that these two parameters, apart from ozone dosage, were the most important ones affecting the BFPs of source waters with Br(-) concentration >20 μg L(-1). The model could be a useful tool for the prediction of the BFPs of source water.
Yang, Huilin; Peng, Silu; Zhang, Zhibin; Yan, Riming; Wang, Ya; Zhan, Jixun; Zhu, Du
2016-12-01
Huperzine A (HupA) is a drug used for the treatment of Alzheimer's disease. However, the biosynthesis of this medicinally important compound is not well understood. The HupA biosynthetic pathway is thought to be initiated by the decarboxylation of lysine to form cadaverine, which is then converted to 5-aminopentanal by copper amine oxidase (CAO). In this study, we cloned and expressed an SsCAO gene from a HupA-producing endophytic fungus, Shiraia sp. Slf14. Analysis of the deduced protein amino acid sequence showed that it contained the Asp catalytic base, conserved motif Asn-Tyr-Asp/Glu, and three copper-binding histidines. The cDNA of SsCAO was amplified and expressed in Escherichia coli BL21(DE3), from which a 76 kDa protein was obtained. The activity of this enzyme was tested, which provided more information about the SsCAO gene in the endophytic fungus. Gas Chromatograph-Mass Spectrometry (GC-MS) revealed that this SsCAO could accept cadaverine as a substrate to produce 5-aminopentanal, the precursor of HupA. Phylogenetic tree analysis indicated that the SsCAO from Shiraia sp. Slf14 was closely related to Stemphylium lycopersici CAO. This is the first report on the cloning and expression of a CAO gene from HupA-producing endophytic fungi. Functional characterization of this enzyme provides new insights into the biosynthesis of the HupA an anti-Alzheimer's drug. Copyright © 2016 Elsevier Inc. All rights reserved.
Vu, Cung Khac; Skelt, Christopher; Nihei, Kurt; Johnson, Paul A.; Guyer, Robert; Ten Cate, James A.; Le Bas, Pierre-Yves; Larmat, Carene S.
2015-06-02
A system and a method for generating a three-dimensional image of a rock formation, compressional velocity VP, shear velocity VS and velocity ratio VP/VS of a rock formation are provided. A first acoustic signal includes a first plurality of pulses. A second acoustic signal from a second source includes a second plurality of pulses. A detected signal returning to the borehole includes a signal generated by a non-linear mixing process from the first and second acoustic signals in a non-linear mixing zone within an intersection volume. The received signal is processed to extract the signal over noise and/or signals resulting from linear interaction and the three dimensional image of is generated.
Shilov, Georgi E
1977-01-01
Covers determinants, linear spaces, systems of linear equations, linear functions of a vector argument, coordinate transformations, the canonical form of the matrix of a linear operator, bilinear and quadratic forms, Euclidean spaces, unitary spaces, quadratic forms in Euclidean and unitary spaces, finite-dimensional space. Problems with hints and answers.
Vu, Cung Khac; Nihei, Kurt Toshimi; Johnson, Paul A.; Guyer, Robert A.; Ten Cate, James A.; Le Bas, Pierre-Yves; Larmat, Carene S.
2016-06-07
A system and method of characterizing properties of a medium from a non-linear interaction are include generating, by first and second acoustic sources disposed on a surface of the medium on a first line, first and second acoustic waves. The first and second acoustic sources are controllable such that trajectories of the first and second acoustic waves intersect in a mixing zone within the medium. The method further includes receiving, by a receiver positioned in a plane containing the first and second acoustic sources, a third acoustic wave generated by a non-linear mixing process from the first and second acoustic waves in the mixing zone; and creating a first two-dimensional image of non-linear properties or a first ratio of compressional velocity and shear velocity, or both, of the medium in a first plane generally perpendicular to the surface and containing the first line, based on the received third acoustic wave.
International Nuclear Information System (INIS)
Suwono.
1978-01-01
A linear gate providing a variable gate duration from 0,40μsec to 4μsec was developed. The electronic circuity consists of a linear circuit and an enable circuit. The input signal can be either unipolar or bipolar. If the input signal is bipolar, the negative portion will be filtered. The operation of the linear gate is controlled by the application of a positive enable pulse. (author)
International Nuclear Information System (INIS)
Vretenar, M
2014-01-01
The main features of radio-frequency linear accelerators are introduced, reviewing the different types of accelerating structures and presenting the main characteristics aspects of linac beam dynamics
Axler, Sheldon
2015-01-01
This best-selling textbook for a second course in linear algebra is aimed at undergrad math majors and graduate students. The novel approach taken here banishes determinants to the end of the book. The text focuses on the central goal of linear algebra: understanding the structure of linear operators on finite-dimensional vector spaces. The author has taken unusual care to motivate concepts and to simplify proofs. A variety of interesting exercises in each chapter helps students understand and manipulate the objects of linear algebra. The third edition contains major improvements and revisions throughout the book. More than 300 new exercises have been added since the previous edition. Many new examples have been added to illustrate the key ideas of linear algebra. New topics covered in the book include product spaces, quotient spaces, and dual spaces. Beautiful new formatting creates pages with an unusually pleasant appearance in both print and electronic versions. No prerequisites are assumed other than the ...
Linearization Method and Linear Complexity
Tanaka, Hidema
We focus on the relationship between the linearization method and linear complexity and show that the linearization method is another effective technique for calculating linear complexity. We analyze its effectiveness by comparing with the logic circuit method. We compare the relevant conditions and necessary computational cost with those of the Berlekamp-Massey algorithm and the Games-Chan algorithm. The significant property of a linearization method is that it needs no output sequence from a pseudo-random number generator (PRNG) because it calculates linear complexity using the algebraic expression of its algorithm. When a PRNG has n [bit] stages (registers or internal states), the necessary computational cost is smaller than O(2n). On the other hand, the Berlekamp-Massey algorithm needs O(N2) where N(≅2n) denotes period. Since existing methods calculate using the output sequence, an initial value of PRNG influences a resultant value of linear complexity. Therefore, a linear complexity is generally given as an estimate value. On the other hand, a linearization method calculates from an algorithm of PRNG, it can determine the lower bound of linear complexity.
Directory of Open Access Journals (Sweden)
Marc Chatenay-Lapointe
Full Text Available Synthesis and assembly of the mitochondrial oxidative phosphorylation (OXPHOS system requires genes located both in the nuclear and mitochondrial genomes, but how gene expression is coordinated between these two compartments is not fully understood. One level of control is through regulated expression mitochondrial ribosomal proteins and other factors required for mitochondrial translation and OXPHOS assembly, which are all products of nuclear genes that are subsequently imported into mitochondria. Interestingly, this cadre of genes in budding yeast has in common a 3'-UTR element that is bound by the Pumilio family protein, Puf3p, and is coordinately regulated under many conditions, including during the yeast metabolic cycle. Multiple functions have been assigned to Puf3p, including promoting mRNA degradation, localizing nucleus-encoded mitochondrial transcripts to the outer mitochondrial membrane, and facilitating mitochondria-cytoskeletal interactions and motility. Here we show that Puf3p has a general repressive effect on mitochondrial OXPHOS abundance, translation, and respiration that does not involve changes in overall mitochondrial biogenesis and largely independent of TORC1-mitochondrial signaling. We also identified the cytoplasmic translation factor Slf1p as yeast metabolic cycle-regulated gene that is repressed by Puf3p at the post-transcriptional level and promotes respiration and extension of yeast chronological life span when over-expressed. Altogether, these results should facilitate future studies on which of the many functions of Puf3p is most relevant for regulating mitochondrial gene expression and the role of nuclear-mitochondrial communication in aging and longevity.
Said-Houari, Belkacem
2017-01-01
This self-contained, clearly written textbook on linear algebra is easily accessible for students. It begins with the simple linear equation and generalizes several notions from this equation for the system of linear equations and introduces the main ideas using matrices. It then offers a detailed chapter on determinants and introduces the main ideas with detailed proofs. The third chapter introduces the Euclidean spaces using very simple geometric ideas and discusses various major inequalities and identities. These ideas offer a solid basis for understanding general Hilbert spaces in functional analysis. The following two chapters address general vector spaces, including some rigorous proofs to all the main results, and linear transformation: areas that are ignored or are poorly explained in many textbooks. Chapter 6 introduces the idea of matrices using linear transformation, which is easier to understand than the usual theory of matrices approach. The final two chapters are more advanced, introducing t...
Stoll, R R
1968-01-01
Linear Algebra is intended to be used as a text for a one-semester course in linear algebra at the undergraduate level. The treatment of the subject will be both useful to students of mathematics and those interested primarily in applications of the theory. The major prerequisite for mastering the material is the readiness of the student to reason abstractly. Specifically, this calls for an understanding of the fact that axioms are assumptions and that theorems are logical consequences of one or more axioms. Familiarity with calculus and linear differential equations is required for understand
He, Wanlin; Yang, Jianjun; Guo, Chunlei
2017-03-06
The control of laser-induced periodic ripple microstructures on 4H-SiC crystal surface is studied using temporally delayed collinear three femtosecond laser pulse trains linearly polarized in different directions. The ripple orientation appears to develop independent of the individual laser polarizations and exhibits non-monotonical change with variable time delays, whose variation tendency is also affected by the polarization intersection angles. Remarkably, the ripple period is observed to transfer from high- to low-spatial-frequency regions, accompanied by distinctly improved morphological uniformity and clearness. The results are satisfactorily interpreted based on a physical model of the surface wave excitation on a transient index metasurface, which is confirmed by further experiments. Our investigations indicate that transient noneqilibrium dynamics of the material surface provides an effective way to manipulate the laser-induced microstructures.
Solow, Daniel
2014-01-01
This text covers the basic theory and computation for a first course in linear programming, including substantial material on mathematical proof techniques and sophisticated computation methods. Includes Appendix on using Excel. 1984 edition.
Liesen, Jörg
2015-01-01
This self-contained textbook takes a matrix-oriented approach to linear algebra and presents a complete theory, including all details and proofs, culminating in the Jordan canonical form and its proof. Throughout the development, the applicability of the results is highlighted. Additionally, the book presents special topics from applied linear algebra including matrix functions, the singular value decomposition, the Kronecker product and linear matrix equations. The matrix-oriented approach to linear algebra leads to a better intuition and a deeper understanding of the abstract concepts, and therefore simplifies their use in real world applications. Some of these applications are presented in detailed examples. In several ‘MATLAB-Minutes’ students can comprehend the concepts and results using computational experiments. Necessary basics for the use of MATLAB are presented in a short introduction. Students can also actively work with the material and practice their mathematical skills in more than 300 exerc...
Berberian, Sterling K
2014-01-01
Introductory treatment covers basic theory of vector spaces and linear maps - dimension, determinants, eigenvalues, and eigenvectors - plus more advanced topics such as the study of canonical forms for matrices. 1992 edition.
Searle, Shayle R
2012-01-01
This 1971 classic on linear models is once again available--as a Wiley Classics Library Edition. It features material that can be understood by any statistician who understands matrix algebra and basic statistical methods.
Christofilos, N.C.; Polk, I.J.
1959-02-17
Improvements in linear particle accelerators are described. A drift tube system for a linear ion accelerator reduces gap capacity between adjacent drift tube ends. This is accomplished by reducing the ratio of the diameter of the drift tube to the diameter of the resonant cavity. Concentration of magnetic field intensity at the longitudinal midpoint of the external sunface of each drift tube is reduced by increasing the external drift tube diameter at the longitudinal center region.
Olive, David J
2017-01-01
This text covers both multiple linear regression and some experimental design models. The text uses the response plot to visualize the model and to detect outliers, does not assume that the error distribution has a known parametric distribution, develops prediction intervals that work when the error distribution is unknown, suggests bootstrap hypothesis tests that may be useful for inference after variable selection, and develops prediction regions and large sample theory for the multivariate linear regression model that has m response variables. A relationship between multivariate prediction regions and confidence regions provides a simple way to bootstrap confidence regions. These confidence regions often provide a practical method for testing hypotheses. There is also a chapter on generalized linear models and generalized additive models. There are many R functions to produce response and residual plots, to simulate prediction intervals and hypothesis tests, to detect outliers, and to choose response trans...
International Nuclear Information System (INIS)
Alcaraz, J.
2001-01-01
After several years of study e''+ e''- linear colliders in the TeV range have emerged as the major and optimal high-energy physics projects for the post-LHC era. These notes summarize the present status form the main accelerator and detector features to their physics potential. The LHC era. These notes summarize the present status, from the main accelerator and detector features to their physics potential. The LHC is expected to provide first discoveries in the new energy domain, whereas an e''+ e''- linear collider in the 500 GeV-1 TeV will be able to complement it to an unprecedented level of precision in any possible areas: Higgs, signals beyond the SM and electroweak measurements. It is evident that the Linear Collider program will constitute a major step in the understanding of the nature of the new physics beyond the Standard Model. (Author) 22 refs
Edwards, Harold M
1995-01-01
In his new undergraduate textbook, Harold M Edwards proposes a radically new and thoroughly algorithmic approach to linear algebra Originally inspired by the constructive philosophy of mathematics championed in the 19th century by Leopold Kronecker, the approach is well suited to students in the computer-dominated late 20th century Each proof is an algorithm described in English that can be translated into the computer language the class is using and put to work solving problems and generating new examples, making the study of linear algebra a truly interactive experience Designed for a one-semester course, this text adopts an algorithmic approach to linear algebra giving the student many examples to work through and copious exercises to test their skills and extend their knowledge of the subject Students at all levels will find much interactive instruction in this text while teachers will find stimulating examples and methods of approach to the subject
International Nuclear Information System (INIS)
Xu, H.
1999-01-01
In this letter, the Sverjensky-Molling equation derived from a linear free energy relationship is used to calculate the Gibbs free energies of formation of zirconolite crystalline phases (MZrTi 2 O 7 and MHfTi 2 O 7 ) from the known thermodynamic properties of the corresponding aqueous divalent cations (M 2+ ). Sverjensky-Molling equation is expressed as ΔG 0 f,M v X =a M v X ΔG 0 n,M 2+ +b M v X +β M v X r M 2+ , where the coefficients a M v X , b M v X , and β M v X characterize a particular structural family of M v X, r M 2+ is the ionic radius of M 2+ cation, ΔG f,M v X 0 is the standard Gibbs free energy of formation of M v X, and ΔG 0 n,M 2+ is the standard non-solvation energy of cation M 2+ . This relationship can be used to predict the Gibbs free energies of formation of various fictive phases (such as BaZrTi 2 O 7 , SrZrTi 2 O 7 , PbZrTi 2 O 7 , etc.) that may form solid solution with CaZrTi 2 O 7 in actual Synroc-based nuclear waste forms. Based on obtained linear free energy relationships, it is predicted that large cations (e.g., Ba and Ra) prefer to be in perovskite structure, and small cations (e.g., Ca, Zn, and Cd) prefer to be in zirconolite structure. (orig.)
Hogben, Leslie
2013-01-01
With a substantial amount of new material, the Handbook of Linear Algebra, Second Edition provides comprehensive coverage of linear algebra concepts, applications, and computational software packages in an easy-to-use format. It guides you from the very elementary aspects of the subject to the frontiers of current research. Along with revisions and updates throughout, the second edition of this bestseller includes 20 new chapters.New to the Second EditionSeparate chapters on Schur complements, additional types of canonical forms, tensors, matrix polynomials, matrix equations, special types of
Karloff, Howard
1991-01-01
To this reviewer’s knowledge, this is the first book accessible to the upper division undergraduate or beginning graduate student that surveys linear programming from the Simplex Method…via the Ellipsoid algorithm to Karmarkar’s algorithm. Moreover, its point of view is algorithmic and thus it provides both a history and a case history of work in complexity theory. The presentation is admirable; Karloff's style is informal (even humorous at times) without sacrificing anything necessary for understanding. Diagrams (including horizontal brackets that group terms) aid in providing clarity. The end-of-chapter notes are helpful...Recommended highly for acquisition, since it is not only a textbook, but can also be used for independent reading and study. —Choice Reviews The reader will be well served by reading the monograph from cover to cover. The author succeeds in providing a concise, readable, understandable introduction to modern linear programming. —Mathematics of Computing This is a textbook intend...
Reduction of Linear Programming to Linear Approximation
Vaserstein, Leonid N.
2006-01-01
It is well known that every Chebyshev linear approximation problem can be reduced to a linear program. In this paper we show that conversely every linear program can be reduced to a Chebyshev linear approximation problem.
Linear phase formation by noise simulator
International Nuclear Information System (INIS)
Hazi, G.; Por, G.
1998-01-01
A new simulation technique is introduced to study noise propagation in nuclear power plants. Noise processes are considered as time functions, and the dynamic behaviour of the reactor core is modelled by ordinary and partial differential equations. The equations are solved by numerical methods and the results (time series) are considered as virtual measurements. The auto power spectral density and the cross power spectral density of these time series are calculated by traditional techniques. The spectrum obtained is compared with the analytical solution to validate the new simulation approach. After validation, the simulator is expanded to investigate some physical phenomena which are unmanageable by analytical calculations. Propagating disturbances are studied, and the effect of non-flat flux shape on phase curves is demonstrated. Numerical problems also are briefly discussed. (author)
Directory of Open Access Journals (Sweden)
Tanwiwat Jaikuna
2017-02-01
Full Text Available Purpose: To develop an in-house software program that is able to calculate and generate the biological dose distribution and biological dose volume histogram by physical dose conversion using the linear-quadratic-linear (LQL model. Material and methods : The Isobio software was developed using MATLAB version 2014b to calculate and generate the biological dose distribution and biological dose volume histograms. The physical dose from each voxel in treatment planning was extracted through Computational Environment for Radiotherapy Research (CERR, and the accuracy was verified by the differentiation between the dose volume histogram from CERR and the treatment planning system. An equivalent dose in 2 Gy fraction (EQD2 was calculated using biological effective dose (BED based on the LQL model. The software calculation and the manual calculation were compared for EQD2 verification with pair t-test statistical analysis using IBM SPSS Statistics version 22 (64-bit. Results: Two and three-dimensional biological dose distribution and biological dose volume histogram were displayed correctly by the Isobio software. Different physical doses were found between CERR and treatment planning system (TPS in Oncentra, with 3.33% in high-risk clinical target volume (HR-CTV determined by D90%, 0.56% in the bladder, 1.74% in the rectum when determined by D2cc, and less than 1% in Pinnacle. The difference in the EQD2 between the software calculation and the manual calculation was not significantly different with 0.00% at p-values 0.820, 0.095, and 0.593 for external beam radiation therapy (EBRT and 0.240, 0.320, and 0.849 for brachytherapy (BT in HR-CTV, bladder, and rectum, respectively. Conclusions : The Isobio software is a feasible tool to generate the biological dose distribution and biological dose volume histogram for treatment plan evaluation in both EBRT and BT.
Linear Algebra and Smarandache Linear Algebra
Vasantha, Kandasamy
2003-01-01
The present book, on Smarandache linear algebra, not only studies the Smarandache analogues of linear algebra and its applications, it also aims to bridge the need for new research topics pertaining to linear algebra, purely in the algebraic sense. We have introduced Smarandache semilinear algebra, Smarandache bilinear algebra and Smarandache anti-linear algebra and their fuzzy equivalents. Moreover, in this book, we have brought out the study of linear algebra and vector spaces over finite p...
Linearly constrained minimax optimization
DEFF Research Database (Denmark)
Madsen, Kaj; Schjær-Jacobsen, Hans
1978-01-01
We present an algorithm for nonlinear minimax optimization subject to linear equality and inequality constraints which requires first order partial derivatives. The algorithm is based on successive linear approximations to the functions defining the problem. The resulting linear subproblems...
Cosmological perturbations beyond linear order
CERN. Geneva
2013-01-01
Cosmological perturbation theory is the standard tool to understand the formation of the large scale structure in the Universe. However, its degree of applicability is limited by the growth of the amplitude of the matter perturbations with time. This problem can be tackled with by using N-body simulations or analytical techniques that go beyond the linear calculation. In my talk, I'll summarise some recent efforts in the latter that ameliorate the bad convergence of the standard perturbative expansion. The new techniques allow better analytical control on observables (as the matter power spectrum) over scales very relevant to understand the expansion history and formation of structure in the Universe.
Primordial black holes in linear and non-linear regimes
Energy Technology Data Exchange (ETDEWEB)
Allahyari, Alireza; Abolhasani, Ali Akbar [Department of Physics, Sharif University of Technology, Tehran (Iran, Islamic Republic of); Firouzjaee, Javad T., E-mail: allahyari@physics.sharif.edu, E-mail: j.taghizadeh.f@ipm.ir [School of Astronomy, Institute for Research in Fundamental Sciences (IPM), P.O. Box 19395-5531, Tehran (Iran, Islamic Republic of)
2017-06-01
We revisit the formation of primordial black holes (PBHs) in the radiation-dominated era for both linear and non-linear regimes, elaborating on the concept of an apparent horizon. Contrary to the expectation from vacuum models, we argue that in a cosmological setting a density fluctuation with a high density does not always collapse to a black hole. To this end, we first elaborate on the perturbation theory for spherically symmetric space times in the linear regime. Thereby, we introduce two gauges. This allows to introduce a well defined gauge-invariant quantity for the expansion of null geodesics. Using this quantity, we argue that PBHs do not form in the linear regime irrespective of the density of the background. Finally, we consider the formation of PBHs in non-linear regimes, adopting the spherical collapse picture. In this picture, over-densities are modeled by closed FRW models in the radiation-dominated era. The difference of our approach is that we start by finding an exact solution for a closed radiation-dominated universe. This yields exact results for turn-around time and radius. It is important that we take the initial conditions from the linear perturbation theory. Additionally, instead of using uniform Hubble gauge condition, both density and velocity perturbations are admitted in this approach. Thereby, the matching condition will impose an important constraint on the initial velocity perturbations δ {sup h} {sub 0} = −δ{sub 0}/2. This can be extended to higher orders. Using this constraint, we find that the apparent horizon of a PBH forms when δ > 3 at turn-around time. The corrections also appear from the third order. Moreover, a PBH forms when its apparent horizon is outside the sound horizon at the re-entry time. Applying this condition, we infer that the threshold value of the density perturbations at horizon re-entry should be larger than δ {sub th} > 0.7.
Foundations of linear and generalized linear models
Agresti, Alan
2015-01-01
A valuable overview of the most important ideas and results in statistical analysis Written by a highly-experienced author, Foundations of Linear and Generalized Linear Models is a clear and comprehensive guide to the key concepts and results of linear statistical models. The book presents a broad, in-depth overview of the most commonly used statistical models by discussing the theory underlying the models, R software applications, and examples with crafted models to elucidate key ideas and promote practical model building. The book begins by illustrating the fundamentals of linear models,
Tuey, R. C.
1972-01-01
Computer solutions of linear programming problems are outlined. Information covers vector spaces, convex sets, and matrix algebra elements for solving simultaneous linear equations. Dual problems, reduced cost analysis, ranges, and error analysis are illustrated.
Energy Technology Data Exchange (ETDEWEB)
Peterson, David; Stofleth, Jerome H.; Saul, Venner W.
2017-07-11
Linear shaped charges are described herein. In a general embodiment, the linear shaped charge has an explosive with an elongated arrowhead-shaped profile. The linear shaped charge also has and an elongated v-shaped liner that is inset into a recess of the explosive. Another linear shaped charge includes an explosive that is shaped as a star-shaped prism. Liners are inset into crevices of the explosive, where the explosive acts as a tamper.
Classifying Linear Canonical Relations
Lorand, Jonathan
2015-01-01
In this Master's thesis, we consider the problem of classifying, up to conjugation by linear symplectomorphisms, linear canonical relations (lagrangian correspondences) from a finite-dimensional symplectic vector space to itself. We give an elementary introduction to the theory of linear canonical relations and present partial results toward the classification problem. This exposition should be accessible to undergraduate students with a basic familiarity with linear algebra.
Lawson, C. L.; Krogh, F. T.; Gold, S. S.; Kincaid, D. R.; Sullivan, J.; Williams, E.; Hanson, R. J.; Haskell, K.; Dongarra, J.; Moler, C. B.
1982-01-01
The Basic Linear Algebra Subprograms (BLAS) library is a collection of 38 FORTRAN-callable routines for performing basic operations of numerical linear algebra. BLAS library is portable and efficient source of basic operations for designers of programs involving linear algebriac computations. BLAS library is supplied in portable FORTRAN and Assembler code versions for IBM 370, UNIVAC 1100 and CDC 6000 series computers.
Permafrost Hazards and Linear Infrastructure
Stanilovskaya, Julia; Sergeev, Dmitry
2014-05-01
The international experience of linear infrastructure planning, construction and exploitation in permafrost zone is being directly tied to the permafrost hazard assessment. That procedure should also consider the factors of climate impact and infrastructure protection. The current global climate change hotspots are currently polar and mountain areas. Temperature rise, precipitation and land ice conditions change, early springs occur more often. The big linear infrastructure objects cross the territories with different permafrost conditions which are sensitive to the changes in air temperature, hydrology, and snow accumulation which are connected to climatic dynamics. One of the most extensive linear structures built on permafrost worldwide are Trans Alaskan Pipeline (USA), Alaska Highway (Canada), Qinghai-Xizang Railway (China) and Eastern Siberia - Pacific Ocean Oil Pipeline (Russia). Those are currently being influenced by the regional climate change and permafrost impact which may act differently from place to place. Thermokarst is deemed to be the most dangerous process for linear engineering structures. Its formation and development depend on the linear structure type: road or pipeline, elevated or buried one. Zonal climate and geocryological conditions are also of the determining importance here. All the projects are of the different age and some of them were implemented under different climatic conditions. The effects of permafrost thawing have been recorded every year since then. The exploration and transportation companies from different countries maintain the linear infrastructure from permafrost degradation in different ways. The highways in Alaska are in a good condition due to governmental expenses on annual reconstructions. The Chara-China Railroad in Russia is under non-standard condition due to intensive permafrost response. Standards for engineering and construction should be reviewed and updated to account for permafrost hazards caused by the
Non linear system become linear system
Directory of Open Access Journals (Sweden)
Petre Bucur
2007-01-01
Full Text Available The present paper refers to the theory and the practice of the systems regarding non-linear systems and their applications. We aimed the integration of these systems to elaborate their response as well as to highlight some outstanding features.
Linear motor coil assembly and linear motor
2009-01-01
An ironless linear motor (5) comprising a magnet track (53) and a coil assembly (50) operating in cooperation with said magnet track (53) and having a plurality of concentrated multi-turn coils (31 a-f, 41 a-d, 51 a-k), wherein the end windings (31E) of the coils (31 a-f, 41 a-e) are substantially
Energy Technology Data Exchange (ETDEWEB)
Wiedemann, H.
1981-11-01
Since no linear colliders have been built yet it is difficult to know at what energy the linear cost scaling of linear colliders drops below the quadratic scaling of storage rings. There is, however, no doubt that a linear collider facility for a center of mass energy above say 500 GeV is significantly cheaper than an equivalent storage ring. In order to make the linear collider principle feasible at very high energies a number of problems have to be solved. There are two kinds of problems: one which is related to the feasibility of the principle and the other kind of problems is associated with minimizing the cost of constructing and operating such a facility. This lecture series describes the problems and possible solutions. Since the real test of a principle requires the construction of a prototype I will in the last chapter describe the SLC project at the Stanford Linear Accelerator Center.
Blyth, T S
2002-01-01
Basic Linear Algebra is a text for first year students leading from concrete examples to abstract theorems, via tutorial-type exercises. More exercises (of the kind a student may expect in examination papers) are grouped at the end of each section. The book covers the most important basics of any first course on linear algebra, explaining the algebra of matrices with applications to analytic geometry, systems of linear equations, difference equations and complex numbers. Linear equations are treated via Hermite normal forms which provides a successful and concrete explanation of the notion of linear independence. Another important highlight is the connection between linear mappings and matrices leading to the change of basis theorem which opens the door to the notion of similarity. This new and revised edition features additional exercises and coverage of Cramer's rule (omitted from the first edition). However, it is the new, extra chapter on computer assistance that will be of particular interest to readers:...
International Nuclear Information System (INIS)
Wiedemann, H.
1981-11-01
Since no linear colliders have been built yet it is difficult to know at what energy the linear cost scaling of linear colliders drops below the quadratic scaling of storage rings. There is, however, no doubt that a linear collider facility for a center of mass energy above say 500 GeV is significantly cheaper than an equivalent storage ring. In order to make the linear collider principle feasible at very high energies a number of problems have to be solved. There are two kinds of problems: one which is related to the feasibility of the principle and the other kind of problems is associated with minimizing the cost of constructing and operating such a facility. This lecture series describes the problems and possible solutions. Since the real test of a principle requires the construction of a prototype I will in the last chapter describe the SLC project at the Stanford Linear Accelerator Center
Matrices and linear transformations
Cullen, Charles G
1990-01-01
""Comprehensive . . . an excellent introduction to the subject."" - Electronic Engineer's Design Magazine.This introductory textbook, aimed at sophomore- and junior-level undergraduates in mathematics, engineering, and the physical sciences, offers a smooth, in-depth treatment of linear algebra and matrix theory. The major objects of study are matrices over an arbitrary field. Contents include Matrices and Linear Systems; Vector Spaces; Determinants; Linear Transformations; Similarity: Part I and Part II; Polynomials and Polynomial Matrices; Matrix Analysis; and Numerical Methods. The first
Efficient Non Linear Loudspeakers
DEFF Research Database (Denmark)
Petersen, Bo R.; Agerkvist, Finn T.
2006-01-01
Loudspeakers have traditionally been designed to be as linear as possible. However, as techniques for compensating non linearities are emerging, it becomes possible to use other design criteria. This paper present and examines a new idea for improving the efficiency of loudspeakers at high levels...... by changing the voice coil layout. This deliberate non-linear design has the benefit that a smaller amplifier can be used, which has the benefit of reducing system cost as well as reducing power consumption....
Faraway, Julian J
2014-01-01
A Hands-On Way to Learning Data AnalysisPart of the core of statistics, linear models are used to make predictions and explain the relationship between the response and the predictors. Understanding linear models is crucial to a broader competence in the practice of statistics. Linear Models with R, Second Edition explains how to use linear models in physical science, engineering, social science, and business applications. The book incorporates several improvements that reflect how the world of R has greatly expanded since the publication of the first edition.New to the Second EditionReorganiz
Carr, Joseph
1996-01-01
The linear IC market is large and growing, as is the demand for well trained technicians and engineers who understand how these devices work and how to apply them. Linear Integrated Circuits provides in-depth coverage of the devices and their operation, but not at the expense of practical applications in which linear devices figure prominently. This book is written for a wide readership from FE and first degree students, to hobbyists and professionals.Chapter 1 offers a general introduction that will provide students with the foundations of linear IC technology. From chapter 2 onwa
Fault tolerant linear actuator
Tesar, Delbert
2004-09-14
In varying embodiments, the fault tolerant linear actuator of the present invention is a new and improved linear actuator with fault tolerance and positional control that may incorporate velocity summing, force summing, or a combination of the two. In one embodiment, the invention offers a velocity summing arrangement with a differential gear between two prime movers driving a cage, which then drives a linear spindle screw transmission. Other embodiments feature two prime movers driving separate linear spindle screw transmissions, one internal and one external, in a totally concentric and compact integrated module.
Superconducting linear accelerator cryostat
International Nuclear Information System (INIS)
Ben-Zvi, I.; Elkonin, B.V.; Sokolowski, J.S.
1984-01-01
A large vertical cryostat for a superconducting linear accelerator using quarter wave resonators has been developed. The essential technical details, operational experience and performance are described. (author)
Energy Technology Data Exchange (ETDEWEB)
Patten, B.C.
1983-04-01
Two issues concerning linearity or nonlinearity of natural systems are considered. Each is related to one of the two alternative defining properties of linear systems, superposition and decomposition. Superposition exists when a linear combination of inputs to a system results in the same linear combination of outputs that individually correspond to the original inputs. To demonstrate this property it is necessary that all initial states and inputs of the system which impinge on the output in question be included in the linear combination manipulation. As this is difficult or impossible to do with real systems of any complexity, nature appears nonlinear even though it may be linear. A linear system that displays nonlinear behavior for this reason is termed pseudononlinear. The decomposition property exists when the dynamic response of a system can be partitioned into an input-free portion due to state plus a state-free portion due to input. This is a characteristic of all linear systems, but not of nonlinear systems. Without the decomposition property, it is not possible to distinguish which portions of a system's behavior are due to innate characteristics (self) vs. outside conditions (environment), which is an important class of questions in biology and ecology. Some philosophical aspects of these findings are then considered. It is suggested that those ecologists who hold to the view that organisms and their environments are separate entities are in effect embracing a linear view of nature, even though their belief systems and mathematical models tend to be nonlinear. On the other hand, those who consider that organism-environment complex forms a single inseparable unit are implictly involved in non-linear thought, which may be in conflict with the linear modes and models that some of them use. The need to rectify these ambivalences on the part of both groups is indicated.
STS-82 Pilot Scott Horowitz at SLF
1997-01-01
STS-82 Pilot Scott J. 'Doc' Horowitz flashes a wide grin for photographers after he lands his T-38 jet at KSCs Shuttle Landing Facility. Horowitz and the other six members of the STS-82 crew came from their home base at Johnson Space Center in Houston, TX, to spend the last few days before launch at KSC. STS-82 is scheduled for liftoff on Feb. 11 during a 65-minute launch window which opens at 3:56 a.m. EST. The 10-day flight aboard the Space Shuttle Discovery will be the second Hubble Space Telescope servicing mission.
Linear colliders - prospects 1985
International Nuclear Information System (INIS)
Rees, J.
1985-06-01
We discuss the scaling laws of linear colliders and their consequences for accelerator design. We then report on the SLAC Linear Collider project and comment on experience gained on that project and its application to future colliders. 9 refs., 2 figs
International Nuclear Information System (INIS)
Richter, B.
1985-01-01
A report is given on the goals and progress of the SLAC Linear Collider. The author discusses the status of the machine and the detectors and give an overview of the physics which can be done at this new facility. He also gives some ideas on how (and why) large linear colliders of the future should be built
International Nuclear Information System (INIS)
Rogner, H.H.
1989-01-01
The submitted sections on linear programming are extracted from 'Theorie und Technik der Planung' (1978) by W. Blaas and P. Henseler and reformulated for presentation at the Workshop. They consider a brief introduction to the theory of linear programming and to some essential aspects of the SIMPLEX solution algorithm for the purposes of economic planning processes. 1 fig
International Nuclear Information System (INIS)
Rowe, C.H.; Wilton, M.S. de.
1979-01-01
An improved recirculating electron beam linear accelerator of the racetrack type is described. The system comprises a beam path of four straight legs with four Pretzel bending magnets at the end of each leg to direct the beam into the next leg of the beam path. At least one of the beam path legs includes a linear accelerator. (UK)
Semidefinite linear complementarity problems
International Nuclear Information System (INIS)
Eckhardt, U.
1978-04-01
Semidefinite linear complementarity problems arise by discretization of variational inequalities describing e.g. elastic contact problems, free boundary value problems etc. In the present paper linear complementarity problems are introduced and the theory as well as the numerical treatment of them are described. In the special case of semidefinite linear complementarity problems a numerical method is presented which combines the advantages of elimination and iteration methods without suffering from their drawbacks. This new method has very attractive properties since it has a high degree of invariance with respect to the representation of the set of all feasible solutions of a linear complementarity problem by linear inequalities. By means of some practical applications the properties of the new method are demonstrated. (orig.) [de
Handbook on linear motor application
International Nuclear Information System (INIS)
1988-10-01
This book guides the application for Linear motor. It lists classification and speciality of Linear Motor, terms of linear-induction motor, principle of the Motor, types on one-side linear-induction motor, bilateral linear-induction motor, linear-DC Motor on basic of the motor, linear-DC Motor for moving-coil type, linear-DC motor for permanent-magnet moving type, linear-DC motor for electricity non-utility type, linear-pulse motor for variable motor, linear-pulse motor for permanent magneto type, linear-vibration actuator, linear-vibration actuator for moving-coil type, linear synchronous motor, linear electromagnetic motor, linear electromagnetic solenoid, technical organization and magnetic levitation and linear motor and sensor.
Satellite Formation Control Using Atmospheric Drag
National Research Council Canada - National Science Library
Hajovsky, Blake B
2007-01-01
This study investigates the use of a linear quadratic terminal controller to reconfigure satellite formations using atmospheric drag actuated control while minimizing the loss of energy of the formation...
Linear ubiquitination in immunity.
Shimizu, Yutaka; Taraborrelli, Lucia; Walczak, Henning
2015-07-01
Linear ubiquitination is a post-translational protein modification recently discovered to be crucial for innate and adaptive immune signaling. The function of linear ubiquitin chains is regulated at multiple levels: generation, recognition, and removal. These chains are generated by the linear ubiquitin chain assembly complex (LUBAC), the only known ubiquitin E3 capable of forming the linear ubiquitin linkage de novo. LUBAC is not only relevant for activation of nuclear factor-κB (NF-κB) and mitogen-activated protein kinases (MAPKs) in various signaling pathways, but importantly, it also regulates cell death downstream of immune receptors capable of inducing this response. Recognition of the linear ubiquitin linkage is specifically mediated by certain ubiquitin receptors, which is crucial for translation into the intended signaling outputs. LUBAC deficiency results in attenuated gene activation and increased cell death, causing pathologic conditions in both, mice, and humans. Removal of ubiquitin chains is mediated by deubiquitinases (DUBs). Two of them, OTULIN and CYLD, are constitutively associated with LUBAC. Here, we review the current knowledge on linear ubiquitination in immune signaling pathways and the biochemical mechanisms as to how linear polyubiquitin exerts its functions distinctly from those of other ubiquitin linkage types. © 2015 The Authors. Immunological Reviews Published by John Wiley & Sons Ltd.
International Nuclear Information System (INIS)
Krivonos, S.O.; Sorin, A.S.
1994-06-01
We show that the Zamolodchikov's and Polyakov-Bershadsky nonlinear algebras W 3 and W (2) 3 can be embedded as subalgebras into some linear algebras with finite set of currents. Using these linear algebras we find new field realizations of W (2) 3 and W 3 which could be a starting point for constructing new versions of W-string theories. We also reveal a number of hidden relationships between W 3 and W (2) 3 . We conjecture that similar linear algebras can exist for other W-algebra as well. (author). 10 refs
Schneider, Hans
1989-01-01
Linear algebra is one of the central disciplines in mathematics. A student of pure mathematics must know linear algebra if he is to continue with modern algebra or functional analysis. Much of the mathematics now taught to engineers and physicists requires it.This well-known and highly regarded text makes the subject accessible to undergraduates with little mathematical experience. Written mainly for students in physics, engineering, economics, and other fields outside mathematics, the book gives the theory of matrices and applications to systems of linear equations, as well as many related t
Linearity in Process Languages
DEFF Research Database (Denmark)
Nygaard, Mikkel; Winskel, Glynn
2002-01-01
The meaning and mathematical consequences of linearity (managing without a presumed ability to copy) are studied for a path-based model of processes which is also a model of affine-linear logic. This connection yields an affine-linear language for processes, automatically respecting open......-map bisimulation, in which a range of process operations can be expressed. An operational semantics is provided for the tensor fragment of the language. Different ways to make assemblies of processes lead to different choices of exponential, some of which respect bisimulation....
Amir-Moez, A R; Sneddon, I N
1962-01-01
Elements of Linear Space is a detailed treatment of the elements of linear spaces, including real spaces with no more than three dimensions and complex n-dimensional spaces. The geometry of conic sections and quadric surfaces is considered, along with algebraic structures, especially vector spaces and transformations. Problems drawn from various branches of geometry are given.Comprised of 12 chapters, this volume begins with an introduction to real Euclidean space, followed by a discussion on linear transformations and matrices. The addition and multiplication of transformations and matrices a
Weisberg, Sanford
2013-01-01
Praise for the Third Edition ""...this is an excellent book which could easily be used as a course text...""-International Statistical Institute The Fourth Edition of Applied Linear Regression provides a thorough update of the basic theory and methodology of linear regression modeling. Demonstrating the practical applications of linear regression analysis techniques, the Fourth Edition uses interesting, real-world exercises and examples. Stressing central concepts such as model building, understanding parameters, assessing fit and reliability, and drawing conclusions, the new edition illus
Callier, Frank M.; Desoer, Charles A.
1991-01-01
The aim of this book is to provide a systematic and rigorous access to the main topics of linear state-space system theory in both the continuous-time case and the discrete-time case; and the I/O description of linear systems. The main thrusts of the work are the analysis of system descriptions and derivations of their properties, LQ-optimal control, state feedback and state estimation, and MIMO unity-feedback systems.
ALPS - A LINEAR PROGRAM SOLVER
Viterna, L. A.
1994-01-01
Linear programming is a widely-used engineering and management tool. Scheduling, resource allocation, and production planning are all well-known applications of linear programs (LP's). Most LP's are too large to be solved by hand, so over the decades many computer codes for solving LP's have been developed. ALPS, A Linear Program Solver, is a full-featured LP analysis program. ALPS can solve plain linear programs as well as more complicated mixed integer and pure integer programs. ALPS also contains an efficient solution technique for pure binary (0-1 integer) programs. One of the many weaknesses of LP solvers is the lack of interaction with the user. ALPS is a menu-driven program with no special commands or keywords to learn. In addition, ALPS contains a full-screen editor to enter and maintain the LP formulation. These formulations can be written to and read from plain ASCII files for portability. For those less experienced in LP formulation, ALPS contains a problem "parser" which checks the formulation for errors. ALPS creates fully formatted, readable reports that can be sent to a printer or output file. ALPS is written entirely in IBM's APL2/PC product, Version 1.01. The APL2 workspace containing all the ALPS code can be run on any APL2/PC system (AT or 386). On a 32-bit system, this configuration can take advantage of all extended memory. The user can also examine and modify the ALPS code. The APL2 workspace has also been "packed" to be run on any DOS system (without APL2) as a stand-alone "EXE" file, but has limited memory capacity on a 640K system. A numeric coprocessor (80X87) is optional but recommended. The standard distribution medium for ALPS is a 5.25 inch 360K MS-DOS format diskette. IBM, IBM PC and IBM APL2 are registered trademarks of International Business Machines Corporation. MS-DOS is a registered trademark of Microsoft Corporation.
Blyth, T S
2002-01-01
Most of the introductory courses on linear algebra develop the basic theory of finite dimensional vector spaces, and in so doing relate the notion of a linear mapping to that of a matrix. Generally speaking, such courses culminate in the diagonalisation of certain matrices and the application of this process to various situations. Such is the case, for example, in our previous SUMS volume Basic Linear Algebra. The present text is a continuation of that volume, and has the objective of introducing the reader to more advanced properties of vector spaces and linear mappings, and consequently of matrices. For readers who are not familiar with the contents of Basic Linear Algebra we provide an introductory chapter that consists of a compact summary of the prerequisites for the present volume. In order to consolidate the student's understanding we have included a large num ber of illustrative and worked examples, as well as many exercises that are strategi cally placed throughout the text. Solutions to the ex...
International Nuclear Information System (INIS)
Mamyrin, B.A.; Shmikk, D.V.
1979-01-01
A description and operating principle of a linear mass reflectron with V-form trajectory of ion motion -a new non-magnetic time-of-flight mass spectrometer with high resolution are presented. The ion-optical system of the device consists of an ion source with ionization by electron shock, of accelerating gaps, reflector gaps, a drift space and ion detector. Ions move in the linear mass refraction along the trajectories parallel to the axis of the analyzer chamber. The results of investigations into the experimental device are given. With an ion drift length of 0.6 m the device resolution is 1200 with respect to the peak width at half-height. Small-sized mass spectrometric transducers with high resolution and sensitivity may be designed on the base of the linear mass reflectron principle
Olver, Peter J
2018-01-01
This textbook develops the essential tools of linear algebra, with the goal of imparting technique alongside contextual understanding. Applications go hand-in-hand with theory, each reinforcing and explaining the other. This approach encourages students to develop not only the technical proficiency needed to go on to further study, but an appreciation for when, why, and how the tools of linear algebra can be used across modern applied mathematics. Providing an extensive treatment of essential topics such as Gaussian elimination, inner products and norms, and eigenvalues and singular values, this text can be used for an in-depth first course, or an application-driven second course in linear algebra. In this second edition, applications have been updated and expanded to include numerical methods, dynamical systems, data analysis, and signal processing, while the pedagogical flow of the core material has been improved. Throughout, the text emphasizes the conceptual connections between each application and the un...
Banach, S
1987-01-01
This classic work by the late Stefan Banach has been translated into English so as to reach a yet wider audience. It contains the basics of the algebra of operators, concentrating on the study of linear operators, which corresponds to that of the linear forms a1x1 + a2x2 + ... + anxn of algebra.The book gathers results concerning linear operators defined in general spaces of a certain kind, principally in Banach spaces, examples of which are: the space of continuous functions, that of the pth-power-summable functions, Hilbert space, etc. The general theorems are interpreted in various mathematical areas, such as group theory, differential equations, integral equations, equations with infinitely many unknowns, functions of a real variable, summation methods and orthogonal series.A new fifty-page section (``Some Aspects of the Present Theory of Banach Spaces'''') complements this important monograph.
DEFF Research Database (Denmark)
Høskuldsson, Agnar
1996-01-01
Determination of the proper dimension of a given linear model is one of the most important tasks in the applied modeling work. We consider here eight criteria that can be used to determine the dimension of the model, or equivalently, the number of components to use in the model. Four of these cri......Determination of the proper dimension of a given linear model is one of the most important tasks in the applied modeling work. We consider here eight criteria that can be used to determine the dimension of the model, or equivalently, the number of components to use in the model. Four...... the basic problems in determining the dimension of linear models. Then each of the eight measures are treated. The results are illustrated by examples....
Linear programming using Matlab
Ploskas, Nikolaos
2017-01-01
This book offers a theoretical and computational presentation of a variety of linear programming algorithms and methods with an emphasis on the revised simplex method and its components. A theoretical background and mathematical formulation is included for each algorithm as well as comprehensive numerical examples and corresponding MATLAB® code. The MATLAB® implementations presented in this book are sophisticated and allow users to find solutions to large-scale benchmark linear programs. Each algorithm is followed by a computational study on benchmark problems that analyze the computational behavior of the presented algorithms. As a solid companion to existing algorithmic-specific literature, this book will be useful to researchers, scientists, mathematical programmers, and students with a basic knowledge of linear algebra and calculus. The clear presentation enables the reader to understand and utilize all components of simplex-type methods, such as presolve techniques, scaling techniques, pivoting ru...
International Nuclear Information System (INIS)
Anon.
1994-01-01
The aim of the TESLA (TeV Superconducting Linear Accelerator) collaboration (at present 19 institutions from seven countries) is to establish the technology for a high energy electron-positron linear collider using superconducting radiofrequency cavities to accelerate its beams. Another basic goal is to demonstrate that such a collider can meet its performance goals in a cost effective manner. For this the TESLA collaboration is preparing a 500 MeV superconducting linear test accelerator at the DESY Laboratory in Hamburg. This TTF (TESLA Test Facility) consists of four cryomodules, each approximately 12 m long and containing eight 9-cell solid niobium cavities operating at a frequency of 1.3 GHz
Linearly Adjustable International Portfolios
Fonseca, R. J.; Kuhn, D.; Rustem, B.
2010-09-01
We present an approach to multi-stage international portfolio optimization based on the imposition of a linear structure on the recourse decisions. Multiperiod decision problems are traditionally formulated as stochastic programs. Scenario tree based solutions however can become intractable as the number of stages increases. By restricting the space of decision policies to linear rules, we obtain a conservative tractable approximation to the original problem. Local asset prices and foreign exchange rates are modelled separately, which allows for a direct measure of their impact on the final portfolio value.
Linearly Adjustable International Portfolios
International Nuclear Information System (INIS)
Fonseca, R. J.; Kuhn, D.; Rustem, B.
2010-01-01
We present an approach to multi-stage international portfolio optimization based on the imposition of a linear structure on the recourse decisions. Multiperiod decision problems are traditionally formulated as stochastic programs. Scenario tree based solutions however can become intractable as the number of stages increases. By restricting the space of decision policies to linear rules, we obtain a conservative tractable approximation to the original problem. Local asset prices and foreign exchange rates are modelled separately, which allows for a direct measure of their impact on the final portfolio value.
International Nuclear Information System (INIS)
Barkman, W.E.; Adams, W.Q.; Berrier, B.R.
1978-01-01
A linear induction motor has been operated on a test bed with a feedback pulse resolution of 5 nm (0.2 μin). Slewing tests with this slide drive have shown positioning errors less than or equal to 33 nm (1.3 μin) at feedrates between 0 and 25.4 mm/min (0-1 ipm). A 0.86-m (34-in)-stroke linear motor is being investigated, using the SPACO machine as a test bed. Initial results were encouraging, and work is continuing to optimize the servosystem compensation
Linear Algebra Thoroughly Explained
Vujičić, Milan
2008-01-01
Linear Algebra Thoroughly Explained provides a comprehensive introduction to the subject suitable for adoption as a self-contained text for courses at undergraduate and postgraduate level. The clear and comprehensive presentation of the basic theory is illustrated throughout with an abundance of worked examples. The book is written for teachers and students of linear algebra at all levels and across mathematics and the applied sciences, particularly physics and engineering. It will also be an invaluable addition to research libraries as a comprehensive resource book for the subject.
Reddish, V C
1978-01-01
Stellar Formation brings together knowledge about the formation of stars. In seeking to determine the conditions necessary for star formation, this book examines questions such as how, where, and why stars form, and at what rate and with what properties. This text also considers whether the formation of a star is an accident or an integral part of the physical properties of matter. This book consists of 13 chapters divided into two sections and begins with an overview of theories that explain star formation as well as the state of knowledge of star formation in comparison to stellar structure
2013-05-10
AND VICTIM- ~ vAP BLAMING 4. AMERICA, LINEARLY CYCUCAL AF IMT 1768, 19840901, V5 PREVIOUS EDITION WILL BE USED. C2C Jessica Adams Dr. Brissett...his desires, his failings, and his aspirations follow the same general trend throughout history and throughout cultures. The founding fathers sought
International Nuclear Information System (INIS)
Southworth, B.
1985-01-01
The peak of the construction phase of the Stanford Linear Collider, SLC, to achieve 50 GeV electron-positron collisions has now been passed. The work remains on schedule to attempt colliding beams, initially at comparatively low luminosity, early in 1987. (orig./HSI).
International Nuclear Information System (INIS)
Mafra Neto, F.
1992-01-01
The dose of gamma radiation from a linear source of cesium 137 is obtained, presenting two difficulties: oblique filtration of radiation when cross the platinum wall, in different directions, and dose connection due to the scattering by the material mean of propagation. (C.G.C.)
Resistors Improve Ramp Linearity
Kleinberg, L. L.
1982-01-01
Simple modification to bootstrap ramp generator gives more linear output over longer sweep times. New circuit adds just two resistors, one of which is adjustable. Modification cancels nonlinearities due to variations in load on charging capacitor and due to changes in charging current as the voltage across capacitor increases.
LINEAR COLLIDERS: 1992 workshop
International Nuclear Information System (INIS)
Settles, Ron; Coignet, Guy
1992-01-01
As work on designs for future electron-positron linear colliders pushes ahead at major Laboratories throughout the world in a major international collaboration framework, the LC92 workshop held in Garmisch Partenkirchen this summer, attended by 200 machine and particle physicists, provided a timely focus
Brameier, Markus
2007-01-01
Presents a variant of Genetic Programming that evolves imperative computer programs as linear sequences of instructions, in contrast to the more traditional functional expressions or syntax trees. This book serves as a reference for researchers, but also contains sufficient introduction for students and those who are new to the field
Dobbs, David E.
2013-01-01
A direct method is given for solving first-order linear recurrences with constant coefficients. The limiting value of that solution is studied as "n to infinity." This classroom note could serve as enrichment material for the typical introductory course on discrete mathematics that follows a calculus course.
International Nuclear Information System (INIS)
Takeda, Seishi
1992-01-01
The status of R and D of future e + e - linear colliders proposed by the institutions throughout the world is described including the JLC, NLC, VLEPP, CLIC, DESY/THD and TESLA projects. The parameters and RF sources are discussed. (G.P.) 36 refs.; 1 tab
Linear signal processing using silicon micro-ring resonators
DEFF Research Database (Denmark)
Peucheret, Christophe; Ding, Yunhong; Ou, Haiyan
2012-01-01
We review our recent achievements on the use of silicon micro-ring resonators for linear optical signal processing applications, including modulation format conversion, phase-to-intensity modulation conversion and waveform shaping.......We review our recent achievements on the use of silicon micro-ring resonators for linear optical signal processing applications, including modulation format conversion, phase-to-intensity modulation conversion and waveform shaping....
International Nuclear Information System (INIS)
Silk, J.; Di Cintio, A.; Dvorkin, I.
2014-01-01
Galaxy formation is at the forefront of observation and theory in cosmology. An improved understanding is essential for improving our knowledge both of the cosmological parameters, of the contents of the universe, and of our origins. In these lectures intended for graduate students, galaxy formation theory is reviewed and confronted with recent observational issues. In lecture 1, the following topics are presented: star formation considerations, including IMF, star formation efficiency and star formation rate, the origin of the galaxy luminosity function, and feedback in dwarf galaxies. In lecture 2, we describe formation of disks and massive spheroids, including the growth of supermassive black holes, negative feedback in spheroids, the AGN-star formation connection, star formation rates at high redshift and the baryon fraction in galaxies.
Linear expansion of products out of thermal splitting graphite
International Nuclear Information System (INIS)
Tishina, E.A.; Kurnevich, G.I.
1994-01-01
Linear expansion of thermally split graphite in the form of foil and pressed items of different density was studied. It is ascertained that the extreme character of temperature dependence of linear expansion factor of pressed samples of thermally split graphite is determined by the formation of closed pores containing air in the course of their production. 3 refs., 2 figs
Finite-dimensional linear algebra
Gockenbach, Mark S
2010-01-01
Some Problems Posed on Vector SpacesLinear equationsBest approximationDiagonalizationSummaryFields and Vector SpacesFields Vector spaces Subspaces Linear combinations and spanning sets Linear independence Basis and dimension Properties of bases Polynomial interpolation and the Lagrange basis Continuous piecewise polynomial functionsLinear OperatorsLinear operatorsMore properties of linear operatorsIsomorphic vector spaces Linear operator equations Existence and uniqueness of solutions The fundamental theorem; inverse operatorsGaussian elimination Newton's method Linear ordinary differential eq
Linearity and Non-linearity of Photorefractive effect in Materials ...
African Journals Online (AJOL)
In this paper we have studied the Linearity and Non-linearity of Photorefractive effect in materials using the band transport model. For low light beam intensities the change in the refractive index is proportional to the electric field for linear optics while for non- linear optics the change in refractive index is directly proportional ...
Linearly Refined Session Types
Directory of Open Access Journals (Sweden)
Pedro Baltazar
2012-11-01
Full Text Available Session types capture precise protocol structure in concurrent programming, but do not specify properties of the exchanged values beyond their basic type. Refinement types are a form of dependent types that can address this limitation, combining types with logical formulae that may refer to program values and can constrain types using arbitrary predicates. We present a pi calculus with assume and assert operations, typed using a session discipline that incorporates refinement formulae written in a fragment of Multiplicative Linear Logic. Our original combination of session and refinement types, together with the well established benefits of linearity, allows very fine-grained specifications of communication protocols in which refinement formulae are treated as logical resources rather than persistent truths.
Kuznetsov, N.; Maz'ya, V.; Vainberg, B.
2002-08-01
This book gives a self-contained and up-to-date account of mathematical results in the linear theory of water waves. The study of waves has many applications, including the prediction of behavior of floating bodies (ships, submarines, tension-leg platforms etc.), the calculation of wave-making resistance in naval architecture, and the description of wave patterns over bottom topography in geophysical hydrodynamics. The first section deals with time-harmonic waves. Three linear boundary value problems serve as the approximate mathematical models for these types of water waves. The next section uses a plethora of mathematical techniques in the investigation of these three problems. The techniques used in the book include integral equations based on Green's functions, various inequalities between the kinetic and potential energy and integral identities which are indispensable for proving the uniqueness theorems. The so-called inverse procedure is applied to constructing examples of non-uniqueness, usually referred to as 'trapped nodes.'
The International Linear Collider
Directory of Open Access Journals (Sweden)
List Benno
2014-04-01
Full Text Available The International Linear Collider (ILC is a proposed e+e− linear collider with a centre-of-mass energy of 200–500 GeV, based on superconducting RF cavities. The ILC would be an ideal machine for precision studies of a light Higgs boson and the top quark, and would have a discovery potential for new particles that is complementary to that of LHC. The clean experimental conditions would allow the operation of detectors with extremely good performance; two such detectors, ILD and SiD, are currently being designed. Both make use of novel concepts for tracking and calorimetry. The Japanese High Energy Physics community has recently recommended to build the ILC in Japan.
The International Linear Collider
List, Benno
2014-04-01
The International Linear Collider (ILC) is a proposed e+e- linear collider with a centre-of-mass energy of 200-500 GeV, based on superconducting RF cavities. The ILC would be an ideal machine for precision studies of a light Higgs boson and the top quark, and would have a discovery potential for new particles that is complementary to that of LHC. The clean experimental conditions would allow the operation of detectors with extremely good performance; two such detectors, ILD and SiD, are currently being designed. Both make use of novel concepts for tracking and calorimetry. The Japanese High Energy Physics community has recently recommended to build the ILC in Japan.
DEFF Research Database (Denmark)
Høskuldsson, Agnar
1996-01-01
Determination of the proper dimension of a given linear model is one of the most important tasks in the applied modeling work. We consider here eight criteria that can be used to determine the dimension of the model, or equivalently, the number of components to use in the model. Four...... the basic problems in determining the dimension of linear models. Then each of the eight measures are treated. The results are illustrated by examples....... of these criteria are widely used ones, while the remaining four are ones derived from the H-principle of mathematical modeling. Many examples from practice show that the criteria derived from the H-principle function better than the known and popular criteria for the number of components. We shall briefly review...
Goldowsky, Michael P. (Inventor)
1987-01-01
A reciprocating linear motor is formed with a pair of ring-shaped permanent magnets having opposite radial polarizations, held axially apart by a nonmagnetic yoke, which serves as an axially displaceable armature assembly. A pair of annularly wound coils having axial lengths which differ from the axial lengths of the permanent magnets are serially coupled together in mutual opposition and positioned with an outer cylindrical core in axial symmetry about the armature assembly. One embodiment includes a second pair of annularly wound coils serially coupled together in mutual opposition and an inner cylindrical core positioned in axial symmetry inside the armature radially opposite to the first pair of coils. Application of a potential difference across a serial connection of the two pairs of coils creates a current flow perpendicular to the magnetic field created by the armature magnets, thereby causing limited linear displacement of the magnets relative to the coils.
International Nuclear Information System (INIS)
Henneaux, Marc; Teitelboim, Claudio
2005-01-01
We show that duality transformations of linearized gravity in four dimensions, i.e., rotations of the linearized Riemann tensor and its dual into each other, can be extended to the dynamical fields of the theory so as to be symmetries of the action and not just symmetries of the equations of motion. Our approach relies on the introduction of two superpotentials, one for the spatial components of the spin-2 field and the other for their canonically conjugate momenta. These superpotentials are two-index, symmetric tensors. They can be taken to be the basic dynamical fields and appear locally in the action. They are simply rotated into each other under duality. In terms of the superpotentials, the canonical generator of duality rotations is found to have a Chern-Simons-like structure, as in the Maxwell case
International Nuclear Information System (INIS)
Phinney, N.
1992-01-01
The SLAC Linear Collider has begun a new era of operation with the SLD detector. During 1991 there was a first engineering run for the SLD in parallel with machine improvements to increase luminosity and reliability. For the 1992 run, a polarized electron source was added and more than 10,000 Zs with an average of 23% polarization have been logged by the SLD. This paper discusses the performance of the SLC in 1991 and 1992 and the technical advances that have produced higher luminosity. Emphasis will be placed on issues relevant to future linear colliders such as producing and maintaining high current, low emittance beams and focusing the beams to the micron scale for collisions. (Author) tab., 2 figs., 18 refs
Linear waves and instabilities
International Nuclear Information System (INIS)
Bers, A.
1975-01-01
The electrodynamic equations for small-amplitude waves and their dispersion relation in a homogeneous plasma are outlined. For such waves, energy and momentum, and their flow and transformation, are described. Perturbation theory of waves is treated and applied to linear coupling of waves, and the resulting instabilities from such interactions between active and passive waves. Linear stability analysis in time and space is described where the time-asymptotic, time-space Green's function for an arbitrary dispersion relation is developed. The perturbation theory of waves is applied to nonlinear coupling, with particular emphasis on pump-driven interactions of waves. Details of the time--space evolution of instabilities due to coupling are given. (U.S.)
Extended linear chain compounds
Linear chain substances span a large cross section of contemporary chemistry ranging from covalent polymers, to organic charge transfer com plexes to nonstoichiometric transition metal coordination complexes. Their commonality, which coalesced intense interest in the theoretical and exper imental solid state physics/chemistry communities, was based on the obser vation that these inorganic and organic polymeric substrates exhibit striking metal-like electrical and optical properties. Exploitation and extension of these systems has led to the systematic study of both the chemistry and physics of highly and poorly conducting linear chain substances. To gain a salient understanding of these complex materials rich in anomalous aniso tropic electrical, optical, magnetic, and mechanical properties, the conver gence of diverse skills and talents was required. The constructive blending of traditionally segregated disciplines such as synthetic and physical organic, inorganic, and polymer chemistry, crystallog...
Diamond, Jared M.
1966-01-01
1. The relation between osmotic gradient and rate of osmotic water flow has been measured in rabbit gall-bladder by a gravimetric procedure and by a rapid method based on streaming potentials. Streaming potentials were directly proportional to gravimetrically measured water fluxes. 2. As in many other tissues, water flow was found to vary with gradient in a markedly non-linear fashion. There was no consistent relation between the water permeability and either the direction or the rate of water flow. 3. Water flow in response to a given gradient decreased at higher osmolarities. The resistance to water flow increased linearly with osmolarity over the range 186-825 m-osM. 4. The resistance to water flow was the same when the gall-bladder separated any two bathing solutions with the same average osmolarity, regardless of the magnitude of the gradient. In other words, the rate of water flow is given by the expression (Om — Os)/[Ro′ + ½k′ (Om + Os)], where Ro′ and k′ are constants and Om and Os are the bathing solution osmolarities. 5. Of the theories advanced to explain non-linear osmosis in other tissues, flow-induced membrane deformations, unstirred layers, asymmetrical series-membrane effects, and non-osmotic effects of solutes could not explain the results. However, experimental measurements of water permeability as a function of osmolarity permitted quantitative reconstruction of the observed water flow—osmotic gradient curves. Hence non-linear osmosis in rabbit gall-bladder is due to a decrease in water permeability with increasing osmolarity. 6. The results suggest that aqueous channels in the cell membrane behave as osmometers, shrinking in concentrated solutions of impermeant molecules and thereby increasing membrane resistance to water flow. A mathematical formulation of such a membrane structure is offered. PMID:5945254
Fundamentals of linear algebra
Dash, Rajani Ballav
2008-01-01
FUNDAMENTALS OF LINEAR ALGEBRA is a comprehensive Text Book, which can be used by students and teachers of All Indian Universities. The Text has easy, understandable form and covers all topics of UGC Curriculum. There are lots of worked out examples which helps the students in solving the problems without anybody's help. The Problem sets have been designed keeping in view of the questions asked in different examinations.
Sander, K F
1964-01-01
Linear Network Theory covers the significant algebraic aspect of network theory, with minimal reference to practical circuits. The book begins the presentation of network analysis with the exposition of networks containing resistances only, and follows it up with a discussion of networks involving inductance and capacity by way of the differential equations. Classification and description of certain networks, equivalent networks, filter circuits, and network functions are also covered. Electrical engineers, technicians, electronics engineers, electricians, and students learning the intricacies
Non linear viscoelastic models
DEFF Research Database (Denmark)
Agerkvist, Finn T.
2011-01-01
Viscoelastic eects are often present in loudspeaker suspensions, this can be seen in the displacement transfer function which often shows a frequency dependent value below the resonance frequency. In this paper nonlinear versions of the standard linear solid model (SLS) are investigated....... The simulations show that the nonlinear version of the Maxwell SLS model can result in a time dependent small signal stiness while the Kelvin Voight version does not....
Relativistic Linear Restoring Force
Clark, D.; Franklin, J.; Mann, N.
2012-01-01
We consider two different forms for a relativistic version of a linear restoring force. The pair comes from taking Hooke's law to be the force appearing on the right-hand side of the relativistic expressions: d"p"/d"t" or d"p"/d["tau"]. Either formulation recovers Hooke's law in the non-relativistic limit. In addition to these two forces, we…
Superconducting linear colliders
International Nuclear Information System (INIS)
Anon.
1990-01-01
The advantages of superconducting radiofrequency (SRF) for particle accelerators have been demonstrated by successful operation of systems in the TRISTAN and LEP electron-positron collider rings respectively at the Japanese KEK Laboratory and at CERN. If performance continues to improve and costs can be lowered, this would open an attractive option for a high luminosity TeV (1000 GeV) linear collider
Perturbed asymptotically linear problems
Bartolo, R.; Candela, A. M.; Salvatore, A.
2012-01-01
The aim of this paper is investigating the existence of solutions of some semilinear elliptic problems on open bounded domains when the nonlinearity is subcritical and asymptotically linear at infinity and there is a perturbation term which is just continuous. Also in the case when the problem has not a variational structure, suitable procedures and estimates allow us to prove that the number of distinct crtitical levels of the functional associated to the unperturbed problem is "stable" unde...
Miniature linear cooler development
International Nuclear Information System (INIS)
Pruitt, G.R.
1993-01-01
An overview is presented of the status of a family of miniature linear coolers currently under development by Hughes Aircraft Co. for use in hand held, volume limited or power limited infrared applications. These coolers, representing the latest additions to the Hughes family of TOP trademark [twin-opposed piston] linear coolers, have been fabricated and tested in three different configurations. Each configuration is designed to utilize a common compressor assembly resulting in reduced manufacturing costs. The baseline compressor has been integrated with two different expander configurations and has been operated with two different levels of input power. These various configuration combinations offer a wide range of performance and interface characteristics which may be tailored to applications requiring limited power and size without significantly compromising cooler capacity or cooldown characteristics. Key cooler characteristics and test data are summarized for three combinations of cooler configurations which are representative of the versatility of this linear cooler design. Configurations reviewed include the shortened coldfinger [1.50 to 1.75 inches long], limited input power [less than 17 Watts] for low power availability applications; the shortened coldfinger with higher input power for lightweight, higher performance applications; and coldfingers compatible with DoD 0.4 Watt Common Module coolers for wider range retrofit capability. Typical weight of these miniature linear coolers is less than 500 grams for the compressor, expander and interconnecting transfer line. Cooling capacity at 80K at room ambient conditions ranges from 400 mW to greater than 550 mW. Steady state power requirements for maintaining a heat load of 150 mW at 80K has been shown to be less than 8 Watts. Ongoing reliability growth testing is summarized including a review of the latest test article results
Directory of Open Access Journals (Sweden)
Avram Mihai
2017-01-01
Full Text Available The paper presents a linear pneumatic actuator with short working stroke. It consists of a pneumatic motor (a simple stroke cylinder or a membrane chamber, two 2/2 pneumatic distributors “all or nothing” electrically commanded for controlling the intake/outtake flow to/from the active chamber of the motor, a position transducer and a microcontroller. There is also presented the theoretical analysis (mathematical modelling and numerical simulation accomplished.
Avram Mihai; Niţu Constantin; Bucşan Constantin; Grămescu Bogdan
2017-01-01
The paper presents a linear pneumatic actuator with short working stroke. It consists of a pneumatic motor (a simple stroke cylinder or a membrane chamber), two 2/2 pneumatic distributors “all or nothing” electrically commanded for controlling the intake/outtake flow to/from the active chamber of the motor, a position transducer and a microcontroller. There is also presented the theoretical analysis (mathematical modelling and numerical simulation) accomplished.
International Nuclear Information System (INIS)
Scheffel, J.
1984-03-01
The linear Grad-Shafranov equation for a toroidal, axisymmetric plasma is solved analytically. Exact solutions are given in terms of confluent hyper-geometric functions. As an alternative, simple and accurate WKBJ solutions are presented. With parabolic pressure profiles, both hollow and peaked toroidal current density profiles are obtained. As an example the equilibrium of a z-pinch with a square-shaped cross section is derived.(author)
Buttram, M.T.; Ginn, J.W.
1988-06-21
A linear induction accelerator includes a plurality of adder cavities arranged in a series and provided in a structure which is evacuated so that a vacuum inductance is provided between each adder cavity and the structure. An energy storage system for the adder cavities includes a pulsed current source and a respective plurality of bipolar converting networks connected thereto. The bipolar high-voltage, high-repetition-rate square pulse train sets and resets the cavities. 4 figs.
Springer, T A
1998-01-01
"[The first] ten chapters...are an efficient, accessible, and self-contained introduction to affine algebraic groups over an algebraically closed field. The author includes exercises and the book is certainly usable by graduate students as a text or for self-study...the author [has a] student-friendly style… [The following] seven chapters... would also be a good introduction to rationality issues for algebraic groups. A number of results from the literature…appear for the first time in a text." –Mathematical Reviews (Review of the Second Edition) "This book is a completely new version of the first edition. The aim of the old book was to present the theory of linear algebraic groups over an algebraically closed field. Reading that book, many people entered the research field of linear algebraic groups. The present book has a wider scope. Its aim is to treat the theory of linear algebraic groups over arbitrary fields. Again, the author keeps the treatment of prerequisites self-contained. The material of t...
Parametric Linear Dynamic Logic
Directory of Open Access Journals (Sweden)
Peter Faymonville
2014-08-01
Full Text Available We introduce Parametric Linear Dynamic Logic (PLDL, which extends Linear Dynamic Logic (LDL by temporal operators equipped with parameters that bound their scope. LDL was proposed as an extension of Linear Temporal Logic (LTL that is able to express all ω-regular specifications while still maintaining many of LTL's desirable properties like an intuitive syntax and a translation into non-deterministic Büchi automata of exponential size. But LDL lacks capabilities to express timing constraints. By adding parameterized operators to LDL, we obtain a logic that is able to express all ω-regular properties and that subsumes parameterized extensions of LTL like Parametric LTL and PROMPT-LTL. Our main technical contribution is a translation of PLDL formulas into non-deterministic Büchi word automata of exponential size via alternating automata. This yields a PSPACE model checking algorithm and a realizability algorithm with doubly-exponential running time. Furthermore, we give tight upper and lower bounds on optimal parameter values for both problems. These results show that PLDL model checking and realizability are not harder than LTL model checking and realizability.
Quantum linear Boltzmann equation
International Nuclear Information System (INIS)
Vacchini, Bassano; Hornberger, Klaus
2009-01-01
We review the quantum version of the linear Boltzmann equation, which describes in a non-perturbative fashion, by means of scattering theory, how the quantum motion of a single test particle is affected by collisions with an ideal background gas. A heuristic derivation of this Lindblad master equation is presented, based on the requirement of translation-covariance and on the relation to the classical linear Boltzmann equation. After analyzing its general symmetry properties and the associated relaxation dynamics, we discuss a quantum Monte Carlo method for its numerical solution. We then review important limiting forms of the quantum linear Boltzmann equation, such as the case of quantum Brownian motion and pure collisional decoherence, as well as the application to matter wave optics. Finally, we point to the incorporation of quantum degeneracies and self-interactions in the gas by relating the equation to the dynamic structure factor of the ambient medium, and we provide an extension of the equation to include internal degrees of freedom.
International Nuclear Information System (INIS)
Emma, P.
1995-01-01
The Stanford Linear Collider (SLC) is the first and only high-energy e + e - linear collider in the world. Its most remarkable features are high intensity, submicron sized, polarized (e - ) beams at a single interaction point. The main challenges posed by these unique characteristics include machine-wide emittance preservation, consistent high intensity operation, polarized electron production and transport, and the achievement of a high degree of beam stability on all time scales. In addition to serving as an important machine for the study of Z 0 boson production and decay using polarized beams, the SLC is also an indispensable source of hands-on experience for future linear colliders. Each new year of operation has been highlighted with a marked improvement in performance. The most significant improvements for the 1994-95 run include new low impedance vacuum chambers for the damping rings, an upgrade to the optics and diagnostics of the final focus systems, and a higher degree of polarization from the electron source. As a result, the average luminosity has nearly doubled over the previous year with peaks approaching 10 30 cm -2 s -1 and an 80% electron polarization at the interaction point. These developments as well as the remaining identifiable performance limitations will be discussed
Linearity stabilizes discrete breathers
Indian Academy of Sciences (India)
themselves and with the boundaries leading to the eventual formation of an ... explored where these fascinating entities are being studied as, for example, ... Josephson-junction arrays, layered silicates, micromechanical cantilever ... velocities at late times (an expected result based on the Central Limit Theorem) and the.
Galaxy formation and evolution
Mo, Houjun; White, Simon
2010-01-01
The rapidly expanding field of galaxy formation lies at the interface between astronomy, particle physics, and cosmology. Covering diverse topics from these disciplines, all of which are needed to understand how galaxies form and evolve, this book is ideal for researchers entering the field. Individual chapters explore the evolution of the Universe as a whole and its particle and radiation content; linear and nonlinear growth of cosmic structure; processes affecting the gaseous and dark matter components of galaxies and their stellar populations; the formation of spiral and elliptical galaxies; central supermassive black holes and the activity associated with them; galaxy interactions; and the intergalactic medium. Emphasizing both observational and theoretical aspects, this book provides a coherent introduction for astronomers, cosmologists, and astroparticle physicists to the broad range of science underlying the formation and evolution of galaxies.
International Nuclear Information System (INIS)
Garbet, X.; Mourgues, F.; Samain, A.
1987-01-01
Among the various instabilities which could explain the anomalous electron heat transport observed in tokamaks during additional heating, a microtearing turbulence is a reasonable candidate since it affects directly the magnetic topology. This turbulence may be described in a proper frame rotating around the majors axis by a static potential vector. In strong non linear regimes, the flow of electrons along the stochastic field lines induces a current. The point is to know whether this current can sustain the turbulence. The mechanisms of this self-consistency, involving the combined effects of the thermal diamagnetism and of the electric drift are presented here
Wangler, Thomas P
2008-01-01
Thomas P. Wangler received his B.S. degree in physics from Michigan State University, and his Ph.D. degree in physics and astronomy from the University of Wisconsin. After postdoctoral appointments at the University of Wisconsin and Brookhaven National Laboratory, he joined the staff of Argonne National Laboratory in 1966, working in the fields of experimental high-energy physics and accelerator physics. He joined the Accelerator Technology Division at Los Alamos National Laboratory in 1979, where he specialized in high-current beam physics and linear accelerator design and technology. In 2007
International Nuclear Information System (INIS)
Richter, B.; Bell, R.A.; Brown, K.L.
1980-06-01
The SLAC LINEAR COLLIDER is designed to achieve an energy of 100 GeV in the electron-positron center-of-mass system by accelerating intense bunches of particles in the SLAC linac and transporting the electron and positron bunches in a special magnet system to a point where they are focused to a radius of about 2 microns and made to collide head on. The rationale for this new type of colliding beam system is discussed, the project is described, some of the novel accelerator physics issues involved are discussed, and some of the critical technical components are described
Lopez, Cesar
2014-01-01
MATLAB is a high-level language and environment for numerical computation, visualization, and programming. Using MATLAB, you can analyze data, develop algorithms, and create models and applications. The language, tools, and built-in math functions enable you to explore multiple approaches and reach a solution faster than with spreadsheets or traditional programming languages, such as C/C++ or Java. MATLAB Linear Algebra introduces you to the MATLAB language with practical hands-on instructions and results, allowing you to quickly achieve your goals. In addition to giving an introduction to
Special set linear algebra and special set fuzzy linear algebra
Kandasamy, W. B. Vasantha; Smarandache, Florentin; Ilanthenral, K.
2009-01-01
The authors in this book introduce the notion of special set linear algebra and special set fuzzy Linear algebra, which is an extension of the notion set linear algebra and set fuzzy linear algebra. These concepts are best suited in the application of multi expert models and cryptology. This book has five chapters. In chapter one the basic concepts about set linear algebra is given in order to make this book a self contained one. The notion of special set linear algebra and their fuzzy analog...
Energy Technology Data Exchange (ETDEWEB)
Munehiro, H
1980-05-29
When driving the carriage of a printer through a rotating motor, there are problems regarding the limited accuracy of the carriage position due to rotation or contraction and ageing of the cable. In order to solve the problem, a direct drive system was proposed, in which the printer carriage is driven by a linear motor. If one wants to keep the motor circuit of such a motor compact, then the magnetic flux density in the air gap must be reduced or the motor travel must be reduced. It is the purpose of this invention to create an electrodynamic linear motor, which on the one hand is compact and light and on the other hand has a relatively high constant force over a large travel. The invention is characterised by the fact that magnetic fields of alternating polarity are generated at equal intervals in the magnetic field, and that the coil arrangement has 2 adjacent coils, whose size corresponds to half the length of each magnetic pole. A logic circuit is provided to select one of the two coils and to determine the direction of the current depending on the signals of a magnetic field sensor on the coil arrangement.
International Nuclear Information System (INIS)
Kozarov, A.; Petrov, O.; Antonov, J.; Sotirova, S.; Petrova, B.
2006-01-01
The purpose of the linear wind-power generator described in this article is to decrease the following disadvantages of the common wind-powered turbine: 1) large bending and twisting moments to the blades and the shaft, especially when strong winds and turbulence exist; 2) significant values of the natural oscillation period of the construction result in the possibility of occurrence of destroying resonance oscillations; 3) high velocity of the peripheral parts of the rotor creating a danger for birds; 4) difficulties, connected with the installation and the operation on the mountain ridges and passages where the wind energy potential is the largest. The working surfaces of the generator in questions driven by the wind are not connected with a joint shaft but each moves along a railway track with few oscillations. So the sizes of each component are small and their number can be rather large. The mechanical trajectory is not a circle but a closed outline in a vertical plain, which consists of two rectilinear sectors, one above the other, connected in their ends by semi-circumferences. The mechanical energy of each component turns into electrical on the principle of the linear electrical generator. A regulation is provided when the direction of the wind is perpendicular to the route. A possibility of effectiveness is shown through aiming of additional quantities of air to the movable components by static barriers
Linearization of the Lorenz system
International Nuclear Information System (INIS)
Li, Chunbiao; Sprott, Julien Clinton; Thio, Wesley
2015-01-01
A partial and complete piecewise linearized version of the Lorenz system is proposed. The linearized versions have an independent total amplitude control parameter. Additional further linearization leads naturally to a piecewise linear version of the diffusionless Lorenz system. A chaotic circuit with a single amplitude controller is then implemented using a new switch element, producing a chaotic oscillation that agrees with the numerical calculation for the piecewise linear diffusionless Lorenz system. - Highlights: • A partial and complete piecewise linearized version of the Lorenz system are addressed. • The linearized versions have an independent total amplitude control parameter. • A piecewise linear version of the diffusionless Lorenz system is derived by further linearization. • A corresponding chaotic circuit without any multiplier is implemented for the chaotic oscillation
Topics in computational linear optimization
DEFF Research Database (Denmark)
Hultberg, Tim Helge
2000-01-01
Linear optimization has been an active area of research ever since the pioneering work of G. Dantzig more than 50 years ago. This research has produced a long sequence of practical as well as theoretical improvements of the solution techniques avilable for solving linear optimization problems...... of high quality solvers and the use of algebraic modelling systems to handle the communication between the modeller and the solver. This dissertation features four topics in computational linear optimization: A) automatic reformulation of mixed 0/1 linear programs, B) direct solution of sparse unsymmetric...... systems of linear equations, C) reduction of linear programs and D) integration of algebraic modelling of linear optimization problems in C++. Each of these topics is treated in a separate paper included in this dissertation. The efficiency of solving mixed 0-1 linear programs by linear programming based...
Linearization of the Lorenz system
Energy Technology Data Exchange (ETDEWEB)
Li, Chunbiao, E-mail: goontry@126.com [School of Electronic & Information Engineering, Nanjing University of Information Science & Technology, Nanjing 210044 (China); Engineering Technology Research and Development Center of Jiangsu Circulation Modernization Sensor Network, Jiangsu Institute of Commerce, Nanjing 211168 (China); Sprott, Julien Clinton [Department of Physics, University of Wisconsin–Madison, Madison, WI 53706 (United States); Thio, Wesley [Department of Electrical and Computer Engineering, The Ohio State University, Columbus, OH 43210 (United States)
2015-05-08
A partial and complete piecewise linearized version of the Lorenz system is proposed. The linearized versions have an independent total amplitude control parameter. Additional further linearization leads naturally to a piecewise linear version of the diffusionless Lorenz system. A chaotic circuit with a single amplitude controller is then implemented using a new switch element, producing a chaotic oscillation that agrees with the numerical calculation for the piecewise linear diffusionless Lorenz system. - Highlights: • A partial and complete piecewise linearized version of the Lorenz system are addressed. • The linearized versions have an independent total amplitude control parameter. • A piecewise linear version of the diffusionless Lorenz system is derived by further linearization. • A corresponding chaotic circuit without any multiplier is implemented for the chaotic oscillation.
On the linear programming bound for linear Lee codes.
Astola, Helena; Tabus, Ioan
2016-01-01
Based on an invariance-type property of the Lee-compositions of a linear Lee code, additional equality constraints can be introduced to the linear programming problem of linear Lee codes. In this paper, we formulate this property in terms of an action of the multiplicative group of the field [Formula: see text] on the set of Lee-compositions. We show some useful properties of certain sums of Lee-numbers, which are the eigenvalues of the Lee association scheme, appearing in the linear programming problem of linear Lee codes. Using the additional equality constraints, we formulate the linear programming problem of linear Lee codes in a very compact form, leading to a fast execution, which allows to efficiently compute the bounds for large parameter values of the linear codes.
Introduction to linear elasticity
Gould, Phillip L
2013-01-01
Introduction to Linear Elasticity, 3rd Edition, provides an applications-oriented grounding in the tensor-based theory of elasticity for students in mechanical, civil, aeronautical, and biomedical engineering, as well as materials and earth science. The book is distinct from the traditional text aimed at graduate students in solid mechanics by introducing the subject at a level appropriate for advanced undergraduate and beginning graduate students. The author's presentation allows students to apply the basic notions of stress analysis and move on to advanced work in continuum mechanics, plasticity, plate and shell theory, composite materials, viscoelasticity and finite method analysis. This book also: Emphasizes tensor-based approach while still distilling down to explicit notation Provides introduction to theory of plates, theory of shells, wave propagation, viscoelasticity and plasticity accessible to advanced undergraduate students Appropriate for courses following emerging trend of teaching solid mechan...
International Nuclear Information System (INIS)
Haniger, L.; Elger, R.; Kocandrle, L.; Zdebor, J.
1986-01-01
A linear step drive is described developed in Czechoslovak-Soviet cooperation and intended for driving WWER-1000 control rods. The functional principle is explained of the motor and the mechanical and electrical parts of the drive, power control, and the indicator of position are described. The motor has latches situated in the reactor at a distance of 3 m from magnetic armatures, it has a low structural height above the reactor cover, which suggests its suitability for seismic localities. Its magnetic circuits use counterpoles; the mechanical shocks at the completion of each step are damped using special design features. The position indicator is of a special design and evaluates motor position within ±1% of total travel. A drive diagram and the flow chart of both the control electronics and the position indicator are presented. (author) 4 figs
International Nuclear Information System (INIS)
Tjutju, R.L.
1977-01-01
Pulse amplifier is standard significant part of spectrometer. Apart from other type of amplification, it's a combination of amplification and pulse shaping. Because of its special purpose the device should fulfill the following : High resolution is desired to gain a high yield comparable to its actual state of condition. High signal to noise is desired to nhν resolution. High linearity to facilitate calibration. A good overload recovery, in order to the device will capable of analizing a low energy radiation which appear joinly on the high energy fields. Other expections of the device are its economical and practical use its extentive application. For that reason it's built on a standard NIM principle. Taking also into account the above mentioned considerations. High quality component parts are used throughout, while its availability in the domestic market is secured. (author)
International Nuclear Information System (INIS)
1976-01-01
This report covers the activity of the Linear Accelerator Laboratory during the period June 1974-June 1976. The activity of the Laboratory is essentially centered on high energy physics. The main activities were: experiments performed with the colliding rings (ACO), construction of the new colliding rings and beginning of the work at higher energy (DCI), bubble chamber experiments with the CERN PS neutrino beam, counter experiments with CERN's PS and setting-up of equipment for new experiments with CERN's SPS. During this period a project has also been prepared for an experiment with the new PETRA colliding ring at Hamburg. On the other hand, intense collaboration with the LURE Laboratory, using the electron synchrotron radiation emitted by ACO and DCI, has been developed [fr
Van Atta, C.M.; Beringer, R.; Smith, L.
1959-01-01
A linear accelerator of heavy ions is described. The basic contributions of the invention consist of a method and apparatus for obtaining high energy particles of an element with an increased charge-to-mass ratio. The method comprises the steps of ionizing the atoms of an element, accelerating the resultant ions to an energy substantially equal to one Mev per nucleon, stripping orbital electrons from the accelerated ions by passing the ions through a curtain of elemental vapor disposed transversely of the path of the ions to provide a second charge-to-mass ratio, and finally accelerating the resultant stripped ions to a final energy of at least ten Mev per nucleon.
Tip, A.
1998-06-01
Starting from Maxwell's equations for a linear, nonconducting, absorptive, and dispersive medium, characterized by the constitutive equations D(x,t)=ɛ1(x)E(x,t)+∫t-∞dsχ(x,t-s)E(x,s) and H(x,t)=B(x,t), a unitary time evolution and canonical formalism is obtained. Given the complex, coordinate, and frequency-dependent, electric permeability ɛ(x,ω), no further assumptions are made. The procedure leads to a proper definition of band gaps in the periodic case and a new continuity equation for energy flow. An S-matrix formalism for scattering from lossy objects is presented in full detail. A quantized version of the formalism is derived and applied to the generation of Čerenkov and transition radiation as well as atomic decay. The last case suggests a useful generalization of the density of states to the absorptive situation.
Computer Program For Linear Algebra
Krogh, F. T.; Hanson, R. J.
1987-01-01
Collection of routines provided for basic vector operations. Basic Linear Algebra Subprogram (BLAS) library is collection from FORTRAN-callable routines for employing standard techniques to perform basic operations of numerical linear algebra.
Quaternion Linear Canonical Transform Application
Bahri, Mawardi
2015-01-01
Quaternion linear canonical transform (QLCT) is a generalization of the classical linear canonical transfom (LCT) using quaternion algebra. The focus of this paper is to introduce an application of the QLCT to study of generalized swept-frequency filter
Recursive Algorithm For Linear Regression
Varanasi, S. V.
1988-01-01
Order of model determined easily. Linear-regression algorithhm includes recursive equations for coefficients of model of increased order. Algorithm eliminates duplicative calculations, facilitates search for minimum order of linear-regression model fitting set of data satisfactory.
Dynamical systems and linear algebra
Colonius, Fritz (Prof.)
2007-01-01
Dynamical systems and linear algebra / F. Colonius, W. Kliemann. - In: Handbook of linear algebra / ed. by Leslie Hogben. - Boca Raton : Chapman & Hall/CRC, 2007. - S. 56,1-56,22. - (Discrete mathematics and its applications)
Linear spaces: history and theory
Albrecht Beutelspracher
1990-01-01
Linear spaces belong to the most fundamental geometric and combinatorial structures. In this paper I would like to give an onerview about the theory of embedding finite linear spaces in finite projective planes.
Linear versus non-linear supersymmetry, in general
Energy Technology Data Exchange (ETDEWEB)
Ferrara, Sergio [Theoretical Physics Department, CERN,CH-1211 Geneva 23 (Switzerland); INFN - Laboratori Nazionali di Frascati,Via Enrico Fermi 40, I-00044 Frascati (Italy); Department of Physics and Astronomy, UniversityC.L.A.,Los Angeles, CA 90095-1547 (United States); Kallosh, Renata [SITP and Department of Physics, Stanford University,Stanford, California 94305 (United States); Proeyen, Antoine Van [Institute for Theoretical Physics, Katholieke Universiteit Leuven,Celestijnenlaan 200D, B-3001 Leuven (Belgium); Wrase, Timm [Institute for Theoretical Physics, Technische Universität Wien,Wiedner Hauptstr. 8-10, A-1040 Vienna (Austria)
2016-04-12
We study superconformal and supergravity models with constrained superfields. The underlying version of such models with all unconstrained superfields and linearly realized supersymmetry is presented here, in addition to the physical multiplets there are Lagrange multiplier (LM) superfields. Once the equations of motion for the LM superfields are solved, some of the physical superfields become constrained. The linear supersymmetry of the original models becomes non-linearly realized, its exact form can be deduced from the original linear supersymmetry. Known examples of constrained superfields are shown to require the following LM’s: chiral superfields, linear superfields, general complex superfields, some of them are multiplets with a spin.
Linear versus non-linear supersymmetry, in general
International Nuclear Information System (INIS)
Ferrara, Sergio; Kallosh, Renata; Proeyen, Antoine Van; Wrase, Timm
2016-01-01
We study superconformal and supergravity models with constrained superfields. The underlying version of such models with all unconstrained superfields and linearly realized supersymmetry is presented here, in addition to the physical multiplets there are Lagrange multiplier (LM) superfields. Once the equations of motion for the LM superfields are solved, some of the physical superfields become constrained. The linear supersymmetry of the original models becomes non-linearly realized, its exact form can be deduced from the original linear supersymmetry. Known examples of constrained superfields are shown to require the following LM’s: chiral superfields, linear superfields, general complex superfields, some of them are multiplets with a spin.
Monahan, John F
2008-01-01
Preface Examples of the General Linear Model Introduction One-Sample Problem Simple Linear Regression Multiple Regression One-Way ANOVA First Discussion The Two-Way Nested Model Two-Way Crossed Model Analysis of Covariance Autoregression Discussion The Linear Least Squares Problem The Normal Equations The Geometry of Least Squares Reparameterization Gram-Schmidt Orthonormalization Estimability and Least Squares Estimators Assumptions for the Linear Mean Model Confounding, Identifiability, and Estimability Estimability and Least Squares Estimators F
Fassott, G.; Henseler, Jörg; Cooper, C.; Lee, N.; Farrell, A.
2015-01-01
When using measurement models with multiple indicators, researchers need to decide about the epistemic relationship between the latent variable and its indicators. In this article, we describe the nature, the estimation, the characteristics, and the validity assessment of formative measurement
Templates for Linear Algebra Problems
Bai, Z.; Day, D.; Demmel, J.; Dongarra, J.; Gu, M.; Ruhe, A.; Vorst, H.A. van der
1995-01-01
The increasing availability of advanced-architecture computers is having a very signicant eect on all spheres of scientic computation, including algorithm research and software development in numerical linear algebra. Linear algebra {in particular, the solution of linear systems of equations and
Linearization of CIF through SOS
Nadales Agut, D.E.; Reniers, M.A.; Luttik, B.; Valencia, F.
2011-01-01
Linearization is the procedure of rewriting a process term into a linear form, which consist only of basic operators of the process language. This procedure is interesting both from a theoretical and a practical point of view. In particular, a linearization algorithm is needed for the Compositional
DEFF Research Database (Denmark)
Engberg, Uffe Henrik; Winskel, Glynn
This article shows how individual Petri nets form models of Girard's intuitionistic linear logic. It explores questions of expressiveness and completeness of linear logic with respect to this interpretation. An aim is to use Petri nets to give an understanding of linear logic and give some apprai...
International Nuclear Information System (INIS)
Richards, J.A.
1977-01-01
A linear particle accelerator which provides a pulsed beam of charged particles of uniform energy is described. The accelerator is in the form of an evacuated dielectric tube, inside of which a particle source is located at one end of the tube, with a target or window located at the other end of the dielectric tube. Along the length of the tube are externally located pairs of metal plates, each insulated from each other in an insulated housing. Each of the plates of a pair are connected to an electrical source of voltage of opposed polarity, with the polarity of the voltage of the plates oriented so that the plate of a pair, nearer to the particle source, is of the opposed polarity to the charge of the particle emitted by the source. Thus, a first plate about the tube located nearest the particle source, attracts a particle which as it passes through the tube past the first plate is then repelled by the reverse polarity of the second plate of the pair to continue moving towards the target
Generalized Linear Covariance Analysis
Carpenter, James R.; Markley, F. Landis
2014-01-01
This talk presents a comprehensive approach to filter modeling for generalized covariance analysis of both batch least-squares and sequential estimators. We review and extend in two directions the results of prior work that allowed for partitioning of the state space into solve-for'' and consider'' parameters, accounted for differences between the formal values and the true values of the measurement noise, process noise, and textita priori solve-for and consider covariances, and explicitly partitioned the errors into subspaces containing only the influence of the measurement noise, process noise, and solve-for and consider covariances. In this work, we explicitly add sensitivity analysis to this prior work, and relax an implicit assumption that the batch estimator's epoch time occurs prior to the definitive span. We also apply the method to an integrated orbit and attitude problem, in which gyro and accelerometer errors, though not estimated, influence the orbit determination performance. We illustrate our results using two graphical presentations, which we call the variance sandpile'' and the sensitivity mosaic,'' and we compare the linear covariance results to confidence intervals associated with ensemble statistics from a Monte Carlo analysis.
Equipartitioning in linear accelerators
International Nuclear Information System (INIS)
Jameson, R.A.
1982-01-01
Emittance growth has long been a concern in linear accelerators, as has the idea that some kind of energy balance, or equipartitioning, between the degrees of freedom, would ameliorate the growth. M. Prome observed that the average transverse and longitudinal velocity spreads tend to equalize as current in the channel is increased, while the sum of the energy in the system stays nearly constant. However, only recently have we shown that an equipartitioning requirement on a bunched injected beam can indeed produce remarkably small emittance growth. The simple set of equations leading to this condition are outlined. At the same time, Hofmann has investigated collective instabilities in transported beams and has identified thresholds and regions in parameter space where instabilities occur. Evidence is presented that shows transport system boundaries to be quite accurate in computer simulations of accelerating systems. Discussed are preliminary results of efforts to design accelerators that avoid parameter regions where emittance is affected by the instabilities identified by Hofmann. These efforts suggest that other mechanisms are present. The complicated behavior of the RFQ linac in this framework also is shown
Equipartitioning in linear accelerators
International Nuclear Information System (INIS)
Jameson, R.A.
1981-01-01
Emittance growth has long been a concern in linear accelerators, as has the idea that some kind of energy balance, or equipartitioning, between the degrees of freedom, would ameliorate the growth. M. Prome observed that the average transverse and longitudinal velocity spreads tend to equalize as current in the channel is increased, while the sum of the energy in the system stays nearly constant. However, only recently have we shown that an equipartitioning requirement on a bunched injected beam can indeed produce remarkably small emittance growth. The simple set of equations leading to this condition are outlined below. At the same time, Hofmann, using powerful analytical and computational methods, has investigated collective instabilities in transported beams and has identified thresholds and regions in parameter space where instabilities occur. This is an important generalization. Work that he will present at this conference shows that the results are essentially the same in r-z coordinates for transport systems, and evidence is presented that shows transport system boundaries to be quite accurate in computer simulations of accelerating systems also. Discussed are preliminary results of efforts to design accelerators that avoid parameter regions where emittance is affected by the instabilities identified by Hofmann. These efforts suggest that other mechanisms are present. The complicated behavior of the RFQ linac in this framework also is shown
International Nuclear Information System (INIS)
Briggs, R.J.
1986-06-01
The development of linear induction accelerators has been motivated by applications requiring high-pulsed currents of charged particles at voltages exceeding the capability of single-stage, diode-type accelerators and at currents too high for rf accelerators. In principle, one can accelerate charged particles to arbitrarily high voltages using a multi-stage induction machine, but the 50-MeV, 10-kA Advanced Test Accelerator (ATA) at LLNL is the highest voltage machine in existence at this time. The advent of magnetic pulse power systems makes sustained operation at high-repetition rates practical, and this capability for high-average power is very likely to open up many new applications of induction machines in the future. This paper surveys the US induction linac technology with primary emphasis on electron machines. A simplified description of how induction machines couple energy to the electron beam is given, to illustrate many of the general issues that bound the design space of induction linacs
Berkeley Proton Linear Accelerator
Alvarez, L. W.; Bradner, H.; Franck, J.; Gordon, H.; Gow, J. D.; Marshall, L. C.; Oppenheimer, F. F.; Panofsky, W. K. H.; Richman, C.; Woodyard, J. R.
1953-10-13
A linear accelerator, which increases the energy of protons from a 4 Mev Van de Graaff injector, to a final energy of 31.5 Mev, has been constructed. The accelerator consists of a cavity 40 feet long and 39 inches in diameter, excited at resonance in a longitudinal electric mode with a radio-frequency power of about 2.2 x 10{sup 6} watts peak at 202.5 mc. Acceleration is made possible by the introduction of 46 axial "drift tubes" into the cavity, which is designed such that the particles traverse the distance between the centers of successive tubes in one cycle of the r.f. power. The protons are longitudinally stable as in the synchrotron, and are stabilized transversely by the action of converging fields produced by focusing grids. The electrical cavity is constructed like an inverted airplane fuselage and is supported in a vacuum tank. Power is supplied by 9 high powered oscillators fed from a pulse generator of the artificial transmission line type.
Random linear codes in steganography
Directory of Open Access Journals (Sweden)
Kamil Kaczyński
2016-12-01
Full Text Available Syndrome coding using linear codes is a technique that allows improvement in the steganographic algorithms parameters. The use of random linear codes gives a great flexibility in choosing the parameters of the linear code. In parallel, it offers easy generation of parity check matrix. In this paper, the modification of LSB algorithm is presented. A random linear code [8, 2] was used as a base for algorithm modification. The implementation of the proposed algorithm, along with practical evaluation of algorithms’ parameters based on the test images was made.[b]Keywords:[/b] steganography, random linear codes, RLC, LSB
Rf system specifications for a linear accelerator
International Nuclear Information System (INIS)
Young, A.; Eaton, L.E.
1992-01-01
A linear accelerator contains many systems; however, the most complex and costly is the RF system. The goal of an RF system is usually simply stated as maintaining the phase and amplitude of the RF signal within a given tolerance to accelerate the charged particle beam. An RF system that drives a linear accelerator needs a complete system specification, which should contain specifications for all the subsystems (i.e., high-power RF, low-level RF, RF generation/distribution, and automation control). This paper defines a format for the specifications of these subsystems and discusses each RF subsystem independently to provide a comprehensive understanding of the function of each subsystem. This paper concludes with an example of a specification spreadsheet allowing one to input the specifications of a subsystem. Thus, some fundamental parameters (i.e., the cost and size) of the RF system can be determined
Linear Algebraic Method for Non-Linear Map Analysis
International Nuclear Information System (INIS)
Yu, L.; Nash, B.
2009-01-01
We present a newly developed method to analyze some non-linear dynamics problems such as the Henon map using a matrix analysis method from linear algebra. Choosing the Henon map as an example, we analyze the spectral structure, the tune-amplitude dependence, the variation of tune and amplitude during the particle motion, etc., using the method of Jordan decomposition which is widely used in conventional linear algebra.
DEFF Research Database (Denmark)
Telschow, Samira; Jappe Frandsen, Flemming; Theisen, Kirsten
2012-01-01
Cement production has been subject to several technological changes, each of which requires detailed knowledge about the high multiplicity of processes, especially the high temperature process involved in the rotary kiln. This article gives an introduction to the topic of cement, including...... an overview of cement production, selected cement properties, and clinker phase relations. An extended summary of laboratory-scale investigations on clinkerization reactions, the most important reactions in cement production, is provided. Clinker formations by solid state reactions, solid−liquid and liquid......−liquid reactions are discussed, as are the influences of particles sizes on clinker phase formation. Furthermore, a mechanism for clinker phase formation in an industrial rotary kiln reactor is outlined....
International Nuclear Information System (INIS)
Woodward, P.R.
1978-01-01
Theoretical models of star formation are discussed beginning with the earliest stages and ending in the formation of rotating, self-gravitating disks or rings. First a model of the implosion of very diffuse gas clouds is presented which relies upon a shock at the edge of a galactic spiral arm to drive the implosion. Second, models are presented for the formation of a second generation of massive stars in such a cloud once a first generation has formed. These models rely on the ionizing radiation from massive stars or on the supernova shocks produced when these stars explode. Finally, calculations of the gravitational collapse of rotating clouds are discussed with special focus on the question of whether rotating disks or rings are the result of such a collapse. 65 references
DEFF Research Database (Denmark)
Sparre, Martin
Galaxy formation is an enormously complex discipline due to the many physical processes that play a role in shaping galaxies. The objective of this thesis is to study galaxy formation with two different approaches: First, numerical simulations are used to study the structure of dark matter and how...... galaxies form stars throughout the history of the Universe, and secondly it is shown that observations of gamma-ray bursts (GRBs) can be used to probe galaxies with active star formation in the early Universe. A conclusion from the hydrodynamical simulations is that the galaxies from the stateof...... is important, since it helps constraining chemical evolution models at high redshift. A new project studying how the population of galaxies hosting GRBs relate to other galaxy population is outlined in the conclusion of this thesis. The core of this project will be to quantify how the stellar mass function...
Blum, J.
2014-07-01
There has been vast progress in our understanding of planetesimal formation over the past decades, owing to a number of laboratory experiments as well as to refined models of dust and ice agglomeration in protoplanetary disks. Coagulation rapidly forms cm-sized ''pebbles'' by direct sticking in collisions at low velocities (Güttler et al. 2010; Zsom et al. 2010). For the further growth, two model approaches are currently being discussed: (1) Local concentration of pebbles in nebular instabilities until gravitational instability occurs (Johansen et al. 2007). (2) A competition between fragmentation and mass transfer in collisions among the dusty bodies, in which a few ''lucky winners'' make it to planetesimal sizes (Windmark et al. 2012a,b; Garaud et al. 2013). Predictions of the physical properties of the resulting bodies in both models allow a distinction of the two formation scenarios of planetesimals. In particular, the tensile strength (i.e, the inner cohesion) of the planetesimals differ widely between the two models (Skorov & Blum 2012; Blum et al. 2014). While model (1) predicts tensile strengths on the order of ˜ 1 Pa, model (2) results in rather compactified dusty bodies with tensile strengths in the kPa regime. If comets are km-sized survivors of the planetesimal-formation era, they should in principle hold the secret of their formation process. Water ice is the prime volatile responsible for the activity of comets. Thermophysical models of the heat and mass transport close to the comet-nucleus surface predict water-ice sublimation temperatures that relate to maximum sublimation pressures well below the kPa regime predicted for formation scenario (2). Model (1), however, is in agreement with the observed dust and gas activity of comets. Thus, a formation scenario for cometesimals involving gravitational instability is favored (Blum et al. 2014).
Kamonsutthipaijit, Nuntaporn
2017-01-01
Three different types of template-directed syntheses of linear porphyrin oligomers are presented. In the classical approach the product has the same number of binding sites as the template, whereas in Vernier reactions the product has the lowest common multiple of the numbers of binding sites in the template and the building block. Mutual Vernier templating is like Vernier templating except that both strands of the Vernier complex undergo coupling simultaneously, so that it becomes impossible to say which is the ‘template’ and which is the ‘building block’. The template-directed synthesis of monodisperse linear oligomers is more difficult than that of cyclic oligomers, because the products of linear templating have reactive ends. All three types of templating are demonstrated here, and used to prepare a nickel(ii) porphyrin dodecamer with 4-pyridyl substituents on all twelve porphyrin units. The stabilities and cooperativities of the double-strand complexes involved in these reactions were investigated by UV-vis-NIR titration. The four-rung ladder duplex has a stability constant of about 2 × 1018 M–1 in dichloromethane at 298 K. PMID:28553508
Chlorination and chloramines formation
International Nuclear Information System (INIS)
Yee, Lim Fang; Mohd Pauzi Abdullah; Sadia Ata; Abbas Abdullah; Basar IShak; Khairul Nidzham
2008-01-01
Chlorination is the most important method of disinfection in Malaysia which aims at ensuring an acceptable and safe drinking water quality. The dosing of chlorine to surface water containing ammonia and nitrogen compounds may form chloramines in the treated water. During this reaction, inorganic and organic chloramines are formed. The recommended maximum acceptable concentration (MAC) for chloramines in drinking water is 3000 μg/L. The production of monochloramine, dichloramine and trichloramine is highly dependent upon pH, contact time and the chlorine to ammonia molar ratio. The purpose of this study is to examine the formation of chloramines that occur upon the chlorination during the treatment process. Chloramines were determined using the N,N-diethyl-p-phenylenediamine (DPD) colorimetric method. The influences of ammonia, pH and chlorine dosage on the chloramines formation were also studied. This paper presents a modeling approach based on regression analysis which is designed to estimate the formation of chloramines. The correlation between the concentration of chloramines and the ammonia, pH and chlorine dosage was examined. In all cases, the quantity of chloramines formed depended linearly upon the amount of chlorine dosage. On the basis of this study it reveals that the concentration of chloramines is a function of chlorine dosage and the ammonia concentration to the chlorination process. PH seems to not significantly affect the formation of chloramines. (author)
Linear Programming and Network Flows
Bazaraa, Mokhtar S; Sherali, Hanif D
2011-01-01
The authoritative guide to modeling and solving complex problems with linear programming-extensively revised, expanded, and updated The only book to treat both linear programming techniques and network flows under one cover, Linear Programming and Network Flows, Fourth Edition has been completely updated with the latest developments on the topic. This new edition continues to successfully emphasize modeling concepts, the design and analysis of algorithms, and implementation strategies for problems in a variety of fields, including industrial engineering, management science, operations research
Elementary linear programming with applications
Kolman, Bernard
1995-01-01
Linear programming finds the least expensive way to meet given needs with available resources. Its results are used in every area of engineering and commerce: agriculture, oil refining, banking, and air transport. Authors Kolman and Beck present the basic notions of linear programming and illustrate how they are used to solve important common problems. The software on the included disk leads students step-by-step through the calculations. The Second Edition is completely revised and provides additional review material on linear algebra as well as complete coverage of elementary linear program
Hood, John Linsley
2013-01-01
The Art of Linear Electronics presents the principal aspects of linear electronics and techniques in linear electronic circuit design. The book provides a wide range of information on the elucidation of the methods and techniques in the design of linear electronic circuits. The text discusses such topics as electronic component symbols and circuit drawing; passive and active semiconductor components; DC and low frequency amplifiers; and the basic effects of feedback. Subjects on frequency response modifying circuits and filters; audio amplifiers; low frequency oscillators and waveform generato
Linearity and Non-linearity of Photorefractive effect in Materials ...
African Journals Online (AJOL)
Linearity and Non-linearity of Photorefractive effect in Materials using the Band transport ... For low light beam intensities the change in the refractive index is ... field is spatially phase shifted by /2 relative to the interference fringe pattern, which ...
The linear programming bound for binary linear codes
Brouwer, A.E.
1993-01-01
Combining Delsarte's (1973) linear programming bound with the information that certain weights cannot occur, new upper bounds for dmin (n,k), the maximum possible minimum distance of a binary linear code with given word length n and dimension k, are derived.
Linear operator inequalities for strongly stable weakly regular linear systems
Curtain, RF
2001-01-01
We consider the question of the existence of solutions to certain linear operator inequalities (Lur'e equations) for strongly stable, weakly regular linear systems with generating operators A, B, C, 0. These operator inequalities are related to the spectral factorization of an associated Popov
Linear and non-linear optics of condensed matter
International Nuclear Information System (INIS)
McLean, T.P.
1977-01-01
Part I - Linear optics: 1. General introduction. 2. Frequency dependence of epsilon(ω, k vector). 3. Wave-vector dependence of epsilon(ω, k vector). 4. Tensor character of epsilon(ω, k vector). Part II - Non-linear optics: 5. Introduction. 6. A classical theory of non-linear response in one dimension. 7. The generalization to three dimensions. 8. General properties of the polarizability tensors. 9. The phase-matching condition. 10. Propagation in a non-linear dielectric. 11. Second harmonic generation. 12. Coupling of three waves. 13. Materials and their non-linearities. 14. Processes involving energy exchange with the medium. 15. Two-photon absorption. 16. Stimulated Raman effect. 17. Electro-optic effects. 18. Limitations of the approach presented here. (author)
Advanced statistics: linear regression, part I: simple linear regression.
Marill, Keith A
2004-01-01
Simple linear regression is a mathematical technique used to model the relationship between a single independent predictor variable and a single dependent outcome variable. In this, the first of a two-part series exploring concepts in linear regression analysis, the four fundamental assumptions and the mechanics of simple linear regression are reviewed. The most common technique used to derive the regression line, the method of least squares, is described. The reader will be acquainted with other important concepts in simple linear regression, including: variable transformations, dummy variables, relationship to inference testing, and leverage. Simplified clinical examples with small datasets and graphic models are used to illustrate the points. This will provide a foundation for the second article in this series: a discussion of multiple linear regression, in which there are multiple predictor variables.
Directory of Open Access Journals (Sweden)
Crasmareanu Mircea
2017-12-01
Full Text Available We consider the paracomplex version of the notion of mixed linear spaces introduced by M. Jurchescu in [4] by replacing the complex unit i with the paracomplex unit j, j2 = 1. The linear algebra of these spaces is studied with a special view towards their morphisms.
Linear Algebra and Image Processing
Allali, Mohamed
2010-01-01
We use the computing technology digital image processing (DIP) to enhance the teaching of linear algebra so as to make the course more visual and interesting. Certainly, this visual approach by using technology to link linear algebra to DIP is interesting and unexpected to both students as well as many faculty. (Contains 2 tables and 11 figures.)
Efficient Searching with Linear Constraints
DEFF Research Database (Denmark)
Agarwal, Pankaj K.; Arge, Lars Allan; Erickson, Jeff
2000-01-01
We show how to preprocess a set S of points in d into an external memory data structure that efficiently supports linear-constraint queries. Each query is in the form of a linear constraint xd a0+∑d−1i=1 aixi; the data structure must report all the points of S that satisfy the constraint. This pr...
Johnson, Bruce G.; Gerver, Michael J.; Hawkey, Timothy J.; Fenn, Ralph C.
1993-01-01
Improved linear actuator comprises air slide and linear electric motor. Unit exhibits low friction, low backlash, and more nearly even acceleration. Used in machinery in which positions, velocities, and accelerations must be carefully controlled and/or vibrations must be suppressed.
Linear morphoea follows Blaschko's lines.
Weibel, L; Harper, J I
2008-07-01
The aetiology of morphoea (or localized scleroderma) remains unknown. It has previously been suggested that lesions of linear morphoea may follow Blaschko's lines and thus reflect an embryological development. However, the distribution of linear morphoea has never been accurately evaluated. We aimed to identify common patterns of clinical presentation in children with linear morphoea and to establish whether linear morphoea follows the lines of Blaschko. A retrospective chart review of 65 children with linear morphoea was performed. According to clinical photographs the skin lesions of these patients were plotted on to standardized head and body charts. With the aid of Adobe Illustrator a final figure was produced including an overlay of all individual lesions which was used for comparison with the published lines of Blaschko. Thirty-four (53%) patients had the en coup de sabre subtype, 27 (41%) presented with linear morphoea on the trunk and/or limbs and four (6%) children had a combination of the two. In 55 (85%) children the skin lesions were confined to one side of the body, showing no preference for either left or right side. On comparing the overlays of all body and head lesions with the original lines of Blaschko there was an excellent correlation. Our data indicate that linear morphoea follows the lines of Blaschko. We hypothesize that in patients with linear morphoea susceptible cells are present in a mosaic state and that exposure to some trigger factor may result in the development of this condition.
Campagnoli, Patrizia; Petris, Giovanni
2009-01-01
State space models have gained tremendous popularity in as disparate fields as engineering, economics, genetics and ecology. Introducing general state space models, this book focuses on dynamic linear models, emphasizing their Bayesian analysis. It illustrates the fundamental steps needed to use dynamic linear models in practice, using R package.
Linear Programming across the Curriculum
Yoder, S. Elizabeth; Kurz, M. Elizabeth
2015-01-01
Linear programming (LP) is taught in different departments across college campuses with engineering and management curricula. Modeling an LP problem is taught in every linear programming class. As faculty teaching in Engineering and Management departments, the depth to which teachers should expect students to master this particular type of…
Introduction to RF linear accelerators
International Nuclear Information System (INIS)
Weiss, M.
1994-01-01
The basic features of RF linear accelerators are described. The concept of the 'loaded cavity', essential for the synchronism wave-particle, is introduced, and formulae describing the action of electromagnetic fields on the beam are given. The treatment of intense beams is mentioned, and various existing linear accelerators are presented as examples. (orig.)
Spatial Processes in Linear Ordering
von Hecker, Ulrich; Klauer, Karl Christoph; Wolf, Lukas; Fazilat-Pour, Masoud
2016-01-01
Memory performance in linear order reasoning tasks (A > B, B > C, C > D, etc.) shows quicker, and more accurate responses to queries on wider (AD) than narrower (AB) pairs on a hypothetical linear mental model (A -- B -- C -- D). While indicative of an analogue representation, research so far did not provide positive evidence for spatial…
DEFF Research Database (Denmark)
Andersen, O. Krogh
1975-01-01
of Korringa-Kohn-Rostoker, linear-combination-of-atomic-orbitals, and cellular methods; the secular matrix is linear in energy, the overlap integrals factorize as potential parameters and structure constants, the latter are canonical in the sense that they neither depend on the energy nor the cell volume...
Introduction to generalized linear models
Dobson, Annette J
2008-01-01
Introduction Background Scope Notation Distributions Related to the Normal Distribution Quadratic Forms Estimation Model Fitting Introduction Examples Some Principles of Statistical Modeling Notation and Coding for Explanatory Variables Exponential Family and Generalized Linear Models Introduction Exponential Family of Distributions Properties of Distributions in the Exponential Family Generalized Linear Models Examples Estimation Introduction Example: Failure Times for Pressure Vessels Maximum Likelihood Estimation Poisson Regression Example Inference Introduction Sampling Distribution for Score Statistics Taylor Series Approximations Sampling Distribution for MLEs Log-Likelihood Ratio Statistic Sampling Distribution for the Deviance Hypothesis Testing Normal Linear Models Introduction Basic Results Multiple Linear Regression Analysis of Variance Analysis of Covariance General Linear Models Binary Variables and Logistic Regression Probability Distributions ...
Acoustic emission linear pulse holography
International Nuclear Information System (INIS)
Collins, H.D.; Busse, L.J.; Lemon, D.K.
1983-01-01
This paper describes the emission linear pulse holography which produces a chronological linear holographic image of a flaw by utilizing the acoustic energy emitted during crack growth. A thirty two point sampling array is used to construct phase-only linear holograms of simulated acoustic emission sources on large metal plates. The concept behind the AE linear pulse holography is illustrated, and a block diagram of a data acquisition system to implement the concept is given. Array element spacing, synthetic frequency criteria, and lateral depth resolution are specified. A reference timing transducer positioned between the array and the inspection zone and which inititates the time-of-flight measurements is described. The results graphically illustrate the technique using a one-dimensional FFT computer algorithm (ie. linear backward wave) for an AE image reconstruction
Linear and Generalized Linear Mixed Models and Their Applications
Jiang, Jiming
2007-01-01
This book covers two major classes of mixed effects models, linear mixed models and generalized linear mixed models, and it presents an up-to-date account of theory and methods in analysis of these models as well as their applications in various fields. The book offers a systematic approach to inference about non-Gaussian linear mixed models. Furthermore, it has included recently developed methods, such as mixed model diagnostics, mixed model selection, and jackknife method in the context of mixed models. The book is aimed at students, researchers and other practitioners who are interested
Robust Decentralized Formation Flight Control
Directory of Open Access Journals (Sweden)
Zhao Weihua
2011-01-01
Full Text Available Motivated by the idea of multiplexed model predictive control (MMPC, this paper introduces a new framework for unmanned aerial vehicles (UAVs formation flight and coordination. Formulated using MMPC approach, the whole centralized formation flight system is considered as a linear periodic system with control inputs of each UAV subsystem as its periodic inputs. Divided into decentralized subsystems, the whole formation flight system is guaranteed stable if proper terminal cost and terminal constraints are added to each decentralized MPC formulation of the UAV subsystem. The decentralized robust MPC formulation for each UAV subsystem with bounded input disturbances and model uncertainties is also presented. Furthermore, an obstacle avoidance control scheme for any shape and size of obstacles, including the nonapriorily known ones, is integrated under the unified MPC framework. The results from simulations demonstrate that the proposed framework can successfully achieve robust collision-free formation flights.
Ferencz, Donald C.; Viterna, Larry A.
1991-01-01
ALPS is a computer program which can be used to solve general linear program (optimization) problems. ALPS was designed for those who have minimal linear programming (LP) knowledge and features a menu-driven scheme to guide the user through the process of creating and solving LP formulations. Once created, the problems can be edited and stored in standard DOS ASCII files to provide portability to various word processors or even other linear programming packages. Unlike many math-oriented LP solvers, ALPS contains an LP parser that reads through the LP formulation and reports several types of errors to the user. ALPS provides a large amount of solution data which is often useful in problem solving. In addition to pure linear programs, ALPS can solve for integer, mixed integer, and binary type problems. Pure linear programs are solved with the revised simplex method. Integer or mixed integer programs are solved initially with the revised simplex, and the completed using the branch-and-bound technique. Binary programs are solved with the method of implicit enumeration. This manual describes how to use ALPS to create, edit, and solve linear programming problems. Instructions for installing ALPS on a PC compatible computer are included in the appendices along with a general introduction to linear programming. A programmers guide is also included for assistance in modifying and maintaining the program.
Linear and quasi-linear equations of parabolic type
Ladyženskaja, O A; Ural′ceva, N N; Uralceva, N N
1968-01-01
Equations of parabolic type are encountered in many areas of mathematics and mathematical physics, and those encountered most frequently are linear and quasi-linear parabolic equations of the second order. In this volume, boundary value problems for such equations are studied from two points of view: solvability, unique or otherwise, and the effect of smoothness properties of the functions entering the initial and boundary conditions on the smoothness of the solutions.
Mathematical modelling and linear stability analysis of laser fusion cutting
International Nuclear Information System (INIS)
Hermanns, Torsten; Schulz, Wolfgang; Vossen, Georg; Thombansen, Ulrich
2016-01-01
A model for laser fusion cutting is presented and investigated by linear stability analysis in order to study the tendency for dynamic behavior and subsequent ripple formation. The result is a so called stability function that describes the correlation of the setting values of the process and the process’ amount of dynamic behavior.
Planning Student Flow with Linear Programming: A Tunisian Case Study.
Bezeau, Lawrence
A student flow model in linear programming format, designed to plan the movement of students into secondary and university programs in Tunisia, is described. The purpose of the plan is to determine a sufficient number of graduating students that would flow back into the system as teachers or move into the labor market to meet fixed manpower…
Mathematical modelling and linear stability analysis of laser fusion cutting
Energy Technology Data Exchange (ETDEWEB)
Hermanns, Torsten; Schulz, Wolfgang [RWTH Aachen University, Chair for Nonlinear Dynamics, Steinbachstr. 15, 52047 Aachen (Germany); Vossen, Georg [Niederrhein University of Applied Sciences, Chair for Applied Mathematics and Numerical Simulations, Reinarzstr.. 49, 47805 Krefeld (Germany); Thombansen, Ulrich [RWTH Aachen University, Chair for Laser Technology, Steinbachstr. 15, 52047 Aachen (Germany)
2016-06-08
A model for laser fusion cutting is presented and investigated by linear stability analysis in order to study the tendency for dynamic behavior and subsequent ripple formation. The result is a so called stability function that describes the correlation of the setting values of the process and the process’ amount of dynamic behavior.
State Space Reduction of Linear Processes using Control Flow Reconstruction
van de Pol, Jan Cornelis; Timmer, Mark
2009-01-01
We present a new method for fighting the state space explosion of process algebraic specifications, by performing static analysis on an intermediate format: linear process equations (LPEs). Our method consists of two steps: (1) we reconstruct the LPE's control flow, detecting control flow parameters
State Space Reduction of Linear Processes Using Control Flow Reconstruction
van de Pol, Jan Cornelis; Timmer, Mark; Liu, Zhiming; Ravn, Anders P.
2009-01-01
We present a new method for fighting the state space explosion of process algebraic specifications, by performing static analysis on an intermediate format: linear process equations (LPEs). Our method consists of two steps: (1) we reconstruct the LPE's control flow, detecting control flow parameters
Canonical structure of evolution equations with non-linear ...
Indian Academy of Sciences (India)
The dispersion produced is compensated by non-linear effects resulting in the formation of exponentially localized .... determining the values of Lagrange's multipliers αis. We postulate that a slightly .... c3 «w2x -v. (36). To include the effect of the secondary constraint c3 in the total Hamiltonian H we modify. (33) as. 104.
The Theory of Linear Prediction
Vaidyanathan, PP
2007-01-01
Linear prediction theory has had a profound impact in the field of digital signal processing. Although the theory dates back to the early 1940s, its influence can still be seen in applications today. The theory is based on very elegant mathematics and leads to many beautiful insights into statistical signal processing. Although prediction is only a part of the more general topics of linear estimation, filtering, and smoothing, this book focuses on linear prediction. This has enabled detailed discussion of a number of issues that are normally not found in texts. For example, the theory of vecto
Correlation and simple linear regression.
Zou, Kelly H; Tuncali, Kemal; Silverman, Stuart G
2003-06-01
In this tutorial article, the concepts of correlation and regression are reviewed and demonstrated. The authors review and compare two correlation coefficients, the Pearson correlation coefficient and the Spearman rho, for measuring linear and nonlinear relationships between two continuous variables. In the case of measuring the linear relationship between a predictor and an outcome variable, simple linear regression analysis is conducted. These statistical concepts are illustrated by using a data set from published literature to assess a computed tomography-guided interventional technique. These statistical methods are important for exploring the relationships between variables and can be applied to many radiologic studies.
Saravanan, R
2018-01-01
Non-linear optical materials have widespread and promising applications, but the efforts to understand the local structure, electron density distribution and bonding is still lacking. The present work explores the structural details, the electron density distribution and the local bond length distribution of some non-linear optical materials. It also gives estimation of the optical band gap, the particle size, crystallite size, and the elemental composition from UV-Visible analysis, SEM, XRD and EDS of some non-linear optical materials respectively.
Optimal control linear quadratic methods
Anderson, Brian D O
2007-01-01
This augmented edition of a respected text teaches the reader how to use linear quadratic Gaussian methods effectively for the design of control systems. It explores linear optimal control theory from an engineering viewpoint, with step-by-step explanations that show clearly how to make practical use of the material.The three-part treatment begins with the basic theory of the linear regulator/tracker for time-invariant and time-varying systems. The Hamilton-Jacobi equation is introduced using the Principle of Optimality, and the infinite-time problem is considered. The second part outlines the
Podolak, Morris
2018-04-01
Modern observational techniques are still not powerful enough to directly view planet formation, and so it is necessary to rely on theory. However, observations do give two important clues to the formation process. The first is that the most primitive form of material in interstellar space exists as a dilute gas. Some of this gas is unstable against gravitational collapse, and begins to contract. Because the angular momentum of the gas is not zero, it contracts along the spin axis, but remains extended in the plane perpendicular to that axis, so that a disk is formed. Viscous processes in the disk carry most of the mass into the center where a star eventually forms. In the process, almost as a by-product, a planetary system is formed as well. The second clue is the time required. Young stars are indeed observed to have gas disks, composed mostly of hydrogen and helium, surrounding them, and observations tell us that these disks dissipate after about 5 to 10 million years. If planets like Jupiter and Saturn, which are very rich in hydrogen and helium, are to form in such a disk, they must accrete their gas within 5 million years of the time of the formation of the disk. Any formation scenario one proposes must produce Jupiter in that time, although the terrestrial planets, which don't contain significant amounts of hydrogen and helium, could have taken longer to build. Modern estimates for the formation time of the Earth are of the order of 100 million years. To date there are two main candidate theories for producing Jupiter-like planets. The core accretion (CA) scenario supposes that any solid materials in the disk slowly coagulate into protoplanetary cores with progressively larger masses. If the core remains small enough it won't have a strong enough gravitational force to attract gas from the surrounding disk, and the result will be a terrestrial planet. If the core grows large enough (of the order of ten Earth masses), and the disk has not yet dissipated, then
Spatial Analysis of Linear Structures in the Exploration of Groundwater
Directory of Open Access Journals (Sweden)
Abdramane Dembele
2017-11-01
Full Text Available The analysis of linear structures on major geological formations plays a crucial role in resource exploration in the Inner Niger Delta. Highlighting and mapping of the large lithological units were carried out using image fusion, spectral bands (RGB coding, Principal Component Analysis (PCA, and band ratio methods. The automatic extraction method of linear structures has permitted the obtaining of a structural map with 82,659 linear structures, distributed on different stratigraphic stages. The intensity study shows an accentuation in density over 12.52% of the total area, containing 22.02% of the linear structures. The density and nodes (intersections of fractures formed by the linear structures on the different lithologies allowed to observe the behavior of the region’s aquifers in the exploration of subsoil resources. The central density, in relation to the hydrographic network of the lowlands, shows the conditioning of the flow and retention of groundwater in the region, and in-depth fluids. The node areas and high-density linear structures, have shown an ability to have rejections in deep (pores that favor the formation of structural traps for oil resources.
Cellular Automata Rules and Linear Numbers
Nayak, Birendra Kumar; Sahoo, Sudhakar; Biswal, Sagarika
2012-01-01
In this paper, linear Cellular Automta (CA) rules are recursively generated using a binary tree rooted at "0". Some mathematical results on linear as well as non-linear CA rules are derived. Integers associated with linear CA rules are defined as linear numbers and the properties of these linear numbers are studied.
Feedback systems for linear colliders
Hendrickson, L; Himel, Thomas M; Minty, Michiko G; Phinney, N; Raimondi, Pantaleo; Raubenheimer, T O; Shoaee, H; Tenenbaum, P G
1999-01-01
Feedback systems are essential for stable operation of a linear collider, providing a cost-effective method for relaxing tight tolerances. In the Stanford Linear Collider (SLC), feedback controls beam parameters such as trajectory, energy, and intensity throughout the accelerator. A novel dithering optimization system which adjusts final focus parameters to maximize luminosity contributed to achieving record performance in the 1997-98 run. Performance limitations of the steering feedback have been investigated, and improvements have been made. For the Next Linear Collider (NLC), extensive feedback systems are planned as an intregal part of the design. Feedback requiremetns for JLC (the Japanese Linear Collider) are essentially identical to NLC; some of the TESLA requirements are similar but there are significant differences. For NLC, algorithms which incorporate improvements upon the SLC implementation are being prototyped. Specialized systems for the damping rings, rf and interaction point will operate at hi...
An introduction to linear algebra
Mirsky, L
2003-01-01
Rigorous, self-contained coverage of determinants, vectors, matrices and linear equations, quadratic forms, more. Elementary, easily readable account with numerous examples and problems at the end of each chapter.
CLIC: developing a linear collider
Laurent Guiraud
1999-01-01
Compact Linear Collider (CLIC) is a CERN project to provide high-energy electron-positron collisions. Instead of conventional radio-frequency klystrons, CLIC will use a low-energy, high-intensity primary beam to produce acceleration.
1988 linear accelerator conference proceedings
International Nuclear Information System (INIS)
1989-06-01
This report contains papers presented at the 1988 Linear Accelerator Conference. A few topics covered are beam dynamics; beam transport; superconducting components; free electron lasers; ion sources; and klystron research
CERN balances linear collider studies
ILC Newsline
2011-01-01
The forces behind the two most mature proposals for a next-generation collider, the International Linear Collider (ILC) and the Compact Linear Collider (CLIC) study, have been steadily coming together, with scientists from both communities sharing ideas and information across the technology divide. In a support of cooperation between the two, CERN in Switzerland, where most CLIC research takes place, recently converted the project-specific position of CLIC Study Leader to the concept-based Linear Collider Study Leader. The scientist who now holds this position, Steinar Stapnes, is charged with making the linear collider a viable option for CERN’s future, one that could include either CLIC or the ILC. The transition to more involve the ILC must be gradual, he said, and the redefinition of his post is a good start. Though not very much involved with superconducting radiofrequency (SRF) technology, where ILC researchers have made significant advances, CERN participates in many aspect...
Linear Methods for Image Interpolation
Pascal Getreuer
2011-01-01
We discuss linear methods for interpolation, including nearest neighbor, bilinear, bicubic, splines, and sinc interpolation. We focus on separable interpolation, so most of what is said applies to one-dimensional interpolation as well as N-dimensional separable interpolation.
Klumpp, A. R.; Lawson, C. L.
1988-01-01
Routines provided for common scalar, vector, matrix, and quaternion operations. Computer program extends Ada programming language to include linear-algebra capabilities similar to HAS/S programming language. Designed for such avionics applications as software for Space Station.
Acoustic emission linear pulse holography
Collins, H.D.; Busse, L.J.; Lemon, D.K.
1983-10-25
This device relates to the concept of and means for performing Acoustic Emission Linear Pulse Holography, which combines the advantages of linear holographic imaging and Acoustic Emission into a single non-destructive inspection system. This unique system produces a chronological, linear holographic image of a flaw by utilizing the acoustic energy emitted during crack growth. The innovation is the concept of utilizing the crack-generated acoustic emission energy to generate a chronological series of images of a growing crack by applying linear, pulse holographic processing to the acoustic emission data. The process is implemented by placing on a structure an array of piezoelectric sensors (typically 16 or 32 of them) near the defect location. A reference sensor is placed between the defect and the array.
Functionalized linear and cyclic polyolefins
Energy Technology Data Exchange (ETDEWEB)
Tuba, Robert; Grubbs, Robert H.
2018-02-13
This invention relates to methods and compositions for preparing linear and cyclic polyolefins. More particularly, the invention relates to methods and compositions for preparing functionalized linear and cyclic polyolefins via olefin metathesis reactions. Polymer products produced via the olefin metathesis reactions of the invention may be utilized for a wide range of materials applications. The invention has utility in the fields of polymer and materials chemistry and manufacture.
Directory of Open Access Journals (Sweden)
Rumen Daskalov
2017-07-01
Full Text Available Let an $[n,k,d]_q$ code be a linear code of length $n$, dimension $k$ and minimum Hamming distance $d$ over $GF(q$. One of the most important problems in coding theory is to construct codes with optimal minimum distances. In this paper 22 new ternary linear codes are presented. Two of them are optimal. All new codes improve the respective lower bounds in [11].
Explorative methods in linear models
DEFF Research Database (Denmark)
Høskuldsson, Agnar
2004-01-01
The author has developed the H-method of mathematical modeling that builds up the model by parts, where each part is optimized with respect to prediction. Besides providing with better predictions than traditional methods, these methods provide with graphic procedures for analyzing different feat...... features in data. These graphic methods extend the well-known methods and results of Principal Component Analysis to any linear model. Here the graphic procedures are applied to linear regression and Ridge Regression....
Polarized Electrons for Linear Colliders
International Nuclear Information System (INIS)
Clendenin, J.
2004-01-01
Future electron-positron linear colliders require a highly polarized electron beam with a pulse structure that depends primarily on whether the acceleration utilizes warm or superconducting rf structures. The International Linear Collider (ILC) will use cold structures for the main linac. It is shown that a dc-biased polarized photoelectron source such as successfully used for the SLC can meet the charge requirements for the ILC micropulse with a polarization approaching 90%
Longair, Malcolm S
2008-01-01
This second edition of Galaxy Formation is an up-to-date text on astrophysical cosmology, expounding the structure of the classical cosmological models from a contemporary viewpoint. This forms the background to a detailed study of the origin of structure and galaxies in the Universe. The derivations of many of the most important results are derived by simple physical arguments which illuminate the results of more advanced treatments. A very wide range of observational data is brought to bear upon these problems, including the most recent results from WMAP, the Hubble Space Telescope, galaxy surveys like the Sloan Digital Sky Survey and the 2dF Galaxy Redshift Survey, studies of Type 1a supernovae, and many other observations.
International Nuclear Information System (INIS)
Gribbin, J.
1979-01-01
The current debate on the origin and evolution of galaxies is reviewed and evidence to support the so-called 'isothermal' and 'adiabatic' fluctuation models considered. It is shown that new theories have to explain the formation of both spiral and elliptical galaxies and the reason for their differences. It is stated that of the most recent models the best indicates that rotating spiral galaxies are formed naturally when gas concentrates in the centre of a great halo and forms stars while ellipticals are explained by later interactions between spiral galaxies and merging, which can cancel out the rotation while producing an elliptical galaxy in which the stars, coming from two original galaxies, follow very elliptical, anisotropic orbits. (UK)
Smith, Kyle S; Graybiel, Ann M
2016-03-01
Habits, both good ones and bad ones, are pervasive in animal behavior. Important frameworks have been developed to understand habits through psychological and neurobiological studies. This work has given us a rich understanding of brain networks that promote habits, and has also helped us to understand what constitutes a habitual behavior as opposed to a behavior that is more flexible and prospective. Mounting evidence from studies using neural recording methods suggests that habit formation is not a simple process. We review this evidence and take the position that habits could be sculpted from multiple dissociable changes in neural activity. These changes occur across multiple brain regions and even within single brain regions. This strategy of classifying components of a habit based on different brain signals provides a potentially useful new way to conceive of disorders that involve overly fixed behaviors as arising from different potential dysfunctions within the brain's habit network.
Smith, Kyle S.; Graybiel, Ann M.
2016-01-01
Habits, both good ones and bad ones, are pervasive in animal behavior. Important frameworks have been developed to understand habits through psychological and neurobiological studies. This work has given us a rich understanding of brain networks that promote habits, and has also helped us to understand what constitutes a habitual behavior as opposed to a behavior that is more flexible and prospective. Mounting evidence from studies using neural recording methods suggests that habit formation is not a simple process. We review this evidence and take the position that habits could be sculpted from multiple dissociable changes in neural activity. These changes occur across multiple brain regions and even within single brain regions. This strategy of classifying components of a habit based on different brain signals provides a potentially useful new way to conceive of disorders that involve overly fixed behaviors as arising from different potential dysfunctions within the brain's habit network. PMID:27069378
2002-01-01
(Released 10 April 2002) The Science This THEMIS visible image was acquired near 7o S, 172o W (188o E) and shows a remarkable martian geologic deposit known as the Medusae Fossae Formation. This Formation, seen here as the raised plateau in the upper two-thirds of the image, is a soft, easily eroded deposit that extends for nearly 1,000 km along the equator of Mars. In this region the deposit has been heavily eroded by the wind to produce a series of linear ridges called yardangs. These parallel ridges point in direction of the prevailing winds that carved them, and demonstrate the power of martian winds to sculpt the dry landscape of Mars. The Medusae Fossae Formation has been completely stripped from the surface in the lower third of the image, revealing a harder layer below that is more resistant to wind erosion. The easily eroded nature of the Medusae Fossae Formation suggests that it is composed of weakly cemented particles, and was most likely formed by the deposition of wind-blown dust or volcanic ash. Several ancient craters that were once completely buried by this deposit are being exposed, or exhumed, as the overlying Medusae Formation is removed. Very few impact craters are visible on this Formation, indicating that the surface seen today is relatively young, and that the processes of erosion are likely to be actively occurring. The Story Medusa of Greek mythology fame, the name-giver to this region, had snaky locks of hair that could turn a person to stone. Wild and unruly, this monster of the underworld could certainly wreak havoc on the world of the human imagination. As scary as she was, Medusa would have no advantage over the fierce, masterful winds blowing across Mars, which once carved the streaky, terrain at the top of this image. Wild and whipping, these winds have slowly eroded away the 'topsoil,' revealing ancient craters and other surface features they once covered. The loosely cemented particles of this 'topsoil' are likely made up of dust
Well logging system with linearity control
International Nuclear Information System (INIS)
Jones, J.M.
1973-01-01
Apparatus is described for controlling the gain of a nuclear well logging system comprising: (1) means for measuring the energy spectrum of gamma rays produced by earth formation materials surrounding a well borehole; (2) means for measuring the number of counts of a gamma rays having an energy falling within each of at least two predetermined energy band portions of the gamma ray energy spectrum; (3) means for generating a signal proportional to the ratio of the gamma ray counts and for comparing the ratio signal with at least one constant ratio calibration signal; (4) means for generating an error signal representative of the difference of the ratio signal and the constant ratio calibration signal; and (5) means for using the error signal to control the linearity of the well logging system. (author)
The linear-non-linear frontier for the Goldstone Higgs
International Nuclear Information System (INIS)
Gavela, M.B.; Saa, S.; Kanshin, K.; Machado, P.A.N.
2016-01-01
The minimal SO(5)/SO(4) σ-model is used as a template for the ultraviolet completion of scenarios in which the Higgs particle is a low-energy remnant of some high-energy dynamics, enjoying a (pseudo) Nambu-Goldstone-boson ancestry. Varying the σ mass allows one to sweep from the perturbative regime to the customary non-linear implementations. The low-energy benchmark effective non-linear Lagrangian for bosons and fermions is obtained, determining as well the operator coefficients including linear corrections. At first order in the latter, three effective bosonic operators emerge which are independent of the explicit soft breaking assumed. The Higgs couplings to vector bosons and fermions turn out to be quite universal: the linear corrections are proportional to the explicit symmetry-breaking parameters. Furthermore, we define an effective Yukawa operator which allows a simple parametrization and comparison of different heavy-fermion ultraviolet completions. In addition, one particular fermionic completion is explored in detail, obtaining the corresponding leading low-energy fermionic operators. (orig.)
Advanced statistics: linear regression, part II: multiple linear regression.
Marill, Keith A
2004-01-01
The applications of simple linear regression in medical research are limited, because in most situations, there are multiple relevant predictor variables. Univariate statistical techniques such as simple linear regression use a single predictor variable, and they often may be mathematically correct but clinically misleading. Multiple linear regression is a mathematical technique used to model the relationship between multiple independent predictor variables and a single dependent outcome variable. It is used in medical research to model observational data, as well as in diagnostic and therapeutic studies in which the outcome is dependent on more than one factor. Although the technique generally is limited to data that can be expressed with a linear function, it benefits from a well-developed mathematical framework that yields unique solutions and exact confidence intervals for regression coefficients. Building on Part I of this series, this article acquaints the reader with some of the important concepts in multiple regression analysis. These include multicollinearity, interaction effects, and an expansion of the discussion of inference testing, leverage, and variable transformations to multivariate models. Examples from the first article in this series are expanded on using a primarily graphic, rather than mathematical, approach. The importance of the relationships among the predictor variables and the dependence of the multivariate model coefficients on the choice of these variables are stressed. Finally, concepts in regression model building are discussed.
The linear-non-linear frontier for the Goldstone Higgs
Energy Technology Data Exchange (ETDEWEB)
Gavela, M.B.; Saa, S. [IFT-UAM/CSIC, Universidad Autonoma de Madrid, Departamento de Fisica Teorica y Instituto de Fisica Teorica, Madrid (Spain); Kanshin, K. [Universita di Padova, Dipartimento di Fisica e Astronomia ' G. Galilei' , Padua (Italy); INFN, Padova (Italy); Machado, P.A.N. [IFT-UAM/CSIC, Universidad Autonoma de Madrid, Departamento de Fisica Teorica y Instituto de Fisica Teorica, Madrid (Spain); Fermi National Accelerator Laboratory, Theoretical Physics Department, Batavia, IL (United States)
2016-12-15
The minimal SO(5)/SO(4) σ-model is used as a template for the ultraviolet completion of scenarios in which the Higgs particle is a low-energy remnant of some high-energy dynamics, enjoying a (pseudo) Nambu-Goldstone-boson ancestry. Varying the σ mass allows one to sweep from the perturbative regime to the customary non-linear implementations. The low-energy benchmark effective non-linear Lagrangian for bosons and fermions is obtained, determining as well the operator coefficients including linear corrections. At first order in the latter, three effective bosonic operators emerge which are independent of the explicit soft breaking assumed. The Higgs couplings to vector bosons and fermions turn out to be quite universal: the linear corrections are proportional to the explicit symmetry-breaking parameters. Furthermore, we define an effective Yukawa operator which allows a simple parametrization and comparison of different heavy-fermion ultraviolet completions. In addition, one particular fermionic completion is explored in detail, obtaining the corresponding leading low-energy fermionic operators. (orig.)
Linearization: Geometric, Complex, and Conditional
Directory of Open Access Journals (Sweden)
Asghar Qadir
2012-01-01
Full Text Available Lie symmetry analysis provides a systematic method of obtaining exact solutions of nonlinear (systems of differential equations, whether partial or ordinary. Of special interest is the procedure that Lie developed to transform scalar nonlinear second-order ordinary differential equations to linear form. Not much work was done in this direction to start with, but recently there have been various developments. Here, first the original work of Lie (and the early developments on it, and then more recent developments based on geometry and complex analysis, apart from Lie’s own method of algebra (namely, Lie group theory, are reviewed. It is relevant to mention that much of the work is not linearization but uses the base of linearization.
Window observers for linear systems
Directory of Open Access Journals (Sweden)
Utkin Vadim
2000-01-01
Full Text Available Given a linear system x ˙ = A x + B u with output y = C x and a window function ω ( t , i.e., ∀ t , ω ( t ∈ {0,1 }, and assuming that the window function is Lebesgue measurable, we refer to the following observer, x ˆ = A x + B u + ω ( t L C ( x − x ˆ as a window observer. The stability issue is treated in this paper. It is proven that for linear time-invariant systems, the window observer can be stabilized by an appropriate design under a very mild condition on the window functions, albeit for linear time-varying system, some regularity of the window functions is required to achieve observer designs with the asymptotic stability. The corresponding design methods are developed. An example is included to illustrate the possible applications
Topics in quaternion linear algebra
Rodman, Leiba
2014-01-01
Quaternions are a number system that has become increasingly useful for representing the rotations of objects in three-dimensional space and has important applications in theoretical and applied mathematics, physics, computer science, and engineering. This is the first book to provide a systematic, accessible, and self-contained exposition of quaternion linear algebra. It features previously unpublished research results with complete proofs and many open problems at various levels, as well as more than 200 exercises to facilitate use by students and instructors. Applications presented in the book include numerical ranges, invariant semidefinite subspaces, differential equations with symmetries, and matrix equations. Designed for researchers and students across a variety of disciplines, the book can be read by anyone with a background in linear algebra, rudimentary complex analysis, and some multivariable calculus. Instructors will find it useful as a complementary text for undergraduate linear algebra courses...
Towards the International Linear Collider
International Nuclear Information System (INIS)
Lopez-Fernandez, Ricardo
2006-01-01
The broad physics potential of e+e- linear colliders was recognized by the high energy physics community right after the end of LEP in 2000. In 2007, the Large Hadron Collider (LHC) now under construction at CERN will obtain its first collisions. The LHC, colliding protons with protons at 14 TeV, will discover a standard model Higgs boson over the full potential mass range, and should be sensitive to new physics into the several TeV range. The program for the Linear Collider (LC) will be set in the context of the discoveries made at the LHC. All the proposals for a Linear Collider will extend the discoveries and provide a wealth of measurements that are essential for giving deeper understanding of their meaning, and pointing the way to further evolution of particle physics in the future. For the mexican groups is the right time to join such an effort
Linear Synchronous Motor Repeatability Tests
International Nuclear Information System (INIS)
Ward, C.R.
2002-01-01
A cart system using linear synchronous motors was being considered for the Plutonium Immobilization Plant (PIP). One of the applications in the PIP was the movement of a stack of furnace trays, filled with the waste form (pucks) from a stacking/unstacking station to several bottom loaded furnaces. A system was ordered to perform this function in the PIP Ceramic Prototype Test Facility (CPTF). This system was installed and started up in SRTC prior to being installed in the CPTF. The PIP was suspended and then canceled after the linear synchronous motor system was started up. This system was used to determine repeatability of a linear synchronous motor cart system for the Modern Pit Facility
Linearly polarized photons at ELSA
Energy Technology Data Exchange (ETDEWEB)
Eberhardt, Holger [Physikalisches Institut, Universitaet Bonn (Germany)
2009-07-01
To investigate the nucleon resonance regime in meson photoproduction, double polarization experiments are currently performed at the electron accelerator ELSA in Bonn. The experiments make use of a polarized target and circularly or linearly polarized photon beams. Linearly polarized photons are produced by coherent bremsstrahlung from an accurately aligned diamond crystal. The orientation of the crystal with respect to the electron beam is measured using the Stonehenge-Technique. Both, the energy of maximum polarization and the plane of polarization, can be deliberately chosen for the experiment. The linearly polarized beam provides the basis for the measurement of azimuthal beam asymmetries, such as {sigma} (unpolarized target) and G (polarized target). These observables are extracted in various single and multiple meson photoproduction channels.
Linear programming foundations and extensions
Vanderbei, Robert J
2001-01-01
Linear Programming: Foundations and Extensions is an introduction to the field of optimization. The book emphasizes constrained optimization, beginning with a substantial treatment of linear programming, and proceeding to convex analysis, network flows, integer programming, quadratic programming, and convex optimization. The book is carefully written. Specific examples and concrete algorithms precede more abstract topics. Topics are clearly developed with a large number of numerical examples worked out in detail. Moreover, Linear Programming: Foundations and Extensions underscores the purpose of optimization: to solve practical problems on a computer. Accordingly, the book is coordinated with free efficient C programs that implement the major algorithms studied: -The two-phase simplex method; -The primal-dual simplex method; -The path-following interior-point method; -The homogeneous self-dual methods. In addition, there are online JAVA applets that illustrate various pivot rules and variants of the simplex m...
Uniqueness theorems in linear elasticity
Knops, Robin John
1971-01-01
The classical result for uniqueness in elasticity theory is due to Kirchhoff. It states that the standard mixed boundary value problem for a homogeneous isotropic linear elastic material in equilibrium and occupying a bounded three-dimensional region of space possesses at most one solution in the classical sense, provided the Lame and shear moduli, A and J1 respectively, obey the inequalities (3 A + 2 J1) > 0 and J1>O. In linear elastodynamics the analogous result, due to Neumann, is that the initial-mixed boundary value problem possesses at most one solution provided the elastic moduli satisfy the same set of inequalities as in Kirchhoffs theorem. Most standard textbooks on the linear theory of elasticity mention only these two classical criteria for uniqueness and neglect altogether the abundant literature which has appeared since the original publications of Kirchhoff. To remedy this deficiency it seems appropriate to attempt a coherent description ofthe various contributions made to the study of uniquenes...
Bayes linear statistics, theory & methods
Goldstein, Michael
2007-01-01
Bayesian methods combine information available from data with any prior information available from expert knowledge. The Bayes linear approach follows this path, offering a quantitative structure for expressing beliefs, and systematic methods for adjusting these beliefs, given observational data. The methodology differs from the full Bayesian methodology in that it establishes simpler approaches to belief specification and analysis based around expectation judgements. Bayes Linear Statistics presents an authoritative account of this approach, explaining the foundations, theory, methodology, and practicalities of this important field. The text provides a thorough coverage of Bayes linear analysis, from the development of the basic language to the collection of algebraic results needed for efficient implementation, with detailed practical examples. The book covers:The importance of partial prior specifications for complex problems where it is difficult to supply a meaningful full prior probability specification...
Scalar-tensor linear inflation
Energy Technology Data Exchange (ETDEWEB)
Artymowski, Michał [Institute of Physics, Jagiellonian University, Łojasiewicza 11, 30-348 Kraków (Poland); Racioppi, Antonio, E-mail: Michal.Artymowski@uj.edu.pl, E-mail: Antonio.Racioppi@kbfi.ee [National Institute of Chemical Physics and Biophysics, Rävala 10, 10143 Tallinn (Estonia)
2017-04-01
We investigate two approaches to non-minimally coupled gravity theories which present linear inflation as attractor solution: a) the scalar-tensor theory approach, where we look for a scalar-tensor theory that would restore results of linear inflation in the strong coupling limit for a non-minimal coupling to gravity of the form of f (φ) R /2; b) the particle physics approach, where we motivate the form of the Jordan frame potential by loop corrections to the inflaton field. In both cases the Jordan frame potentials are modifications of the induced gravity inflationary scenario, but instead of the Starobinsky attractor they lead to linear inflation in the strong coupling limit.
A Linear Electromagnetic Piston Pump
Hogan, Paul H.
Advancements in mobile hydraulics for human-scale applications have increased demand for a compact hydraulic power supply. Conventional designs couple a rotating electric motor to a hydraulic pump, which increases the package volume and requires several energy conversions. This thesis investigates the use of a free piston as the moving element in a linear motor to eliminate multiple energy conversions and decrease the overall package volume. A coupled model used a quasi-static magnetic equivalent circuit to calculate the motor inductance and the electromagnetic force acting on the piston. The force was an input to a time domain model to evaluate the mechanical and pressure dynamics. The magnetic circuit model was validated with finite element analysis and an experimental prototype linear motor. The coupled model was optimized using a multi-objective genetic algorithm to explore the parameter space and maximize power density and efficiency. An experimental prototype linear pump coupled pistons to an off-the-shelf linear motor to validate the mechanical and pressure dynamics models. The magnetic circuit force calculation agreed within 3% of finite element analysis, and within 8% of experimental data from the unoptimized prototype linear motor. The optimized motor geometry also had good agreement with FEA; at zero piston displacement, the magnetic circuit calculates optimized motor force within 10% of FEA in less than 1/1000 the computational time. This makes it well suited to genetic optimization algorithms. The mechanical model agrees very well with the experimental piston pump position data when tuned for additional unmodeled mechanical friction. Optimized results suggest that an improvement of 400% of the state of the art power density is attainable with as high as 85% net efficiency. This demonstrates that a linear electromagnetic piston pump has potential to serve as a more compact and efficient supply of fluid power for the human scale.
Sparse Linear Identifiable Multivariate Modeling
DEFF Research Database (Denmark)
Henao, Ricardo; Winther, Ole
2011-01-01
and bench-marked on artificial and real biological data sets. SLIM is closest in spirit to LiNGAM (Shimizu et al., 2006), but differs substantially in inference, Bayesian network structure learning and model comparison. Experimentally, SLIM performs equally well or better than LiNGAM with comparable......In this paper we consider sparse and identifiable linear latent variable (factor) and linear Bayesian network models for parsimonious analysis of multivariate data. We propose a computationally efficient method for joint parameter and model inference, and model comparison. It consists of a fully...
Quantized, piecewise linear filter network
DEFF Research Database (Denmark)
Sørensen, John Aasted
1993-01-01
A quantization based piecewise linear filter network is defined. A method for the training of this network based on local approximation in the input space is devised. The training is carried out by repeatedly alternating between vector quantization of the training set into quantization classes...... and equalization of the quantization classes linear filter mean square training errors. The equalization of the mean square training errors is carried out by adapting the boundaries between neighbor quantization classes such that the differences in mean square training errors are reduced...
Correct Linearization of Einstein's Equations
Directory of Open Access Journals (Sweden)
Rabounski D.
2006-06-01
Full Text Available Regularly Einstein's equations can be reduced to a wave form (linearly dependent from the second derivatives of the space metric in the absence of gravitation, the space rotation and Christoffel's symbols. As shown here, the origin of the problem is that one uses the general covariant theory of measurement. Here the wave form of Einstein's equations is obtained in the terms of Zelmanov's chronometric invariants (physically observable projections on the observer's time line and spatial section. The obtained equations depend on solely the second derivatives even if gravitation, the space rotation and Christoffel's symbols. The correct linearization proves: the Einstein equations are completely compatible with weak waves of the metric.
Basic linear partial differential equations
Treves, Francois
1975-01-01
Focusing on the archetypes of linear partial differential equations, this text for upper-level undergraduates and graduate students features most of the basic classical results. The methods, however, are decidedly nontraditional: in practically every instance, they tend toward a high level of abstraction. This approach recalls classical material to contemporary analysts in a language they can understand, as well as exploiting the field's wealth of examples as an introduction to modern theories.The four-part treatment covers the basic examples of linear partial differential equations and their
Introduction to computational linear algebra
Nassif, Nabil; Erhel, Jocelyne
2015-01-01
Introduction to Computational Linear Algebra introduces the reader with a background in basic mathematics and computer programming to the fundamentals of dense and sparse matrix computations with illustrating examples. The textbook is a synthesis of conceptual and practical topics in ""Matrix Computations."" The book's learning outcomes are twofold: to understand state-of-the-art computational tools to solve matrix computations problems (BLAS primitives, MATLAB® programming) as well as essential mathematical concepts needed to master the topics of numerical linear algebra. It is suitable for s
Linear feedback controls the essentials
Haidekker, Mark A
2013-01-01
The design of control systems is at the very core of engineering. Feedback controls are ubiquitous, ranging from simple room thermostats to airplane engine control. Helping to make sense of this wide-ranging field, this book provides a new approach by keeping a tight focus on the essentials with a limited, yet consistent set of examples. Analysis and design methods are explained in terms of theory and practice. The book covers classical, linear feedback controls, and linear approximations are used when needed. In parallel, the book covers time-discrete (digital) control systems and juxtapos
Passive longitudinal phase space linearizer
Directory of Open Access Journals (Sweden)
P. Craievich
2010-03-01
Full Text Available We report on the possibility to passively linearize the bunch compression process in electron linacs for the next generation x-ray free electron lasers. This can be done by using the monopole wakefields in a dielectric-lined waveguide. The optimum longitudinal voltage loss over the length of the bunch is calculated in order to compensate both the second-order rf time curvature and the second-order momentum compaction terms. Thus, the longitudinal phase space after the compression process is linearized up to a fourth-order term introduced by the convolution between the bunch and the monopole wake function.
Generalized, Linear, and Mixed Models
McCulloch, Charles E; Neuhaus, John M
2011-01-01
An accessible and self-contained introduction to statistical models-now in a modernized new editionGeneralized, Linear, and Mixed Models, Second Edition provides an up-to-date treatment of the essential techniques for developing and applying a wide variety of statistical models. The book presents thorough and unified coverage of the theory behind generalized, linear, and mixed models and highlights their similarities and differences in various construction, application, and computational aspects.A clear introduction to the basic ideas of fixed effects models, random effects models, and mixed m
Emittance control in linear colliders
International Nuclear Information System (INIS)
Ruth, R.D.
1991-01-01
Before completing a realistic design of a next-generation linear collider, the authors must first learn the lessons taught by the first generation, the SLC. Given that, they must make designs fault tolerant by including correction and compensation in the basic design. They must also try to eliminate these faults by improved alignment and stability of components. When these two efforts cross, they have a realistic design. The techniques of generation and control of emittance reviewed here provide a foundation for a design which can obtain the necessary luminosity in a next-generation linear collider
Linear contextual modal type theory
DEFF Research Database (Denmark)
Schack-Nielsen, Anders; Schürmann, Carsten
Abstract. When one implements a logical framework based on linear type theory, for example the Celf system [?], one is immediately con- fronted with questions about their equational theory and how to deal with logic variables. In this paper, we propose linear contextual modal type theory that gives...... a mathematical account of the nature of logic variables. Our type theory is conservative over intuitionistic contextual modal type theory proposed by Nanevski, Pfenning, and Pientka. Our main contributions include a mechanically checked proof of soundness and a working implementation....
Formation Control for the MAXIM Mission
Luquette, Richard J.; Leitner, Jesse; Gendreau, Keith; Sanner, Robert M.
2004-01-01
Over the next twenty years, a wave of change is occurring in the space-based scientific remote sensing community. While the fundamental limits in the spatial and angular resolution achievable in spacecraft have been reached, based on today s technology, an expansive new technology base has appeared over the past decade in the area of Distributed Space Systems (DSS). A key subset of the DSS technology area is that which covers precision formation flying of space vehicles. Through precision formation flying, the baselines, previously defined by the largest monolithic structure which could fit in the largest launch vehicle fairing, are now virtually unlimited. Several missions including the Micro-Arcsecond X-ray Imaging Mission (MAXIM), and the Stellar Imager will drive the formation flying challenges to achieve unprecedented baselines for high resolution, extended-scene, interferometry in the ultraviolet and X-ray regimes. This paper focuses on establishing the feasibility for the formation control of the MAXIM mission. MAXIM formation flying requirements are on the order of microns, while Stellar Imager mission requirements are on the order of nanometers. This paper specifically addresses: (1) high-level science requirements for these missions and how they evolve into engineering requirements; and (2) the development of linearized equations of relative motion for a formation operating in an n-body gravitational field. Linearized equations of motion provide the ground work for linear formation control designs.
Processes and problems in secondary star formation
International Nuclear Information System (INIS)
Klein, R.I.; Whitaker, R.W.; Sandford, M.T. II.
1984-03-01
Recent developments relating the conditions in molecular clouds to star formation triggered by a prior stellar generation are reviewed. Primary processes are those that lead to the formation of a first stellar generation. The secondary processes that produce stars in response to effects caused by existing stars are compared and evaluated in terms of the observational data presently available. We discuss the role of turbulence to produce clumpy cloud structures and introduce new work on colliding inter-cloud gas flows leading to non-linear inhomogeneous cloud structures in an intially smooth cloud. This clumpy morphology has important consequences for secondary formation. The triggering processes of supernovae, stellar winds, and H II regions are discussed with emphasis on the consequences for radiation driven implosion as a promising secondary star formation mechanism. Detailed two-dimensional, radiation-hydrodynamic calculations of radiation driven implosion are discussed. This mechanism is shown to be highly efficient in synchronizing the formation of new stars in congruent to 1-3 x 10 4 years and could account for the recent evidence for new massive star formation in several UCHII regions. It is concluded that, while no single theory adequately explains the variety of star formation observed, a uniform description of star formation is likely to involve several secondary processes. Advances in the theory of star formation will require multiple dimensional calculations of coupled processes. The important non-linear interactions include hydrodynamics, radiation transport, and magnetic fields
Vanilla Technicolor at Linear Colliders
DEFF Research Database (Denmark)
T. Frandsen, Mads; Jarvinen, Matti; Sannino, Francesco
2011-01-01
We analyze the reach of Linear Colliders (LC)s for models of dynamical electroweak symmetry breaking. We show that LCs can efficiently test the compositeness scale, identified with the mass of the new spin-one resonances, till the maximum energy in the center-of-mass of the colliding leptons. In ...
Variational linear algebraic equations method
International Nuclear Information System (INIS)
Moiseiwitsch, B.L.
1982-01-01
A modification of the linear algebraic equations method is described which ensures a variational bound on the phaseshifts for potentials having a definite sign at all points. The method is illustrated by the elastic scattering of s-wave electrons by the static field of atomic hydrogen. (author)
Feedback Systems for Linear Colliders
International Nuclear Information System (INIS)
1999-01-01
Feedback systems are essential for stable operation of a linear collider, providing a cost-effective method for relaxing tight tolerances. In the Stanford Linear Collider (SLC), feedback controls beam parameters such as trajectory, energy, and intensity throughout the accelerator. A novel dithering optimization system which adjusts final focus parameters to maximize luminosity contributed to achieving record performance in the 1997-98 run. Performance limitations of the steering feedback have been investigated, and improvements have been made. For the Next Linear Collider (NLC), extensive feedback systems are planned as an integral part of the design. Feedback requirements for JLC (the Japanese Linear Collider) are essentially identical to NLC; some of the TESLA requirements are similar but there are significant differences. For NLC, algorithms which incorporate improvements upon the SLC implementation are being prototyped. Specialized systems for the damping rings, rf and interaction point will operate at high bandwidth and fast response. To correct for the motion of individual bunches within a train, both feedforward and feedback systems are planned. SLC experience has shown that feedback systems are an invaluable operational tool for decoupling systems, allowing precision tuning, and providing pulse-to-pulse diagnostics. Feedback systems for the NLC will incorporate the key SLC features and the benefits of advancing technologies
Aspects of robust linear regression
Davies, P.L.
1993-01-01
Section 1 of the paper contains a general discussion of robustness. In Section 2 the influence function of the Hampel-Rousseeuw least median of squares estimator is derived. Linearly invariant weak metrics are constructed in Section 3. It is shown in Section 4 that $S$-estimators satisfy an exact
Periodic linear differential stochastic processes
Kwakernaak, H.
1975-01-01
Periodic linear differential processes are defined and their properties are analyzed. Equivalent representations are discussed, and the solutions of related optimal estimation problems are given. An extension is presented of Kailath and Geesey’s [1] results concerning the innovations representation
Linear colliders for photon collisions
International Nuclear Information System (INIS)
Anon.
1994-01-01
The enthusiasm of the first international workshop on photonphoton colliders and associated physics, held at the Lawrence Berkeley Laboratory from 28 March - 1 April, could have set a ball rolling. According to proponents of this physics, the particle physics one can study with a high energy linear collider is special and complements that of a hadron supercollider
Saturation and linear transport equation
International Nuclear Information System (INIS)
Kutak, K.
2009-03-01
We show that the GBW saturation model provides an exact solution to the one dimensional linear transport equation. We also show that it is motivated by the BK equation considered in the saturated regime when the diffusion and the splitting term in the diffusive approximation are balanced by the nonlinear term. (orig.)
Parameterized Linear Longitudinal Airship Model
Kulczycki, Eric; Elfes, Alberto; Bayard, David; Quadrelli, Marco; Johnson, Joseph
2010-01-01
A parameterized linear mathematical model of the longitudinal dynamics of an airship is undergoing development. This model is intended to be used in designing control systems for future airships that would operate in the atmospheres of Earth and remote planets. Heretofore, the development of linearized models of the longitudinal dynamics of airships has been costly in that it has been necessary to perform extensive flight testing and to use system-identification techniques to construct models that fit the flight-test data. The present model is a generic one that can be relatively easily specialized to approximate the dynamics of specific airships at specific operating points, without need for further system identification, and with significantly less flight testing. The approach taken in the present development is to merge the linearized dynamical equations of an airship with techniques for estimation of aircraft stability derivatives, and to thereby make it possible to construct a linearized dynamical model of the longitudinal dynamics of a specific airship from geometric and aerodynamic data pertaining to that airship. (It is also planned to develop a model of the lateral dynamics by use of the same methods.) All of the aerodynamic data needed to construct the model of a specific airship can be obtained from wind-tunnel testing and computational fluid dynamics
Linear Methods for Image Interpolation
Directory of Open Access Journals (Sweden)
Pascal Getreuer
2011-09-01
Full Text Available We discuss linear methods for interpolation, including nearest neighbor, bilinear, bicubic, splines, and sinc interpolation. We focus on separable interpolation, so most of what is said applies to one-dimensional interpolation as well as N-dimensional separable interpolation.
Directivity of basic linear arrays
DEFF Research Database (Denmark)
Bach, Henning
1970-01-01
For a linear uniform array ofnelements, an expression is derived for the directivity as a function of the spacing and the phase constants. The cases of isotropic elements, collinear short dipoles, and parallel short dipoles are included. The formula obtained is discussed in some detail and contour...
Data Compression with Linear Algebra
Etler, David
2015-01-01
A presentation on the applications of linear algebra to image compression. Covers entropy, the discrete cosine transform, thresholding, quantization, and examples of images compressed with DCT. Given in Spring 2015 at Ocean County College as part of the honors program.
175 Years of Linear Programming
Indian Academy of Sciences (India)
polynomial-time solvability of linear programming, that is, testing if a polyhedron Q E ~ ... Q is rational, i.e. all extreme points and rays of Q are ra- tional vectors or ..... rithrll terminates with an interior solution, a post-processing step is usually ...
175 Years of Linear Programming
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 10. 175 Years of Linear Programming - Max Flow = Min Cut. Vijay Chandru M R Rao. Series Article Volume 4 Issue 10 October 1999 pp 22-39. Fulltext. Click here to view fulltext PDF. Permanent link:
Linear collider systems and costs
International Nuclear Information System (INIS)
Loew, G.A.
1993-05-01
The purpose of this paper is to examine some of the systems and sub-systems involved in so-called ''conventional'' e + e - linear colliders and to study how their design affects the overall cost of these machines. There are presently a total of at least six 500 GeV c. of m. linear collider projects under study in the world. Aside from TESLA (superconducting linac at 1.3 GHz) and CLIC (two-beam accelerator with main linac at 30GHz), the other four proposed e + e - linear colliders can be considered ''conventional'' in that their main linacs use the proven technique of driving room temperature accelerator sections with pulsed klystrons and modulators. The centrally distinguishing feature between these projects is their main linac rf frequency: 3 GHz for the DESY machine, 11.424 GHz for the SLAC and JLC machines, and 14 GHz for the VLEPP machine. The other systems, namely the electron and positron sources, preaccelerators, compressors, damping rings and final foci, are fairly similar from project to project. Probably more than 80% of the cost of these linear colliders will be incurred in the two main linacs facing each other and it is therefore in their design and construction that major savings or extra costs may be found
Linear accelerators of the future
International Nuclear Information System (INIS)
Loew, G.A.
1986-07-01
Some of the requirements imposed on future linear accelerators to be used in electron-positron colliders are reviewed, as well as some approaches presently being examined for meeting those requirements. RF sources for use in these linacs are described, as well as wakefields, single bunches, and multiple-bunch trains
175 Years of Linear Programming
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 5. 175 Years of Linear Programming - Pune's Gift. Vijay Chandru M R Rao. Series Article Volume 4 Issue 5 May ... Computer Science and Automation, IISc Bangalore 560012, India. Director, Indian Institute of Management, Bannerghatta Road, ...
Spaces of Piecewise Linear Manifolds
DEFF Research Database (Denmark)
Gomez Lopez, Mauricio Esteban
Abstract In this thesis we introduce Δ-set ψPLd(RN) which we regard as the piecewise linear analogue of the space ψd(RN) of smooth d-dimensional submanifoldsin RN introduced by Galatius in [4]. Using ψPLd(RN) we define a bi-Δ-set Cd(RN)•,• ( whose geometric realization BCPLd(RN) = llCd(RN)•,•ll ......Abstract In this thesis we introduce Δ-set ψPLd(RN) which we regard as the piecewise linear analogue of the space ψd(RN) of smooth d-dimensional submanifoldsin RN introduced by Galatius in [4]. Using ψPLd(RN) we define a bi-Δ-set Cd(RN)•,• ( whose geometric realization BCPLd(RN) = ll...... BCPLd (RN) ≅ ΩN–1lψPLd (RN)•l when N — d ≥ 3. The proof of the main theorem relies on properties of ψPLd (RN) • which arise from the fact that this Δ-set can be obtained from a more general contravariant functor PL op → Sets defined on the category of finite dimensional polyhedraand piecewise linear...... maps, and on a fiberwise transversality result for piecewise linear submersions whose fibers are contained in R × (-1,1)N-1 ⊆ RN . For the proof of this transversality result we use a theorem of Hudson on extensions of piecewise linear isotopies which is why we need to include the condition N — d ≥ 3...
Linear fixed-field multipass arcs for recirculating linear accelerators
Directory of Open Access Journals (Sweden)
V. S. Morozov
2012-06-01
Full Text Available Recirculating linear accelerators (RLA’s provide a compact and efficient way of accelerating particle beams to medium and high energies by reusing the same linac for multiple passes. In the conventional scheme, after each pass, the different energy beams coming out of the linac are separated and directed into appropriate arcs for recirculation, with each pass requiring a separate fixed-energy arc. In this paper we present a concept of an RLA return arc based on linear combined-function magnets, in which two and potentially more consecutive passes with very different energies are transported through the same string of magnets. By adjusting the dipole and quadrupole components of the constituting linear combined-function magnets, the arc is designed to be achromatic and to have zero initial and final reference orbit offsets for all transported beam energies. We demonstrate the concept by developing a design for a droplet-shaped return arc for a dogbone RLA capable of transporting two beam passes with momenta different by a factor of 2. We present the results of tracking simulations of the two passes and lay out the path to end-to-end design and simulation of a complete dogbone RLA.
Decentralized Control for Scalable Quadcopter Formations
Directory of Open Access Journals (Sweden)
Qasim Ali
2016-01-01
Full Text Available An innovative framework has been developed for teamwork of two quadcopter formations, each having its specified formation geometry, assigned task, and matching control scheme. Position control for quadcopters in one of the formations has been implemented through a Linear Quadratic Regulator Proportional Integral (LQR PI control scheme based on explicit model following scheme. Quadcopters in the other formation are controlled through LQR PI servomechanism control scheme. These two control schemes are compared in terms of their performance and control effort. Both formations are commanded by respective ground stations through virtual leaders. Quadcopters in formations are able to track desired trajectories as well as hovering at desired points for selected time duration. In case of communication loss between ground station and any of the quadcopters, the neighboring quadcopter provides the command data, received from the ground station, to the affected unit. Proposed control schemes have been validated through extensive simulations using MATLAB®/Simulink® that provided favorable results.
Multivariate covariance generalized linear models
DEFF Research Database (Denmark)
Bonat, W. H.; Jørgensen, Bent
2016-01-01
are fitted by using an efficient Newton scoring algorithm based on quasi-likelihood and Pearson estimating functions, using only second-moment assumptions. This provides a unified approach to a wide variety of types of response variables and covariance structures, including multivariate extensions......We propose a general framework for non-normal multivariate data analysis called multivariate covariance generalized linear models, designed to handle multivariate response variables, along with a wide range of temporal and spatial correlation structures defined in terms of a covariance link...... function combined with a matrix linear predictor involving known matrices. The method is motivated by three data examples that are not easily handled by existing methods. The first example concerns multivariate count data, the second involves response variables of mixed types, combined with repeated...
Systems of Inhomogeneous Linear Equations
Scherer, Philipp O. J.
Many problems in physics and especially computational physics involve systems of linear equations which arise e.g. from linearization of a general nonlinear problem or from discretization of differential equations. If the dimension of the system is not too large standard methods like Gaussian elimination or QR decomposition are sufficient. Systems with a tridiagonal matrix are important for cubic spline interpolation and numerical second derivatives. They can be solved very efficiently with a specialized Gaussian elimination method. Practical applications often involve very large dimensions and require iterative methods. Convergence of Jacobi and Gauss-Seidel methods is slow and can be improved by relaxation or over-relaxation. An alternative for large systems is the method of conjugate gradients.
Linear accelerator for radioisotope production
International Nuclear Information System (INIS)
Hansborough, L.D.; Hamm, R.W.; Stovall, J.E.
1982-02-01
A 200- to 500-μA source of 70- to 90-MeV protons would be a valuable asset to the nuclear medicine program. A linear accelerator (linac) can achieve this performance, and it can be extended to even higher energies and currents. Variable energy and current options are available. A 70-MeV linac is described, based on recent innovations in linear accelerator technology; it would be 27.3 m long and cost approx. $6 million. By operating the radio-frequency (rf) power system at a level necessary to produce a 500-μA beam current, the cost of power deposited in the radioisotope-production target is comparable with existing cyclotrons. If the rf-power system is operated at full power, the same accelerator is capable of producing an 1140-μA beam, and the cost per beam watt on the target is less than half that of comparable cyclotrons
Linear regression in astronomy. II
Feigelson, Eric D.; Babu, Gutti J.
1992-01-01
A wide variety of least-squares linear regression procedures used in observational astronomy, particularly investigations of the cosmic distance scale, are presented and discussed. The classes of linear models considered are (1) unweighted regression lines, with bootstrap and jackknife resampling; (2) regression solutions when measurement error, in one or both variables, dominates the scatter; (3) methods to apply a calibration line to new data; (4) truncated regression models, which apply to flux-limited data sets; and (5) censored regression models, which apply when nondetections are present. For the calibration problem we develop two new procedures: a formula for the intercept offset between two parallel data sets, which propagates slope errors from one regression to the other; and a generalization of the Working-Hotelling confidence bands to nonstandard least-squares lines. They can provide improved error analysis for Faber-Jackson, Tully-Fisher, and similar cosmic distance scale relations.
Squares of Random Linear Codes
DEFF Research Database (Denmark)
Cascudo Pueyo, Ignacio; Cramer, Ronald; Mirandola, Diego
2015-01-01
a positive answer, for codes of dimension $k$ and length roughly $\\frac{1}{2}k^2$ or smaller. Moreover, the convergence speed is exponential if the difference $k(k+1)/2-n$ is at least linear in $k$. The proof uses random coding and combinatorial arguments, together with algebraic tools involving the precise......Given a linear code $C$, one can define the $d$-th power of $C$ as the span of all componentwise products of $d$ elements of $C$. A power of $C$ may quickly fill the whole space. Our purpose is to answer the following question: does the square of a code ``typically'' fill the whole space? We give...
Linear inflation from quartic potential
Energy Technology Data Exchange (ETDEWEB)
Kannike, Kristjan; Racioppi, Antonio [National Institute of Chemical Physics and Biophysics,Rävala 10, 10143 Tallinn (Estonia); Raidal, Martti [National Institute of Chemical Physics and Biophysics,Rävala 10, 10143 Tallinn (Estonia); Institute of Physics, University of Tartu,Tartu (Estonia)
2016-01-07
We show that if the inflaton has a non-minimal coupling to gravity and the Planck scale is dynamically generated, the results of Coleman-Weinberg inflation are confined in between two attractor solutions: quadratic inflation, which is ruled out by the recent measurements, and linear inflation which, instead, is in the experimental allowed region. The minimal scenario has only one free parameter — the inflaton’s non-minimal coupling to gravity — that determines all physical parameters such as the tensor-to-scalar ratio and the reheating temperature of the Universe. Should the more precise future measurements of inflationary parameters point towards linear inflation, further interest in scale-invariant scenarios would be motivated.
Computational linear and commutative algebra
Kreuzer, Martin
2016-01-01
This book combines, in a novel and general way, an extensive development of the theory of families of commuting matrices with applications to zero-dimensional commutative rings, primary decompositions and polynomial system solving. It integrates the Linear Algebra of the Third Millennium, developed exclusively here, with classical algorithmic and algebraic techniques. Even the experienced reader will be pleasantly surprised to discover new and unexpected aspects in a variety of subjects including eigenvalues and eigenspaces of linear maps, joint eigenspaces of commuting families of endomorphisms, multiplication maps of zero-dimensional affine algebras, computation of primary decompositions and maximal ideals, and solution of polynomial systems. This book completes a trilogy initiated by the uncharacteristically witty books Computational Commutative Algebra 1 and 2 by the same authors. The material treated here is not available in book form, and much of it is not available at all. The authors continue to prese...
Perspectives on large linear colliders
International Nuclear Information System (INIS)
Richter, B.
1987-11-01
Three main items in the design of large linear colliders are presented. The first is the interrelation of energy and luminosity requirements. These two items impose severe constraints on the accelerator builder who must design a machine to meet the needs of experimentl high energy physics rather than designing a machine for its own sake. An introduction is also given for linear collider design, concentrating on what goes on at the collision point, for still another constraint comes here from the beam-beam interaction which further restricts the choices available to the accelerator builder. The author also gives his impressions of the state of the technology available for building these kinds of machines within the next decade. The paper concludes with a brief recommendation for how we can all get on with the work faster, and hope to realize these machines sooner by working together. 10 refs., 9 figs
Forms and Linear Network Codes
DEFF Research Database (Denmark)
Hansen, Johan P.
We present a general theory to obtain linear network codes utilizing forms and obtain explicit families of equidimensional vector spaces, in which any pair of distinct vector spaces intersect in the same small dimension. The theory is inspired by the methods of the author utilizing the osculating...... spaces of Veronese varieties. Linear network coding transmits information in terms of a basis of a vector space and the information is received as a basis of a possibly altered vector space. Ralf Koetter and Frank R. Kschischang introduced a metric on the set af vector spaces and showed that a minimal...... distance decoder for this metric achieves correct decoding if the dimension of the intersection of the transmitted and received vector space is sufficiently large. The vector spaces in our construction are equidistant in the above metric and the distance between any pair of vector spaces is large making...
Perspectives on large Linear Colliders
International Nuclear Information System (INIS)
Richter, B.
1987-01-01
The accelerator community now generally agrees that the Linear Collider is the most cost-effective technology for reaching much higher energies in the center-of-mass than can be attained in the largest of the e + e - storage rings, LEP. Indeed, even as the first linear collider, the SLC at SLAC, is getting ready to begin operations groups, at SLAC, Novosibirsk, CERN and KEK are doing R and D and conceptual design studies on a next generation machine in the 1 TeV energy region. In this perspectives talk I do not want to restrict my comments to any particular design, and so I will talk about a high-energy machine as the NLC, which is shorthand for the Next Linear Collider, and taken to mean a machine with a center-of-mass energy someplace in the 0.5 to 2 TeV energy range with sufficient luminosity to carry out a meaningful experimental program. I want to discuss three main items with you. The first is the interrelation of energy and luminosity requirements. These two items impose severe constraints on the accelerator builder. Next, I will give an introduction to linear collider design, concentrating on what goes on at the collision point, for still another constraint comes here from the beam-beam interaction which further restricts the choices available to the accelerator builder.Then, I want to give my impressions of the state of the technology available for building these kinds of machines within the next decade
Linear gate with prescaled window
Energy Technology Data Exchange (ETDEWEB)
Koch, J; Bissem, H H; Krause, H; Scobel, W [Hamburg Univ. (Germany, F.R.). 1. Inst. fuer Experimentalphysik
1978-07-15
An electronic circuit is described that combines the features of a linear gate, a single channel analyzer and a prescaler. It allows selection of a pulse height region between two adjustable thresholds and scales the intensity of the spectrum within this window down by a factor 2sup(N) (0<=N<=9), whereas the complementary part of the spectrum is transmitted without being affected.
Stanford Linear Collider magnet positioning
International Nuclear Information System (INIS)
Wand, B.T.
1991-08-01
For the installation of the Stanford Linear Collider (SLC) the positioning and alignment of the beam line components was performed in several individual steps. In the following the general procedures for each step are outlined. The calculation of ideal coordinates for the magnets in the entire SLC will be discussed in detail. Special emphasis was given to the mathematical algorithms and geometry used in the programs to calculate these ideal positions. 35 refs., 21 figs
Linear positivity and virtual probability
International Nuclear Information System (INIS)
Hartle, James B.
2004-01-01
We investigate the quantum theory of closed systems based on the linear positivity decoherence condition of Goldstein and Page. The objective of any quantum theory of a closed system, most generally the universe, is the prediction of probabilities for the individual members of sets of alternative coarse-grained histories of the system. Quantum interference between members of a set of alternative histories is an obstacle to assigning probabilities that are consistent with the rules of probability theory. A quantum theory of closed systems therefore requires two elements: (1) a condition specifying which sets of histories may be assigned probabilities and (2) a rule for those probabilities. The linear positivity condition of Goldstein and Page is the weakest of the general conditions proposed so far. Its general properties relating to exact probability sum rules, time neutrality, and conservation laws are explored. Its inconsistency with the usual notion of independent subsystems in quantum mechanics is reviewed. Its relation to the stronger condition of medium decoherence necessary for classicality is discussed. The linear positivity of histories in a number of simple model systems is investigated with the aim of exhibiting linearly positive sets of histories that are not decoherent. The utility of extending the notion of probability to include values outside the range of 0-1 is described. Alternatives with such virtual probabilities cannot be measured or recorded, but can be used in the intermediate steps of calculations of real probabilities. Extended probabilities give a simple and general way of formulating quantum theory. The various decoherence conditions are compared in terms of their utility for characterizing classicality and the role they might play in further generalizations of quantum mechanics
Order-constrained linear optimization.
Tidwell, Joe W; Dougherty, Michael R; Chrabaszcz, Jeffrey S; Thomas, Rick P
2017-11-01
Despite the fact that data and theories in the social, behavioural, and health sciences are often represented on an ordinal scale, there has been relatively little emphasis on modelling ordinal properties. The most common analytic framework used in psychological science is the general linear model, whose variants include ANOVA, MANOVA, and ordinary linear regression. While these methods are designed to provide the best fit to the metric properties of the data, they are not designed to maximally model ordinal properties. In this paper, we develop an order-constrained linear least-squares (OCLO) optimization algorithm that maximizes the linear least-squares fit to the data conditional on maximizing the ordinal fit based on Kendall's τ. The algorithm builds on the maximum rank correlation estimator (Han, 1987, Journal of Econometrics, 35, 303) and the general monotone model (Dougherty & Thomas, 2012, Psychological Review, 119, 321). Analyses of simulated data indicate that when modelling data that adhere to the assumptions of ordinary least squares, OCLO shows minimal bias, little increase in variance, and almost no loss in out-of-sample predictive accuracy. In contrast, under conditions in which data include a small number of extreme scores (fat-tailed distributions), OCLO shows less bias and variance, and substantially better out-of-sample predictive accuracy, even when the outliers are removed. We show that the advantages of OCLO over ordinary least squares in predicting new observations hold across a variety of scenarios in which researchers must decide to retain or eliminate extreme scores when fitting data. © 2017 The British Psychological Society.
Segmented rail linear induction motor
Cowan, Jr., Maynard; Marder, Barry M.
1996-01-01
A segmented rail linear induction motor has a segmented rail consisting of a plurality of nonferrous electrically conductive segments aligned along a guideway. The motor further includes a carriage including at least one pair of opposed coils fastened to the carriage for moving the carriage. A power source applies an electric current to the coils to induce currents in the conductive surfaces to repel the coils from adjacent edges of the conductive surfaces.
Linear polarization of BY Draconis
International Nuclear Information System (INIS)
Koch, R.H.; Pfeiffer, R.J.
1976-01-01
Linear polarization measurements are reported in four bandpasses for the flare star BY Dra. The red polarization is intrinsically variable at a confidence level greater than 99 percent. On a time scale of many months, the variability is not phase-locked to either a rotational or a Keplerian ephemeris. The observations of the three other bandpasses are useful principally to indicate a polarization spectrum rising toward shorter wavelengths
Linear morphea with secondary mucinosis
Directory of Open Access Journals (Sweden)
Khandpur Sujay
2009-01-01
Full Text Available Secondary mucin deposition in the skin is a common feature of lupus erythematosus and dermatomyositis. In scleroderma, it occurs uncommonly or in small amount. We describe a 7-year-old boy with progressive, linear, bound-down plaques involving the thighs, lower abdomen and back with no systemic involvement. Histopathology showed features of scleroderma with abundant mucin deposition in the reticular dermis. This report highlights excessive mucin deposition in lesions of morphea.
Cast dielectric composite linear accelerator
Sanders, David M [Livermore, CA; Sampayan, Stephen [Manteca, CA; Slenes, Kirk [Albuquerque, NM; Stoller, H M [Albuquerque, NM
2009-11-10
A linear accelerator having cast dielectric composite layers integrally formed with conductor electrodes in a solventless fabrication process, with the cast dielectric composite preferably having a nanoparticle filler in an organic polymer such as a thermosetting resin. By incorporating this cast dielectric composite the dielectric constant of critical insulating layers of the transmission lines of the accelerator are increased while simultaneously maintaining high dielectric strengths for the accelerator.
Introduction to Microwave Linear [Accelerators
Energy Technology Data Exchange (ETDEWEB)
Whittum, David H
1999-01-04
The elements of microwave linear accelerators are introduced starting with the principles of acceleration and accelerating structures. Considerations for microwave structure modeling and design are developed from an elementary point of view. Basic elements of microwave electronics are described for application to the accelerator circuit and instrumentation. Concepts of beam physics are explored together with examples of common beamline instruments. Charged particle optics and lattice diagnostics are introduced. Considerations for fixed-target and colliding-beam experimentation are summarized.
Positive Quasi Linear Operator Formulation
International Nuclear Information System (INIS)
Berry, L.A.; Jaeger, E.F.
2005-01-01
Expressions for the RF quasi-linear operator are biquadratic sums over the Fourier modes (or FLR equivalent) that describe the RF electric field with a kernel that is a function of the two wave vectors, k-vector L and k-vector R , in the sum. As a result of either an implicit or explicit average over field lines or flux surfaces, this kernel only depends on one parallel wave vector, conventionally k R -vector. When k-vector is an independent component of the representation for E, the sums are demonstrably positive. However, except for closed field line systems, k-vector is dependent on the local direction of the equilibrium magnetic field, and, empirically, the absorbed energy and quasi-linear diffusion coefficients are observed to have negative features. We have formally introduced an independent k-vector sum by Fourier transforming the RF electric field (assuming straight field lines) using a field-line-length coordinate. The resulting expression is positive. We have modeled this approach by calculating the quasi linear operator for 'modes' with fixed k-vector. We form these modes by discretizing k-vector and then assigning all of the Fourier components with k-vectorthat fall within a given k-vector bin to that k-vector mode. Results will be shown as a function of the number of bins. Future work will involve implementing the expressions derived from the Fourier transform and evaluating the dependence on field line length
BLAS- BASIC LINEAR ALGEBRA SUBPROGRAMS
Krogh, F. T.
1994-01-01
The Basic Linear Algebra Subprogram (BLAS) library is a collection of FORTRAN callable routines for employing standard techniques in performing the basic operations of numerical linear algebra. The BLAS library was developed to provide a portable and efficient source of basic operations for designers of programs involving linear algebraic computations. The subprograms available in the library cover the operations of dot product, multiplication of a scalar and a vector, vector plus a scalar times a vector, Givens transformation, modified Givens transformation, copy, swap, Euclidean norm, sum of magnitudes, and location of the largest magnitude element. Since these subprograms are to be used in an ANSI FORTRAN context, the cases of single precision, double precision, and complex data are provided for. All of the subprograms have been thoroughly tested and produce consistent results even when transported from machine to machine. BLAS contains Assembler versions and FORTRAN test code for any of the following compilers: Lahey F77L, Microsoft FORTRAN, or IBM Professional FORTRAN. It requires the Microsoft Macro Assembler and a math co-processor. The PC implementation allows individual arrays of over 64K. The BLAS library was developed in 1979. The PC version was made available in 1986 and updated in 1988.
Test accelerator for linear collider
International Nuclear Information System (INIS)
Takeda, S.; Akai, K.; Akemoto, M.; Araki, S.; Hayano, H.; Hugo, T.; Ishihara, N.; Kawamoto, T.; Kimura, Y.; Kobayashi, H.; Kubo, T.; Kurokawa, S.; Matsumoto, H.; Mizuno, H.; Odagiri, J.; Otake, Y.; Sakai, H.; Shidara, T.; Shintake, T.; Suetake, M.; Takashima, T.; Takata, K.; Takeuchi, Y.; Urakawa, J.; Yamamoto, N.; Yokoya, K.; Yoshida, M.; Yoshioka, M.; Yamaoka, Y.
1989-01-01
KEK has proposed to build Test Accelerator Facility (TAF) capable of producing a 2.5 GeV electron beam for the purpose of stimulating R ampersand D for linear collider in TeV region. The TAF consists of a 1.5 GeV S-band linear accelerator, 1.5 GeV damping ring and 1.0 GeV X-band linear accelerator. The TAF project will be carried forward in three phases. Through Phase-I and Phase-II, the S-band and X-band linacs will be constructed, and in Phase-III, the damping ring will be completed. The construction of TAF Phase-I has started, and the 0.2 GeV S-band injector linac has been almost completed. The Phase-I linac is composed of a 240 keV electron gun, subharmonic bunchers, prebunchers and traveling buncher followed by high-gradient accelerating structures. The SLAC 5045 klystrons are driven at 450 kV in order to obtain the rf-power of 100 MW in a 1 μs pulse duration. The rf-power from a pair of klystrons are combined into an accelerating structure. The accelerating gradient up to 100 MeV/m will be obtained in a 0.6 m long structure. 5 refs., 3 figs., 2 tabs
Orthogonal sparse linear discriminant analysis
Liu, Zhonghua; Liu, Gang; Pu, Jiexin; Wang, Xiaohong; Wang, Haijun
2018-03-01
Linear discriminant analysis (LDA) is a linear feature extraction approach, and it has received much attention. On the basis of LDA, researchers have done a lot of research work on it, and many variant versions of LDA were proposed. However, the inherent problem of LDA cannot be solved very well by the variant methods. The major disadvantages of the classical LDA are as follows. First, it is sensitive to outliers and noises. Second, only the global discriminant structure is preserved, while the local discriminant information is ignored. In this paper, we present a new orthogonal sparse linear discriminant analysis (OSLDA) algorithm. The k nearest neighbour graph is first constructed to preserve the locality discriminant information of sample points. Then, L2,1-norm constraint on the projection matrix is used to act as loss function, which can make the proposed method robust to outliers in data points. Extensive experiments have been performed on several standard public image databases, and the experiment results demonstrate the performance of the proposed OSLDA algorithm.
Core seismic behaviour: linear and non-linear models
International Nuclear Information System (INIS)
Bernard, M.; Van Dorsselaere, M.; Gauvain, M.; Jenapierre-Gantenbein, M.
1981-08-01
The usual methodology for the core seismic behaviour analysis leads to a double complementary approach: to define a core model to be included in the reactor-block seismic response analysis, simple enough but representative of basic movements (diagrid or slab), to define a finer core model, with basic data issued from the first model. This paper presents the history of the different models of both kinds. The inert mass model (IMM) yielded a first rough diagrid movement. The direct linear model (DLM), without shocks and with sodium as an added mass, let to two different ones: DLM 1 with independent movements of the fuel and radial blanket subassemblies, and DLM 2 with a core combined movement. The non-linear (NLM) ''CORALIE'' uses the same basic modelization (Finite Element Beams) but accounts for shocks. It studies the response of a diameter on flats and takes into account the fluid coupling and the wrapper tube flexibility at the pad level. Damping consists of one modal part of 2% and one part due to shocks. Finally, ''CORALIE'' yields the time-history of the displacements and efforts on the supports, but damping (probably greater than 2%) and fluid-structures interaction are still to be precised. The validation experiments were performed on a RAPSODIE core mock-up on scale 1, in similitude of 1/3 as to SPX 1. The equivalent linear model (ELM) was developed for the SPX 1 reactor-block response analysis and a specified seismic level (SB or SM). It is composed of several oscillators fixed to the diagrid and yields the same maximum displacements and efforts than the NLM. The SPX 1 core seismic analysis with a diagrid input spectrum which corresponds to a 0,1 g group acceleration, has been carried out with these models: some aspects of these calculations are presented here
Lifescience Database Archive (English)
Full Text Available 5215 |pid:none) Lymphocytic choriomeningitis virus... 39 0.20 AE014187_324( AE014187 |pid:none) Plasmodium f...alciparum 3D7 chromo... 37 0.75 EU480452_2( EU480452 |pid:none) Lymphocytic choriomeningitis... virus... 36 1.3 AF325214_2( AF325214 |pid:none) Lymphocytic choriomeningitis virus... 36 1.7 ( P...09992 ) RecName: Full=Nucleoprotein; AltName: Full=Nucleocapsid... 35 2.2 Y16308_1( Y16308 |pid:none) Lymphocytic choriomeningitis
Lifescience Database Archive (English)
Full Text Available Sampling_GS-28-01-01-1... 44 6e-04 2 ( FG288581 ) 1108793272353 New World Screwworm Egg 9261 ESTs C... 42 0....004 2 ( FG297256 ) 1108793275648 New World Screwworm Larvae 9387 EST... 42 0.004 2 ( AC196929 ) Gallus gallu
Lifescience Database Archive (English)
Full Text Available ilaanql qklkngesitsigssssssssslasspltfsaggggggsyspmfnfsaisiraptgiddm vskqkghlynyygqqqhshyhhgyqhhnihqtygshpndvi...ghlynyygqqqhshyhhgyqhhnihqtygshpndvitydpnlclldpnnskiydy yrqqysdl*yrwgsfrkesrgieiyst*gsr*gy*fln*mykmq*kvk*lll
Lifescience Database Archive (English)
Full Text Available ence ---IPPPFIPNVKGSADTSKIDPVFTDEAPSLTMAGECALNPQQQKDFEGFTYVAESEHL R*i**milk** Translated Amino Acid sequence... (All Frames) Frame A: ---IPPPFIPNVKGSADTSKIDPVFTDEAPSLTMAGECALNPQQQKDFEGFTYVAESEHL R*i**milk
Schwinger mechanism in linear covariant gauges
Aguilar, A. C.; Binosi, D.; Papavassiliou, J.
2017-02-01
In this work we explore the applicability of a special gluon mass generating mechanism in the context of the linear covariant gauges. In particular, the implementation of the Schwinger mechanism in pure Yang-Mills theories hinges crucially on the inclusion of massless bound-state excitations in the fundamental nonperturbative vertices of the theory. The dynamical formation of such excitations is controlled by a homogeneous linear Bethe-Salpeter equation, whose nontrivial solutions have been studied only in the Landau gauge. Here, the form of this integral equation is derived for general values of the gauge-fixing parameter, under a number of simplifying assumptions that reduce the degree of technical complexity. The kernel of this equation consists of fully dressed gluon propagators, for which recent lattice data are used as input, and of three-gluon vertices dressed by a single form factor, which is modeled by means of certain physically motivated Ansätze. The gauge-dependent terms contributing to this kernel impose considerable restrictions on the infrared behavior of the vertex form factor; specifically, only infrared finite Ansätze are compatible with the existence of nontrivial solutions. When such Ansätze are employed, the numerical study of the integral equation reveals a continuity in the type of solutions as one varies the gauge-fixing parameter, indicating a smooth departure from the Landau gauge. Instead, the logarithmically divergent form factor displaying the characteristic "zero crossing," while perfectly consistent in the Landau gauge, has to undergo a dramatic qualitative transformation away from it, in order to yield acceptable solutions. The possible implications of these results are briefly discussed.
A review of linear compressors for refrigeration
Liang, Kun
2017-01-01
Linear compressor has no crank mechanism compared with conventional reciprocating compressor. This allows higher efficiency, oil-free operation, lower cost and smaller size when linear compressors are used for vapour compression refrigeration (VCR) system. Typically, a linear compressor consists of a linear motor (connected to a piston) and suspension springs, operated at resonant frequency. This paper presents a review of linear compressors for refrigeration system. Different designs and mod...
A Trivial Linear Discriminant Function
Directory of Open Access Journals (Sweden)
Shuichi Shinmura
2015-11-01
Full Text Available In this paper, we focus on the new model selection procedure of the discriminant analysis. Combining re-sampling technique with k-fold cross validation, we develop a k-fold cross validation for small sample method. By this breakthrough, we obtain the mean error rate in the validation samples (M2 and the 95\\% confidence interval (CI of discriminant coefficient. Moreover, we propose the model selection procedure in which the model having a minimum M2 was chosen to the best model. We apply this new method and procedure to the pass/ fail determination of exam scores. In this case, we fix the constant =1 for seven linear discriminant functions (LDFs and several good results were obtained as follows: 1 M2 of Fisher's LDF are over 4.6\\% worse than Revised IP-OLDF. 2 A soft-margin SVM for penalty c=1 (SVM1 is worse than another mathematical programming (MP based LDFs and logistic regression . 3 The 95\\% CI of the best discriminant coefficients was obtained. Seven LDFs except for Fisher's LDF are almost the same as a trivial LDF for the linear separable model. Furthermore, if we choose the median of the coefficient of seven LDFs except for Fisher's LDF, those are almost the same as the trivial LDF for the linear separable model.
ESPRIT And Uniform Linear Arrays
Roy, R. H.; Goldburg, M.; Ottersten, B. E.; Swindlehurst, A. L.; Viberg, M.; Kailath, T.
1989-11-01
Abstract ¬â€?ESPRIT is a recently developed and patented technique for high-resolution estimation of signal parameters. It exploits an invariance structure designed into the sensor array to achieve a reduction in computational requirements of many orders of magnitude over previous techniques such as MUSIC, Burg's MEM, and Capon's ML, and in addition achieves performance improvement as measured by parameter estimate error variance. It is also manifestly more robust with respect to sensor errors (e.g. gain, phase, and location errors) than other methods as well. Whereas ESPRIT only requires that the sensor array possess a single invariance best visualized by considering two identical but other-wise arbitrary arrays of sensors displaced (but not rotated) with respect to each other, many arrays currently in use in various applications are uniform linear arrays of identical sensor elements. Phased array radars are commonplace in high-resolution direction finding systems, and uniform tapped delay lines (i.e., constant rate A/D converters) are the rule rather than the exception in digital signal processing systems. Such arrays possess many invariances, and are amenable to other types of analysis, which is one of the main reasons such structures are so prevalent. Recent developments in high-resolution algorithms of the signal/noise subspace genre including total least squares (TLS) ESPRIT applied to uniform linear arrays are summarized. ESPRIT is also shown to be a generalization of the root-MUSIC algorithm (applicable only to the case of uniform linear arrays of omni-directional sensors and unimodular cisoids). Comparisons with various estimator bounds, including CramerRao bounds, are presented.
Linearized gyro-kinetic equation
International Nuclear Information System (INIS)
Catto, P.J.; Tsang, K.T.
1976-01-01
An ordering of the linearized Fokker-Planck equation is performed in which gyroradius corrections are retained to lowest order and the radial dependence appropriate for sheared magnetic fields is treated without resorting to a WKB technique. This description is shown to be necessary to obtain the proper radial dependence when the product of the poloidal wavenumber and the gyroradius is large (k rho much greater than 1). A like particle collision operator valid for arbitrary k rho also has been derived. In addition, neoclassical, drift, finite β (plasma pressure/magnetic pressure), and unperturbed toroidal electric field modifications are treated
Matrix algebra for linear models
Gruber, Marvin H J
2013-01-01
Matrix methods have evolved from a tool for expressing statistical problems to an indispensable part of the development, understanding, and use of various types of complex statistical analyses. This evolution has made matrix methods a vital part of statistical education. Traditionally, matrix methods are taught in courses on everything from regression analysis to stochastic processes, thus creating a fractured view of the topic. Matrix Algebra for Linear Models offers readers a unique, unified view of matrix analysis theory (where and when necessary), methods, and their applications. Written f
Fast feedback for linear colliders
International Nuclear Information System (INIS)
Hendrickson, L.; Adolphsen, C.; Allison, S.; Gromme, T.; Grossberg, P.; Himel, T.; Krauter, K.; MacKenzie, R.; Minty, M.; Sass, R.
1995-01-01
A fast feedback system provides beam stabilization for the SLC. As the SLC is in some sense a prototype for future linear colliders, this system may be a prototype for future feedbacks. The SLC provides a good base of experience for feedback requirements and capabilities as well as a testing ground for performance characteristics. The feedback system controls a wide variety of machine parameters throughout the SLC and associated experiments, including regulation of beam position, angle, energy, intensity and timing parameters. The design and applications of the system are described, in addition to results of recent performance studies
PIGMI linear-accelerator technology
International Nuclear Information System (INIS)
Boyd, T.J.; Crandall, K.R.; Hamm, R.W.
1981-01-01
A new linear-accelerator technology has been developed that makes pi-meson (pion) generation possible for cancer therapy in the setting of a major hospital center. This technology uses several new major inventions in particle accelerator science-such as a new accelerator system called the radio-frequency quadrupole (RFQ), and permanent-magnet drift-tube focusing-to substantially reduce the size, cost, and complexity of a meson factory for this use. This paper describes this technology, discusses other possible uses for these new developments, and finally discusses possible costs for such installations
Beam dynamics in linear colliders
International Nuclear Information System (INIS)
Ruth, R.D.
1990-09-01
In this paper, we discuss some basic beam dynamics issues related to obtaining and preserving the luminosity of a next generation linear collider. The beams are extracted from a damping ring and compressed in length by the first bunch compressor. They are then accelerated in a preaccelerator linac up to an energy appropriate for injection into a high gradient linac. In many designs this pre-acceleration is followed by another bunch compression to reach a short bunch. After acceleration in the linac, the bunches are finally focused transversely to a small spot. 27 refs., 1 fig
Modelling Loudspeaker Non-Linearities
DEFF Research Database (Denmark)
Agerkvist, Finn T.
2007-01-01
This paper investigates different techniques for modelling the non-linear parameters of the electrodynamic loudspeaker. The methods are tested not only for their accuracy within the range of original data, but also for the ability to work reasonable outside that range, and it is demonstrated...... that polynomial expansions are rather poor at this, whereas an inverse polynomial expansion or localized fitting functions such as the gaussian are better suited for modelling the Bl-factor and compliance. For the inductance the sigmoid function is shown to give very good results. Finally the time varying...
Meromorphic functions and linear algebra
Nevanlinna, Olavi
2003-01-01
This volume describes for the first time in monograph form important applications in numerical methods of linear algebra. The author presents new material and extended results from recent papers in a very readable style. The main goal of the book is to study the behavior of the resolvent of a matrix under the perturbation by low rank matrices. Whereas the eigenvalues (the poles of the resolvent) and the pseudospectra (the sets where the resolvent takes large values) can move dramatically under such perturbations, the growth of the resolvent as a matrix-valued meromorphic function remains essen
Linear resonance acceleration of pellets
International Nuclear Information System (INIS)
Mills, R.G.
1978-01-01
A possible requirement for the acceleration of macroscopic pellets to velocities exceeding 10 4 meters per second implies the development of new apparatus. A satisfactory approach might be the linear resonance accelerator. Such apparatus would require the charging of pellets to very high values not yet demonstrated. The incompatibility of phase stability with radial stability in these machines may require abandoning phase stability and adopting feedback control of the accelerating voltage to accommodate statistical fluctuations in the charge to mass ratio of successive pellets
Linear and Nonlinear Finite Elements.
1983-12-01
Metzler. Con/ ugte rapdent solution of a finite element elastic problem with high Poson rato without scaling and once with the global stiffness matrix K...nonzero c, that makes u(0) = 1. According to the linear, small deflection theory of the membrane the central displacement given to the membrane is not... theory is possible based on the approximations (l-y 2 )t = +y’ 2 +y , (1-y)’ 1-y’ 2 - y" (6) that change eq. (5) to V) = , [yŖ(1 + y") - Qy
Gyrokinetic linearized Landau collision operator
DEFF Research Database (Denmark)
Madsen, Jens
2013-01-01
, which is important in multiple ion-species plasmas. Second, the equilibrium operator describes drag and diffusion of the magnetic field aligned component of the vorticity associated with the E×B drift. Therefore, a correct description of collisional effects in turbulent plasmas requires the equilibrium......The full gyrokinetic electrostatic linearized Landau collision operator is calculated including the equilibrium operator, which represents the effect of collisions between gyrokinetic Maxwellian particles. First, the equilibrium operator describes energy exchange between different plasma species...... operator, even for like-particle collisions....
Controlling bistability by linear augmentation
International Nuclear Information System (INIS)
Sharma, Pooja Rani; Shrimali, Manish Dev; Prasad, Awadhesh; Feudel, Ulrike
2013-01-01
In many bistable oscillating systems only one of the attractors is desired to possessing certain system performance. We present a method to drive a bistable system to a desired target attractor by annihilating the other one. This shift from bistability to monostability is achieved by augmentation of the nonlinear oscillator with a linear control system. For a proper choice of the control function one of the attractors disappears at a critical coupling strength in an control-induced boundary crisis. This transition from bistability to monostability is demonstrated with two paradigmatic examples, the autonomous Chua oscillator and a neuronal system with a periodic input signal.
Linear network error correction coding
Guang, Xuan
2014-01-01
There are two main approaches in the theory of network error correction coding. In this SpringerBrief, the authors summarize some of the most important contributions following the classic approach, which represents messages by sequences?similar to algebraic coding,?and also briefly discuss the main results following the?other approach,?that uses the theory of rank metric codes for network error correction of representing messages by subspaces. This book starts by establishing the basic linear network error correction (LNEC) model and then characterizes two equivalent descriptions. Distances an
Linear interaction of gravitational waves
International Nuclear Information System (INIS)
Ciubotariu, C.D.
1992-01-01
Starting with the linearized Einstein equations written in the same form as Maxwell equations, a damping term is found in the wave equation. The analogy with the propagation of the electromagnetic wave in ohmic media is obvious if we introduce an 'ohmic relation' for gravitational interaction. The possibility of the amplification of gravitational waves by a suitable choice of the velocity field of a dust ('dust with negative viscosity'), for example by the use of the free-electron laser principle, is indicated. (Author)
Linear operators in Clifford algebras
International Nuclear Information System (INIS)
Laoues, M.
1991-01-01
We consider the real vector space structure of the algebra of linear endomorphisms of a finite-dimensional real Clifford algebra (2, 4, 5, 6, 7, 8). A basis of that space is constructed in terms of the operators M eI,eJ defined by x→e I .x.e J , where the e I are the generators of the Clifford algebra and I is a multi-index (3, 7). In particular, it is shown that the family (M eI,eJ ) is exactly a basis in the even case. (orig.)
Convex variational problems linear, nearly linear and anisotropic growth conditions
Bildhauer, Michael
2003-01-01
The author emphasizes a non-uniform ellipticity condition as the main approach to regularity theory for solutions of convex variational problems with different types of non-standard growth conditions. This volume first focuses on elliptic variational problems with linear growth conditions. Here the notion of a "solution" is not obvious and the point of view has to be changed several times in order to get some deeper insight. Then the smoothness properties of solutions to convex anisotropic variational problems with superlinear growth are studied. In spite of the fundamental differences, a non-uniform ellipticity condition serves as the main tool towards a unified view of the regularity theory for both kinds of problems.
Quantum algorithm for linear regression
Wang, Guoming
2017-07-01
We present a quantum algorithm for fitting a linear regression model to a given data set using the least-squares approach. Differently from previous algorithms which yield a quantum state encoding the optimal parameters, our algorithm outputs these numbers in the classical form. So by running it once, one completely determines the fitted model and then can use it to make predictions on new data at little cost. Moreover, our algorithm works in the standard oracle model, and can handle data sets with nonsparse design matrices. It runs in time poly( log2(N ) ,d ,κ ,1 /ɛ ) , where N is the size of the data set, d is the number of adjustable parameters, κ is the condition number of the design matrix, and ɛ is the desired precision in the output. We also show that the polynomial dependence on d and κ is necessary. Thus, our algorithm cannot be significantly improved. Furthermore, we also give a quantum algorithm that estimates the quality of the least-squares fit (without computing its parameters explicitly). This algorithm runs faster than the one for finding this fit, and can be used to check whether the given data set qualifies for linear regression in the first place.
Linearity of holographic entanglement entropy
Energy Technology Data Exchange (ETDEWEB)
Almheiri, Ahmed [Stanford Institute for Theoretical Physics, Department of Physics,Stanford University, Stanford, CA 94305 (United States); Dong, Xi [School of Natural Sciences, Institute for Advanced Study,Princeton, NJ 08540 (United States); Swingle, Brian [Stanford Institute for Theoretical Physics, Department of Physics,Stanford University, Stanford, CA 94305 (United States)
2017-02-14
We consider the question of whether the leading contribution to the entanglement entropy in holographic CFTs is truly given by the expectation value of a linear operator as is suggested by the Ryu-Takayanagi formula. We investigate this property by computing the entanglement entropy, via the replica trick, in states dual to superpositions of macroscopically distinct geometries and find it consistent with evaluating the expectation value of the area operator within such states. However, we find that this fails once the number of semi-classical states in the superposition grows exponentially in the central charge of the CFT. Moreover, in certain such scenarios we find that the choice of surface on which to evaluate the area operator depends on the density matrix of the entire CFT. This nonlinearity is enforced in the bulk via the homology prescription of Ryu-Takayanagi. We thus conclude that the homology constraint is not a linear property in the CFT. We also discuss the existence of ‘entropy operators’ in general systems with a large number of degrees of freedom.
Updating Linear Schedules with Lowest Cost: a Linear Programming Model
Biruk, Sławomir; Jaśkowski, Piotr; Czarnigowska, Agata
2017-10-01
Many civil engineering projects involve sets of tasks repeated in a predefined sequence in a number of work areas along a particular route. A useful graphical representation of schedules of such projects is time-distance diagrams that clearly show what process is conducted at a particular point of time and in particular location. With repetitive tasks, the quality of project performance is conditioned by the ability of the planner to optimize workflow by synchronizing the works and resources, which usually means that resources are planned to be continuously utilized. However, construction processes are prone to risks, and a fully synchronized schedule may expire if a disturbance (bad weather, machine failure etc.) affects even one task. In such cases, works need to be rescheduled, and another optimal schedule should be built for the changed circumstances. This typically means that, to meet the fixed completion date, durations of operations have to be reduced. A number of measures are possible to achieve such reduction: working overtime, employing more resources or relocating resources from less to more critical tasks, but they all come at a considerable cost and affect the whole project. The paper investigates the problem of selecting the measures that reduce durations of tasks of a linear project so that the cost of these measures is kept to the minimum and proposes an algorithm that could be applied to find optimal solutions as the need to reschedule arises. Considering that civil engineering projects, such as road building, usually involve less process types than construction projects, the complexity of scheduling problems is lower, and precise optimization algorithms can be applied. Therefore, the authors put forward a linear programming model of the problem and illustrate its principle of operation with an example.
Complexation of Polyelectrolyte Micelles with Oppositely Charged Linear Chains.
Kalogirou, Andreas; Gergidis, Leonidas N; Miliou, Kalliopi; Vlahos, Costas
2017-03-02
The formation of interpolyelectrolyte complexes (IPECs) from linear AB diblock copolymer precursor micelles and oppositely charged linear homopolymers is studied by means of molecular dynamics simulations. All beads of the linear polyelectrolyte (C) are charged with elementary quenched charge +1e, whereas in the diblock copolymer only the solvophilic (A) type beads have quenched charge -1e. For the same Bjerrum length, the ratio of positive to negative charges, Z +/- , of the mixture and the relative length of charged moieties r determine the size of IPECs. We found a nonmonotonic variation of the size of the IPECs with Z +/- . For small Z +/- values, the IPECs retain the size of the precursor micelle, whereas at larger Z +/- values the IPECs decrease in size due to the contraction of the corona and then increase as the aggregation number of the micelle increases. The minimum size of the IPECs is obtained at lower Z +/- values when the length of the hydrophilic block of the linear diblock copolymer decreases. The aforementioned findings are in agreement with experimental results. At a smaller Bjerrum length, we obtain the same trends but at even smaller Z +/- values. The linear homopolymer charged units are distributed throughout the corona.
Positronium formation at low temperatures: The role of trapped electrons
DEFF Research Database (Denmark)
Hirade, T.; Maurer, F.H.J.; Eldrup, Morten Mostgaard
2000-01-01
Measurements have been carried out of electron spin densities (by electron spin resonance technique) and positronium (Ps) formation probability as functions of Co-60 gamma-irradiation dose in poly(methyl methacrylate) and linear poly(ethylene) at 77 K. We observe a linear relationship between...
Material testing in a linear theta pinch
International Nuclear Information System (INIS)
Alani, R.; Azodi, H.; Naraghi, M.; Safaii, B.; Torabi-Fard, A.
1983-01-01
The interaction of stainless steel 316 and Inconel 625 alloys has been investigated with a thermonuclear-like plasma, n = 10 16 cm -3 and Tsub(i) = 1 keV, generated in the Alvand I linear theta pinch. The average power flux is 10 7 W/cm 2 and the interaction time nearly one μs. A theoretical analysis based on the formation of an observed impurity layer near the material, has been used to determine the properties of the impurity layer and the extent of the damage on the material. Although arcing has been observed, the dominant damage mechanism has been assessed to be due to evaporation. Exposure to single shots has produced very heavily defective areas and even surface cracks on the SS 316 sample, but no cracks were observed on Inconel 625 after exposure to even 18 shots. On the basis of temperature rise and evaporation a comparison is made among materials exposed to plasmas of a theta pinch, shock tube, present generation tokamak and an anticipated tokamak reactor. (orig.)
Linear accelerator for burner-reactor
International Nuclear Information System (INIS)
Batskikh, G.I.; Murin, B.P.; Fedotov, A.P.
1991-01-01
Future development of nuclear power engineering depends on the successful solution of two key problems of safety and utilization of high level radioactive wastes (HLRW) of atomic power plants (APP). Modern methods of HLRW treatment involve solidification, preliminary storing for a period of 30-50 years necessary for the decay of long-living nuclides and final burial in geological formations several hundred meters below the ground surface. The depth burial of the radioactive wastes requires complicated under ground constructions. It's very expensive and doesn't meet modern ecological requirements. Alternative modern and more reasonable methods of APP HLRW treatment are under consideration now. One of the methods involves separation of APP waste radionuclides for use in economy with subsequent transmutation of the long-living isotopes into the short-living ones by high-intensity neutron fluxes generated by proton accelerators. The installation intended for the long-living radionuclides transmutation into the short-living ones is called burner-reactor. It can be based on the continuous regime proton accelerator with 1.5 GeV energy, 0.3 A current and beam mean power of 450 MW. The preferable type of the proton accelerator with the aforementioned parameters is the linear accelerator
Multicollinearity in hierarchical linear models.
Yu, Han; Jiang, Shanhe; Land, Kenneth C
2015-09-01
This study investigates an ill-posed problem (multicollinearity) in Hierarchical Linear Models from both the data and the model perspectives. We propose an intuitive, effective approach to diagnosing the presence of multicollinearity and its remedies in this class of models. A simulation study demonstrates the impacts of multicollinearity on coefficient estimates, associated standard errors, and variance components at various levels of multicollinearity for finite sample sizes typical in social science studies. We further investigate the role multicollinearity plays at each level for estimation of coefficient parameters in terms of shrinkage. Based on these analyses, we recommend a top-down method for assessing multicollinearity in HLMs that first examines the contextual predictors (Level-2 in a two-level model) and then the individual predictors (Level-1) and uses the results for data collection, research problem redefinition, model re-specification, variable selection and estimation of a final model. Copyright © 2015 Elsevier Inc. All rights reserved.
Experimental Approaches at Linear Colliders
International Nuclear Information System (INIS)
Jaros, John A
2002-01-01
Precision measurements have played a vital role in our understanding of elementary particle physics. Experiments performed using e + e - collisions have contributed an essential part. Recently, the precision measurements at LEP and SLC have probed the standard model at the quantum level and severely constrained the mass of the Higgs boson [1]. Coupled with the limits on the Higgs mass from direct searches [2], this enables the mass to be constrained to be in the range 115-205 GeV. Developments in accelerator R and D have matured to the point where one could contemplate construction of a linear collider with initial energy in the 500 GeV range and a credible upgrade path to ∼ 1 TeV. Now is therefore the correct time to critically evaluate the case for such a facility
Linear regression in astronomy. I
Isobe, Takashi; Feigelson, Eric D.; Akritas, Michael G.; Babu, Gutti Jogesh
1990-01-01
Five methods for obtaining linear regression fits to bivariate data with unknown or insignificant measurement errors are discussed: ordinary least-squares (OLS) regression of Y on X, OLS regression of X on Y, the bisector of the two OLS lines, orthogonal regression, and 'reduced major-axis' regression. These methods have been used by various researchers in observational astronomy, most importantly in cosmic distance scale applications. Formulas for calculating the slope and intercept coefficients and their uncertainties are given for all the methods, including a new general form of the OLS variance estimates. The accuracy of the formulas was confirmed using numerical simulations. The applicability of the procedures is discussed with respect to their mathematical properties, the nature of the astronomical data under consideration, and the scientific purpose of the regression. It is found that, for problems needing symmetrical treatment of the variables, the OLS bisector performs significantly better than orthogonal or reduced major-axis regression.
Decomposable log-linear models
DEFF Research Database (Denmark)
Eriksen, Poul Svante
can be characterized by a structured set of conditional independencies between some variables given some other variables. We term the new model class decomposable log-linear models, which is illustrated to be a much richer class than decomposable graphical models.It covers a wide range of non...... The present paper considers discrete probability models with exact computational properties. In relation to contingency tables this means closed form expressions of the maksimum likelihood estimate and its distribution. The model class includes what is known as decomposable graphicalmodels, which......-hierarchical models, models with structural zeroes, models described by quasi independence and models for level merging. Also, they have a very natural interpretation as they may be formulated by a structured set of conditional independencies between two events given some other event. In relation to contingency...
Computational aspects of linear control
2002-01-01
Many devices (we say dynamical systems or simply systems) behave like black boxes: they receive an input, this input is transformed following some laws (usually a differential equation) and an output is observed. The problem is to regulate the input in order to control the output, that is for obtaining a desired output. Such a mechanism, where the input is modified according to the output measured, is called feedback. The study and design of such automatic processes is called control theory. As we will see, the term system embraces any device and control theory has a wide variety of applications in the real world. Control theory is an interdisci plinary domain at the junction of differential and difference equations, system theory and statistics. Moreover, the solution of a control problem involves many topics of numerical analysis and leads to many interesting computational problems: linear algebra (QR, SVD, projections, Schur complement, structured matrices, localization of eigenvalues, computation of the...
Nonabelian Gauged Linear Sigma Model
Institute of Scientific and Technical Information of China (English)
Yongbin RUAN
2017-01-01
The gauged linear sigma model (GLSM for short) is a 2d quantum field theory introduced by Witten twenty years ago.Since then,it has been investigated extensively in physics by Hori and others.Recently,an algebro-geometric theory (for both abelian and nonabelian GLSMs) was developed by the author and his collaborators so that he can start to rigorously compute its invariants and check against physical predications.The abelian GLSM was relatively better understood and is the focus of current mathematical investigation.In this article,the author would like to look over the horizon and consider the nonabelian GLSM.The nonabelian case possesses some new features unavailable to the abelian GLSM.To aid the future mathematical development,the author surveys some of the key problems inspired by physics in the nonabelian GLSM.
Dietary arginine and linear growth
DEFF Research Database (Denmark)
van Vught, Anneke J A H; Dagnelie, Pieter C; Arts, Ilja C W
2013-01-01
Child Intervention Study during 2001-2 (baseline), and at 3-year and 7-year follow-up, were used. Arginine intake was estimated via a 7 d precoded food diary at baseline and 3-year follow-up. Data were analysed in a multilevel structure in which children were embedded within schools. Random intercept......The amino acid arginine is a well-known growth hormone (GH) stimulator and GH is an important modulator of linear growth. The aim of the present study was to investigate the effect of dietary arginine on growth velocity in children between 7 and 13 years of age. Data from the Copenhagen School...... and slopes were defined to estimate the association between arginine intake and growth velocity, including the following covariates: sex; age; baseline height; energy intake; puberty stage at 7-year follow-up and intervention/control group. The association between arginine intake and growth velocity...
An Ordering Linear Unification Algorithm
Institute of Scientific and Technical Information of China (English)
胡运发
1989-01-01
In this paper,we present an ordering linear unification algorithm(OLU).A new idea on substituteion of the binding terms is introduced to the algorithm,which is able to overcome some drawbacks of other algorithms,e.g.,MM algorithm[1],RG1 and RG2 algorithms[2],Particularly,if we use the directed eyclie graphs,the algoritm needs not check the binding order,then the OLU algorithm can also be aplied to the infinite tree data struceture,and a higher efficiency can be expected.The paper focuses upon the discussion of OLU algorithm and a partial order structure with respect to the unification algorithm.This algorithm has been implemented in the GKD-PROLOG/VAX 780 interpreting system.Experimental results have shown that the algorithm is very simple and efficient.
DEFF Research Database (Denmark)
Du, Yigang
.3% relative to the measurement from a 1 inch diameter transducer. A preliminary study for harmonic imaging using synthetic aperture sequential beamforming (SASB) has been demonstrated. A wire phantom underwater measurement is made by an experimental synthetic aperture real-time ultrasound scanner (SARUS......) with a linear array transducer. The second harmonic imaging is obtained by a pulse inversion technique. The received data is beamformed by the SASB using a Beamformation Toolbox. In the measurements the lateral resolution at -6 dB is improved by 66% compared to the conventional imaging algorithm. There is also...... a 35% improvement for the lateral resolution at -6 dB compared with the sole harmonic imaging and a 46% improvement compared with merely using the SASB....
Linear rotary optical delay lines
Guerboukha, Hichem; Qu, Hang; Skorobogatiy, Maksim
2016-03-01
We present a semi-analytical solution for the design of a high-speed rotary optical delay line that use a combination of two rotating curvilinear reflectors. We demonstrate that it is possible to design an infinite variety of the optical delay lines featuring linear dependence of the optical delay on the rotation angle. This is achieved via shape optimization of the rotating reflector surfaces. Moreover, a convenient spatial separation of the incoming and outgoing beams is possible. For the sake of example, we present blades that fit into a circle of 10cm diameter. Finally, a prototype of a rotary delay line is fabricated using CNC machining, and its optical properties are characterized.
Dark matter wants Linear Collider
International Nuclear Information System (INIS)
Matsumoto, S.; Asano, M.; Fujii, K.; Takubo, Y.; Honda, T.; Saito, T.; Yamamoto, H.; Humdi, R.S.; Ito, H.; Kanemura, S; Nabeshima, T.; Okada, N.; Suehara, T.
2011-01-01
One of the main purposes of physics at the International Linear Collider (ILC) is to study the property of dark matter such as its mass, spin, quantum numbers, and interactions with particles of the standard model. We discuss how the property can or cannot be investigated at the ILC using two typical cases of dark matter scenario: 1) most of new particles predicted in physics beyond the standard model are heavy and only dark matter is accessible at the ILC, and 2) not only dark matter but also other new particles are accessible at the ILC. We find that, as can be easily imagined, dark matter can be detected without any difficulties in the latter case. In the former case, it is still possible to detect dark matter when the mass of dark matter is less than a half mass of the Higgs boson.
28th Linear Accelerator Conference
Facco, Alberto; McCausey, Amy; Schaa, Volker R W
2017-01-01
The 28th Linear Accelerator Conference, LINAC 16, to take place at the Kellogg Hotel and Conference Center in East Lansing, Michigan, on 25-30 September 2016. This conference is the main bi-yearly gathering for the world-wide community of linac specialists. It provides a unique opportunity to hear about the latest advances of projects and developments concerning hadron and lepton linacs, and their applications. In the tradition of previous LINAC conferences, plenary sessions including invited speakers are scheduled every day. Poster sessions will be held on Monday, Tuesday and Thursday afternoons. There will also be two special events on Sunday, 25 September 2016, namely a student poster session and an evening reception for registrants and their companions at the Kellogg Hotel and Conference Center. Participants are also warmly invited to join an outing to Lake Michigan and the beautiful surroundings on Wednesday afternoon, and to visit the Facility for Rare Isotope Beams on Friday afternoon, after the formal...
Crab cavities for linear colliders
Burt, G; Carter, R; Dexter, A; Tahir, I; Beard, C; Dykes, M; Goudket, P; Kalinin, A; Ma, L; McIntosh, P; Shulte, D; Jones, Roger M; Bellantoni, L; Chase, B; Church, M; Khabouline, T; Latina, A; Adolphsen, C; Li, Z; Seryi, Andrei; Xiao, L
2008-01-01
Crab cavities have been proposed for a wide number of accelerators and interest in crab cavities has recently increased after the successful operation of a pair of crab cavities in KEK-B. In particular crab cavities are required for both the ILC and CLIC linear colliders for bunch alignment. Consideration of bunch structure and size constraints favour a 3.9 GHz superconducting, multi-cell cavity as the solution for ILC, whilst bunch structure and beam-loading considerations suggest an X-band copper travelling wave structure for CLIC. These two cavity solutions are very different in design but share complex design issues. Phase stabilisation, beam loading, wakefields and mode damping are fundamental issues for these crab cavities. Requirements and potential design solutions will be discussed for both colliders.
Linear parallel processing machines I
Energy Technology Data Exchange (ETDEWEB)
Von Kunze, M
1984-01-01
As is well-known, non-context-free grammars for generating formal languages happen to be of a certain intrinsic computational power that presents serious difficulties to efficient parsing algorithms as well as for the development of an algebraic theory of contextsensitive languages. In this paper a framework is given for the investigation of the computational power of formal grammars, in order to start a thorough analysis of grammars consisting of derivation rules of the form aB ..-->.. A/sub 1/ ... A /sub n/ b/sub 1/...b /sub m/ . These grammars may be thought of as automata by means of parallel processing, if one considers the variables as operators acting on the terminals while reading them right-to-left. This kind of automata and their 2-dimensional programming language prove to be useful by allowing a concise linear-time algorithm for integer multiplication. Linear parallel processing machines (LP-machines) which are, in their general form, equivalent to Turing machines, include finite automata and pushdown automata (with states encoded) as special cases. Bounded LP-machines yield deterministic accepting automata for nondeterministic contextfree languages, and they define an interesting class of contextsensitive languages. A characterization of this class in terms of generating grammars is established by using derivation trees with crossings as a helpful tool. From the algebraic point of view, deterministic LP-machines are effectively represented semigroups with distinguished subsets. Concerning the dualism between generating and accepting devices of formal languages within the algebraic setting, the concept of accepting automata turns out to reduce essentially to embeddability in an effectively represented extension monoid, even in the classical cases.
Voltage linear transformation circuit design
Sanchez, Lucas R. W.; Jin, Moon-Seob; Scott, R. Phillip; Luder, Ryan J.; Hart, Michael
2017-09-01
Many engineering projects require automated control of analog voltages over a specified range. We have developed a computer interface comprising custom hardware and MATLAB code to provide real-time control of a Thorlabs adaptive optics (AO) kit. The hardware interface includes an op amp cascade to linearly shift and scale a voltage range. With easy modifications, any linear transformation can be accommodated. In AO applications, the design is suitable to drive a range of different types of deformable and fast steering mirrors (FSM's). Our original motivation and application was to control an Optics in Motion (OIM) FSM which requires the customer to devise a unique interface to supply voltages to the mirror controller to set the mirror's angular deflection. The FSM is in an optical servo loop with a wave front sensor (WFS), which controls the dynamic behavior of the mirror's deflection. The code acquires wavefront data from the WFS and fits a plane, which is subsequently converted into its corresponding angular deflection. The FSM provides +/-3° optical angular deflection for a +/-10 V voltage swing. Voltages are applied to the mirror via a National Instruments digital-to-analog converter (DAC) followed by an op amp cascade circuit. This system has been integrated into our Thorlabs AO testbed which currently runs at 11 Hz, but with planned software upgrades, the system update rate is expected to improve to 500 Hz. To show that the FSM subsystem is ready for this speed, we conducted two different PID tuning runs at different step commands. Once 500 Hz is achieved, we plan to make the code and method for our interface solution freely available to the community.
Summary of the Linear Collider Working Group
International Nuclear Information System (INIS)
Ruth, R.D.
1989-01-01
The focus of the Linear Collider Working Group was on a next generation linear collider. Topics discussed are: parameters; damping rings; bunch compression and pre-acceleration; linac; final focus; and multibunch effects. 8 refs., 3 figs., 7 tabs
Compact Spectrometers Based on Linear Variable Filters
National Aeronautics and Space Administration — Demonstrate a linear-variable spectrometer with an H2RG array. Linear Variable Filter (LVF) spectrometers provide attractive resource benefits – high optical...
Ranking Forestry Investments With Parametric Linear Programming
Paul A. Murphy
1976-01-01
Parametric linear programming is introduced as a technique for ranking forestry investments under multiple constraints; it combines the advantages of simple tanking and linear programming as capital budgeting tools.
Strings and superstrings. Electron linear colliders
International Nuclear Information System (INIS)
Alessandrini, V.; Bambade, P.; Binetruy, P.; Kounnas, C.; Le Duff, J.; Schwimmer, A.
1989-01-01
Basic string theory; strings in interaction; construction of strings and superstrings in arbitrary space-time dimensions; compactification and phenomenology; linear e+e- colliders; and the Stanford linear collider were discussed [fr
Dynamic linearization system for a radiation gauge
International Nuclear Information System (INIS)
Panarello, J.A.
1977-01-01
The linearization system and process converts a high resolution non-linear analog input signal, representative of the thickness of an object, into a high resolution linear analog output signal suitable for use in driving a variety of output devices. The system requires only a small amount of memory for storing pre-calculated non-linear correction coefficients. The system channels the input signal to separate circuit paths so that it may be used directly to; locate an appropriate correction coefficient; develop a correction term after an appropriate correction coefficient is located; and develop a linearized signal having the same high resolution inherent in the input signal. The system processes the linearized signal to compensate for the possible errors introduced by radiation source noise. The processed linearized signal is the high resolution linear analog output signal which accurately represents the thickness of the object being gauged
A Global algorithm for linear radiosity
Sbert Cassasayas, Mateu; Pueyo Sánchez, Xavier
1993-01-01
A linear algorithm for radiosity is presented, linear both in time and storage. The new algorithm is based on previous work by the authors and on the well known algorithms for progressive radiosity and Monte Carlo particle transport.
Linear superposition solutions to nonlinear wave equations
International Nuclear Information System (INIS)
Liu Yu
2012-01-01
The solutions to a linear wave equation can satisfy the principle of superposition, i.e., the linear superposition of two or more known solutions is still a solution of the linear wave equation. We show in this article that many nonlinear wave equations possess exact traveling wave solutions involving hyperbolic, triangle, and exponential functions, and the suitable linear combinations of these known solutions can also constitute linear superposition solutions to some nonlinear wave equations with special structural characteristics. The linear superposition solutions to the generalized KdV equation K(2,2,1), the Oliver water wave equation, and the k(n, n) equation are given. The structure characteristic of the nonlinear wave equations having linear superposition solutions is analyzed, and the reason why the solutions with the forms of hyperbolic, triangle, and exponential functions can form the linear superposition solutions is also discussed
Resent advance in electron linear accelerators
International Nuclear Information System (INIS)
Takeda, Seishi; Tsumori, Kunihiko; Takamuku, Setsuo; Okada, Toichi; Hayashi, Koichiro; Kawanishi, Masaharu
1986-01-01
In recently constructed electron linear accelerators, there has been remarkable advance both in acceleration of a high-current single bunch electron beam for radiation research and in generation of high accelerating gradient for high energy accelerators. The ISIR single bunch electron linear accelerator has been modified an injector to increase a high-current single bunch charge up to 67 nC, which is ten times greater than the single bunch charge expected in early stage of construction. The linear collider projects require a high accelerating gradient of the order of 100 MeV/m in the linear accelerators. High-current and high-gradient linear accelerators make it possible to obtain high-energy electron beam with small-scale linear accelerators. The advance in linear accelerators stimulates the applications of linear accelerators not only to fundamental research of science but also to industrial uses. (author)
Linear q-nonuniform difference equations
International Nuclear Information System (INIS)
Bangerezako, Gaspard
2010-01-01
We introduce basic concepts of q-nonuniform differentiation and integration and study linear q-nonuniform difference equations and systems, as well as their application in q-nonuniform difference linear control systems. (author)
An introduction to linear algebra and tensors
Akivis, M A; Silverman, Richard A
1978-01-01
Eminently readable, completely elementary treatment begins with linear spaces and ends with analytic geometry, covering multilinear forms, tensors, linear transformation, and more. 250 problems, most with hints and answers. 1972 edition.
Linear quadratic optimization for positive LTI system
Muhafzan, Yenti, Syafrida Wirma; Zulakmal
2017-05-01
Nowaday the linear quadratic optimization subject to positive linear time invariant (LTI) system constitute an interesting study considering it can become a mathematical model of variety of real problem whose variables have to nonnegative and trajectories generated by these variables must be nonnegative. In this paper we propose a method to generate an optimal control of linear quadratic optimization subject to positive linear time invariant (LTI) system. A sufficient condition that guarantee the existence of such optimal control is discussed.
International Nuclear Information System (INIS)
Larson, R.B.
1977-01-01
It is illustrated that a theoretical understanding of the formation and evolution of galaxies depends on an understanding of star formation, and especially of the factors influencing the rate of star formation. Some of the theoretical problems of star formation in galaxies, some approaches that have been considered in models of galaxy evolution, and some possible observational tests that may help to clarify which processes or models are most relevant are reviewed. The material is presented under the following headings: power-law models for star formation, star formation processes (conditions required, ways of achieving these conditions), observational indications and tests, and measures of star formation rates in galaxies. 49 references
Directory of Open Access Journals (Sweden)
Andrej Justinek
1997-01-01
Full Text Available The article argues that the primary aim of adult formation is comprehensive personality development which is supposed to ensure quality existence in modern world. The article also suggests that formarion is a permanent process. Justinek puts special emphasis on adult formation methodology and defines fundamental formation styles which encourage independent action in individuals. Justinek differentiates between formation and education. methods and concludes that formation methods are related to the emotional sphere of personality, and education methods mostly to the rational. Justinek believes that formation of adults is based primarily on appropriate formation methodology.
An Application of Linear Algebra over Lattices
Directory of Open Access Journals (Sweden)
M. Hosseinyazdi
2008-03-01
Full Text Available In this paper, first we consider L n as a semimodule over a complete bounded distributive lattice L. Then we define the basic concepts of module theory for L n. After that, we proved many similar theorems in linear algebra for the space L n. An application of linear algebra over lattices for solving linear systems, was given
Application of linear logic to simulation
Clarke, Thomas L.
1998-08-01
Linear logic, since its introduction by Girard in 1987 has proven expressive and powerful. Linear logic has provided natural encodings of Turing machines, Petri nets and other computational models. Linear logic is also capable of naturally modeling resource dependent aspects of reasoning. The distinguishing characteristic of linear logic is that it accounts for resources; two instances of the same variable are considered differently from a single instance. Linear logic thus must obey a form of the linear superposition principle. A proportion can be reasoned with only once, unless a special operator is applied. Informally, linear logic distinguishes two kinds of conjunction, two kinds of disjunction, and also introduces a modal storage operator that explicitly indicates propositions that can be reused. This paper discuses the application of linear logic to simulation. A wide variety of logics have been developed; in addition to classical logic, there are fuzzy logics, affine logics, quantum logics, etc. All of these have found application in simulations of one sort or another. The special characteristics of linear logic and its benefits for simulation will be discussed. Of particular interest is a connection that can be made between linear logic and simulated dynamics by using the concept of Lie algebras and Lie groups. Lie groups provide the connection between the exponential modal storage operators of linear logic and the eigen functions of dynamic differential operators. Particularly suggestive are possible relations between complexity result for linear logic and non-computability results for dynamical systems.
An Application of Linear Algebra over Lattices
M. Hosseinyazdi
2008-01-01
In this paper, first we consider L n as a semimodule over a complete bounded distributive lattice L. Then we define the basic concepts of module theory for L n. After that, we proved many similar theorems in linear algebra for the space L n. An application of linear algebra over lattices for solving linear systems, was given
Investigating Integer Restrictions in Linear Programming
Edwards, Thomas G.; Chelst, Kenneth R.; Principato, Angela M.; Wilhelm, Thad L.
2015-01-01
Linear programming (LP) is an application of graphing linear systems that appears in many Algebra 2 textbooks. Although not explicitly mentioned in the Common Core State Standards for Mathematics, linear programming blends seamlessly into modeling with mathematics, the fourth Standard for Mathematical Practice (CCSSI 2010, p. 7). In solving a…
Linearization of resistance thermometers and other transducers
DEFF Research Database (Denmark)
Diamond, Joseph M.
1970-01-01
deflection output or to null balance output. The application to the common temperature transducers is considered. It is shown that thermistors, linear metals (e.g., copper), and nickel can be linearized in terms of temperature, but platinum cannot be. If linearization is desired in terms of the reciprocal...
Introducing Linear Functions: An Alternative Statistical Approach
Nolan, Caroline; Herbert, Sandra
2015-01-01
The introduction of linear functions is the turning point where many students decide if mathematics is useful or not. This means the role of parameters and variables in linear functions could be considered to be "threshold concepts". There is recognition that linear functions can be taught in context through the exploration of linear…
Stability of Linear Equations--Algebraic Approach
Cherif, Chokri; Goldstein, Avraham; Prado, Lucio M. G.
2012-01-01
This article could be of interest to teachers of applied mathematics as well as to people who are interested in applications of linear algebra. We give a comprehensive study of linear systems from an application point of view. Specifically, we give an overview of linear systems and problems that can occur with the computed solution when the…
Square pulse linear transformer driver
Directory of Open Access Journals (Sweden)
A. A. Kim
2012-04-01
Full Text Available The linear transformer driver (LTD technological approach can result in relatively compact devices that can deliver fast, high current, and high-voltage pulses straight out of the LTD cavity without any complicated pulse forming and pulse compression network. Through multistage inductively insulated voltage adders, the output pulse, increased in voltage amplitude, can be applied directly to the load. The usual LTD architecture [A. A. Kim, M. G. Mazarakis, V. A. Sinebryukhov, B. M. Kovalchuk, V. A. Vizir, S. N Volkov, F. Bayol, A. N. Bastrikov, V. G. Durakov, S. V. Frolov, V. M. Alexeenko, D. H. McDaniel, W. E. Fowler, K. LeCheen, C. Olson, W. A. Stygar, K. W. Struve, J. Porter, and R. M. Gilgenbach, Phys. Rev. ST Accel. Beams 12, 050402 (2009PRABFM1098-440210.1103/PhysRevSTAB.12.050402; M. G. Mazarakis, W. E. Fowler, A. A. Kim, V. A. Sinebryukhov, S. T. Rogowski, R. A. Sharpe, D. H. McDaniel, C. L. Olson, J. L. Porter, K. W. Struve, W. A. Stygar, and J. R. Woodworth, Phys. Rev. ST Accel. Beams 12, 050401 (2009PRABFM1098-440210.1103/PhysRevSTAB.12.050401] provides sine shaped output pulses that may not be well suited for some applications like z-pinch drivers, flash radiography, high power microwaves, etc. A more suitable power pulse would have a flat or trapezoidal (rising or falling top. In this paper, we present the design and first test results of an LTD cavity that generates such a type of output pulse by including within its circular array a number of third harmonic bricks in addition to the main bricks. A voltage adder made out of a square pulse cavity linear array will produce the same shape output pulses provided that the timing of each cavity is synchronized with the propagation of the electromagnetic pulse.
Formate Formation and Formate Conversion in Biological Fuels Production
Directory of Open Access Journals (Sweden)
Bryan R. Crable
2011-01-01
Full Text Available Biomethanation is a mature technology for fuel production. Fourth generation biofuels research will focus on sequestering CO2 and providing carbon-neutral or carbon-negative strategies to cope with dwindling fossil fuel supplies and environmental impact. Formate is an important intermediate in the methanogenic breakdown of complex organic material and serves as an important precursor for biological fuels production in the form of methane, hydrogen, and potentially methanol. Formate is produced by either CoA-dependent cleavage of pyruvate or enzymatic reduction of CO2 in an NADH- or ferredoxin-dependent manner. Formate is consumed through oxidation to CO2 and H2 or can be further reduced via the Wood-Ljungdahl pathway for carbon fixation or industrially for the production of methanol. Here, we review the enzymes involved in the interconversion of formate and discuss potential applications for biofuels production.
Emittance control in linear colliders
International Nuclear Information System (INIS)
Ruth, R.D.
1991-05-01
In this paper, we discuss the generation and control of the emittance in a next-generation linear collider. The beams are extracted from a damping ring and compressed in length by the first bunch compressor. They are then accelerated in a preaccelerator linac up to an energy appropriate for injection into a high gradient linac. In many designs this pre-acceleration is followed by another bunch compression to reach a short bunch. After acceleration in the linac, the bunches are finally focused transversely to a small spot. The proposed vertical beam sizes at the interaction point are the order of a few nanometers while the horizontal sizes are about a factor of 100 larger. This cross-sectional area is about a factor of 10 4 smaller than the SLC. However, the main question is: what are the tolerances to achieve such a small size, and how do they compare to present techniques for alignment and stability? These tolerances are very design dependent. Alignment tolerances in the linac can vary from 1 μm to 100 μm depending upon the basic approach. In this paper we discuss techniques of emittance generation and control which move alignment tolerances to the 100 μm range
Linear programming algorithms and applications
Vajda, S
1981-01-01
This text is based on a course of about 16 hours lectures to students of mathematics, statistics, and/or operational research. It is intended to introduce readers to the very wide range of applicability of linear programming, covering problems of manage ment, administration, transportation and a number of other uses which are mentioned in their context. The emphasis is on numerical algorithms, which are illustrated by examples of such modest size that the solutions can be obtained using pen and paper. It is clear that these methods, if applied to larger problems, can also be carried out on automatic (electronic) computers. Commercially available computer packages are, in fact, mainly based on algorithms explained in this book. The author is convinced that the user of these algorithms ought to be knowledgeable about the underlying theory. Therefore this volume is not merely addressed to the practitioner, but also to the mathematician who is interested in relatively new developments in algebraic theory and in...
An adjustable linear Halbach array
Energy Technology Data Exchange (ETDEWEB)
Hilton, J.E., E-mail: James.Hilton@csiro.au [CSIRO Mathematics, Informatics and Statistics, Clayton South, VIC 3169 (Australia); McMurry, S.M. [School of Physics, Trinity College, Dublin (Ireland)
2012-07-15
The linear Halbach array is a well-known planar magnetic structure capable, in the idealized case, of generating a one-sided magnetic field. We show that such a field can be created from an array of uniformly magnetized rods, and rotating these rods in an alternating fashion can smoothly transfer the resultant magnetic field through the plane of the device. We examine an idealized model composed of infinite line dipoles and carry out computational simulations on a realizable device using a magnetic boundary element method. Such an arrangement can be used for an efficient latching device, or to produce a highly tunable field in the space above the device. - Highlights: Black-Right-Pointing-Pointer We model an adjustable 'one-sided' flux sheet made up of a series of dipolar magnetic field sources. Black-Right-Pointing-Pointer We show that magnetic field can be switched from one side of sheet to other by a swap rotation of each of magnetic sources. Black-Right-Pointing-Pointer Investigations show that such an arrangement is practical and can easily be fabricated. Black-Right-Pointing-Pointer The design has a wide range of potential applications.
An adjustable linear Halbach array
International Nuclear Information System (INIS)
Hilton, J.E.; McMurry, S.M.
2012-01-01
The linear Halbach array is a well-known planar magnetic structure capable, in the idealized case, of generating a one-sided magnetic field. We show that such a field can be created from an array of uniformly magnetized rods, and rotating these rods in an alternating fashion can smoothly transfer the resultant magnetic field through the plane of the device. We examine an idealized model composed of infinite line dipoles and carry out computational simulations on a realizable device using a magnetic boundary element method. Such an arrangement can be used for an efficient latching device, or to produce a highly tunable field in the space above the device. - Highlights: ► We model an adjustable ‘one-sided’ flux sheet made up of a series of dipolar magnetic field sources. ► We show that magnetic field can be switched from one side of sheet to other by a swap rotation of each of magnetic sources. ► Investigations show that such an arrangement is practical and can easily be fabricated. ► The design has a wide range of potential applications.
Regularized Label Relaxation Linear Regression.
Fang, Xiaozhao; Xu, Yong; Li, Xuelong; Lai, Zhihui; Wong, Wai Keung; Fang, Bingwu
2018-04-01
Linear regression (LR) and some of its variants have been widely used for classification problems. Most of these methods assume that during the learning phase, the training samples can be exactly transformed into a strict binary label matrix, which has too little freedom to fit the labels adequately. To address this problem, in this paper, we propose a novel regularized label relaxation LR method, which has the following notable characteristics. First, the proposed method relaxes the strict binary label matrix into a slack variable matrix by introducing a nonnegative label relaxation matrix into LR, which provides more freedom to fit the labels and simultaneously enlarges the margins between different classes as much as possible. Second, the proposed method constructs the class compactness graph based on manifold learning and uses it as the regularization item to avoid the problem of overfitting. The class compactness graph is used to ensure that the samples sharing the same labels can be kept close after they are transformed. Two different algorithms, which are, respectively, based on -norm and -norm loss functions are devised. These two algorithms have compact closed-form solutions in each iteration so that they are easily implemented. Extensive experiments show that these two algorithms outperform the state-of-the-art algorithms in terms of the classification accuracy and running time.
A linear atomic quantum coupler
Energy Technology Data Exchange (ETDEWEB)
El-Orany, Faisal A A [Department of Mathematics and computer Science, Faculty of Science, Suez Canal University 41522, Ismailia (Egypt); Wahiddin, M R B, E-mail: el_orany@hotmail.co, E-mail: faisal.orany@mimos.m, E-mail: mridza@mimos.m [Cyberspace Security Laboratory, MIMOS Berhad, Technology Park Malaysia, 57000 Kuala Lumpur (Malaysia)
2010-04-28
In this paper we develop the notion of the linear atomic quantum coupler. This device consists of two modes propagating into two waveguides, each of which includes a localized atom. These waveguides are placed close enough to allow exchange of energy between them via evanescent waves. Each mode interacts with the atom in the same waveguide in the standard way as the Jaynes-Cummings model (JCM) and with the atom-mode system in the second waveguide via the evanescent wave. We present the Hamiltonian for this system and deduce its wavefunction. We investigate the atomic inversions and the second-order correlation function. In contrast to the conventional coupler the atomic quantum coupler is able to generate nonclassical effects. The atomic inversions can exhibit a long revival-collapse phenomenon as well as subsidiary revivals based on the competition among the switching mechanisms in the system. Finally, under certain conditions the system can yield the results of the two-mode JCM.
Principles of linear algebra with Mathematica
Shiskowski, Kenneth M
2013-01-01
A hands-on introduction to the theoretical and computational aspects of linear algebra using Mathematica® Many topics in linear algebra are simple, yet computationally intensive, and computer algebra systems such as Mathematica® are essential not only for learning to apply the concepts to computationally challenging problems, but also for visualizing many of the geometric aspects within this field of study. Principles of Linear Algebra with Mathematica uniquely bridges the gap between beginning linear algebra and computational linear algebra that is often encountered in applied settings,
International Nuclear Information System (INIS)
Petrila, Iulian; Bodale, Ilie; Rotarescu, Cristian; Stancu, Alexandru
2011-01-01
A comparative analysis between linear and non-linear energy barriers used for modeling statistical thermally-excited ferromagnetic systems is presented. The linear energy barrier is obtained by new symmetry considerations about the anisotropy energy and the link with the non-linear energy barrier is also presented. For a relevant analysis we compare the effects of linear and non-linear energy barriers implemented in two different models: Preisach-Neel and Ising-Metropolis. The differences between energy barriers which are reflected in different coercive field dependence of the temperature are also presented. -- Highlights: → The linear energy barrier is obtained from symmetry considerations. → The linear and non-linear energy barriers are calibrated and implemented in Preisach-Neel and Ising-Metropolis models. → The temperature and time effects of the linear and non-linear energy barriers are analyzed.
Enriching an effect calculus with linear types
DEFF Research Database (Denmark)
Egger, Jeff; Møgelberg, Rasmus Ejlers; Simpson, Alex
2009-01-01
We define an ``enriched effect calculus'' by conservatively extending a type theory for computational effects with primitives from linear logic. By doing so, we obtain a generalisation of linear type theory, intended as a formalism for expressing linear aspects of effects. As a worked example, we...... formulate linearly-used continuations in the enriched effect calculus. These are captured by a fundamental translation of the enriched effect calculus into itself, which extends existing call-by-value and call-by-name linearly-used CPS translations. We show that our translation is involutive. Full...... completeness results for the various linearly-used CPS translations follow. Our main results, the conservativity of enriching the effect calculus with linear primitives, and the involution property of the fundamental translation, are proved using a category-theoretic semantics for the enriched effect calculus...
Studies of linear Gramicidin synthesis in Bacillus brevis ATCC 8185
International Nuclear Information System (INIS)
Kubota, Kou; Kagawa, Kenichi
1976-01-01
Bacillus brevis ATCC 8185 was grown in polypepton and Ehrlich's meat extract medium, and this strain produced two kinds of peptide antibiotics, Tyrocidine and linear Gramicidin. A simple chromatographic method was developed for the isolation of linear Gramicidin from mixture Tyrothricin, applied on the column. Trimethoprim, an inhibitor of dihydrofolate reductase, inhibits the synthesis of both peptides in the growing culture with slight inhibition to cell growth. Serine- 14 C is incorporated in the Gramicidin, and recovered as ethanol amine and glycine by the hydrolysis of 14 C-labeled Gramicidin, but deoxypyridoxine-HCl, B 6 antagonist, has no effect on the production of antibiotics in the culture. Linear Gramicidin gives two spots on the thin layer chromatogram (TLC) developed by ethyl acetate-pyridine-water system of 16:4:2, and by chloroform-methanol-water system of 17:3:0.3. The incorporations of constitutive 14 C-labeled amino acids, ethanol amine, and sodium formate into linear Gramicidin were studied by growing cells. These labeled specimens were identified to correspond to authentic specimens which migrated on TLC. Cells were hydrolysed with Lysozyme, and the crude extract was prepared between 0.33 and 0.45 saturation of ammonium sulfate. It activated constituent amino acids including D-leucine by ATP- 32 PPi exchange reaction, but hardly activated L-serine, D-valine, and formyl L-valine. (Kobatake, H.)
General Linearized Theory of Quantum Fluctuations around Arbitrary Limit Cycles.
Navarrete-Benlloch, Carlos; Weiss, Talitha; Walter, Stefan; de Valcárcel, Germán J
2017-09-29
The theory of Gaussian quantum fluctuations around classical steady states in nonlinear quantum-optical systems (also known as standard linearization) is a cornerstone for the analysis of such systems. Its simplicity, together with its accuracy far from critical points or situations where the nonlinearity reaches the strong coupling regime, has turned it into a widespread technique, being the first method of choice in most works on the subject. However, such a technique finds strong practical and conceptual complications when one tries to apply it to situations in which the classical long-time solution is time dependent, a most prominent example being spontaneous limit-cycle formation. Here, we introduce a linearization scheme adapted to such situations, using the driven Van der Pol oscillator as a test bed for the method, which allows us to compare it with full numerical simulations. On a conceptual level, the scheme relies on the connection between the emergence of limit cycles and the spontaneous breaking of the symmetry under temporal translations. On the practical side, the method keeps the simplicity and linear scaling with the size of the problem (number of modes) characteristic of standard linearization, making it applicable to large (many-body) systems.
HESS Opinions: Linking Darcy's equation to the linear reservoir
Savenije, Hubert H. G.
2018-03-01
In groundwater hydrology, two simple linear equations exist describing the relation between groundwater flow and the gradient driving it: Darcy's equation and the linear reservoir. Both equations are empirical and straightforward, but work at different scales: Darcy's equation at the laboratory scale and the linear reservoir at the watershed scale. Although at first sight they appear similar, it is not trivial to upscale Darcy's equation to the watershed scale without detailed knowledge of the structure or shape of the underlying aquifers. This paper shows that these two equations, combined by the water balance, are indeed identical provided there is equal resistance in space for water entering the subsurface network. This implies that groundwater systems make use of an efficient drainage network, a mostly invisible pattern that has evolved over geological timescales. This drainage network provides equally distributed resistance for water to access the system, connecting the active groundwater body to the stream, much like a leaf is organized to provide all stomata access to moisture at equal resistance. As a result, the timescale of the linear reservoir appears to be inversely proportional to Darcy's conductance, the proportionality being the product of the porosity and the resistance to entering the drainage network. The main question remaining is which physical law lies behind pattern formation in groundwater systems, evolving in a way that resistance to drainage is constant in space. But that is a fundamental question that is equally relevant for understanding the hydraulic properties of leaf veins in plants or of blood veins in animals.
A linear iterative unfolding method
International Nuclear Information System (INIS)
László, András
2012-01-01
A frequently faced task in experimental physics is to measure the probability distribution of some quantity. Often this quantity to be measured is smeared by a non-ideal detector response or by some physical process. The procedure of removing this smearing effect from the measured distribution is called unfolding, and is a delicate problem in signal processing, due to the well-known numerical ill behavior of this task. Various methods were invented which, given some assumptions on the initial probability distribution, try to regularize the unfolding problem. Most of these methods definitely introduce bias into the estimate of the initial probability distribution. We propose a linear iterative method (motivated by the Neumann series / Landweber iteration known in functional analysis), which has the advantage that no assumptions on the initial probability distribution is needed, and the only regularization parameter is the stopping order of the iteration, which can be used to choose the best compromise between the introduced bias and the propagated statistical and systematic errors. The method is consistent: 'binwise' convergence to the initial probability distribution is proved in absence of measurement errors under a quite general condition on the response function. This condition holds for practical applications such as convolutions, calorimeter response functions, momentum reconstruction response functions based on tracking in magnetic field etc. In presence of measurement errors, explicit formulae for the propagation of the three important error terms is provided: bias error (distance from the unknown to-be-reconstructed initial distribution at a finite iteration order), statistical error, and systematic error. A trade-off between these three error terms can be used to define an optimal iteration stopping criterion, and the errors can be estimated there. We provide a numerical C library for the implementation of the method, which incorporates automatic
CSIR Research Space (South Africa)
Ojijo, Vincent O
2015-12-01
Full Text Available to the formation of non-linear copolymer architecture at the interface. Scanning electron microscopy showed a drastic reduction of the dispersed phase size upon compatibilization, even at very low quantities of the chain extender. Rheological probing...
Similarities and Differences Between Warped Linear Prediction and Laguerre Linear Prediction
Brinker, Albertus C. den; Krishnamoorthi, Harish; Verbitskiy, Evgeny A.
2011-01-01
Linear prediction has been successfully applied in many speech and audio processing systems. This paper presents the similarities and differences between two classes of linear prediction schemes, namely, Warped Linear Prediction (WLP) and Laguerre Linear Prediction (LLP). It is shown that both
Automating linear accelerator quality assurance.
Eckhause, Tobias; Al-Hallaq, Hania; Ritter, Timothy; DeMarco, John; Farrey, Karl; Pawlicki, Todd; Kim, Gwe-Ya; Popple, Richard; Sharma, Vijeshwar; Perez, Mario; Park, SungYong; Booth, Jeremy T; Thorwarth, Ryan; Moran, Jean M
2015-10-01
The purpose of this study was 2-fold. One purpose was to develop an automated, streamlined quality assurance (QA) program for use by multiple centers. The second purpose was to evaluate machine performance over time for multiple centers using linear accelerator (Linac) log files and electronic portal images. The authors sought to evaluate variations in Linac performance to establish as a reference for other centers. The authors developed analytical software tools for a QA program using both log files and electronic portal imaging device (EPID) measurements. The first tool is a general analysis tool which can read and visually represent data in the log file. This tool, which can be used to automatically analyze patient treatment or QA log files, examines the files for Linac deviations which exceed thresholds. The second set of tools consists of a test suite of QA fields, a standard phantom, and software to collect information from the log files on deviations from the expected values. The test suite was designed to focus on the mechanical tests of the Linac to include jaw, MLC, and collimator positions during static, IMRT, and volumetric modulated arc therapy delivery. A consortium of eight institutions delivered the test suite at monthly or weekly intervals on each Linac using a standard phantom. The behavior of various components was analyzed for eight TrueBeam Linacs. For the EPID and trajectory log file analysis, all observed deviations which exceeded established thresholds for Linac behavior resulted in a beam hold off. In the absence of an interlock-triggering event, the maximum observed log file deviations between the expected and actual component positions (such as MLC leaves) varied from less than 1% to 26% of published tolerance thresholds. The maximum and standard deviations of the variations due to gantry sag, collimator angle, jaw position, and MLC positions are presented. Gantry sag among Linacs was 0.336 ± 0.072 mm. The standard deviation in MLC
The gaseous haloes of evolving galaxies: a probe using the linear sizes of radio sources
International Nuclear Information System (INIS)
Subramanian, K.; Swarup, G.
1990-01-01
As galaxies form and evolve, their gaseous haloes are expected to undergo corresponding evolution. We examine here whether observations of the linear sizes of radio sources can be used to probe such evolution. For this purpose we first represent the gas density at various stages of galaxy formation and evolution by means of simple model density profiles, and then work out the expected linear sizes (l) of radio sources in these models. (author)
Generating two simultaneously chaotic attractors with a switching piecewise-linear controller
International Nuclear Information System (INIS)
Zheng Zuohuan; Lue Jinhu; Chen Guanrong; Zhou Tianshou; Zhang Suochun
2004-01-01
It has been demonstrated that a piecewise-linear system can generate chaos under suitable conditions. This paper proposes a novel method for simultaneously creating two symmetrical chaotic attractor--an upper-attractor and a lower-attractor--in a 3D linear autonomous system. Basically dynamical behaviors of this new chaotic system are further investigated. Especially, the chaos formation mechanism is explored by analyzing the structure of fixed points and the system trajectories
FORMATION CONSTANTS AND THERMODYNAMIC ...
African Journals Online (AJOL)
KEY WORDS: Metal complexes, Schiff base ligand, Formation constant, DFT calculation ... best values for the formation constants of the proposed equilibrium model by .... to its positive charge distribution and the ligand deformation geometry.
Some remarks on word formation in Danish
DEFF Research Database (Denmark)
Götzsche, Hans
Abstract for the 25th Scandinavian Conference of Linguistics Some remarks on wordformation in Danish Some Danish word formation phenomena pose a problem for the linguist, being a predicament for analysis. In Danish a train leaves the station when it afgår ‘leaves’, while a minister may gå af......, there are some patterns for these Danish compounds concerning their internal semantics, in that the same lexical items may be used for different purposes depending on whether they are formed as a straightforward linear sequence (a word formation) or a reversed sequence (a phrase). The problem is (i) how the two...
Process for recovering oil from subterranean formations
International Nuclear Information System (INIS)
Knight, B.; Gogarty, W.B.
1978-01-01
Improved flooding of oil-bearing formations is obtained by injecting and displacing through the formation a saline solution containing a water-soluble, substantially linear, high molecular weight polymer obtained by irradiating an aqueous solution of an ethylenically unsaturated monomer and a water-soluble salt under controlled conditions of concentration, radiation intensity, conversion, and total radiation dose. The saline water can contain at least 15,000 ppm of TDS (total dissolved solids) and at least 50 ppm and preferably 300 ppm of polyvalent cations. (Auth.)
New Paradigm for Plasma Crystal Formation with weak grain interaction
International Nuclear Information System (INIS)
Tsytovich, V.N.; Morfill, G.E.
2005-01-01
New results for non-linear grain screening, non-linear ion drag and non-linear collective attractions appropriate for existing experiments are used for the first time together to explain the observed phenomena of plasma condensation. Based on the physics of collective non-linear grain attraction a paradigm for plasma crystal formation is formulated according to which plasma the crystal formation is due to localization of grains in weak non-linear collective attraction wells. Nonlinearity in screening is an important feature of new paradigm and takes into account that the grain charges are large. The physical consequence of large non-linearity is the presence of relative large attraction potential well at distances several times larger then the non-linear screening radius. Calculated location of the potential well is of the order of the observed inter-grain distances in plasma crystals and the calculated deepness of the potential well determining the temperature of phase transition is close to that observed. The calculations of the deepness of the attraction collective well and the critical value of the coupling constant are performed using an assumption that the collective attraction length is larger than the non-linear screening length. The concept of collective grain interaction in complex plasmas is considered for the case where the non-linear screening is fully determining the collective attraction well
JET VELOCITY OF LINEAR SHAPED CHARGES
Directory of Open Access Journals (Sweden)
Vječislav Bohanek
2012-12-01
Full Text Available Shaped explosive charges with one dimension significantly larger than the other are called linear shaped charges. Linear shaped charges are used in various industries and are applied within specific technologies for metal cutting, such as demolition of steel structures, separating spent rocket fuel tanks, demining, cutting holes in the barriers for fire service, etc. According to existing theories and models efficiency of linear shaped charges depends on the kinetic energy of the jet which is proportional to square of jet velocity. The original method for measuring velocity of linear shaped charge jet is applied in the aforementioned research. Measurements were carried out for two different linear materials, and the results are graphically presented, analysed and compared. Measurement results show a discrepancy in the measured velocity of the jet for different materials with the same ratio between linear and explosive mass (M/C per unit of surface, which is not described by presented models (the paper is published in Croatian.
A linear maglev guide for machine tools
Energy Technology Data Exchange (ETDEWEB)
Tieste, K D [Inst. of Mechanics, Univ. of Hannover (Germany); Popp, K [Inst. of Mechanics, Univ. of Hannover (Germany)
1996-12-31
Machine tools require linear guides with high slide velocity and very high position accuracy. The three tasks of a linear guide - supporting, guiding and driving - shall be realised by means of active magnetic bearings (AMB). The resulting linear magnetically levitated (maglev) guide has to accomplish the following characteristics: High stiffness, good damping and low noise as well as low heat production. First research on a one degree-of-freedom (DOF) support magnet unit aimed at the development of components and efficient control strategies for the linear maglev guide. The actual research is directed to realise a five DOF linear maglev guide for machine tools without drive to answer the question whether the maglev principle can be used for a linear axis in a machine tool. (orig.)
Performance test of 100 W linear compressor
Energy Technology Data Exchange (ETDEWEB)
Ko, J; Ko, D. Y.; Park, S. J.; Kim, H. B.; Hong, Y. J.; Yeom, H. K. [Korea Institute of Machinery and Materials, Daejeon(Korea, Republic of)
2013-09-15
In this paper, we present test results of developed 100 W class linear compressor for Stirling-type pulse tube refrigerator. The fabricated linear compressor has dual-opposed configuration, free piston and moving magnet type linear motor. Power transfer, efficiency and required pressure waveform are predicted with designed and measured specifications. In experiments, room temperature test with flow impedance is conducted to evaluate performance of developed linear compressor. Flow impedance is loaded to compressor with metering valve for flow resistance, inertance tube for flow inertance and buffer volumes for flow compliance. Several operating parameters such as input voltage, current, piston displacement and pressure wave are measured for various operating frequency and fixed input current level. Behaviors of dynamics and performance of linear compressor as varying flow impedance are discussed with measured experimental results. The developed linear compressor shows 124 W of input power, 86 % of motor efficiency and 60 % of compressor efficiency at its resonant operating condition.
Evolution Is Linear: Debunking Life's Little Joke.
Jenner, Ronald A
2018-01-01
Linear depictions of the evolutionary process are ubiquitous in popular culture, but linear evolutionary imagery is strongly rejected by scientists who argue that evolution branches. This point is frequently illustrated by saying that we didn't evolve from monkeys, but that we are related to them as collateral relatives. Yet, we did evolve from monkeys, but our monkey ancestors are extinct, not extant. Influential voices, such as the late Stephen Jay Gould, have misled audiences for decades by falsely portraying the linear and branching aspects of evolution to be in conflict, and by failing to distinguish between the legitimate linearity of evolutionary descent, and the branching relationships among collateral relatives that result when lineages of ancestors diverge. The purpose of this article is to correct the widespread misplaced rejection of linear evolutionary imagery, and to re-emphasize the basic truth that the evolutionary process is fundamentally linear. © 2017 WILEY Periodicals, Inc.
Ultrasonic Linear Motor with Two Independent Vibrations
Muneishi, Takeshi; Tomikawa, Yoshiro
2004-09-01
We propose a new structure of an ultrasonic linear motor in order to solve the problems of high-power ultrasonic linear motors that drive the XY-stage for electron beam equipment and to expand the application fields of the motor. We pay special attention to the following three points: (1) the vibration in two directions of the ultrasonic linear motor should not influence mutually each other, (2) the vibration in two directions should be divided into the stage traveling direction and the pressing direction of the ultrasonic linear motor, and (3) the rigidity of the stage traveling direction of the ultrasonic linear motor should be increased. As a result, the supporting method of ultrasonic linear motors is simplified. The efficiency of the motor is improved and temperature rise is reduced. The stage position drift is also improved.
International Nuclear Information System (INIS)
Hasegawa, Akira.
1975-04-01
A new theory of aurora formation is presented based on Alfven wave-electron interaction. The theory explains consistently 1) the electron acceleration process, 2) the formation of auroral layers and 3) the long wave formation in the longitudinal direction. (auth.)
Topological characterizations of S-Linearity
Directory of Open Access Journals (Sweden)
Carfi', David
2007-10-01
Full Text Available We give several characterizations of basic concepts of S-linear algebra in terms of weak duality on topological vector spaces. On the way, some classic results of Functional Analysis are reinterpreted in terms of S-linear algebra, by an application-oriented fashion. The results are required in the S-linear algebra formulation of infinite dimensional Decision Theory and in the study of abstract evolution equations in economical and physical Theories.
Displacement measurement system for linear array detector
International Nuclear Information System (INIS)
Zhang Pengchong; Chen Ziyu; Shen Ji
2011-01-01
It presents a set of linear displacement measurement system based on encoder. The system includes displacement encoders, optical lens and read out circuit. Displacement read out unit includes linear CCD and its drive circuit, two amplifier circuits, second order Butterworth low-pass filter and the binarization circuit. The coding way is introduced, and various parts of the experimental signal waveforms are given, and finally a linear experimental test results are given. The experimental results are satisfactory. (authors)
Determination of regression laws: Linear and nonlinear
International Nuclear Information System (INIS)
Onishchenko, A.M.
1994-01-01
A detailed mathematical determination of regression laws is presented in the article. Particular emphasis is place on determining the laws of X j on X l to account for source nuclei decay and detector errors in nuclear physics instrumentation. Both linear and nonlinear relations are presented. Linearization of 19 functions is tabulated, including graph, relation, variable substitution, obtained linear function, and remarks. 6 refs., 1 tab
On pole structure assignment in linear systems
Czech Academy of Sciences Publication Activity Database
Loiseau, J.-J.; Zagalak, Petr
2009-01-01
Roč. 82, č. 7 (2009), s. 1179-1192 ISSN 0020-7179 R&D Projects: GA ČR(CZ) GA102/07/1596 Institutional research plan: CEZ:AV0Z10750506 Keywords : linear systems * linear state feedback * pole structure assignment Subject RIV: BC - Control Systems Theory Impact factor: 1.124, year: 2009 http://library.utia.cas.cz/separaty/2009/AS/zagalak-on pole structure assignment in linear systems.pdf
International Workshop on Linear Colliders 2010
CERN. Geneva
2010-01-01
IWLC2010 International Workshop on Linear Colliders 2010ECFA-CLIC-ILC joint meeting: Monday 18 October - Friday 22 October 2010Venue: CERN and CICG (International Conference Centre Geneva, Switzerland) This year, the International Workshop on Linear Colliders organized by the European Committee for Future Accelerators (ECFA) will study the physics, detectors and accelerator complex of a linear collider covering both CLIC and ILC options.Contact Workshop Secretariat IWLC2010 is hosted by CERN
Linear accelerator use in the nuclear field
International Nuclear Information System (INIS)
Lecomte, J.-C.
Radiography of internal conformity is performed on weldments and thick castings using linear accelerators. The basic principles relating to linear accelerators are outlined and their advantages over Co 60 sources described. Linear accelerator operation related requirements are presented as well as the use of this apparatus as a method for volumetric inspection, during fabrication of French Nuclear Steam Supply Systems (NSSS). Finally the resources needed to use this technique as an inspection method is dealt with [fr
Isomorphism of Intransitive Linear Lie Equations
Directory of Open Access Journals (Sweden)
Jose Miguel Martins Veloso
2009-11-01
Full Text Available We show that formal isomorphism of intransitive linear Lie equations along transversal to the orbits can be extended to neighborhoods of these transversal. In analytic cases, the word formal is dropped from theorems. Also, we associate an intransitive Lie algebra with each intransitive linear Lie equation, and from the intransitive Lie algebra we recover the linear Lie equation, unless of formal isomorphism. The intransitive Lie algebra gives the structure functions introduced by É. Cartan.
Advanced linear algebra for engineers with Matlab
Dianat, Sohail A
2009-01-01
Matrices, Matrix Algebra, and Elementary Matrix OperationsBasic Concepts and NotationMatrix AlgebraElementary Row OperationsSolution of System of Linear EquationsMatrix PartitionsBlock MultiplicationInner, Outer, and Kronecker ProductsDeterminants, Matrix Inversion and Solutions to Systems of Linear EquationsDeterminant of a MatrixMatrix InversionSolution of Simultaneous Linear EquationsApplications: Circuit AnalysisHomogeneous Coordinates SystemRank, Nu
Automating linear accelerator quality assurance
International Nuclear Information System (INIS)
Eckhause, Tobias; Thorwarth, Ryan; Moran, Jean M.; Al-Hallaq, Hania; Farrey, Karl; Ritter, Timothy; DeMarco, John; Pawlicki, Todd; Kim, Gwe-Ya; Popple, Richard; Sharma, Vijeshwar; Park, SungYong; Perez, Mario; Booth, Jeremy T.
2015-01-01
Purpose: The purpose of this study was 2-fold. One purpose was to develop an automated, streamlined quality assurance (QA) program for use by multiple centers. The second purpose was to evaluate machine performance over time for multiple centers using linear accelerator (Linac) log files and electronic portal images. The authors sought to evaluate variations in Linac performance to establish as a reference for other centers. Methods: The authors developed analytical software tools for a QA program using both log files and electronic portal imaging device (EPID) measurements. The first tool is a general analysis tool which can read and visually represent data in the log file. This tool, which can be used to automatically analyze patient treatment or QA log files, examines the files for Linac deviations which exceed thresholds. The second set of tools consists of a test suite of QA fields, a standard phantom, and software to collect information from the log files on deviations from the expected values. The test suite was designed to focus on the mechanical tests of the Linac to include jaw, MLC, and collimator positions during static, IMRT, and volumetric modulated arc therapy delivery. A consortium of eight institutions delivered the test suite at monthly or weekly intervals on each Linac using a standard phantom. The behavior of various components was analyzed for eight TrueBeam Linacs. Results: For the EPID and trajectory log file analysis, all observed deviations which exceeded established thresholds for Linac behavior resulted in a beam hold off. In the absence of an interlock-triggering event, the maximum observed log file deviations between the expected and actual component positions (such as MLC leaves) varied from less than 1% to 26% of published tolerance thresholds. The maximum and standard deviations of the variations due to gantry sag, collimator angle, jaw position, and MLC positions are presented. Gantry sag among Linacs was 0.336 ± 0.072 mm. The
Automating linear accelerator quality assurance
Energy Technology Data Exchange (ETDEWEB)
Eckhause, Tobias; Thorwarth, Ryan; Moran, Jean M., E-mail: jmmoran@med.umich.edu [Department of Radiation Oncology, University of Michigan, Ann Arbor, Michigan 48109-5010 (United States); Al-Hallaq, Hania; Farrey, Karl [Department of Radiation Oncology and Cellular Oncology, The University of Chicago, Chicago, Illinois 60637 (United States); Ritter, Timothy [Ann Arbor VA Medical Center, Ann Arbor, Michigan 48109 (United States); DeMarco, John [Department of Radiation Oncology, Cedars-Sinai Medical Center, Los Angeles, California, 90048 (United States); Pawlicki, Todd; Kim, Gwe-Ya [UCSD Medical Center, La Jolla, California 92093 (United States); Popple, Richard [Department of Radiation Oncology, University of Alabama Birmingham, Birmingham, Alabama 35249 (United States); Sharma, Vijeshwar; Park, SungYong [Karmanos Cancer Institute, McLaren-Flint, Flint, Michigan 48532 (United States); Perez, Mario; Booth, Jeremy T. [Royal North Shore Hospital, Sydney, NSW 2065 (Australia)
2015-10-15
Purpose: The purpose of this study was 2-fold. One purpose was to develop an automated, streamlined quality assurance (QA) program for use by multiple centers. The second purpose was to evaluate machine performance over time for multiple centers using linear accelerator (Linac) log files and electronic portal images. The authors sought to evaluate variations in Linac performance to establish as a reference for other centers. Methods: The authors developed analytical software tools for a QA program using both log files and electronic portal imaging device (EPID) measurements. The first tool is a general analysis tool which can read and visually represent data in the log file. This tool, which can be used to automatically analyze patient treatment or QA log files, examines the files for Linac deviations which exceed thresholds. The second set of tools consists of a test suite of QA fields, a standard phantom, and software to collect information from the log files on deviations from the expected values. The test suite was designed to focus on the mechanical tests of the Linac to include jaw, MLC, and collimator positions during static, IMRT, and volumetric modulated arc therapy delivery. A consortium of eight institutions delivered the test suite at monthly or weekly intervals on each Linac using a standard phantom. The behavior of various components was analyzed for eight TrueBeam Linacs. Results: For the EPID and trajectory log file analysis, all observed deviations which exceeded established thresholds for Linac behavior resulted in a beam hold off. In the absence of an interlock-triggering event, the maximum observed log file deviations between the expected and actual component positions (such as MLC leaves) varied from less than 1% to 26% of published tolerance thresholds. The maximum and standard deviations of the variations due to gantry sag, collimator angle, jaw position, and MLC positions are presented. Gantry sag among Linacs was 0.336 ± 0.072 mm. The
Linear algebra a first course with applications
Knop, Larry E
2008-01-01
Linear Algebra: A First Course with Applications explores the fundamental ideas of linear algebra, including vector spaces, subspaces, basis, span, linear independence, linear transformation, eigenvalues, and eigenvectors, as well as a variety of applications, from inventories to graphics to Google's PageRank. Unlike other texts on the subject, this classroom-tested book gives students enough time to absorb the material by focusing on vector spaces early on and using computational sections as numerical interludes. It offers introductions to Maple™, MATLAB®, and TI-83 Plus for calculating matri
On two examples in linear topological spaces
International Nuclear Information System (INIS)
Iyahen, S.O.
1985-11-01
This note first gives examples of B-complete linear topological spaces, and shows that neither the closed graph theorem nor the open mapping theorem holds for linear mappings from such a space to itself. It then looks at Hausdorff linear topological spaces for which coarser Hausdorff linear topologies can be extended from hyperplanes. For B-complete spaces, those which are barrelled necessarily have countable dimension, and conversely. The paper had been motivated by two questions arising in earlier studies related to the closed graph and open mapping theorems; answers to these questions are contained therein. (author)
COMPARISON OF LINEAR CONTROLLERS FOR A
DEFF Research Database (Denmark)
Andersen, Torben Ole; Hansen, Michael Rygaard; Pedersen, Henrik C.
2005-01-01
on comparing different linear controllers, based on both simulation and experimental results, to determine what is obtainable when applying standard linear controllers to a hydraulic SISO servo system. The paper furthermore addresses how the performance may be improved by using internal pressure control......In many hydraulic control applications, classic linear controllers are still employed, although there exist a number of number of nonlinear control methods, which may be better suited for handling the intrensic non-linearities often found in hydraulic systems. The focus of this paper is therefore...... and model based information to include feedforward information. The control strategies considered are all based on measurement of piston position and pressure only....
Ultra-high vacuum photoelectron linear accelerator
Yu, David U.L.; Luo, Yan
2013-07-16
An rf linear accelerator for producing an electron beam. The outer wall of the rf cavity of said linear accelerator being perforated to allow gas inside said rf cavity to flow to a pressure chamber surrounding said rf cavity and having means of ultra high vacuum pumping of the cathode of said rf linear accelerator. Said rf linear accelerator is used to accelerate polarized or unpolarized electrons produced by a photocathode, or to accelerate thermally heated electrons produced by a thermionic cathode, or to accelerate rf heated field emission electrons produced by a field emission cathode.
On the formation of auroral arcs
International Nuclear Information System (INIS)
Stasiewicz, K.
1984-04-01
A new mechanism for auroral arc formation is presented. The characteristic linear shape of auroral arcs is determined by magnetically connected plasma clouds in the distant equatorial magnetosphere. These clouds originate as high speed plasma beams in the magnetotail and in the solar wind. It is found that the free energy for driving an auroral arc is provided by the difference of pressure between the cloud and the ambient plasma. (author)
Complexity of formation in holography
International Nuclear Information System (INIS)
Chapman, Shira; Marrochio, Hugo; Myers, Robert C.
2017-01-01
It was recently conjectured that the quantum complexity of a holographic boundary state can be computed by evaluating the gravitational action on a bulk region known as the Wheeler-DeWitt patch. We apply this complexity=action duality to evaluate the ‘complexity of formation’ (DOI: 10.1103/PhysRevLett.116.191301; 10.1103/PhysRevD.93.086006), i.e. the additional complexity arising in preparing the entangled thermofield double state with two copies of the boundary CFT compared to preparing the individual vacuum states of the two copies. We find that for boundary dimensions d>2, the difference in the complexities grows linearly with the thermal entropy at high temperatures. For the special case d=2, the complexity of formation is a fixed constant, independent of the temperature. We compare these results to those found using the complexity=volume duality.
Complexity of formation in holography
Energy Technology Data Exchange (ETDEWEB)
Chapman, Shira [Perimeter Institute for Theoretical Physics,Waterloo, ON N2L 2Y5 (Canada); Marrochio, Hugo [Perimeter Institute for Theoretical Physics,Waterloo, ON N2L 2Y5 (Canada); Department of Physics & Astronomy and Guelph-Waterloo Physics Institute,University of Waterloo, Waterloo, ON N2L 3G1 (Canada); Myers, Robert C. [Perimeter Institute for Theoretical Physics,Waterloo, ON N2L 2Y5 (Canada)
2017-01-16
It was recently conjectured that the quantum complexity of a holographic boundary state can be computed by evaluating the gravitational action on a bulk region known as the Wheeler-DeWitt patch. We apply this complexity=action duality to evaluate the ‘complexity of formation’ (DOI: 10.1103/PhysRevLett.116.191301; 10.1103/PhysRevD.93.086006), i.e. the additional complexity arising in preparing the entangled thermofield double state with two copies of the boundary CFT compared to preparing the individual vacuum states of the two copies. We find that for boundary dimensions d>2, the difference in the complexities grows linearly with the thermal entropy at high temperatures. For the special case d=2, the complexity of formation is a fixed constant, independent of the temperature. We compare these results to those found using the complexity=volume duality.
Formation of interstellar anions
Senent, Maria Luisa
2012-05-01
Formation of interstellar anions: M.L. Senent. The recent detection of negative charged species in the ISM1 has instigated enthusiasm for anions in the astrophysical community2. Many of these species are new and entail characterization. How they are formed in astrophysical sources is a question of major relevance. The anion presence in ISM was first predicted theoretically on the basis of electron affinities and on the negative linear chain molecular stabilities. Although very early, they were considered in astrochemical models3-4, their discovery is so recent because their abundances seem to be relatively low. These have to be understood in terms of molecular stabilities, reaction probabilities and radiative and collisional excitations. Then, we present our theoretical work on even carbon chains type Cn and CnH (n=2,4,6) focused to the understanding of anion abundances. We use highly correlated ab initio methods. We performed spectroscopic studies of various isomers that can play important roles as intermediates5-8. In previous papers9-10, we compared C2H and C2H- collisional rates responsible for observed line intensities. Actually, we study hydrogen attachment (Cn +H → CnH and Cn- +H → CnH-) and associative detachment processes (Cn- +H → CnH +e-) for 2, 4 and 6 carbon atom chains11. [1] M.C.McCarthy, C.A.Gottlieb, H.Gupta, P.Thaddeus, Astrophys.J, 652, L141 (2006) [2] V.M.Bierbaum, J.Cernicharo, R.Bachiller, eds., 2011, pp 383-389. [3] A. Dalgarno, R.A. Mc Cray, Astrophys.J,, 181, 95 (1973) [4] E. Herbst E., Nature, 289, 656 (1981); [5] H.Massó, M.L.Senent, P.Rosmus, M.Hochlaf, J.Chem.Phys., 124, 234304 (2006) [6] M.L.Senent, M.Hochlaf, Astrophys. J. , 708, 1452(2010) [7] H.Massó, M.L.Senent, J.Phys.Chem.A, 113, 12404 (2009) [8] D. Hammoutene, M.Hochlaf, M.L.Senent, submitted. [9] A. Spielfiedel, N. Feautrier, F. Najar, D. ben Abdallah, F. Dayou, M.L. Senent, F. Lique, Mon.Not.R.Astron.Soc., 421, 1891 (2012) [10] F.Dumouchel, A, Spielfieldel , M
Novel linear polymers able to inhibit bacterial quorum sensing.
Cavaleiro, Eliana; Duarte, Ana Sofia; Esteves, Ana Cristina; Correia, António; Whitcombe, Michael J; Piletska, Elena V; Piletsky, Sergey A; Chianella, Iva
2015-05-01
Bacterial phenotypes, such as biofilm formation, antibiotic resistance and virulence expression, are associated with quorum sensing. Quorum sensing is a density-dependent regulatory system of gene expression controlled by specific signal molecules, such as N-acyl homoserine lactones (AHLs), produced and released by bacteria. This study reports the development of linear polymers capable to attenuate quorum sensing by adsorption of AHLs. Linear polymers were synthesized using MMA as backbone monomer and methacrylic acid and itaconic acid as functional monomers. Two different quorum sensing-controlled phenotypes, Vibrio fischeri bioluminescence and Aeromonas hydrophila biofilm formation, were evaluated to test the polymers' efficiency. Results showed that both phenotypes were significantly affected by the polymers, with the itaconic acid-containing material being more effective than the methacrylic acid one. The polymer inhibitory effects were reverted by the addition of lactones, confirming attenuation of quorum sensing through sequestration of signal molecules. The polymers also showed no cytotoxicity when tested using a mammalian cell line. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Price Uncertainty in Linear Production Situations
Suijs, J.P.M.
1999-01-01
This paper analyzes linear production situations with price uncertainty, and shows that the corrresponding stochastic linear production games are totally balanced. It also shows that investment funds, where investors pool their individual capital for joint investments in financial assets, fit into
An Inquiry-Based Linear Algebra Class
Wang, Haohao; Posey, Lisa
2011-01-01
Linear algebra is a standard undergraduate mathematics course. This paper presents an overview of the design and implementation of an inquiry-based teaching material for the linear algebra course which emphasizes discovery learning, analytical thinking and individual creativity. The inquiry-based teaching material is designed to fit the needs of a…
Numerical solution of large sparse linear systems
International Nuclear Information System (INIS)
Meurant, Gerard; Golub, Gene.
1982-02-01
This note is based on one of the lectures given at the 1980 CEA-EDF-INRIA Numerical Analysis Summer School whose aim is the study of large sparse linear systems. The main topics are solving least squares problems by orthogonal transformation, fast Poisson solvers and solution of sparse linear system by iterative methods with a special emphasis on preconditioned conjuguate gradient method [fr
Non-linear finite element modeling
DEFF Research Database (Denmark)
Mikkelsen, Lars Pilgaard
The note is written for courses in "Non-linear finite element method". The note has been used by the author teaching non-linear finite element modeling at Civil Engineering at Aalborg University, Computational Mechanics at Aalborg University Esbjerg, Structural Engineering at the University...
Petri Nets as Models of Linear Logic
DEFF Research Database (Denmark)
Engberg, Uffe Henrik; Winskel, Glynn
1990-01-01
The chief purpose of this paper is to appraise the feasibility of Girad's linear logic as a specification language for parallel processes. To this end we propose an interpretation of linear logic in Petri nets, with respect to which we investigate the expressive power of the logic...
Understanding Linear Functions and Their Representations
Wells, Pamela J.
2015-01-01
Linear functions are an important part of the middle school mathematics curriculum. Students in the middle grades gain fluency by working with linear functions in a variety of representations (NCTM 2001). Presented in this article is an activity that was used with five eighth-grade classes at three different schools. The activity contains 15 cards…
Balanced truncation for linear switched systems
DEFF Research Database (Denmark)
Petreczky, Mihaly; Wisniewski, Rafal; Leth, John-Josef
2013-01-01
In this paper, we present a theoretical analysis of the model reduction algorithm for linear switched systems from Shaker and Wisniewski (2011, 2009) and . This algorithm is a reminiscence of the balanced truncation method for linear parameter varying systems (Wood et al., 1996) [3]. Specifically...
Non-linear realizations and bosonic branes
International Nuclear Information System (INIS)
West, P.
2001-01-01
In this very short note, following hep-th/0001216, we express the well known bosonic brane as a non-linear realization. The reader may also consult hep-th/9912226, 0001216 and 0005270 where the branes of M theory are constructed as a non-linear realisation. The automorphisms of the supersymmetry algebra play an essential role. (author)
Hamiltonian structure of linearly extended Virasoro algebra
International Nuclear Information System (INIS)
Arakelyan, T.A.; Savvidi, G.K.
1991-01-01
The Hamiltonian structure of linearly extended Virasoro algebra which admits free bosonic field representation is described. An example of a non-trivial extension is found. The hierarchy of integrable non-linear equations corresponding to this Hamiltonian structure is constructed. This hierarchy admits the Lax representation by matrix Lax operator of second order
Linear Unlearning for Cross-Validation
DEFF Research Database (Denmark)
Hansen, Lars Kai; Larsen, Jan
1996-01-01
The leave-one-out cross-validation scheme for generalization assessment of neural network models is computationally expensive due to replicated training sessions. In this paper we suggest linear unlearning of examples as an approach to approximative cross-validation. Further, we discuss...... time series prediction benchmark demonstrate the potential of the linear unlearning technique...
Composite Linear Models | Division of Cancer Prevention
By Stuart G. Baker The composite linear models software is a matrix approach to compute maximum likelihood estimates and asymptotic standard errors for models for incomplete multinomial data. It implements the method described in Baker SG. Composite linear models for incomplete multinomial data. Statistics in Medicine 1994;13:609-622. The software includes a library of thirty
Linear determining equations for differential constraints
International Nuclear Information System (INIS)
Kaptsov, O V
1998-01-01
A construction of differential constraints compatible with partial differential equations is considered. Certain linear determining equations with parameters are used to find such differential constraints. They generalize the classical determining equations used in the search for admissible Lie operators. As applications of this approach equations of an ideal incompressible fluid and non-linear heat equations are discussed
Neural Networks for Non-linear Control
DEFF Research Database (Denmark)
Sørensen, O.
1994-01-01
This paper describes how a neural network, structured as a Multi Layer Perceptron, is trained to predict, simulate and control a non-linear process.......This paper describes how a neural network, structured as a Multi Layer Perceptron, is trained to predict, simulate and control a non-linear process....
Simulation of linear Switched Reluctance Motor drives
Garcia Amoros, Jordi; Blanqué Molina, Balduino; Andrada Gascón, Pedro
2011-01-01
This paper presents a simulation model of linear switched reluctance motor drives. A Matlab-Simulink environment coupled with finite element analysis is used to perform the simulations. Experimental and simulation results for a double sided linear switched motor drive prototype are reported and compared to verify the simulation model.
A linear motor as seismic horizontal vibrator
Drijkoningen, G.; Veltman, A.; Hendrix, W.H.A.; Brouwer, J.; Hemstede, A.
2006-01-01
In this paper we propose to use the concept of linear synchronous motors to act as a seismic shear-wave vibratory source. We show that a linear motor, even with a design that is not focussed on application of seismic surveying, gives seismic records that are convincing and comparable with an
Simplified Linear Equation Solvers users manual
Energy Technology Data Exchange (ETDEWEB)
Gropp, W. [Argonne National Lab., IL (United States); Smith, B. [California Univ., Los Angeles, CA (United States)
1993-02-01
The solution of large sparse systems of linear equations is at the heart of many algorithms in scientific computing. The SLES package is a set of easy-to-use yet powerful and extensible routines for solving large sparse linear systems. The design of the package allows new techniques to be used in existing applications without any source code changes in the applications.
Actuarial statistics with generalized linear mixed models
Antonio, K.; Beirlant, J.
2007-01-01
Over the last decade the use of generalized linear models (GLMs) in actuarial statistics has received a lot of attention, starting from the actuarial illustrations in the standard text by McCullagh and Nelder [McCullagh, P., Nelder, J.A., 1989. Generalized linear models. In: Monographs on Statistics
Non-Linear Approximation of Bayesian Update
Litvinenko, Alexander
2016-01-01
We develop a non-linear approximation of expensive Bayesian formula. This non-linear approximation is applied directly to Polynomial Chaos Coefficients. In this way, we avoid Monte Carlo sampling and sampling error. We can show that the famous Kalman Update formula is a particular case of this update.
Microwave Radiometer Linearity Measured by Simple Means
DEFF Research Database (Denmark)
Skou, Niels
2002-01-01
Modern spaceborne radiometer systems feature an almost perfect on-board calibration, hence the primary calibration task to be carried out before launch is a check of radiometer linearity. This paper describes two ways of measuring linearity of microwave radiometers only requiring relatively simple...
Timetabling an Academic Department with Linear Programming.
Bezeau, Lawrence M.
This paper describes an approach to faculty timetabling and course scheduling that uses computerized linear programming. After reviewing the literature on linear programming, the paper discusses the process whereby a timetable was created for a department at the University of New Brunswick. Faculty were surveyed with respect to course offerings…
Linear Logistic Test Modeling with R
Baghaei, Purya; Kubinger, Klaus D.
2015-01-01
The present paper gives a general introduction to the linear logistic test model (Fischer, 1973), an extension of the Rasch model with linear constraints on item parameters, along with eRm (an R package to estimate different types of Rasch models; Mair, Hatzinger, & Mair, 2014) functions to estimate the model and interpret its parameters. The…
Linear ubiquitination signals in adaptive immune responses.
Ikeda, Fumiyo
2015-07-01
Ubiquitin can form eight different linkage types of chains using the intrinsic Met 1 residue or one of the seven intrinsic Lys residues. Each linkage type of ubiquitin chain has a distinct three-dimensional topology, functioning as a tag to attract specific signaling molecules, which are so-called ubiquitin readers, and regulates various biological functions. Ubiquitin chains linked via Met 1 in a head-to-tail manner are called linear ubiquitin chains. Linear ubiquitination plays an important role in the regulation of cellular signaling, including the best-characterized tumor necrosis factor (TNF)-induced canonical nuclear factor-κB (NF-κB) pathway. Linear ubiquitin chains are specifically generated by an E3 ligase complex called the linear ubiquitin chain assembly complex (LUBAC) and hydrolyzed by a deubiquitinase (DUB) called ovarian tumor (OTU) DUB with linear linkage specificity (OTULIN). LUBAC linearly ubiquitinates critical molecules in the TNF pathway, such as NEMO and RIPK1. The linear ubiquitin chains are then recognized by the ubiquitin readers, including NEMO, which control the TNF pathway. Accumulating evidence indicates an importance of the LUBAC complex in the regulation of apoptosis, development, and inflammation in mice. In this article, I focus on the role of linear ubiquitin chains in adaptive immune responses with an emphasis on the TNF-induced signaling pathways. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Characteristic polynomials of linear polyacenes and their ...
Indian Academy of Sciences (India)
Coefficients of characteristic polynomials (CP) of linear polyacenes (LP) have been shown to be obtainable from Pascal's triangle by using a graph factorisation and squaring technique. Strong subspectrality existing among the members of the linear polyacene series has been shown from the derivation of the CP's. Thus it ...
Lie algebras and linear differential equations.
Brockett, R. W.; Rahimi, A.
1972-01-01
Certain symmetry properties possessed by the solutions of linear differential equations are examined. For this purpose, some basic ideas from the theory of finite dimensional linear systems are used together with the work of Wei and Norman on the use of Lie algebraic methods in differential equation theory.
Superconducting linear accelerator system for NSC
Indian Academy of Sciences (India)
This paper reports the construction of a superconducting linear accelerator as a booster to the 15 UD Pelletron accelerator at Nuclear Science Centre, New Delhi. The LINAC will use superconducting niobium quarter wave resonators as the accelerating element. Construction of the linear accelerator has progressed ...
Non-Linear Approximation of Bayesian Update
Litvinenko, Alexander
2016-06-23
We develop a non-linear approximation of expensive Bayesian formula. This non-linear approximation is applied directly to Polynomial Chaos Coefficients. In this way, we avoid Monte Carlo sampling and sampling error. We can show that the famous Kalman Update formula is a particular case of this update.
Linear integral equations and soliton systems
International Nuclear Information System (INIS)
Quispel, G.R.W.
1983-01-01
A study is presented of classical integrable dynamical systems in one temporal and one spatial dimension. The direct linearizations are given of several nonlinear partial differential equations, for example the Korteweg-de Vries equation, the modified Korteweg-de Vries equation, the sine-Gordon equation, the nonlinear Schroedinger equation, and the equation of motion for the isotropic Heisenberg spin chain; the author also discusses several relations between these equations. The Baecklund transformations of these partial differential equations are treated on the basis of a singular transformation of the measure (or equivalently of the plane-wave factor) occurring in the corresponding linear integral equations, and the Baecklund transformations are used to derive the direct linearization of a chain of so-called modified partial differential equations. Finally it is shown that the singular linear integral equations lead in a natural way to the direct linearizations of various nonlinear difference-difference equations. (Auth.)
The International Linear Collider Progress Report 2015
Energy Technology Data Exchange (ETDEWEB)
Evans, L. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Yamamoto, A. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States)
2015-07-15
The International Committee for Future Accelerators (ICFA) set up the Global Design Effort (GDE) for the design of the International Linear Collider (ILC) in 2005. Drawing on the resources of over 300 national laboratories, universities and institutes worldwide, the GDE produced a Reference Design Report in 2007, followed by a more detailed Technical Design Report (TDR) in 2013. Following this report, the GDE was disbanded. A compact core team, the Linear Collider Collaboration (LCC), replaced it. This is still under the auspices of ICFA and is directly overseen by the Linear Collider Board, which reports to ICFA. The LCC is charged with continuing the design effort on a much-reduced scale until the Project is approved for construction. An additional mandate of the LCC was to bring together all linear collider work, including the CERN-based Compact Linear Collider (CLIC) under one structure in order to exploit synergies between the two studies.
Linear viscoelastic characterization from filament stretching rheometry
DEFF Research Database (Denmark)
Wingstrand, Sara Lindeblad; Alvarez, Nicolas J.; Hassager, Ole
to measure both linear and nonlinear dynamics on a single apparatus. With a software modification to the FSR motor control, we show that linear viscoelasticity can be measured via small amplitude squeeze flow (SASF). Squeeze flow is a combination of both shear and extensional flow applied by axially......Traditionally, linear viscoelasticity is measured using small amplitude oscillatory shear flow. Due to experimental difficulties, shear flows are predominately confined to the linear and mildly nonlinear regime. On the other hand, extensional flows have proven more practical in measuring...... viscoelasticity well into the nonlinear regime. Therefore at present, complete rheological characterization of a material requires two apparatuses: a shear and an extensional rheometer. This work is focused on developing a linear viscoelastic protocol for the filament stretching rheometer (FSR) in order...
Multivariate generalized linear mixed models using R
Berridge, Damon Mark
2011-01-01
Multivariate Generalized Linear Mixed Models Using R presents robust and methodologically sound models for analyzing large and complex data sets, enabling readers to answer increasingly complex research questions. The book applies the principles of modeling to longitudinal data from panel and related studies via the Sabre software package in R. A Unified Framework for a Broad Class of Models The authors first discuss members of the family of generalized linear models, gradually adding complexity to the modeling framework by incorporating random effects. After reviewing the generalized linear model notation, they illustrate a range of random effects models, including three-level, multivariate, endpoint, event history, and state dependence models. They estimate the multivariate generalized linear mixed models (MGLMMs) using either standard or adaptive Gaussian quadrature. The authors also compare two-level fixed and random effects linear models. The appendices contain additional information on quadrature, model...
Applied linear algebra and matrix analysis
Shores, Thomas S
2018-01-01
In its second edition, this textbook offers a fresh approach to matrix and linear algebra. Its blend of theory, computational exercises, and analytical writing projects is designed to highlight the interplay between these aspects of an application. This approach places special emphasis on linear algebra as an experimental science that provides tools for solving concrete problems. The second edition’s revised text discusses applications of linear algebra like graph theory and network modeling methods used in Google’s PageRank algorithm. Other new materials include modeling examples of diffusive processes, linear programming, image processing, digital signal processing, and Fourier analysis. These topics are woven into the core material of Gaussian elimination and other matrix operations; eigenvalues, eigenvectors, and discrete dynamical systems; and the geometrical aspects of vector spaces. Intended for a one-semester undergraduate course without a strict calculus prerequisite, Applied Linear Algebra and M...
International Nuclear Information System (INIS)
Khasanov, A.Kh.
1988-01-01
Deposit formation (especially endogenous) is the complicated, multi-stage and long process. Establishment of deposit formation succession, age-specific correlations of minerals and aggregates have a high importance at solving genetic questions. Studying of minerals correlations and mineral aggregates, succession of their crystallization and other observations let restore the history of deposit formation, pick up in it different on duration and physical and chemical conditions stages
Thebault, Ph.; Haghighipour, N.
2014-01-01
Spurred by the discovery of numerous exoplanets in multiple systems, binaries have become in recent years one of the main topics in planet formation research. Numerous studies have investigated to what extent the presence of a stellar companion can affect the planet formation process. Such studies have implications that can reach beyond the sole context of binaries, as they allow to test certain aspects of the planet formation scenario by submitting them to extreme environments. We review her...
M. ZANGIABADI; H. R. MALEKI
2007-01-01
In the real-world optimization problems, coefficients of the objective function are not known precisely and can be interpreted as fuzzy numbers. In this paper we define the concepts of optimality for linear programming problems with fuzzy parameters based on those for multiobjective linear programming problems. Then by using the concept of comparison of fuzzy numbers, we transform a linear programming problem with fuzzy parameters to a multiobjective linear programming problem. To this end, w...
Genetic design of interpolated non-linear controllers for linear plants
International Nuclear Information System (INIS)
Ajlouni, N.
2000-01-01
The techniques of genetic algorithms are proposed as a means of designing non-linear PID control systems. It is shown that the use of genetic algorithms for this purpose results in highly effective non-linear PID control systems. These results are illustrated by using genetic algorithms to design a non-linear PID control system and contrasting the results with an optimally tuned linear PID controller. (author)
Data format translation routines
International Nuclear Information System (INIS)
Burris, R.D.
1981-02-01
To enable the effective connection of several dissimilar computers into a network, modification of the data being passed from one computer to another may become necessary. This document describes a package of routines which permit the translation of data in PDP-8 formats to PDP-11 or DECsystem-10 formats or from PDP-11 format to DECsystem-10 format. Additional routines are described which permit the effective use of the translation routines in the environment of the Fusion Energy Division (FED) network and the Elmo Bumpy Torus (EBT) data base
International Nuclear Information System (INIS)
Khalil, M.A.; Lemmel, H.D.
1986-09-01
This document is a brief user's description of the format of ENDF/B. This format, originally designed for the US Evaluated Nuclear Data File, is recommended for international use. This summary is an aid to customers of the IAEA Nuclear Data Section when receiving data retrievals in ENDF/B format. For more detailed information the report BNL-NCS-50496 (ENDF 102) should be consulted. An Appendix to the present document gives a summary of the format differences between ENDF/B-4 and ENDF/B-5. (author)
DEFF Research Database (Denmark)
Jensen, Mads Møller; Rasmussen, Majken; Grønbæk, Kaj
2013-01-01
of how the opponent format and relationships impact a game are almost absent in current research. Thus, this paper aims to elucidate how the perception of a competition differs, depending on the opponent format, by presenting a game mechanic framework. The paper furthermore presents an interactive...... football-training platform, as well as games designed to explore the different opponent formats. The games are qualitatively evaluated to illuminate the qualities of and distinctions between different types of opponent formats, proposed by the framework terminology....
HOW GALACTIC ENVIRONMENT REGULATES STAR FORMATION
Energy Technology Data Exchange (ETDEWEB)
Meidt, Sharon E. [Max-Planck-Institut für Astronomie/Königstuhl 17 D-69117 Heidelberg (Germany)
2016-02-10
In a new simple model I reconcile two contradictory views on the factors that determine the rate at which molecular clouds form stars—internal structure versus external, environmental influences—providing a unified picture for the regulation of star formation in galaxies. In the presence of external pressure, the pressure gradient set up within a self-gravitating turbulent (isothermal) cloud leads to a non-uniform density distribution. Thus the local environment of a cloud influences its internal structure. In the simple equilibrium model, the fraction of gas at high density in the cloud interior is determined simply by the cloud surface density, which is itself inherited from the pressure in the immediate surroundings. This idea is tested using measurements of the properties of local clouds, which are found to show remarkable agreement with the simple equilibrium model. The model also naturally predicts the star formation relation observed on cloud scales and at the same time provides a mapping between this relation and the closer-to-linear molecular star formation relation measured on larger scales in galaxies. The key is that pressure regulates not only the molecular content of the ISM but also the cloud surface density. I provide a straightforward prescription for the pressure regulation of star formation that can be directly implemented in numerical models. Predictions for the dense gas fraction and star formation efficiency measured on large-scales within galaxies are also presented, establishing the basis for a new picture of star formation regulated by galactic environment.
Zoladz, Phillip R; Diamond, David M
2008-10-16
Over a century of behavioral research has shown that stress can enhance or impair learning and memory. In the present review, we have explored the complex effects of stress on cognition and propose that they are characterized by linear and non-linear dose-response functions, which together reveal a hormetic relationship between stress and learning. We suggest that stress initially enhances hippocampal function, resulting from amygdala-induced excitation of hippocampal synaptic plasticity, as well as the excitatory effects of several neuromodulators, including corticosteroids, norepinephrine, corticotropin-releasing hormone, acetylcholine and dopamine. We propose that this rapid activation of the amygdala-hippocampus brain memory system results in a linear dose-response relation between emotional strength and memory formation. More prolonged stress, however, leads to an inhibition of hippocampal function, which can be attributed to compensatory cellular responses that protect hippocampal neurons from excitotoxicity. This inhibition of hippocampal functioning in response to prolonged stress is potentially relevant to the well-described curvilinear dose-response relationship between arousal and memory. Our emphasis on the temporal features of stress-brain interactions addresses how stress can activate, as well as impair, hippocampal functioning to produce a hormetic relationship between stress and learning.
Piecewise linear regression splines with hyperbolic covariates
International Nuclear Information System (INIS)
Cologne, John B.; Sposto, Richard
1992-09-01
Consider the problem of fitting a curve to data that exhibit a multiphase linear response with smooth transitions between phases. We propose substituting hyperbolas as covariates in piecewise linear regression splines to obtain curves that are smoothly joined. The method provides an intuitive and easy way to extend the two-phase linear hyperbolic response model of Griffiths and Miller and Watts and Bacon to accommodate more than two linear segments. The resulting regression spline with hyperbolic covariates may be fit by nonlinear regression methods to estimate the degree of curvature between adjoining linear segments. The added complexity of fitting nonlinear, as opposed to linear, regression models is not great. The extra effort is particularly worthwhile when investigators are unwilling to assume that the slope of the response changes abruptly at the join points. We can also estimate the join points (the values of the abscissas where the linear segments would intersect if extrapolated) if their number and approximate locations may be presumed known. An example using data on changing age at menarche in a cohort of Japanese women illustrates the use of the method for exploratory data analysis. (author)
Investigating Students' Modes of Thinking in Linear Algebra: The Case of Linear Independence
Çelik, Derya
2015-01-01
Linear algebra is one of the most challenging topics to learn and teach in many countries. To facilitate the teaching and learning of linear algebra, priority should be given to epistemologically analyze the concepts that the undergraduate students have difficulty in conceptualizing and to define their ways of reasoning in linear algebra. After…
Linear and non-linear calculations of the hose instability in the ion-focused regime
International Nuclear Information System (INIS)
Buchanan, H.L.
1982-01-01
A simple model is adopted to study the hose instability of an intense relativistic electron beam in a partially neutralized, low density ion channel (ion focused regime). Equations of motion for the beam and the channel are derived and linearized to obtain an approximate dispersion relation. The non-linear equations of motion are then solved numerically and the results compared to linearized data