Energy Technology Data Exchange (ETDEWEB)
Timko, Michael P
2013-02-01
The biosynthesis of chlorophyll is a critical biochemical step in the development of photosynthetic vascular plants and green algae. From photosynthetic bacteria (cyanobacteria) to algae, non-vascular plants, gymnosperms and vascular plants, mechanisms have evolved for protochlorophyllide reduction a key step in chlorophyll synthesis. Protochlorophyllide reduction is carried out by both a light-dependent (POR) and light-independent (LIPOR) mechanisms. NADPH: protochlorophyllide oxidoreductase (EC 1.3.1.33, abbreviated POR) catalyzes the light-dependent reduction of protochlorophyllide (PChlide) to chlorophyllide (Chlide). In contrast, a light-independent protochlorophyllide reductase (LIPOR) involves three plastid gene products (chlL, chlN, and chlB) and several nuclear factors. Our work focused on characterization of both the POR and LIPOR catalyzed processes.
A protochlorophyllide light-harvesting complex involved in de-etiolation of higher plants
International Nuclear Information System (INIS)
Reinbothe, C.; Lebedev, N.; Reinbothe, S.
1999-01-01
When etiolated angiosperm seedlings break through the soil after germination, they are immediately exposed to sunlight, but at this stage they are unable to perform photosynthesis1. In the absence of chlorophyll a and chlorophyll b, two other porphyrin species cooperate as the basic light-harvesting structure of etiolated plants. Protochlorophyllide a and protochlorophyllide b (ref. 2) form supramolecular complexes with NADPH and two closely related NADPH:protochlorophyllide oxidoreductase (POR) proteins—PORA and PORB (ref. 3)—in the prolamellar body of etioplasts. Here we report that these light-harvesting POR–protochlorophyllide complexes, named LHPP, are essential for the establishment of the photosynthetic apparatus and also confer photoprotection on the plant. They collect sunlight for rapid chlorophyll a biosynthesis and, simultaneously, dissipate excess light energy in the bulk of non-photoreducible protochlorophyllide b. Based on this dual function, it seems that LHPP provides the link between skotomorphogenesis and photosynthesis that is required for efficient de-etiolation
Directory of Open Access Journals (Sweden)
Derren J Heyes
Full Text Available The light-driven enzyme protochlorophyllide oxidoreductase (POR catalyzes the reduction of protochlorophyllide (Pchlide to chlorophyllide (Chlide. This reaction is a key step in the biosynthesis of chlorophyll. Ultrafast photochemical processes within the Pchlide molecule are required for catalysis and previous studies have suggested that a short-lived excited-state species, known as I675*, is the first catalytic intermediate in the reaction and is essential for capturing excitation energy to drive subsequent hydride and proton transfers. The chemical nature of the I675* excited state species and its role in catalysis are not known. Here, we report time-resolved pump-probe spectroscopy measurements to study the involvement of the I675* intermediate in POR photochemistry. We show that I675* is not unique to the POR-catalyzed photoreduction of Pchlide as it is also formed in the absence of the POR enzyme. The I675* species is only produced in samples that contain both Pchlide substrate and Chlide product and its formation is dependent on the pump excitation wavelength. The rate of formation and the quantum yield is maximized in 50∶50 mixtures of the two pigments (Pchlide and Chlide and is caused by direct energy transfer between Pchlide and neighboring Chlide molecules, which is inhibited in the polar solvent methanol. Consequently, we have re-evaluated the mechanism for early stage photochemistry in the light-driven reduction of Pchlide and propose that I675* represents an excited state species formed in Pchlide-Chlide dimers, possibly an excimer. Contrary to previous reports, we conclude that this excited state species has no direct mechanistic relevance to the POR-catalyzed reduction of Pchlide.
Energy Technology Data Exchange (ETDEWEB)
Nomata, Jiro [Graduate School of Bioagricultural Sciences, Nagoya University, Furo-cho, Chikusa-ku, Nagoya, 464-8601 (Japan); Terauchi, Kazuki [Department of Life Sciences, Ritsumeikan University, Kusatsu, Shiga, 525-8577 (Japan); Fujita, Yuichi, E-mail: fujita@agr.nagoya-u.ac.jp [Graduate School of Bioagricultural Sciences, Nagoya University, Furo-cho, Chikusa-ku, Nagoya, 464-8601 (Japan)
2016-02-12
Dark-operative protochlorophyllide (Pchlide) oxidoreductase (DPOR) is a nitrogenase-like enzyme catalyzing a reduction of the C17 = C18 double bond of Pchlide to form chlorophyllide a (Chlide) in bacteriochlorophyll biosynthesis. DPOR consists of an ATP-dependent reductase component, L-protein (a BchL dimer), and a catalytic component, NB-protein (a BchN–BchB heterotetramer). The L-protein transfers electrons to the NB-protein to reduce Pchlide, which is coupled with ATP hydrolysis. Here we determined the stoichiometry of ATP hydrolysis and the Chlide formation of DPOR. The minimal ratio of ATP to Chlide (ATP/2e{sup –}) was 4, which coincides with that of nitrogenase. The ratio increases with increasing molar ratio of L-protein to NB-protein. This profile differs from that of nitrogenase. These results suggest that DPOR has a specific intrinsic property, while retaining the common features shared with nitrogenase. - Highlights: • The stoichiometry of nitrogenase-like protochlorophyllide reductase was determined. • The minimal ATP/2e{sup –} ratio was 4, which coincides with that of nitrogenase. • The ATP/2e{sup –} ratio increases with increasing L-protein/NB-protein molar ratio. • DPOR has an intrinsic property, but retains features shared with nitrogenase.
Directory of Open Access Journals (Sweden)
Michał Gabruk
Full Text Available Photoactive Pchlide-POR-NADPH complexes were reconstituted using protochlorophyllide (Pchlide and recombinant light-dependent protochlorophyllide oxidoreductase (POR proteins, His₆-PORA, His₆-PORB and His₆-PORC, from Arabidopsis thaliana. We did not observe any differences in the kinetics of the protochlorophyllide photoreduction at room temperature among the PORA, PORB and PORC proteins. In contrast, the PORC protein showed lower yield of Chlide formation than PORA and PORB when preincubated in the dark for 30 min and then illuminated for a short time. The most significant observation was that reconstituted Pchlide-POR-NADPH complexes showed fluorescence maxima at 77 K similar to those observed for highly aggregated Pchlide-POR-NADPH complexes in prolamellar bodies (PLBs in vivo. Homology models of PORA, PORB and PORC of Arabidopsis thaliana were developed to compare predicted structures of POR isoforms. There were only slight structural differences, mainly in the organisation of helices and loops, but not in the shape of whole molecules. This is the first comparative analysis of all POR isoforms functioning at different stages of A. thaliana development.
Arabidopsis CDS blastp result: AK103940 [KOME
Lifescience Database Archive (English)
Full Text Available AK103940 001-013-G08 At5g54190.1 protochlorophyllide reductase A, chloroplast / PCR A / NADPH-protochlorophy...llide oxidoreductase A (PORA) identical to SP:Q42536 protochlorophyllide reductase ...A, chloroplast precursor (EC 1.3.1.33) (PCR A) (NADPH-protochlorophyllide oxidoreductase A) (POR A) [Arabidopsis thaliana] 1e-130 ...
Arabidopsis CDS blastp result: AK104855 [KOME
Lifescience Database Archive (English)
Full Text Available AK104855 001-043-B11 At5g54190.1 protochlorophyllide reductase A, chloroplast / PCR A / NADPH-protochlorophy...llide oxidoreductase A (PORA) identical to SP:Q42536 protochlorophyllide reductase ...A, chloroplast precursor (EC 1.3.1.33) (PCR A) (NADPH-protochlorophyllide oxidoreductase A) (POR A) [Arabidopsis thaliana] 1e-130 ...
Hey, Daniel; Rothbart, Maxi; Herbst, Josephine; Wang, Peng; Müller, Jakob; Wittmann, Daniel; Gruhl, Kirsten; Grimm, Bernhard
2017-06-01
The LIL3 protein of Arabidopsis ( Arabidopsis thaliana ) belongs to the light-harvesting complex (LHC) protein family, which also includes the light-harvesting chlorophyll-binding proteins of photosystems I and II, the early-light-inducible proteins, PsbS involved in nonphotochemical quenching, and the one-helix proteins and their cyanobacterial homologs designated high-light-inducible proteins. Each member of this family is characterized by one or two LHC transmembrane domains (referred to as the LHC motif) to which potential functions such as chlorophyll binding, protein interaction, and integration of interacting partners into the plastid membranes have been attributed. Initially, LIL3 was shown to interact with geranylgeranyl reductase (CHLP), an enzyme of terpene biosynthesis that supplies the hydrocarbon chain for chlorophyll and tocopherol. Here, we show another function of LIL3 for the stability of protochlorophyllide oxidoreductase (POR). Multiple protein-protein interaction analyses suggest the direct physical interaction of LIL3 with POR but not with chlorophyll synthase. Consistently, LIL3-deficient plants exhibit substantial loss of POR as well as CHLP, which is not due to defective transcription of the POR and CHLP genes but to the posttranslational modification of their protein products. Interestingly, in vitro biochemical analyses provide novel evidence that LIL3 shows high binding affinity to protochlorophyllide, the substrate of POR. Taken together, this study suggests a critical role for LIL3 in the organization of later steps in chlorophyll biosynthesis. We suggest that LIL3 associates with POR and CHLP and thus contributes to the supply of the two metabolites, chlorophyllide and phytyl pyrophosphate, required for the final step in chlorophyll a synthesis. © 2017 American Society of Plant Biologists. All Rights Reserved.
Ma, Zhaoxue; Hu, Xupeng; Cai, Wenjuan; Huang, Weihua; Zhou, Xin; Luo, Qian; Yang, Hongquan; Wang, Jiawei; Huang, Jirong
2014-01-01
An extraordinarily precise regulation of chlorophyll biosynthesis is essential for plant growth and development. However, our knowledge on the complex regulatory mechanisms of chlorophyll biosynthesis is very limited. Previous studies have demonstrated that miR171-targeted scarecrow-like proteins (SCL6/22/27) negatively regulate chlorophyll biosynthesis via an unknown mechanism. Here we showed that SCLs inhibit the expression of the key gene encoding protochlorophyllide oxidoreductase (POR) in light-grown plants, but have no significant effect on protochlorophyllide biosynthesis in etiolated seedlings. Histochemical analysis of β-glucuronidase (GUS) activity in transgenic plants expressing pSCL27::rSCL27-GUS revealed that SCL27-GUS accumulates at high levels and suppresses chlorophyll biosynthesis at the leaf basal proliferation region during leaf development. Transient gene expression assays showed that the promoter activity of PORC is indeed regulated by SCL27. Consistently, chromatin immunoprecipitation and quantitative PCR assays showed that SCL27 binds to the promoter region of PORC in vivo. An electrophoretic mobility shift assay revealed that SCL27 is directly interacted with G(A/G)(A/T)AA(A/T)GT cis-elements of the PORC promoter. Furthermore, genetic analysis showed that gibberellin (GA)-regulated chlorophyll biosynthesis is mediated, at least in part, by SCLs. We demonstrated that SCL27 interacts with DELLA proteins in vitro and in vivo by yeast-two-hybrid and coimmunoprecipitation analysis and found that their interaction reduces the binding activity of SCL27 to the PORC promoter. Additionally, we showed that SCL27 activates MIR171 gene expression, forming a feedback regulatory loop. Taken together, our data suggest that the miR171-SCL module is critical for mediating GA-DELLA signaling in the coordinate regulation of chlorophyll biosynthesis and leaf growth in light. PMID:25101599
Rahfeld, Peter; Kirsch, Roy; Kugel, Susann; Wielsch, Natalie; Stock, Magdalena; Groth, Marco; Boland, Wilhelm; Burse, Antje
2014-01-01
Larvae of the leaf beetle subtribe Chrysomelina sensu stricto repel their enemies by displaying glandular secretions that contain defensive compounds. These repellents can be produced either de novo (iridoids) or by using plant-derived precursors (e.g. salicylaldehyde). The autonomous production of iridoids, as in Phaedon cochleariae, is the ancestral chrysomeline chemical defence and predates the evolution of salicylaldehyde-based defence. Both biosynthesis strategies include an oxidative step of an alcohol intermediate. In salicylaldehyde-producing species, this step is catalysed by salicyl alcohol oxidases (SAOs) of the glucose-methanol-choline (GMC) oxidoreductase superfamily, but the enzyme oxidizing the iridoid precursor is unknown. Here, we show by in vitro as well as in vivo experiments that P. cochleariae also uses an oxidase from the GMC superfamily for defensive purposes. However, our phylogenetic analysis of chrysomeline GMC oxidoreductases revealed that the oxidase of the iridoid pathway originated from a GMC clade different from that of the SAOs. Thus, the evolution of a host-independent chemical defence followed by a shift to a host-dependent chemical defence in chrysomeline beetles coincided with the utilization of genes from different GMC subfamilies. These findings illustrate the importance of the GMC multi-gene family for adaptive processes in plant–insect interactions. PMID:24943369
Biswal, Ajaya K.; Pattanayak, Gopal K.; Pandey, Shiv S.; Leelavathi, Sadhu; Reddy, Vanga S.; Govindjee; Tripathy, Baishnab C.
2012-01-01
Chlorophyll b is synthesized by the oxidation of a methyl group on the B ring of a tetrapyrrole molecule to a formyl group by chlorophyllide a oxygenase (CAO). The full-length CAO from Arabidopsis (Arabidopsis thaliana) was overexpressed in tobacco (Nicotiana tabacum) that grows well at light intensities much higher than those tolerated by Arabidopsis. This resulted in an increased synthesis of glutamate semialdehyde, 5-aminolevulinic acid, magnesium-porphyrins, and chlorophylls. Overexpression of CAO resulted in increased chlorophyll b synthesis and a decreased chlorophyll a/b ratio in low light-grown as well as high light-grown tobacco plants; this effect, however, was more pronounced in high light. The increased potential of the protochlorophyllide oxidoreductase activity and chlorophyll biosynthesis compensated for the usual loss of chlorophylls in high light. Increased chlorophyll b synthesis in CAO-overexpressed plants was accompanied not only by an increased abundance of light-harvesting chlorophyll proteins but also of other proteins of the electron transport chain, which led to an increase in the capture of light as well as enhanced (40%–80%) electron transport rates of photosystems I and II at both limiting and saturating light intensities. Although the quantum yield of carbon dioxide fixation remained unchanged, the light-saturated photosynthetic carbon assimilation, starch content, and dry matter accumulation increased in CAO-overexpressed plants grown in both low- and high-light regimes. These results demonstrate that controlled up-regulation of chlorophyll b biosynthesis comodulates the expression of several thylakoid membrane proteins that increase both the antenna size and the electron transport rates and enhance carbon dioxide assimilation, starch content, and dry matter accumulation. PMID:22419827
Leferink, N.G.H.; Berkel, van W.J.H.
2014-01-01
Vitamin C is a widely used vitamin. Here we review the occurrence and properties of aldonolactone oxidoreductases, an important group of flavoenzymes responsible for the ultimate production of vitamin C and its analogs in animals, plants, and single-cell organisms.
CRYSTAL STRUCTURE ANALYSIS OF A PUTATIVE OXIDOREDUCTASE FROM KLEBSIELLA PNEUMONIAE
Energy Technology Data Exchange (ETDEWEB)
Baig, M.; Brown, A.; Eswaramoorthy, S.; Swaminathan, S.
2009-01-01
Klebsiella pneumoniae, a gram-negative enteric bacterium, is found in nosocomial infections which are acquired during hospital stays for about 10% of hospital patients in the United States. The crystal structure of a putative oxidoreductase from K. pneumoniae has been determined. The structural information of this K. pneumoniae protein was used to understand its function. Crystals of the putative oxidoreductase enzyme were obtained by the sitting drop vapor diffusion method using Polyethylene glycol (PEG) 3350, Bis-Tris buffer, pH 5.5 as precipitant. These crystals were used to collect X-ray data at beam line X12C of the National Synchrotron Light Source (NSLS) at Brookhaven National Laboratory (BNL). The crystal structure was determined using the SHELX program and refi ned with CNS 1.1. This protein, which is involved in the catalysis of an oxidation-reduction (redox) reaction, has an alpha/beta structure. It utilizes nicotinamide adenine dinucleotide phosphate (NADP) or nicotine adenine dinucleotide (NAD) to perform its function. This structure could be used to determine the active and co-factor binding sites of the protein, information that could help pharmaceutical companies in drug design and in determining the protein’s relationship to disease treatment such as that for pneumonia and other related pathologies.
Energy Technology Data Exchange (ETDEWEB)
Zhang, Shaojie; Patel, Ananddeep; Moorthy, Bhagavatula; Shivanna, Binoy, E-mail: shivanna@bcm.edu
2015-11-13
Activation of the aryl hydrocarbon receptor (AhR) transcriptionally induces phase I (cytochrome P450 (CYP) 1A1) and phase II (NAD(P)H quinone oxidoreductase 1 (NQO1) detoxifying enzymes. The effects of the classical and nonclassical AhR ligands on phase I and II enzymes are well studied in human hepatocytes. Additionally, we observed that the proton pump inhibitor, omeprazole (OM), transcriptionally induces CYP1A1 in the human adenocarcinoma cell line, H441 cells via AhR. Whether OM activates AhR and induces the phase II enzyme, NAD(P)H quinone oxidoreductase 1 (NQO1), in fetal primary human pulmonary microvascular endothelial cells (HPMEC) is unknown. Therefore, we tested the hypothesis that OM will induce NQO1 in HPMEC via the AhR. The concentrations of OM used in our experiments did not result in cytotoxicity. OM activated AhR as evident by increased CYP1A1 mRNA expression. However, contrary to our hypothesis, OM increased NQO1 mRNA and protein via an AhR-independent mechanism as AhR knockdown failed to abrogate OM-mediated increase in NQO1 expression. Interestingly, OM activated Nrf2 as evident by increased phosphoNrf2 (S40) expression in OM-treated compared to vehicle-treated cells. Furthermore, Nrf2 knockdown abrogated OM-mediated increase in NQO1 expression. In conclusion, we provide evidence that OM induces NQO1 via AhR-independent, but Nrf2-dependent mechanisms. - Highlights: • We investigated whether omeprazole induces NQO1 in human fetal lung cells. • Omeprazole induces the phase II enzyme, NQO1, in human fetal lung cells. • AhR deficiency fails to abrogate omeprazole-mediated induction of NQO1. • Omeprazole increases phosphoNrf2 (S40) protein expression in human fetal lung cells. • Nrf2 knockdown abrogates the induction of NQO1 by omeprazole in human lung cells.
Oxidoreductases on their way to industrial biotransformations
Martínez, Angel T.; Ruiz-Dueñas, Francisco J.; Camarero, Susana; Serrano, Ana; Linde, Dolores; Lund, Henrik; Vind, Jesper; Tovborg, Morten; Herold-Majumdar, Owik M.; Hofrichter, Martin; Liers, Christiane; Berkel, van Willem J.H.
2017-01-01
Fungi produce heme-containing peroxidases and peroxygenases, flavin-containing oxidases and dehydrogenases, and different copper-containing oxidoreductases involved in the biodegradation of lignin and other recalcitrant compounds. Heme peroxidases comprise the classical ligninolytic peroxidases and
Oxidoreductases on their way to industrial biotransformations
Martínez, Angel T.; Ruiz-Dueñas, Francisco J.; Camarero, Susana; Serrano, Ana; Linde, Dolores; Lund, Henrik; Vind, Jesper; Tovborg, Morten; Herold-Majumdar, Owik M.; Hofrichter, Martin; Liers, Christiane; Ullrich, René; Scheibner, Katrin; Sannia, Giovanni; Piscitelli, Alessandra; Pezzella, Cinzia; Sener, Mehmet E.; Kılıç, Sibel; van Berkel, Willem J.H.; Guallar, Victor; Lucas, Maria Fátima; Zuhse, Ralf; Ludwig, Roland; Hollmann, F.; Fernandez Fueyo, E.; Record, Eric; Faulds, Craig B.; Tortajada, Marta; Winckelmann, Ib; Rasmussen, Jo Anne; Gelo-Pujic, Mirjana; Gutiérrez, Ana; del Río, José C.; Rencoret, Jorge; Alcalde, Miguel
2017-01-01
Fungi produce heme-containing peroxidases and peroxygenases, flavin-containing oxidases and dehydrogenases, and different copper-containing oxidoreductases involved in the biodegradation of lignin and other recalcitrant compounds. Heme peroxidases comprise the classical ligninolytic peroxidases
Seo, Hyung-Min; Jeon, Jong-Min; Lee, Ju Hee; Song, Hun-Suk; Joo, Han-Byul; Park, Sung-Hee; Choi, Kwon-Young; Kim, Yong Hyun; Park, Kyungmoon; Ahn, Jungoh; Lee, Hongweon; Yang, Yung-Hun
2016-01-01
Furfural is a toxic by-product formulated from pretreatment processes of lignocellulosic biomass. In order to utilize the lignocellulosic biomass on isobutanol production, inhibitory effect of the furfural on isobutanol production was investigated and combinatorial application of two oxidoreductases, FucO and YqhD, was suggested as an alternative strategy. Furfural decreased cell growth and isobutanol production when only YqhD or FucO was employed as an isobutyraldehyde oxidoreductase. However, combinatorial overexpression of FucO and YqhD could overcome the inhibitory effect of furfural giving higher isobutanol production by 110% compared with overexpression of YqhD. The combinatorial oxidoreductases increased furfural detoxification rate 2.1-fold and also accelerated glucose consumption 1.4-fold. When it compares to another known system increasing furfural tolerance, membrane-bound transhydrogenase (pntAB), the combinatorial aldehyde oxidoreductases were better on cell growth and production. Thus, to control oxidoreductases is important to produce isobutanol using furfural-containing biomass and the combinatorial overexpression of FucO and YqhD can be an alternative strategy.
Kulkarni, R.; Chidley, H.; Deshpande, A.; Schmidt, A.; Pujari, K.; Giri, A.; Gershenzon, J.; Gupta, V.
2013-01-01
Two furanones, furaneol (4-hydroxy-2,5-dimethyl-3(2H)-furanone) and mesifuran (2,5-dimethyl-4-methoxy-3(2H)-furanone), are important constituents of flavor of the Alphonso cultivar of mango (Mangifera indica). To get insights into the biosynthesis of these furanones, we isolated an enone oxidoreductase gene from the Alphonso mango. It has high sequence similarity to an alkenal/one oxidoreductase from cucumber (79% identity) and enone oxidoreductases from tomato (73% identity) and strawberry (...
Energy Technology Data Exchange (ETDEWEB)
Reichmuth, D.S.; Hittle, J.L.; Blanch, H.W.; Keasling, J.D.
2000-01-05
One possible alternative to current fuel hydrodesulfurization methods is the use of microorganisms to remove sulfur compounds. Biodesulfurization requires much milder processing conditions, gives higher specificity, and does not require molecular hydrogen. In the present work the authors have produced two compatible plasmids: pDSR3, which allows Escherichia coli to convert dibenzothiophene (DBT) to hydroxybiphenyl (HBP), and pDSR2, which produces a Vibrio harveyi flavin oxidoreductase. The authors show that the flavin oxidoreductase enhances the rate of DBT removal when co-expressed in vivo with the desulfurization enzymes. The plasmids pDSR2 and pDSR3 were co-expressed in growing cultures. The expression of oxidoreductase caused an increase in the rate of DBT removal but a decrease in the rate of HBP production. The maximum rate of DBT removal was 8 mg/h {center{underscore}dot} g dry cell weight. Experiments were also conducted using resting cells with the addition of various carbon sources. It was found that the addition of glucose or glycerol to cultures with oxidoreductase expression produced the highest DBT removal rate. The culture with acetate and no oxidoreductase expression had the highest level of HBP production. For all carbon sources, the DBT removal rate was faster and the HBP generation rate slower with the expression of the oxidoreductase. Analysis of desulfurization intermediates indicates that the last enzyme in the pathway may be limiting.
Xanthine oxidoreductase in cancer: more than a differentiation marker
International Nuclear Information System (INIS)
Battelli, Maria Giulia; Polito, Letizia; Bortolotti, Massimo; Bolognesi, Andrea
2015-01-01
Human xanthine oxidoreductase (XOR) catalyzes the last two steps of purine catabolism and is present in two interconvertible forms, which may utilize O 2 or NAD + as electron acceptors. In addition to uric acid, XOR products may comprise reactive oxygen and nitrogen species that have many biologic effects, including inflammation, endothelial dysfunction, and cytotoxicity, as well as mutagenesis and induction of proliferation. XOR is strictly modulated at the transcriptional and post-translational levels, and its expression and activity are highly variable in cancer. Xanthine oxidoreductase (XOR) expression has been negatively associated with a high malignity grade and a worse prognosis in neoplasms of the breast, liver, gastrointestinal tract, and kidney, which normally express a high level of XOR protein. However, the level of XOR expression may be associated with a worse outcome in cancer of low XOR-expressing cells, in relation to the inflammatory response elicited through the tissue damage induced by tumor growth. Xanthine oxidoreductase (XOR) has been implicated in the process of oncogenesis either directly because it is able to catalyze the metabolic activation of carcinogenic substances or indirectly through the action of XOR-derived reactive oxygen and nitrogen species. The role of uric acid is characterized by both oxidant and antioxidant action; thus, it is still debatable whether control of uricemia may be helpful to improve the outcomes of tumor illness
Luong, Truc Thanh; Tirgar, Reyhaneh; Reardon-Robinson, Melissa E; Joachimiak, Andrzej; Osipiuk, Jerzy; Ton-That, Hung
2018-05-01
The actinobacterium Corynebacterium matruchotii has been implicated in nucleation of oral microbial consortia leading to biofilm formation. Due to the lack of genetic tools, little is known about basic cellular processes, including protein secretion and folding, in this organism. We report here a survey of the C. matruchotii genome, which encodes a large number of exported proteins containing paired cysteine residues, and identified an oxidoreductase that is highly homologous to the Corynebacterium diphtheriae thiol-disulfide oxidoreductase MdbA (MdbA Cd ). Crystallization studies uncovered that the 1.2-Å resolution structure of C. matruchotii MdbA (MdbA Cm ) possesses two conserved features found in actinobacterial MdbA enzymes, a thioredoxin-like fold and an extended α-helical domain. By reconstituting the disulfide bond-forming machine in vitro , we demonstrated that MdbA Cm catalyzes disulfide bond formation within the actinobacterial pilin FimA. A new gene deletion method supported that mdbA is essential in C. matruchotii Remarkably, heterologous expression of MdbA Cm in the C. diphtheriae Δ mdbA mutant rescued its known defects in cell growth and morphology, toxin production, and pilus assembly, and this thiol-disulfide oxidoreductase activity required the catalytic motif CXXC. Altogether, the results suggest that MdbA Cm is a major thiol-disulfide oxidoreductase, which likely mediates posttranslocational protein folding in C. matruchotii by a mechanism that is conserved in Actinobacteria IMPORTANCE The actinobacterium Corynebacterium matruchotii has been implicated in the development of oral biofilms or dental plaque; however, little is known about the basic cellular processes in this organism. We report here a high-resolution structure of a C. matruchotii oxidoreductase that is highly homologous to the Corynebacterium diphtheriae thiol-disulfide oxidoreductase MdbA. By biochemical analysis, we demonstrated that C. matruchotii MdbA catalyzes disulfide
Reichmuth, D S; Hittle, J L; Blanch, H W; Keasling, J D
2000-01-05
One possible alternative to current fuel hydrodesulfurization methods is the use of microorganisms to remove sulfur compounds. Biodesulfurization requires much milder processing conditions, gives higher specificity, and does not require molecular hydrogen. In the present work we have produced two compatible plasmids: pDSR3, which allows Escherichia coli to convert dibenzothiophene (DBT) to hydroxybiphenyl (HBP), and pDSR2, which produces a Vibrio harveyi flavin oxidoreductase. We show that the flavin oxidoreductase enhances the rate of DBT removal when co-expressed in vivo with the desulfurization enzymes. The plasmids pDSR2 and pDSR3 were co-expressed in growing cultures. The expression of oxidoreductase caused an increase in the rate of DBT removal but a decrease in the rate of HBP production. The maximum rate of DBT removal was 8 mg/h. g dry cell weight. Experiments were also conducted using resting cells with the addition of various carbon sources. It was found that the addition of glucose or glycerol to cultures with oxidoreductase expression produced the highest DBT removal rate (51 mg/h. g dry cell weight). The culture with acetate and no oxidoreductase expression had the highest level of HBP production. For all carbon sources, the DBT removal rate was faster and the HBP generation rate slower with the expression of the oxidoreductase. Analysis of desulfurization intermediates indicates that the last enzyme in the pathway may be limiting. Copyright 2000 John Wiley & Sons, Inc.
Directory of Open Access Journals (Sweden)
Thomas eSimmen
2014-10-01
Full Text Available Endoplasmic reticulum (ER chaperones and oxidoreductases are abundant enzymes that mediate the production of fully folded secretory and transmembrane proteins. Resisting the Golgi and plasma membrane-directed bulk flow, ER chaperones and oxidoreductases enter retrograde trafficking whenever they are pulled outside of the ER. However, solid tumors are characterized by the increased production of reactive oxygen species (ROS, combined with reduced blood flow that leads to low oxygen supply and ER stress. Under these conditions, hypoxia and the unfolded protein response (UPR upregulate ER chaperones and oxidoreductases. When this occurs, ER oxidoreductases and chaperones become important regulators of tumor growth. However, under these conditions, these proteins not only promote the production of proteins, but also alter the properties of the plasma membrane and hence modulate tumor immune recognition. For instance, high levels of calreticulin serve as an eat-me signal on the surface of tumor cells. Conversely, both intracellular and surface BiP/GRP78 promotes tumor growth. Other ER folding assistants able to modulate the properties of tumor tissue include protein disulfide isomerase (PDI, Ero1α and GRP94. Understanding the roles and mechanisms of ER chaperones in regulating tumor cell functions and immunorecognition will lead to important insight for the development of novel cancer therapies.
Characterization of apoptosis-related oxidoreductases from Neurospora crassa.
Directory of Open Access Journals (Sweden)
Patrícia Carneiro
Full Text Available The genome from Neurospora crassa presented three open reading frames homologous to the genes coding for human AIF and AMID proteins, which are flavoproteins with oxidoreductase activities implicated in caspase-independent apoptosis. To investigate the role of these proteins, namely within the mitochondrial respiratory chain, we studied their cellular localization and characterized the respective null mutant strains. Efficiency of the respiratory chain was analyzed by oxygen consumption studies and supramolecular organization of the OXPHOS system was assessed through BN-PAGE analysis in the respective null mutant strains. The results demonstrate that, unlike in mammalian systems, disruption of AIF in Neurospora does not affect either complex I assembly or function. Furthermore, the mitochondrial respiratory chain complexes of the mutant strains display a similar supramolecular organization to that observed in the wild type strain. Further characterization revealed that N. crassa AIF appears localized to both the mitochondria and the cytoplasm, whereas AMID was found exclusively in the cytoplasm. AMID2 was detected in both mitochondria and cytoplasm of the amid mutant strain, but was barely discernible in wild type extracts, suggesting overlapping functions for the two proteins.
Fadeeva, Maria S; Yakovtseva, Evgenia A; Belevich, Galina A; Bertsova, Yulia V; Bogachev, Alexander V
2007-10-01
The expression of genes encoding sodium-translocating NADH:quinone oxidoreductase (Na(+)-NQR) was studied in the marine bacterium Vibrio harveyi and in the enterobacterium Klebsiella pneumoniae. It has been shown that such parameters as NaCl concentration, pH value, and presence of an uncoupler in the growth media do not influence significantly the level of nqr expression. However, nqr expression depends on the growth substrates used by these bacteria. Na(+)-NQR is highly repressed in V. harveyi during anaerobic growth, and nqr expression is modulated by electron acceptors and values of their redox potentials. The latter effect was shown to be independent of the ArcAB regulatory system.
Kulkarni, Ram; Chidley, Hemangi; Deshpande, Ashish; Schmidt, Axel; Pujari, Keshav; Giri, Ashok; Gershenzon, Jonathan; Gupta, Vidya
2013-01-01
Two furanones, furaneol (4-hydroxy-2,5-dimethyl-3(2H)-furanone) and mesifuran (2,5-dimethyl-4-methoxy-3(2H)-furanone), are important constituents of flavor of the Alphonso cultivar of mango (Mangifera indica). To get insights into the biosynthesis of these furanones, we isolated an enone oxidoreductase gene from the Alphonso mango. It has high sequence similarity to an alkenal/one oxidoreductase from cucumber (79% identity) and enone oxidoreductases from tomato (73% identity) and strawberry (72% identity). The complete open reading frame was expressed in E. coli and the (his)6-tagged recombinant protein was purified by affinity chromatography. The purified protein assayed with NADH as a reducing agent converted D-fructose-1,6-diphosphate into furaneol, the immediate precursor of mesifuran. The enzyme was also able to convert two highly reactive carbonyls, 3-buten-2-one and 1-penten-3-one, produced by lipid peroxidation in plants, into their saturated derivatives. Expression profiling in various ripening stages of Alphonso fruits depicted an expression maxima at 10 days after harvest stage, shortly before the appearance of the maximum amount of furanones (completely ripe stage, 15 days after harvest). Although no furanones were detected at the 0 day after harvest stage, significant expression of this gene was detected in the fruits at this stage. Overall, the results suggest that this oxidoreductase plays important roles in Alphonso mango fruits.
Miller, Matthew [Boston, MA; Suominen, Pirkko [Maple Grove, MN; Aristidou, Aristos [Highland Ranch, CO; Hause, Benjamin Matthew [Currie, MN; Van Hoek, Pim [Camarillo, CA; Dundon, Catherine Asleson [Minneapolis, MN
2012-03-20
Yeast cells having an exogenous lactate dehydrogenase gene ae modified by reducing L- or D-lactate:ferricytochrome c oxidoreductase activity in the cell. This leads to reduced consumption of lactate by the cell and can increase overall lactate yields in a fermentation process. Cells having the reduced L- or D-lactate:ferricytochrome c oxidoreductase activity can be screened for by resistance to organic acids such as lactic or glycolic acid.
Soapwort oxidoreductase is involved in trinitrotoluene detoxification
Czech Academy of Sciences Publication Activity Database
Podlipná, Radka; Nepovím, Aleš; Soudek, Petr; Vágner, Martin; Vaněk, Tomáš
2007-01-01
Roč. 51, č. 2 (2007), s. 367-371 ISSN 0006-3134 R&D Projects: GA MŠk 1P05OC042; GA MŠk 1P05ME730 Institutional research plan: CEZ:AV0Z50380511; CEZ:AV0Z40550506 Source of funding: V - iné verejné zdroje ; V - iné verejné zdroje Keywords : flavoprotein * Old Yellow Enzyme * oxidoreductase Subject RIV: EF - Botanics Impact factor: 1.259, year: 2007
Plaga, W; Lottspeich, F; Oesterhelt, D
1992-04-01
An improved purification procedure, including nickel chelate affinity chromatography, is reported which resulted in a crystallizable pyruvate:ferredoxin oxidoreductase preparation from Halobacterium halobium. Crystals of the enzyme were obtained using potassium citrate as the precipitant. The genes coding for pyruvate:ferredoxin oxidoreductase were cloned and their nucleotide sequences determined. The genes of both subunits were adjacent to one another on the halobacterial genome. The derived amino acid sequences were confirmed by partial primary structure analysis of the purified protein. The structural motif of thiamin-diphosphate-binding enzymes was unequivocally located in the deduced amino acid sequence of the small subunit.
Kooij, A.; Bosch, K. S.; Frederiks, W. M.; van Noorden, C. J.
1992-01-01
The localization of xanthine oxidoreductase activity was investigated in unfixed cryostat sections of various rat tissues by an enzyme histochemical method which specifically demonstrates both the dehydrogenase and oxidase forms of xanthine oxidoreductase. High activity was found in epithelial cells
DEFF Research Database (Denmark)
King, Zachary A.; Feist, Adam
2013-01-01
Central oxidoreductase enzymes (eg, dehydrogenases, reductases) in microbial metabolism often have preferential binding specificity for one of the two major currency metabolites NAD(H) and NADP(H). These enzyme specificities result in a division of the metabolic functionality of the currency...... specificities of oxidoreductase enzyme and complementary reaction knockouts. Using the Escherichia coli genome-scale metabolic model iJO1366, OptSwap predicted eight growth-coupled production designs with significantly greater product yields or substrate-specific productivities than designs predicted with gene...
Oxidoreductases from Trametes spp. in Biotechnology: A Wealth of Catalytic Activity
Directory of Open Access Journals (Sweden)
Gibson S. Nyanhongo
2007-01-01
Full Text Available Those oxidoreductases that are part of the ligninolytic complex of basidiomycete and ascomycete fungi have played an increasingly important role in biotechnological applications during the last decade. The stability of these extracellular enzymes, their good solubility, and a multitude of catalyzed reactions contribute to this trend. This review focuses on a single genus of white-rot basidiomycetes, Trametes, to highlight the numerous possibilities for the application of this microorganism as well as three of its enzymes: laccase, cellobiose dehydrogenase, and pyranose 2-oxidase. Whereas laccase is without doubt a major player in biotechnology, the two other enzymes are less well known, but represent emerging biocatalysts with potential. Both cellobiose dehydrogenase and pyranose 2-oxidase are presumed to participate in lignin breakdown and will be used to exemplify the potential of less prominent oxidoreductases from this genus.
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Glyphosate Oxidoreductase GOX or... REQUIREMENTS FOR PLANT-INCORPORATED PROTECTANTS Tolerances and Tolerance Exemptions § 174.524 Glyphosate... Glyphosate Oxidoreductase GOX or GOXv247 enzyme in all plants are exempt from the requirement of a tolerance...
Chánique, Andrea M; Parra, Loreto P
2018-01-01
Oxidoreductases are ubiquitous enzymes that catalyze an extensive range of chemical reactions with great specificity, efficiency, and selectivity. Most oxidoreductases are nicotinamide cofactor-dependent enzymes with a strong preference for NADP or NAD. Because these coenzymes differ in stability, bioavailability and costs, the enzyme preference for a specific coenzyme is an important issue for practical applications. Different approaches for the manipulation of coenzyme specificity have been reported, with different degrees of success. Here we present various attempts for the switching of nicotinamide coenzyme preference in oxidoreductases by protein engineering. This review covers 103 enzyme engineering studies from 82 articles and evaluates the accomplishments in terms of coenzyme specificity and catalytic efficiency compared to wild type enzymes of different classes. We analyzed different protein engineering strategies and related them with the degree of success in inverting the cofactor specificity. In general, catalytic activity is compromised when coenzyme specificity is reversed, however when switching from NAD to NADP, better results are obtained. In most of the cases, rational strategies were used, predominantly with loop exchange generating the best results. In general, the tendency of removing acidic residues and incorporating basic residues is the strategy of choice when trying to change specificity from NAD to NADP, and vice versa . Computational strategies and algorithms are also covered as helpful tools to guide protein engineering strategies. This mini review aims to give a general introduction to the topic, giving an overview of tools and information to work in protein engineering for the reversal of coenzyme specificity.
Field study of visual and biological light conditions of independently-living elderly people
Aarts, M.P.J.; Westerlaken, A.C.
2005-01-01
A field study was carried out to learn more about the influence of light on the lives of elderly people . The results should lead to the development and design of a light concept for elderly people that will improve their everyday health and well-being. Methods: Ninetyone independently-living
Halo-independent analysis of direct detection data for light WIMPs
International Nuclear Information System (INIS)
Nobile, Eugenio Del; Gelmini, Graciela B.; Huh, Ji-Haeng; Gondolo, Paolo
2013-01-01
We present a halo-independent analysis of direct detection data on ''light WIMPs'', i.e. weakly interacting massive particles with mass close to or below 10 GeV/c 2 . We include new results from silicon CDMS detectors (bounds and excess events), the latest CoGeNT acceptances, and recent measurements of low sodium quenching factors in NaI crystals. We focus on light WIMPs with spin-independent isospin-conserving and isospin-violating interactions with nucleons. For these dark matter candidates we find that a low quenching factor would make the DAMA modulation incompatible with a reasonable escape velocity for the dark matter halo, and that the tension among experimental data tightens in both the isospin-conserving and isospin-violating scenarios. We also find that a new although milder tension appears between the CoGeNT and DAMA annual modulations on one side and the silicon excess events on the other, in that it seems difficult to interpret them as the modulated and unmodulated aspects of the same WIMP dark matter signal
LENUS (Irish Health Repository)
Sahakitrungruang, Taninee
2009-12-01
P450 oxidoreductase (POR) deficiency causes disordered steroidogenesis; severe mutations cause genital ambiguity in both sexes plus the Antley-Bixler skeletal malformation syndrome, whereas mild mutations can cause adult infertility.
Second-order temporal interference of two independent light beams at an asymmetrical beam splitter
International Nuclear Information System (INIS)
Liu Jianbin; Wang Jingjing; Xu Zhuo
2017-01-01
The second-order temporal interference of classical and nonclassical light at an asymmetrical beam splitter is discussed based on two-photon interference in Feynman’s path integral theory. The visibility of the second-order interference pattern is determined by the properties of the superposed light beams, the ratio between the intensities of these two light beams, and the reflectivity of the asymmetrical beam splitter. Some requirements about the asymmetrical beam splitter have to be satisfied in order to ensure that the visibility of the second-order interference pattern of nonclassical light beams exceeds the classical limit. The visibility of the second-order interference pattern of photons emitted by two independent single-photon sources is independent of the ratio between the intensities. These conclusions are important for the researches and applications in quantum optics and quantum information when an asymmetrical beam splitter is employed. (paper)
Lebrun, Jérémie D; Demont-Caulet, Nathalie; Cheviron, Nathalie; Laval, Karine; Trinsoutrot-Gattin, Isabelle; Mougin, Christian
2016-02-01
The present study investigates the effect of metals on the secretion of enzymes from 12 fungal strains maintained in liquid cultures. Hydrolases (acid phosphatase, β-glucosidase, β-galactosidase, and N-acetyl-β-glucosaminidase) and ligninolytic oxidoreductases (laccase, Mn, and lignin peroxidases) activities, as well as biomass production, were measured in culture fluids from fungi exposed to Cu or Cd. Our results showed that all fungi secreted most of the selected hydrolases and that about 50% of them produced a partial oxidative system in the absence of metals. Then, exposure of fungi to metals led to the decrease in biomass production. At the enzymatic level, Cu and Cd modified the secretion profiles of soil fungi. The response of hydrolases to metals was contrasted and complex and depended on metal, enzyme, and fungal strain considered. By contrast, the metals always stimulated the activity of ligninolytic oxidoreductases in fungal strains. In some of them, oxidoreductases were specifically produced following metal exposure. Fungal oxidoreductases provide a more generic response than hydrolases, constituting thus a physiological basis for their use as biomarkers of metal exposure in soils.
Inhibitors of type II NADH:menaquinone oxidoreductase represent a class of antitubercular drugs
Weinstein, Edward A.; Yano, Takahiro; Li, Lin-Sheng; Avarbock, David; Avarbock, Andrew; Helm, Douglas; McColm, Andrew A.; Duncan, Ken; Lonsdale, John T.; Rubin, Harvey
2005-01-01
Mycobacterium tuberculosis (Mtb) is an obligate aerobe that is capable of long-term persistence under conditions of low oxygen tension. Analysis of the Mtb genome predicts the existence of a branched aerobic respiratory chain terminating in a cytochrome bd system and a cytochrome aa3 system. Both chains can be initiated with type II NADH:menaquinone oxidoreductase. We present a detailed biochemical characterization of the aerobic respiratory chains from Mtb and show that phenothiazine analogs specifically inhibit NADH:menaquinone oxidoreductase activity. The emergence of drug-resistant strains of Mtb has prompted a search for antimycobacterial agents. Several phenothiazines analogs are highly tuberculocidal in vitro, suppress Mtb growth in a mouse model of acute infection, and represent lead compounds that may give rise to a class of selective antibiotics. PMID:15767566
International Nuclear Information System (INIS)
Zhang, Yanfei; Cherney, Maia M.; Solomonson, Matthew; Liu, Jianshe; James, Michael N. G.; Weiner, Joel H.
2009-01-01
The sulfide:quinone oxidoreductase from A. ferrooxidans ATCC 23270 was overexpressed in E. coli and purified. Crystallization and preliminarily X-ray crystallographic analysis were performed for the recombinant enzyme. The gene product of open reading frame AFE-1293 from Acidithiobacillus ferrooxidans ATCC 23270 is annotated as encoding a sulfide:quinone oxidoreductase, an enzyme that catalyses electron transfer from sulfide to quinone. Following overexpression in Escherichia coli, the enzyme was purified and crystallized using the hanging-drop vapour-diffusion method. The native crystals belonged to the tetragonal space group P4 2 2 1 2, with unit-cell parameters a = b = 131.7, c = 208.8 Å, and diffracted to 2.3 Å resolution. Preliminary crystallographic analysis indicated the presence of a dimer in the asymmetric unit, with an extreme value of the Matthews coefficient (V M ) of 4.53 Å 3 Da −1 and a solvent content of 72.9%
WrbA bridges bacterial flavonoids and eukaryotic NAD(P)H:quinone oxidoreductases
Czech Academy of Sciences Publication Activity Database
Carey, J.; Brynda, Jiří; Wolfová, Julie; Grandori, R.; Gustavsson, T.; Ettrich, Rüdiger; Kutá-Smatanová, Ivana
2007-01-01
Roč. 16, č. 10 (2007), s. 2301-2305 ISSN 0961-8368 Institutional research plan: CEZ:AV0Z50520514; CEZ:AV0Z60870520 Keywords : WrbA * crystal structure * Nqo1 * oxidoreductases Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.135, year: 2007
Satter, R L; Wetherell, D F
1968-06-01
When Sinningia plants were grown with fluorescent light of photosynthetic intensity for 8 hours each day, stems became abnormally elongated when the P(FR) level was lowered by far red light given during the last half of several consecutive nights. However, plants were even taller if the source also emitted red light. Elongation was independent of the red/far red energy ratio if it was lower than one, but dependent upon irradiance at all values tested.Elongation of plants irradiated by a well filtered far red source was presumed to be limited by a shortage of respiratory substrate. Enhancement by radiation shorter than 700 mmu was attributed to promotion of processes leading to increased substrate supply. Protochlorophyllide was regarded as the primary photoreceptor. Its photoreduction promoted chlorophyll synthesis which, in turn, increased photosynthetic capacity and thus substrate supply.
Model-independent study of light cone current commutators
International Nuclear Information System (INIS)
Gautam, S.R.; Dicus, D.A.
1974-01-01
An attempt is made to extract information on the nature of light cone current commutators (L. C. C.) in a model independent manner. Using simple assumptions on the validity of the DGS representation for the structure functions of deep inelastic scattering and using the Bjorken--Johnston--Low theorem it is shown that in principle the L. C. C. may be constructed knowing the experimental electron--proton scattering data. On the other hand the scaling behavior of the structure functions is utilized to study the consistency of a vanishing value for various L. C. C. under mild assumptions on the behavior of the DGS spectral moments. (U.S.)
Ryden, Anna-Margareta; Ruyter-Spira, Carolien; Litjens, Ralph; Takahashi, Shunji; Quax, Wim; Osada, Hiroyuki; Bouwmeester, Harro; Kayser, Oliver
From Artemisia annua L., a new oxidoreductase (Red 1) was cloned, sequenced and functionally characterized. Through bioinformatics, heterologous protein expression and enzyme substrate conversion assays, the elucidation of the enzymatic capacities of Red1 was achieved. Red1 acts on monoterpenoids,
Ryden, A.M.; Ruyter-Spira, C.P.; Litjens, R.; Takahashi, S.; Quax, W.J.; Osada, H.; Bouwmeester, H.J.; Kayser, O.
2010-01-01
From Artemisia annua L., a new oxidoreductase (Red 1) was cloned, sequenced and functionally characterized. Through bioinformatics, heterologous protein expression, and enzyme substrate conversion assays, the elucidation of the enzymatic capacities of Red1 was achieved. Red1 acts on monoterpenoids,
Jiang, Cong; Yu, Zong-Wen; Wang, Xiang-Bin
2018-04-01
We present an analysis for measurement-device-independent quantum key distribution with correlated source-light-intensity errors. Numerical results show that the results here can greatly improve the key rate especially with large intensity fluctuations and channel attenuation compared with prior results if the intensity fluctuations of different sources are correlated.
Structural Analysis of Quinoline 2-Oxidoreductase from Pseudomonas putida 86
Bonin, Irena
2007-01-01
The crystal structure of the Quinoline 2-Oxidoreductase (Qor), a member of the molybdenum hydroxylase family, was solved at 1.8 Å resolution. Still controversial for molybdenum hydroxylases is the nature of the molybdenum apical ligand. In Qor the sulfido-ligand was found in the equatorial position while the oxo-ligand occupied the apical position. In addition, structural studies were carried out on two Nus family proteins. These resulted in the crystal structures of the transcription factors...
Gray, Joshua P; Karandrea, Shpetim; Burgos, Delaine Zayasbazan; Jaiswal, Anil A; Heart, Emma A
2016-11-16
NQO1 (NAD(P)H-quinone oxidoreductase 1) reduces quinones and xenobiotics to less-reactive compounds via 2-electron reduction, one feature responsible for the role of NQO1 in antioxidant defense in several tissues. In contrast, NADPH cytochrome P450 oxidoreductase (CYP450OR), catalyzes the 1-electron reduction of quinones and xenobiotics, resulting in enhanced superoxide formation. However, to date, the roles of NQO1 and CYP450OR in pancreatic β-cell metabolism under basal conditions and oxidant challenge have not been characterized. Using NQO1 inhibition, over-expression and knock out, we have demonstrated that, in addition to protection of β-cells from toxic concentrations of the redox cycling quinone menadione, NQO1 also regulates the basal level of reduced-to-oxidized nucleotides, suggesting other role(s) beside that of an antioxidant enzyme. In contrast, over-expression of NADPH cytochrome P450 oxidoreductase (CYP450OR) resulted in enhanced redox cycling activity and decreased cellular viability, consistent with the enhanced generation of superoxide and H 2 O 2 . Basal expression of NQO1 and CYP450OR was comparable in isolated islets and liver. However, NQO1, but not CYP450OR, was strongly induced in β-cells exposed to menadione. NQO1 and CYP450OR exhibited a reciprocal preference for reducing equivalents in β-cells: while CYP450OR preferentially utilized NADPH, NQO1 primarily utilized NADH. Together, these results demonstrate that NQO1 and CYP450OR reciprocally regulate oxidant metabolism in pancreatic β-cells. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Lafaye, Céline [Laboratoire des Protéines Membranaires, Institut de Biologie Structurale, CEA/CNRS/Université Joseph Fourier, 41 Rue Jules Horowitz, 38027 Grenoble CEDEX 01 (France); Iwena, Thomas; Ferrer, Jean-Luc [Laboratoire de Cristallogénèse et Cristallisation des Protéines, Institut de Biologie Structurale, CEA/CNRS/Université Joseph Fourier, 41 Rue Jules Horowitz, 38027 Grenoble CEDEX 01 (France); Kroll, J. Simon [Department of Paediatrics, Imperial College London, St Mary’s Hospital Campus, Norfolk Place, London W2 1PG (United Kingdom); Griat, Mickael; Serre, Laurence, E-mail: laurence.serre@ibs.fr [Laboratoire des Protéines Membranaires, Institut de Biologie Structurale, CEA/CNRS/Université Joseph Fourier, 41 Rue Jules Horowitz, 38027 Grenoble CEDEX 01 (France)
2008-02-01
The Neisseria meningitidis genome possesses three genes encoding active DsbAs. To throw light on the reason for this genetic multiplicity, the three enzymes have been purified and crystallized. Bacterial virulence depends on the correct folding of surface-exposed proteins, a process that is catalyzed by the thiol-disulfide oxidoreductase DsbA, which facilitates the synthesis of disulfide bonds in Gram-negative bacteria. Uniquely among bacteria, the Neisseria meningitidis genome possesses three genes encoding active DsbAs: DsbA1, DsbA2 and DsbA3. DsbA1 and DsbA2 have been characterized as lipoproteins involved in natural competence and in host-interactive biology, while the function of DsbA3 remains unknown. In an attempt to shed light on the reason for this multiplicity of dsbA genes, the three enzymes from N. meningitidis have been purified and crystallized in the presence of high concentrations of ammonium sulfate. The best crystals were obtained using DsbA1 and DsbA3; they belong to the orthorhombic and tetragonal systems and diffract to 1.5 and 2.7 Å resolution, respectively.
Transgenic Mice Over-Expressing RBP4 Have RBP4-Dependent and Light-Independent Retinal Degeneration.
Du, Mei; Phelps, Eric; Balangue, Michael J; Dockins, Aaron; Moiseyev, Gennadiy; Shin, Younghwa; Kane, Shelley; Otalora, Laura; Ma, Jian-Xing; Farjo, Rafal; Farjo, Krysten M
2017-08-01
Transgenic mice overexpressing serum retinol-binding protein (RBP4-Tg) develop progressive retinal degeneration, characterized by microglia activation, yet the precise mechanisms underlying retinal degeneration are unclear. Previous studies showed RBP4-Tg mice have normal ocular retinoid levels, suggesting that degeneration is independent of the retinoid visual cycle or light exposure. The present study addresses whether retinal degeneration is light-dependent and RBP4-dependent by testing the effects of dark-rearing and pharmacological lowering of serum RBP4 levels, respectively. RBP4-Tg mice reared on normal mouse chow in normal cyclic light conditions were directly compared to RBP4-Tg mice exposed to chow supplemented with the RBP4-lowering compound A1120 or dark-rearing conditions. Quantitative retinal histological analysis was conducted to assess retinal degeneration, and electroretinography (ERG) and optokinetic tracking (OKT) tests were performed to assess retinal and visual function. Ocular retinoids and bis-retinoid A2E were quantified. Dark-rearing RBP4-Tg mice effectively reduced ocular bis-retinoid A2E levels, but had no significant effect on retinal degeneration or dysfunction in RBP4-Tg mice, demonstrating that retinal degeneration is light-independent. A1120 treatment lowered serum RBP4 levels similar to wild-type mice, and prevented structural retinal degeneration. However, A1120 treatment did not prevent retinal dysfunction in RBP4-Tg mice. Moreover, RBP4-Tg mice on A1120 diet had significant worsening of OKT response and loss of cone photoreceptors compared to RBP4-Tg mice on normal chow. This may be related to the very significant reduction in retinyl ester levels in the retina of mice on A1120-supplemented diet. Retinal degeneration in RBP4-Tg mice is RBP4-dependent and light-independent.
Enzymatic coupling of 2,4-dichlorophenol to stream fulvic acid in the presence of oxidoreductases
International Nuclear Information System (INIS)
Sarkar, J.M.; Malcolm, R.L.; Bollag, J.M.
1988-01-01
The coupling 14 C-ring-labelled 2,4-dichlorophenol (2,4-DCP) to stream fulvic acid was investigated in the presence of several oxidoreductases including tyrosinase, peroxidase, and laccases of Rhizoctonia praticola and Trametes vesicolor. During 12-h incubation of the oxidoreductases with 14 C-2, 4-DCP and stream fulvic acid, a substantial amount of the radioactivity was incorporated into fulvic acid. Chromatographic analysis indicated that although a large portion of the radioactivity remained in solution, no unbound 14 C-2,4-DCP was present in the supernatant. The effects of pH, temperature, concentration of fulvic acid, and concentration of enzyme on the coupling processes were studied. The results of this research provide evidence that the enzymatic coupling of certain xenobiotic pollutants to humic substances is an important natural process which must be considered in studies of the fate, reactivity, and persistence of these organic compounds in soils and stream waters
International Nuclear Information System (INIS)
Pereira, L.; Saraiva, I. H.; Coelho, R.; Newman, D. K.; Louro, R. O.; Frazão, C.
2012-01-01
Crystals of the R. ferrooxidans SW2 iron oxidoreductase FoxE were obtained and the phase problem was solved by Fe SAD at 2.44 Å resolution. FoxE is a protein encoded by the foxEYZ operon of Rhodobacter ferrooxidans SW2 that is involved in Fe II -based anoxygenic photosynthesis (‘photoferrotrophy’). It is thought to reside in the periplasm, where it stimulates light-dependent Fe II oxidation. It contains 259 residues, including two haem c-binding motifs. As no three-dimensional model is available and there is no structure with a similar sequence, crystals of FoxE were produced. They diffracted to 2.44 Å resolution using synchrotron radiation at the Fe edge. The phase problem was solved by SAD using SHELXC/D/E and the experimental maps confirmed the presence of two haems per molecule
Wang, X.; Miller, E. N.; Yomano, L. P.; Zhang, X.; Shanmugam, K. T.; Ingram, L. O.
2011-01-01
Furfural is an important fermentation inhibitor in hemicellulose sugar syrups derived from woody biomass. The metabolism of furfural by NADPH-dependent oxidoreductases, such as YqhD (low Km for NADPH), is proposed to inhibit the growth and fermentation of xylose in Escherichia coli by competing with biosynthesis for NADPH. The discovery that the NADH-dependent propanediol oxidoreductase (FucO) can reduce furfural provided a new approach to improve furfural tolerance. Strains that produced eth...
Kooij, A.; Frederiks, W. M.; Gossrau, R.; van Noorden, C. J.
1991-01-01
We have detected xanthine oxidoreductase activity in unfixed cryostat sections of rat and chicken liver, rat duodenum, and bovine mammary gland using the tissue protectant polyvinyl alcohol, the electron carrier 1-methoxyphenazine methosulfate, the final electron acceptor Tetranitro BT, and
Directory of Open Access Journals (Sweden)
Aleksandr L. Simonian
2002-03-01
Full Text Available Mass transfer in nanocomposite hydrogel thin films consisting of alternating layers of an organometallic redox polymer (RP and oxidoreductase enzymes was investigated. Multilayer nanostructures were fabricated on gold surfaces by the deposition of an anionic self-assembled monolayer of 11-mercaptoundecanoic acid, followed by the electrostatic binding of a cationic redox polymer, poly[vinylpyridine Os(bis-bipyridine2Clco-allylamine], and an anionic oxidoreductase. Surface plasmon resonance spectroscopy, Fourier transform infrared external reflection spectroscopy (FTIR-ERS, ellipsometry and electrochemistry were employed to characterize the assembly of these nanocomposite films. Simultaneous SPR/electrochemistry enabled real time observation of the assembly of sensing components, changes in film structure with electrode potential, and the immediate, in situ electrochemical verification of substrate-dependent current upon the addition of enzyme to the multilayer structure. SPR and FTIR-ERS studies also showed no desorption of polymer or enzyme from the nanocomposite structure when stored in aqueous environment occurred over the period of three weeks, suggesting that decreasing in substrate sensitivity were due to loss of enzymatic activity rather than loss of film compounds from the nanostructure.
Inhibitors of type II NADH:menaquinone oxidoreductase represent a class of antitubercular drugs
Weinstein, Edward A.; Yano, Takahiro; Li, Lin-Sheng; Avarbock, David; Avarbock, Andrew; Helm, Douglas; McColm, Andrew A.; Duncan, Ken; Lonsdale, John T.; Rubin, Harvey
2005-01-01
Mycobacterium tuberculosis (Mtb) is an obligate aerobe that is capable of long-term persistence under conditions of low oxygen tension. Analysis of the Mtb genome predicts the existence of a branched aerobic respiratory chain terminating in a cytochrome bd system and a cytochrome aa3 system. Both chains can be initiated with type II NADH:menaquinone oxidoreductase. We present a detailed biochemical characterization of the aerobic respiratory chains from Mtb and show that phenothiazine analogs...
Wang, Xuan; Miller, Elliot N.; Yomano, Lorraine P.; Shanmugam, Keelnatham T.; Ingram, Lonnie O'Neal
2016-05-24
The subject invention pertains to overexpression of a putative oxidoreductase (ucpA) for increasing furfural tolerance in genetically modified microorganisms. Genetically modified microorganisms capable of overexpressing UcpA are also provided. Increased expression of ucpA was shown to increase furfural tolerance by 50%, and to permit the fermentation of sugars to products in the presence of 15 mM furfural.
Evolution of NADPH-cytochrome P450 oxidoreductases (POR) in Apiales - POR 1 is missing
DEFF Research Database (Denmark)
Andersen, Trine Bundgaard; Hansen, Niels Bjørn; Laursen, Tomas
2016-01-01
The NADPH-dependent cytochrome P450 oxidoreductase (POR) is the obligate electron donor to eukaryotic microsomal cytochromes P450 enzymes. The number of PORs within plant species is limited to one to four isoforms, with the most common being two PORs per plant. These enzymes provide electrons to ...... (available from the SRA at NCBI). All three genes were shown to be functional upon reconstitution into nanodiscs, confirming that none of the isoforms are pseudogenes....
Xanthine oxidoreductase and its inhibitors: relevance for gout.
Day, Richard O; Kamel, Bishoy; Kannangara, Diluk R W; Williams, Kenneth M; Graham, Garry G
2016-12-01
Xanthine oxidoreductase (XOR) is the rate-limiting enzyme in purine catabolism and converts hypoxanthine to xanthine, and xanthine into uric acid. When concentrations of uric acid exceed its biochemical saturation point, crystals of uric acid, in the form of monosodium urate, emerge and can predispose an individual to gout, the commonest form of inflammatory arthritis in men aged over 40 years. XOR inhibitors are primarily used in the treatment of gout, reducing the formation of uric acid and thereby, preventing the formation of monosodium urate crystals. Allopurinol is established as first-line therapy for gout; a newer alternative, febuxostat, is used in patients unable to tolerate allopurinol. This review provides an overview of gout, a detailed analysis of the structure and function of XOR, discussion on the pharmacokinetics and pharmacodynamics of XOR inhibitors-allopurinol and febuxostat, and the relevance of XOR in common comorbidities of gout. © 2016 The Author(s). published by Portland Press Limited on behalf of the Biochemical Society.
International Nuclear Information System (INIS)
Cedervall, Peder E.; Hooper, Alan B.; Wilmot, Carrie M.
2009-01-01
A new crystal form of N. europaea hydroxylamine oxidoreductase (space group P2 1 2 1 2) diffracted to 2.25 Å resolution at a third-generation synchrotron X-ray source. Hydroxylamine oxidoreductase (HAO) from Nitrosomonas europaea is a homotrimeric protein that catalyzes the oxidation of hydroxylamine to nitrite. Each monomer, with a molecular weight of 67.1 kDa, contains seven c-type hemes and one heme P460, the porphyrin ring of which is covalently linked to a tyrosine residue from an adjacent subunit. HAO was first crystallized and structurally characterized at a resolution of 2.8 Å in 1997. The structure was solved in space group P6 3 and suffered from merohedral twinning. Here, a crystallization procedure is presented that yielded untwinned crystals belonging to space group P2 1 2 1 2, which diffracted to 2.25 Å resolution and contained one trimer in the asymmetric unit. The unit-cell parameters were a = 140.7, b = 142.6, c = 107.4 Å
Directory of Open Access Journals (Sweden)
Yuki Fujimura
Full Text Available Xanthine oxidoreductase (XOR, which catalyzes purine catabolism, has two interconvertible forms, xanthine dehydrogenase and xanthine oxidase, the latter of which produces superoxide during uric acid (UA synthesis. An association between plasma XOR activity and cardiovascular and renal outcomes has been previously suggested. We investigated the potential association between cardiac parameters and plasma XOR activity among cardiology patients.Plasma XOR activity was measured by [13C2,15N2]xanthine coupled with liquid chromatography/triplequadrupole mass spectrometry. Among 270 patients who were not taking UA-lowering drugs, XOR activity was associated with body mass index (BMI, alanine aminotransferase (ALT, HbA1c and renal function. Although XOR activity was not associated with serum UA overall, patients with chronic kidney disease (CKD, those with higher XOR activity had higher serum UA among patients without CKD. Compared with patients with the lowest XOR activity quartile, those with higher three XOR activity quartiles more frequently had left ventricular hypertrophy. In addition, plasma XOR activity showed a U-shaped association with low left ventricular ejection fraction (LVEF and increased plasma B-type natriuretic peptide (BNP levels, and these associations were independent of age, gender, BMI, ALT, HbA1C, serum UA, and CKD stages.Among cardiac patients, left ventricular hypertrophy, low LVEF, and increased BNP were significantly associated with plasma XOR activity independent of various confounding factors. Whether pharmaceutical modification of plasma XOR activity might inhibit cardiac remodeling and improve cardiovascular outcome should be investigated in future studies.
Hirota, Ryuichi; Kuroda, Akio; Ikeda, Tsukasa; Takiguchi, Noboru; Ohtake, Hisao; Kato, Junichi
2006-08-01
The nitrifying bacterium Nitrosomonas sp. strain ENI-11 has three copies of the gene encoding hydroxylamine oxidoreductase (hao(1), hao(2), and hao(3)) on its genome. Broad-host-range reporter plasmids containing transcriptional fusion genes between hao copies and lacZ were constructed to analyze the expression of each hydroxylamine oxidoreductase gene (hao) copy individually and quantitatively. beta-Galactosidase assays of ENI-11 harboring reporter plasmids revealed that all hao copies were transcribed in the wild-type strain. Promoter analysis of hao copies revealed that transcription of hao(3) was highest among the hao copies. Expression levels of hao(1) and hao(2) were 40% and 62% of that of hao(3) respectively. Transcription of hao(1) was negatively regulated, whereas a portion of hao(3) transcription was read through transcription from the rpsT promoter. When energy-depleted cells were incubated in the growth medium, only hao(3) expression increased. This result suggests that it is hao(3) that is responsible for recovery from energy-depleted conditions in Nitrosomonas sp. strain ENI-11.
Energy Technology Data Exchange (ETDEWEB)
Peak, M J; Peak, J G; Foote, C S; Krinsky, N I
1984-01-01
An oxygen enhancement ratio of 10 for the induction of backbone single-strand breaks (SSBs) in purified deoxyribonucleic acid (DNA) by monochromatic 365 nm UV radiation was obtained. Similarly, a dose reduction factor of 10 was observed when the DNA was irradiated in the presence of 0.1 M diazabicyclo(2.2.2)octane (DABCO). To determine whether this breakage of DNA was due to the action of a reactive oxygen species such as singlet oxygen, we used the photosensitizing dye Rose Bengal and visible light as a system for generating singlet oxygen. Treatment of the DNA with Rose Bengal and 545 nm monochromatic light enhanced the rate of induction of SSBs six times, compared with the rate we obtained when the light was used alone. Elimination of oxygen or addition of 0.1 M DABCO during the 545 nm irradiation in the presence of Rose Bengal did not alter the enhancement of SSBs in the DNA caused by Rose Bengal and 545 nm radiation. The induction of SSBs in the DNA caused by irradiation of the DNA by 545 nm light in the presence of Rose Bengal was not enhanced by the use of D/sub 2/O instead of H/sub 2/O as a solvent. The results indicate that Rose Bengal plus visible light can cause biological damage without the intermediacy of reactive oxygen species, i.e. Rose Bengal and visible light can react directly with biological material, in reactions that appear to be type I photosensitized processes, independent of singlet oxygen as an intermediate.
Differentially regulated NADPH:cytochrome P450 oxidoreductases in parsley
Koopmann, Edda; Hahlbrock, Klaus
1997-01-01
Two NADPH:cytochrome P450 oxidoreductases (CPRs) from parsley (Petroselinum crispum) were cloned, and the complete proteins were expressed and functionally identified in yeast. The two enzymes, designated CPR1 and CPR2, are 80% identical in amino acid sequence with one another and about 75% identical with CPRs from several other plant species. The mRNA accumulation patterns for CPR1 and CPR2 in fungal elicitor-treated or UV-irradiated cultured parsley cells and in developing or infected parsley plants were compared with those for cinnamate 4-hydroxylase (C4H), one of the most abundant CPR-dependent P450 enzymes in plants. All treatments strongly induced the mRNAs for C4H and CPR1 but not for CPR2, suggesting distinct metabolic roles of CPR1 and CPR2 and a functional relationship between CPR1 and C4H. PMID:9405720
Differentially regulated NADPH: cytochrome p450 oxidoreductases in parsely
International Nuclear Information System (INIS)
Koopmann, E.; Hahlbrock, K.
1997-01-01
Two NADPH:cytochrome P450 oxidoreductases (CPRs) from parsley (Petroselinum crispum) were cloned, and the complete proteins were expressed and functionally identified in yeast. The two enzymes, designated CPR1 and CPR2, are 80% identical in amino acid sequence with one another and about 75% identical with CPRs from several other plant species. The mRNA accumulation patterns for CPR1 and CPR2 in fungal elicitor-treated or UV-irradiated cultured parsley cells and in developing or infected parsley plants were compared with those for cinnamate 4-hydroxylase (C4H), one of the most abundant CPR-dependent P450 enzymes in plants. All treatments strongly induced the mRNAs for C4H and CPR1 but not for CPR2, suggesting distinct metabolic roles of CPR1 and CPR2 and a functional relationship between CPR1 and C4H
Miller, Elliot N.; Zhang, Xueli; Yomano, Lorraine P.; Wang, Xuan; Shanmugam, Keelnatham T.; Ingram, Lonnie O'Neal
2015-10-13
The subject invention pertains to the discovery that the NADH-dependent propanediol oxidoreductase (FucO) can reduce furfural. This allows for a new approach to improve furfural tolerance in bacterial and/or yeast cells used to produce desired products. Thus, novel biocatalysts (bacterial, fungal or yeast cells) exhibiting increased tolerance to furfural and 5-hydroxymethylfurfural (5-HMF) are provided as are methods of making and using such biocatalysts for the production of a desired product.
Energy Technology Data Exchange (ETDEWEB)
None, None
2017-09-29
The GATEWAY program evaluated a trial installation of tunable-white LED lighting systems in three classrooms in the Carrollton-Farmers Branch Independent School District in Carrollton, TX. The report provides valuable insights into the use of this technology in a real-world setting.
Leptonic decay of light vector mesons in an independent quark model
International Nuclear Information System (INIS)
Barik, N.; Dash, P.C.; Panda, A.R.
1993-01-01
Leptonic decay widths of light vector mesons are calculated in a framework based on the independent quark model with a scalar-vector harmonic potential. Assuming a strong correlation to exist between the quark-antiquark momenta inside the meson, so as to make their total momentum identically zero in the center-of-mass frame of the meson, we extract the quark and antiquark momentum distribution amplitudes from the bound quark eigenmode. Using the model parameters determined from earlier studies, we arrive at the leptonic decay widths of (ρ,ω,φ) as (6.26 keV, 0.67 keV, 1.58 keV) which are in very good agreement with the respective experimental data (6.77±0.32 keV, 0.6±0.02 keV, 1.37±0.05 keV)
Mishanina, Tatiana V.; Yadav, Pramod K.; Ballou, David P.; Banerjee, Ruma
2015-01-01
The first step in the mitochondrial sulfide oxidation pathway is catalyzed by sulfide quinone oxidoreductase (SQR), which belongs to the family of flavoprotein disulfide oxidoreductases. During the catalytic cycle, the flavin cofactor is intermittently reduced by sulfide and oxidized by ubiquinone, linking H2S oxidation to the electron transfer chain and to energy metabolism. Human SQR can use multiple thiophilic acceptors, including sulfide, sulfite, and glutathione, to form as products, hydrodisulfide, thiosulfate, and glutathione persulfide, respectively. In this study, we have used transient kinetics to examine the mechanism of the flavin reductive half-reaction and have determined the redox potential of the bound flavin to be −123 ± 7 mV. We observe formation of an unusually intense charge-transfer (CT) complex when the enzyme is exposed to sulfide and unexpectedly, when it is exposed to sulfite. In the canonical reaction, sulfide serves as the sulfur donor and sulfite serves as the acceptor, forming thiosulfate. We show that thiosulfate is also formed when sulfide is added to the sulfite-induced CT intermediate, representing a new mechanism for thiosulfate formation. The CT complex is formed at a kinetically competent rate by reaction with sulfide but not with sulfite. Our study indicates that sulfide addition to the active site disulfide is preferred under normal turnover conditions. However, under pathological conditions when sulfite concentrations are high, sulfite could compete with sulfide for addition to the active site disulfide, leading to attenuation of SQR activity and to an alternate route for thiosulfate formation. PMID:26318450
Mishanina, Tatiana V; Yadav, Pramod K; Ballou, David P; Banerjee, Ruma
2015-10-09
The first step in the mitochondrial sulfide oxidation pathway is catalyzed by sulfide quinone oxidoreductase (SQR), which belongs to the family of flavoprotein disulfide oxidoreductases. During the catalytic cycle, the flavin cofactor is intermittently reduced by sulfide and oxidized by ubiquinone, linking H2S oxidation to the electron transfer chain and to energy metabolism. Human SQR can use multiple thiophilic acceptors, including sulfide, sulfite, and glutathione, to form as products, hydrodisulfide, thiosulfate, and glutathione persulfide, respectively. In this study, we have used transient kinetics to examine the mechanism of the flavin reductive half-reaction and have determined the redox potential of the bound flavin to be -123 ± 7 mV. We observe formation of an unusually intense charge-transfer (CT) complex when the enzyme is exposed to sulfide and unexpectedly, when it is exposed to sulfite. In the canonical reaction, sulfide serves as the sulfur donor and sulfite serves as the acceptor, forming thiosulfate. We show that thiosulfate is also formed when sulfide is added to the sulfite-induced CT intermediate, representing a new mechanism for thiosulfate formation. The CT complex is formed at a kinetically competent rate by reaction with sulfide but not with sulfite. Our study indicates that sulfide addition to the active site disulfide is preferred under normal turnover conditions. However, under pathological conditions when sulfite concentrations are high, sulfite could compete with sulfide for addition to the active site disulfide, leading to attenuation of SQR activity and to an alternate route for thiosulfate formation. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.
Energy Technology Data Exchange (ETDEWEB)
None
2017-09-29
Summary of GATEWAY report evaluating a trial installation of tunable-white LED lighting systems in three classrooms in the Carrollton-Farmers Branch Independent School District in Carrollton, TX. The report provides valuable insights into the use of this technology in a real-world setting.
Albracht, S.P.J.
2010-01-01
Bovine NADH:ubiquinone oxidoreductase (Complex I) is the first complex in the mitochondrial respiratory chain. It has long been assumed that it contained only one FMN group. However, as demonstrated in 2003, the intact enzyme contains two FMN groups. The second FMN was proposed to be located in a
Zhou, Fei; Wang, Cheng-Yuan; Gutensohn, Michael; Jiang, Ling; Zhang, Peng; Zhang, Dabing; Dudareva, Natalia; Lu, Shan
2017-06-27
In plants, geranylgeranyl diphosphate (GGPP) is produced by plastidic GGPP synthase (GGPPS) and serves as a precursor for vital metabolic branches, including chlorophyll, carotenoid, and gibberellin biosynthesis. However, molecular mechanisms regulating GGPP allocation among these biosynthetic pathways localized in the same subcellular compartment are largely unknown. We found that rice contains only one functionally active GGPPS, OsGGPPS1, in chloroplasts. A functionally active homodimeric enzyme composed of two OsGGPPS1 subunits is located in the stroma. In thylakoid membranes, however, the GGPPS activity resides in a heterodimeric enzyme composed of one OsGGPPS1 subunit and GGPPS recruiting protein (OsGRP). OsGRP is structurally most similar to members of the geranyl diphosphate synthase small subunit type II subfamily. In contrast to members of this subfamily, OsGRP enhances OsGGPPS1 catalytic efficiency and specificity of GGPP production on interaction with OsGGPPS1. Structural biology and protein interaction analyses demonstrate that affinity between OsGRP and OsGGPPS1 is stronger than between two OsGGPPS1 molecules in homodimers. OsGRP determines OsGGPPS1 suborganellar localization and directs it to a large protein complex in thylakoid membranes, consisting of geranylgeranyl reductase (OsGGR), light-harvesting-like protein 3 (OsLIL3), protochlorophyllide oxidoreductase (OsPORB), and chlorophyll synthase (OsCHLG). Taken together, genetic and biochemical analyses suggest OsGRP functions in recruiting OsGGPPS1 from the stroma toward thylakoid membranes, thus providing a mechanism to control GGPP flux toward chlorophyll biosynthesis.
Independent Evolution of Six Families of Halogenating Enzymes.
Xu, Gangming; Wang, Bin-Gui
2016-01-01
Halogenated natural products are widespread in the environment, and the halogen atoms are typically vital to their bioactivities. Thus far, six families of halogenating enzymes have been identified: cofactor-free haloperoxidases (HPO), vanadium-dependent haloperoxidases (V-HPO), heme iron-dependent haloperoxidases (HI-HPO), non-heme iron-dependent halogenases (NI-HG), flavin-dependent halogenases (F-HG), and S-adenosyl-L-methionine (SAM)-dependent halogenases (S-HG). However, these halogenating enzymes with similar biological functions but distinct structures might have evolved independently. Phylogenetic and structural analyses suggest that the HPO, V-HPO, HI-HPO, NI-HG, F-HG, and S-HG enzyme families may have evolutionary relationships to the α/β hydrolases, acid phosphatases, peroxidases, chemotaxis phosphatases, oxidoreductases, and SAM hydroxide adenosyltransferases, respectively. These halogenating enzymes have established sequence homology, structural conservation, and mechanistic features within each family. Understanding the distinct evolutionary history of these halogenating enzymes will provide further insights into the study of their catalytic mechanisms and halogenation specificity.
Albracht, S.P.J.
2010-01-01
The first purification of bovine NADH:ubiquinone oxidoreductase (Complex I) was reported nearly half a century ago (Hatefi et al. J Biol Chem 237:1676-1680, 1962). The pathway of electron-transfer through the enzyme is still under debate. A major obstacle is the assignment of EPR signals to the
Weak leptonic decay of light and heavy pseudoscalar mesons in an independent quark model
International Nuclear Information System (INIS)
Barik, N.; Dash, P.C.
1993-01-01
Weak leptonic decays of light and heavy pseudoscalar mesons are studied in a field-theoretic framework based on the independent quark model with a scalar-vector harmonic potential. Defining the quark-antiquark momentum distribution amplitude obtainable from the bound quark eigenmodes of the model with the assumption of a strong correlation between quark-antiquark momenta inside the decaying meson in its rest frame, we derive the partial decay width with correct kinematical factors from which we extract an expression for the pseudoscalar decay constants f M . Using the model parameters determined from earlier studies in the light-flavor sector and heavy-quark masses m c and m b from the hyperfine splitting of (D * ,D) and (B * ,B), we calculate the pseudoscalar decay constants. We find that while (f π ,f K )≡(138,157 MeV); (f D ,f Ds )≡(161,205 MeV), (f B ,f Bs )≡(122,154 MeV), and f Bc =221 MeV. We also obtain the partial decay widths and branching ratios for some kinematically allowed weak leptonic decay processes
Light Chain Amyloid Fibrils Cause Metabolic Dysfunction in Human Cardiomyocytes.
Directory of Open Access Journals (Sweden)
Helen P McWilliams-Koeppen
Full Text Available Light chain (AL amyloidosis is the most common form of systemic amyloid disease, and cardiomyopathy is a dire consequence, resulting in an extremely poor prognosis. AL is characterized by the production of monoclonal free light chains that deposit as amyloid fibrils principally in the heart, liver, and kidneys causing organ dysfunction. We have studied the effects of amyloid fibrils, produced from recombinant λ6 light chain variable domains, on metabolic activity of human cardiomyocytes. The data indicate that fibrils at 0.1 μM, but not monomer, significantly decrease the enzymatic activity of cellular NAD(PH-dependent oxidoreductase, without causing significant cell death. The presence of amyloid fibrils did not affect ATP levels; however, oxygen consumption was increased and reactive oxygen species were detected. Confocal fluorescence microscopy showed that fibrils bound to and remained at the cell surface with little fibril internalization. These data indicate that AL amyloid fibrils severely impair cardiomyocyte metabolism in a dose dependent manner. These data suggest that effective therapeutic intervention for these patients should include methods for removing potentially toxic amyloid fibrils.
Nguyen, Diep M N; Schut, Gerrit J; Zadvornyy, Oleg A; Tokmina-Lukaszewska, Monika; Poudel, Saroj; Lipscomb, Gina L; Adams, Leslie A; Dinsmore, Jessica T; Nixon, William J; Boyd, Eric S; Bothner, Brian; Peters, John W; Adams, Michael W W
2017-09-01
Electron bifurcation has recently gained acceptance as the third mechanism of energy conservation in which energy is conserved through the coupling of exergonic and endergonic reactions. A structure-based mechanism of bifurcation has been elucidated recently for the flavin-based enzyme NADH-dependent ferredoxin NADP + oxidoreductase I (NfnI) from the hyperthermophillic archaeon Pyrococcus furiosus. NfnI is thought to be involved in maintaining the cellular redox balance, producing NADPH for biosynthesis by recycling the two other primary redox carriers, NADH and ferredoxin. The P. furiosus genome encodes an NfnI paralog termed NfnII, and the two are differentially expressed, depending on the growth conditions. In this study, we show that deletion of the genes encoding either NfnI or NfnII affects the cellular concentrations of NAD(P)H and particularly NADPH. This results in a moderate to severe growth phenotype in deletion mutants, demonstrating a key role for each enzyme in maintaining redox homeostasis. Despite their similarity in primary sequence and cofactor content, crystallographic, kinetic, and mass spectrometry analyses reveal that there are fundamental structural differences between the two enzymes, and NfnII does not catalyze the NfnI bifurcating reaction. Instead, it exhibits non-bifurcating ferredoxin NADP oxidoreductase-type activity. NfnII is therefore proposed to be a bifunctional enzyme and also to catalyze a bifurcating reaction, although its third substrate, in addition to ferredoxin and NADP(H), is as yet unknown. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.
Hirose, Fumiaki; Inagaki, Noritoshi; Hanada, Atsushi; Yamaguchi, Shinjiro; Kamiya, Yuji; Miyao, Akio; Hirochika, Hirohiko; Takano, Makoto
2012-09-01
In contrast to a wealth of knowledge about the photoregulation of gibberellin metabolism in dicots, that in monocots remains largely unclear. In this study, we found that a blue light signal triggers reduction of active gibberellin content in rice seedlings with simultaneous repression of two gibberellin 20-oxidase genes (OsGA20ox2 and OsGA20ox4) and acute induction of four gibberellin 2-oxidase genes (OsGA2ox4-OsGA2ox7). For further examination of the regulation of these genes, we established a series of cryptochrome-deficient lines through reverse genetic screening from a Tos17 mutant population and construction of knockdown lines based on an RNA interference technique. By using these lines and phytochrome mutants, we elucidated that cryptochrome 1 (cry1), consisting of two species in rice plants (cry1a and cry1b), is indispensable for robust induction of the GA2ox genes. On the other hand, repression of the GA20ox genes is mediated by phytochromes. In addition, we found that the phytochromes also mediate the repression of a gibberellin 3-oxidase gene (OsGA3ox2) in the light. These results imply that, in rice seedlings, phytochromes mediate the repression of gibberellin biosynthesis capacity, while cry1 mediates the induction of gibberellin inactivation capacity. The cry1 action was demonstrated to be dominant in the reduction of active gibberellin content, but, in rice seedlings, the cumulative effects of these independent actions reduced active gibberellin content in the light. This pathway design in which different types of photoreceptors independently but cooperatively regulate active gibberellin content is unique from the viewpoint of dicot research. This redundancy should provide robustness to the response in rice plants.
Regulation of NAD(P)H:quininone oxidoreductase by glucocorticoids
International Nuclear Information System (INIS)
Pinaire, J.A.; Xiao, G.-H.; Falkner, K.C.; Prough, R.A.
2004-01-01
Previous studies in neonatal and adolescent rats as well as adrenalectomized rats have demonstrated that glucocorticoids regulate the expression of the rat NAD(P)H:quinone oxidoreductase gene (QOR). We used primary cultures of rat adult hepatocytes to document that added glucorticoids repress both the basal and 1,2-benzanthracene-induced expression of QOR mRNA by 65-70%. QOR enzyme activity and protein were concomitantly suppressed as well. The monotonic concentration response for repression of QOR gene products up to 100 μM DEX concentration demonstrated that the glucocorticoid receptor (GR) was most likely involved in this process. The lack of effect at higher concentration rules out a role for the Pregnane X receptor in this regulation by DEX. In addition, the anti-glucorticoid RU38486 blocked this negative regulation and the protein synthesis inhibitor cycloheximide had no effect on this repression process. Similar results of GR dependence were observed using a luciferase reporter construct containing the 5'-flanking region of the human QOR gene using HepG2 cells. Collectively, these results demonstrate that GR must directly participate in the negative regulation of QOR gene expression by dexamethasone and other glucocorticoids in vivo
Directory of Open Access Journals (Sweden)
Margit Winkler
2013-08-01
Full Text Available Enzymes of the non-conventional yeast Yarrowia lipolytica seem to be tailor-made for the conversion of lipophilic substrates. Herein, we cloned and overexpressed the Zn-dependent alcohol dehydrogenase ADH2 from Yarrowia lipolytica in Escherichia coli. The purified enzyme was characterized in vitro. The substrate scope for YlADH2 mediated oxidation and reduction was investigated spectrophotometrically and the enzyme showed a broader substrate range than its homolog from Saccharomyces cerevisiae. A preference for secondary compared to primary alcohols in oxidation direction was observed for YlADH2. 2-Octanone was investigated in reduction mode in detail. Remarkably, YlADH2 displays perfect (S-selectivity and together with a highly (R-selective short chain dehydrogenase/ reductase from Yarrowia lipolytica it is possible to access both enantiomers of 2-octanol in >99% ee with Yarrowia lipolytica oxidoreductases.
Napora-Wijata, Kamila; Strohmeier, Gernot A; Sonavane, Manoj N; Avi, Manuela; Robins, Karen; Winkler, Margit
2013-08-12
Enzymes of the non-conventional yeast Yarrowia lipolytica seem to be tailor-made for the conversion of lipophilic substrates. Herein, we cloned and overexpressed the Zn-dependent alcohol dehydrogenase ADH2 from Yarrowia lipolytica in Escherichia coli. The purified enzyme was characterized in vitro. The substrate scope for YlADH2 mediated oxidation and reduction was investigated spectrophotometrically and the enzyme showed a broader substrate range than its homolog from Saccharomyces cerevisiae. A preference for secondary compared to primary alcohols in oxidation direction was observed for YlADH2. 2-Octanone was investigated in reduction mode in detail. Remarkably, YlADH2 displays perfect (S)-selectivity and together with a highly (R)-selective short chain dehydrogenase/ reductase from Yarrowia lipolytica it is possible to access both enantiomers of 2-octanol in >99% ee with Yarrowia lipolytica oxidoreductases.
Raab, Thomas; López-Ráez, Juan Antonio; Klein, Dorothée; Caballero, Jose Luis; Moyano, Enriqueta; Schwab, Wilfried; Muñoz-Blanco, Juan
2006-04-01
The flavor of strawberry (Fragaria x ananassa) fruit is dominated by an uncommon group of aroma compounds with a 2,5-dimethyl-3(H)-furanone structure. We report the characterization of an enzyme involved in the biosynthesis of 4-hydroxy-2,5-dimethyl-3(2H)-furanone (HDMF; Furaneol), the key flavor compound in strawberries. Protein extracts were partially purified, and the observed distribution of enzymatic activity correlated with the presence of a single polypeptide of approximately 37 kD. Sequence analysis of two peptide fragments showed total identity with the protein sequence of a strongly ripening-induced, auxin-dependent putative quinone oxidoreductase, Fragaria x ananassa quinone oxidoreductase (FaQR). The open reading frame of the FaQR cDNA consists of 969 bp encoding a 322-amino acid protein with a calculated molecular mass of 34.3 kD. Laser capture microdissection followed by RNA extraction and amplification demonstrated the presence of FaQR mRNA in parenchyma tissue of the strawberry fruit. The FaQR protein was functionally expressed in Escherichia coli, and the monomer catalyzed the formation of HDMF. After chemical synthesis and liquid chromatography-tandem mass spectrometry analysis, 4-hydroxy-5-methyl-2-methylene-3(2H)-furanone was confirmed as a substrate of FaQR and the natural precursor of HDMF. This study demonstrates the function of the FaQR enzyme in the biosynthesis of HDMF as enone oxidoreductase and provides a foundation for the improvement of strawberry flavor and the biotechnological production of HDMF.
Haan, de L.H.J.; Boerboom, A.M.J.F.; Rietjens, I.M.C.M.; Capelle, van D.; Ruijter, de A.J.M.; Jaiswal, A.K.; Aarts, J.M.M.J.G.
2002-01-01
NAD(P)H:quinone oxidoreductase 1 (NQO1) has often been suggested to be involved in cancer prevention by means of detoxification of electrophilic quinones. In the present study, a series of Chinese hamster ovary (CHO) cell lines expressing various elevated levels of human NQO1 were generated by
Obayashi, Kenji; Saeki, Keigo; Iwamoto, Junko; Ikada, Yoshito; Kurumatani, Norio
2014-07-01
Circadian misalignment between internal and environmental rhythms dysregulates blood pressure (BP) variability because of disruption of the biological clock, resulting in increased nighttime BP. Although exposure to light-at-night is associated with the circadian misalignment, it remains unclear whether exposure to light-at-night in home settings is associated with nighttime BP. In this cross-sectional analysis of 528 elderly individuals (mean age: 72.8 years), we measured bedroom light intensity at 1-min intervals on two consecutive nights along with ambulatory BP, overnight urinary melatonin excretion and actigraphy. With regard to adjusted mean comparisons using analysis of covariance, the light-at-night group (average: ≥5 lux; n = 109) showed significantly higher nighttime systolic BP (SBP; adjusted mean: 120.8 vs. 116.5 mmHg, p = 0.01) and diastolic BP (70.1 vs. 67.1 mmHg, p light-at-night and nighttime BP in different cutoff values for light-at-night intensity (i.e. 3 and 10 lux). In conclusion, exposure to light-at-night in home settings is significantly associated with increased nighttime BP in elderly individuals independently of overnight urinary melatonin excretion. A 4.3 mmHg increase in nighttime SBP is associated with a 6.1% increase in total mortality, which corresponds to approximately 10 000 annual excess deaths in Japanese elderly population.
Haan, de L.H.J.; Pot, G.K.; Aarts, J.M.M.J.G.; Rietjens, I.M.C.M.; Alink, G.M.
2006-01-01
NAD(P)H:quinone oxidoreductase (NQO1)-mediated detoxification of quinones is suggested to be involved in cancer prevention. In the present study, using transfected CHO cells, it was demonstrated that the relation between NQO1 activity and the resulting protection against the cytotoxicity of
Yamagata, A; Hirota, R; Kato, J; Kuroda, A; Ikeda, T; Takiguchi, N; Ohtake, H
2000-08-01
The ammonia-oxidizing bacterium Nitrosomonas sp. strain ENI-11 contains three copies of the hao gene (hao1, hao2, and hao3) coding for hydroxylamine oxidoreductase (HAO). Three single mutants (hao1::kan, hao2::kan, or hao3::kan) had 68 to 75% of the wild-type growth rate and 58 to 89% of the wild-type HAO activity when grown under the same conditions. A double mutant (hao1::kan and hao3::amp) also had 68% of the wild-type growth and 37% of the wild-type HAO activity.
Caranto, Jonathan D; Lancaster, Kyle M
2017-08-01
Ammonia (NH 3 )-oxidizing bacteria (AOB) emit substantial amounts of nitric oxide (NO) and nitrous oxide (N 2 O), both of which contribute to the harmful environmental side effects of large-scale agriculture. The currently accepted model for AOB metabolism involves NH 3 oxidation to nitrite (NO 2 - ) via a single obligate intermediate, hydroxylamine (NH 2 OH). Within this model, the multiheme enzyme hydroxylamine oxidoreductase (HAO) catalyzes the four-electron oxidation of NH 2 OH to NO 2 - We provide evidence that HAO oxidizes NH 2 OH by only three electrons to NO under both anaerobic and aerobic conditions. NO 2 - observed in HAO activity assays is a nonenzymatic product resulting from the oxidation of NO by O 2 under aerobic conditions. Our present study implies that aerobic NH 3 oxidation by AOB occurs via two obligate intermediates, NH 2 OH and NO, necessitating a mediator of the third enzymatic step.
Directory of Open Access Journals (Sweden)
Lynette H. Bikos
2014-06-01
Full Text Available The highlights of a study of the 4-H Record Book (RB in light of the four positive youth development (PYD concepts: belonging, mastery, independence, and generosity are discussed in this paper. Utilizing qualitative methods we interviewed 21 participants (14 leaders, 9 recent 4-H alumni from 9 states. Results describe the ways in which participants perceived that the RB (a supports the four PYD concepts (e.g., “RB fosters independence through the goal setting, monitoring, and appraising process” and (b does not support, or should be revised to support the concept (e.g., “RB competitions may hinder mastery”. Our results support the RB as a PYD intervention but we recommend that states/counties consider these results when revising RBs. In light of concerns about age and developmental appropriateness, we suggest that the most pressing question is whether or not the traditionally formatted RB is appropriate for all 4-Hers. We encourage RB committees to engage professionals with developmental expertise (e.g., educators in RB revisions.
Energy Technology Data Exchange (ETDEWEB)
Polusani, Srikanth R.; Kar, Rekha; Riquelme, Manuel A.; Masters, Bettie Sue [The University of Texas Health Science Center at San Antonio, Department of Biochemistry, San Antonio, TX 78229 (United States); Panda, Satya P., E-mail: panda@uthscsa.edu [The University of Texas Health Science Center at San Antonio, Department of Biochemistry, San Antonio, TX 78229 (United States)
2011-08-05
Highlights: {yields} Humans with severe forms of cytochrome P450 oxidoreductase (CYPOR) mutations show bone defects as observed in Antley-Bixler Syndrome. {yields} First report showing knockdown of CYPOR in osteoblasts decreased Connexin 43 (Cx43) protein levels. Cx43 is known to play an important role in bone modeling. {yields} Knockdown of CYPOR decreased Gap Junctional Intercellular Communication and hemichannel activity. {yields} Knockdown of CYPOR decreased Cx43 in mouse primary calvarial osteoblasts. {yields} Decreased Cx43 expression was observed at the transcriptional level. -- Abstract: Cytochrome P450 oxidoreductase (CYPOR) is a microsomal electron-transferring enzyme containing both FAD and FMN as co-factors, which provides the reducing equivalents to various redox partners, such as cytochromes P450 (CYPs), heme oxygenase (HO), cytochrome b{sub 5} and squalene monooxygenase. Human patients with severe forms of CYPOR mutation show bone defects such as cranio- and humeroradial synostoses and long bone fractures, known as Antley-Bixler-like Syndrome (ABS). To elucidate the role of CYPOR in bone, we knocked-down CYPOR in multiple osteoblast cell lines using RNAi technology. In this study, knock-down of CYPOR decreased the expression of Connexin 43 (Cx43), known to play a critical role in bone formation, modeling, and remodeling. Knock-down of CYPOR also decreased Gap Junction Intercellular Communication (GJIC) and hemichannel activity. Promoter luciferase assays revealed that the decrease in expression of Cx43 in CYPOR knock-down cells was due to transcriptional repression. Primary osteoblasts isolated from bone specific Por knock-down mice calvariae confirmed the findings in the cell lines. Taken together, our study provides novel insights into the regulation of gap junction function by CYPOR and suggests that Cx43 may play an important role(s) in CYPOR-mediated bone defects seen in patients.
International Nuclear Information System (INIS)
Polusani, Srikanth R.; Kar, Rekha; Riquelme, Manuel A.; Masters, Bettie Sue; Panda, Satya P.
2011-01-01
Highlights: → Humans with severe forms of cytochrome P450 oxidoreductase (CYPOR) mutations show bone defects as observed in Antley-Bixler Syndrome. → First report showing knockdown of CYPOR in osteoblasts decreased Connexin 43 (Cx43) protein levels. Cx43 is known to play an important role in bone modeling. → Knockdown of CYPOR decreased Gap Junctional Intercellular Communication and hemichannel activity. → Knockdown of CYPOR decreased Cx43 in mouse primary calvarial osteoblasts. → Decreased Cx43 expression was observed at the transcriptional level. -- Abstract: Cytochrome P450 oxidoreductase (CYPOR) is a microsomal electron-transferring enzyme containing both FAD and FMN as co-factors, which provides the reducing equivalents to various redox partners, such as cytochromes P450 (CYPs), heme oxygenase (HO), cytochrome b 5 and squalene monooxygenase. Human patients with severe forms of CYPOR mutation show bone defects such as cranio- and humeroradial synostoses and long bone fractures, known as Antley-Bixler-like Syndrome (ABS). To elucidate the role of CYPOR in bone, we knocked-down CYPOR in multiple osteoblast cell lines using RNAi technology. In this study, knock-down of CYPOR decreased the expression of Connexin 43 (Cx43), known to play a critical role in bone formation, modeling, and remodeling. Knock-down of CYPOR also decreased Gap Junction Intercellular Communication (GJIC) and hemichannel activity. Promoter luciferase assays revealed that the decrease in expression of Cx43 in CYPOR knock-down cells was due to transcriptional repression. Primary osteoblasts isolated from bone specific Por knock-down mice calvariae confirmed the findings in the cell lines. Taken together, our study provides novel insights into the regulation of gap junction function by CYPOR and suggests that Cx43 may play an important role(s) in CYPOR-mediated bone defects seen in patients.
Arts, Isabelle S.; Vertommen, Didier; Baldin, Francesca; Laloux, Géraldine; Collet, Jean-François
2016-01-01
Thioredoxin (Trx) is a ubiquitous oxidoreductase maintaining protein-bound cysteine residues in the reduced thiol state. Here, we combined a well-established method to trap Trx substrates with the power of bacterial genetics to comprehensively characterize the in vivo Trx redox interactome in the model bacterium Escherichia coli. Using strains engineered to optimize trapping, we report the identification of a total 268 Trx substrates, including 201 that had never been reported to depend on Trx for reduction. The newly identified Trx substrates are involved in a variety of cellular processes, ranging from energy metabolism to amino acid synthesis and transcription. The interaction between Trx and two of its newly identified substrates, a protein required for the import of most carbohydrates, PtsI, and the bacterial actin homolog MreB was studied in detail. We provide direct evidence that PtsI and MreB contain cysteine residues that are susceptible to oxidation and that participate in the formation of an intermolecular disulfide with Trx. By considerably expanding the number of Trx targets, our work highlights the role played by this major oxidoreductase in a variety of cellular processes. Moreover, as the dependence on Trx for reduction is often conserved across species, it also provides insightful information on the interactome of Trx in organisms other than E. coli. PMID:27081212
Goodman, Stephen I; Binard, Robert J; Woontner, Michael R; Frerman, Frank E
2002-01-01
Glutaric acidemia type II is a human inborn error of metabolism which can be due to defects in either subunit of electron transfer flavoprotein (ETF) or in ETF:ubiquinone oxidoreductase (ETF:QO), but few disease-causing mutations have been described. The ETF:QO gene is located on 4q33, and contains 13 exons. Primers to amplify these exons are presented, together with mutations identified by molecular analysis of 20 ETF:QO-deficient patients. Twenty-one different disease-causing mutations were identified on 36 of the 40 chromosomes.
Granzyme A Cleaves a Mitochondrial Complex I Protein to Initiate Caspase-Independent Cell Death
Martinvalet, Denis; Dykxhoorn, Derek M.; Ferrini, Roger; Lieberman, Judy
2010-01-01
SUMMARY The killer lymphocyte protease granzyme A (GzmA) triggers caspase-independent target cell death with morphological features of apoptosis. We previously showed that GzmA acts directly on mitochondria to generate reactive oxygen species (ROS) and disrupt the transmembrane potential (ΔΨm) but does not permeabilize the mitochondrial outer membrane. Mitochondrial damage is critical to GzmA-induced cell death since cells treated with superoxide scavengers are resistant to GzmA. Here we find that GzmA accesses the mitochondrial matrix to cleave the complex I protein NDUFS3, an iron-sulfur subunit of the NADH:ubiquinone oxidoreductase complex I, after Lys56 to interfere with NADH oxidation and generate superoxide anions. Target cells expressing a cleavage site mutant of NDUFS3 are resistant to GzmA-mediated cell death but remain sensitive to GzmB. PMID:18485875
Spector, E B; Seltzer, W K; Goodman, S I
1999-08-01
Electron transfer flavoprotein-ubiquinone oxidoreductase (ETF-QO) is a nuclear-encoded protein located in the inner mitochondrial membrane. Inherited defects of ETF-QO cause glutaric acidemia type II. We here describe the localization of the ETF-QO gene to human chromosome 4q33 by somatic cell hybridization and fluorescence in situ hybridization. Copyright 1999 Academic Press.
Associations between children’s independent mobility and physical activity
2014-01-01
Background Independent mobility describes the freedom of children to travel and play in public spaces without adult supervision. The potential benefits for children are significant such as social interactions with peers, spatial and traffic safety skills and increased physical activity. Yet, the health benefits of independent mobility, particularly on physical activity accumulation, are largely unexplored. This study aimed to investigate associations of children’s independent mobility with light, moderate-to-vigorous, and total physical activity accumulation. Methods In 2011 - 2012, 375 Australian children aged 8-13 years (62% girls) were recruited into a cross-sectional study. Children’s independent mobility (i.e. independent travel to school and non-school destinations, independent outdoor play) and socio-demographics were assessed through child and parent surveys. Physical activity intensity was measured objectively through an Actiheart monitor worn on four consecutive days. Associations between independent mobility and physical activity variables were analysed using generalized linear models, accounting for clustered sampling, Actiheart wear time, socio-demographics, and assessing interactions by sex. Results Independent travel (walking, cycling, public transport) to school and non-school destinations were not associated with light, moderate-to-vigorous and total physical activity. However, sub-analyses revealed a positive association between independent walking and cycling (excluding public transport) to school and total physical but only in boys (b = 36.03, p physical activity (b = 29.76, p physical activity. When assessing differences by sex, the observed significant associations of independent outdoor play with light and total physical activity remained in girls but not in boys. All other associations showed no significant differences by sex. Conclusions Independent outdoor play may boost children’s daily physical activity levels
International Nuclear Information System (INIS)
Maeda, Yoshifumi; Doubayashi, Daiju; Ootake, Takumi; Oki, Masaya; Mikami, Bunzo; Uchida, Hiroyuki
2010-01-01
Formate oxidase from A. oryzae RIB40 was crystallized and diffraction data were collected to a resolution of 2.4 Å. Formate oxidase (FOD), which catalyzes the oxidation of formate to yield carbon dioxide and hydrogen peroxide, belongs to the glucose–methanol–choline oxidoreductase (GMCO) family. FOD from Aspergillus oryzae RIB40, which has a modified FAD as a cofactor, was crystallized at 293 K by the hanging-drop vapour-diffusion method. The crystal was orthorhombic and belonged to space group C222 1 . Diffraction data were collected from a single crystal to 2.4 Å resolution
Reardon-Robinson, Melissa E; Osipiuk, Jerzy; Jooya, Neda; Chang, Chungyu; Joachimiak, Andrzej; Das, Asis; Ton-That, Hung
2015-12-01
The Gram-positive pathogen Corynebacterium diphtheriae exports through the Sec apparatus many extracellular proteins that include the key virulence factors diphtheria toxin and the adhesive pili. How these proteins attain their native conformations after translocation as unfolded precursors remains elusive. The fact that the majority of these exported proteins contain multiple cysteine residues and that several membrane-bound oxidoreductases are encoded in the corynebacterial genome suggests the existence of an oxidative protein-folding pathway in this organism. Here we show that the shaft pilin SpaA harbors a disulfide bond in vivo and alanine substitution of these cysteines abrogates SpaA polymerization and leads to the secretion of degraded SpaA peptides. We then identified a thiol-disulfide oxidoreductase (MdbA), whose structure exhibits a conserved thioredoxin-like domain with a CPHC active site. Remarkably, deletion of mdbA results in a severe temperature-sensitive cell division phenotype. This mutant also fails to assemble pilus structures and is greatly defective in toxin production. Consistent with these defects, the ΔmdbA mutant is attenuated in a guinea pig model of diphtheritic toxemia. Given its diverse cellular functions in cell division, pilus assembly and toxin production, we propose that MdbA is a component of the general oxidative folding machine in C. diphtheriae. © 2015 John Wiley & Sons Ltd.
Does firm performance affect board independence?
Directory of Open Access Journals (Sweden)
Yi Wang
2010-07-01
Full Text Available This paper seeks to shed some light on the antecedents of board independence. Specifically, it attempts to test the conceptual frameworks which make different predictions about the effect of firm performance on the level of board independence. The results provide support for the perspective that appointing more independent members to the boards may merely represent firms’ attempts to comply with institutional pressures. It is found that higher blockholder shareholdings lead to lower independence on the board, and audit and remuneration committees. Moreover, larger firms have relatively more independent directors sitting on nomination and remuneration committees.
Kast, Brigitte; Schori, Christian; Grimm, Christian
2016-05-01
Hypoxic preconditioning protects photoreceptors against light-induced degeneration preserving retinal morphology and function. Although hypoxia inducible transcription factors 1 and 2 (HIF1, HIF2) are the main regulators of the hypoxic response, photoreceptor protection does not depend on HIF1 in rods. Here we used rod-specific Hif2a single and Hif1a;Hif2a double knockout mice to investigate the potential involvement of HIF2 in rods for protection after hypoxic preconditioning. To identify potential HIF2 target genes in rods we determined the retinal transcriptome of hypoxic control and rod-specific Hif2a knockouts by RNA sequencing. We show that rods do not need HIF2 for hypoxia-induced increased survival after light exposure. The transcriptomic analysis revealed a number of genes that are potentially regulated by HIF2 in rods; among those were Htra1, Timp3 and Hmox1, candidates that are interesting due to their connection to human degenerative diseases of the retina. We conclude that neither HIF1 nor HIF2 are required in photoreceptors for protection by hypoxic preconditioning. We hypothesize that HIF transcription factors may be needed in other cells to produce protective factors acting in a paracrine fashion on photoreceptor cells. Alternatively, hypoxic preconditioning induces a rod-intrinsic response that is independent of HIF transcription factors. Copyright © 2015 Elsevier Ltd. All rights reserved.
Pohl, Thomas; Uhlmann, Mareike; Kaufenstein, Miriam; Friedrich, Thorsten
2007-09-18
The proton-pumping NADH:ubiquinone oxidoreductase, the respiratory complex I, couples the transfer of electrons from NADH to ubiquinone with the translocation of protons across the membrane. The Escherichia coli complex I consists of 13 different subunits named NuoA-N (from NADH:ubiquinone oxidoreductase), that are coded by the genes of the nuo-operon. Genetic manipulation of the operon is difficult due to its enormous size. The enzymatic activity of variants is obscured by an alternative NADH dehydrogenase, and purification of the variants is hampered by their instability. To overcome these problems the entire E. coli nuo-operon was cloned and placed under control of the l-arabinose inducible promoter ParaBAD. The exposed N-terminus of subunit NuoF was chosen for engineering the complex with a hexahistidine-tag by lambda-Red-mediated recombineering. Overproduction of the complex from this construct in a strain which is devoid of any membrane-bound NADH dehydrogenase led to the assembly of a catalytically active complex causing the entire NADH oxidase activity of the cytoplasmic membranes. After solubilization with dodecyl maltoside the engineered complex binds to a Ni2+-iminodiacetic acid matrix allowing the purification of approximately 11 mg of complex I from 25 g of cells. The preparation is pure and monodisperse and comprises all known subunits and cofactors. It contains more lipids than earlier preparations due to the gentle and fast purification procedure. After reconstitution in proteoliposomes it couples the electron transfer with proton translocation in an inhibitor sensitive manner, thus meeting all prerequisites for structural and functional studies.
DEFF Research Database (Denmark)
Bavishi, Krutika; Laursen, Tomas; Martinez, Karen Laurence
2016-01-01
Direct electrochemistry of cytochrome P450 containing systems has primarily focused on investigating enzymes from microbes and animals for bio-sensing applications. Plant P450s receive electrons from NADPH P450 oxidoreductase (POR) to orchestrate the bio-synthesis of a plethora of commercially...... was electro-catalytically active while the P450s generated hydrogen peroxide (H2O2). These nanodisc-based investigations lay the prospects and guidelines for construction of a simplified platform to perform mediator-free, direct electrochemistry of non-engineered cytochromes P450 under native-like conditions...
Kofoed, Melissa A; Wampler, David A; Pandey, Arti S; Peters, John W; Ensign, Scott A
2011-09-01
NADPH:2-ketopropyl-coenzyme M oxidoreductase/carboxylase (2-KPCC), an atypical member of the disulfide oxidoreductase (DSOR) family of enzymes, catalyzes the reductive cleavage and carboxylation of 2-ketopropyl-coenzyme M [2-(2-ketopropylthio)ethanesulfonate; 2-KPC] to form acetoacetate and coenzyme M (CoM) in the bacterial pathway of propylene metabolism. Structural studies of 2-KPCC from Xanthobacter autotrophicus strain Py2 have revealed a distinctive active-site architecture that includes a putative catalytic triad consisting of two histidine residues that are hydrogen bonded to an ordered water molecule proposed to stabilize enolacetone formed from dithiol-mediated 2-KPC thioether bond cleavage. Site-directed mutants of 2-KPCC were constructed to test the tenets of the mechanism proposed from studies of the native enzyme. Mutagenesis of the interchange thiol of 2-KPCC (C82A) abolished all redox-dependent reactions of 2-KPCC (2-KPC carboxylation or protonation). The air-oxidized C82A mutant, as well as wild-type 2-KPCC, exhibited the characteristic charge transfer absorbance seen in site-directed variants of other DSOR enzymes but with a pK(a) value for C87 (8.8) four units higher (i.e., four orders of magnitude less acidic) than that for the flavin thiol of canonical DSOR enzymes. The same higher pK(a) value was observed in native 2-KPCC when the interchange thiol was alkylated by the CoM analog 2-bromoethanesulfonate. Mutagenesis of the flavin thiol (C87A) also resulted in an inactive enzyme for steady-state redox-dependent reactions, but this variant catalyzed a single-turnover reaction producing a 0.8:1 ratio of product to enzyme. Mutagenesis of the histidine proximal to the ordered water (H137A) led to nearly complete loss of redox-dependent 2-KPCC reactions, while mutagenesis of the distal histidine (H84A) reduced these activities by 58 to 76%. A redox-independent reaction of 2-KPCC (acetoacetate decarboxylation) was not decreased for any of the
Bill, E.; Gismelseed, A.; Laroque, D.; Trautwein, A. X.; Nasri, H.; Fischer, J.; Weiss, R.
1988-02-01
The divalent high-spin iron in the P460 center of hydroxylamine oxidoreductase and in three possible “picket fence” heme models exhibit extremely large quadrupole splittings (˜4 mms-1). Their isomer shifts of about 1 mms-1 are consistent with the X-ray results of two of the models, i.e. that Fe(II) is pentacoordinated. The coordination geometry of iron deviates considerably from the common fourfold symmetry of the “picket fence” porphyrin due to a CH3CO{2/-} ligand. This feature is also reflected by the significant anisotropies of g-factors, A tensor and rhombicity E/D.
Hachiya, Takushi; Ueda, Nanae; Kitagawa, Munenori; Hanke, Guy; Suzuki, Akira; Hase, Toshiharu; Sakakibara, Hitoshi
2016-11-01
Ferredoxin:NADP(H) oxidoreductase (FNR) plays a key role in redox metabolism in plastids. Whereas leaf FNR (LFNR) is required for photosynthesis, root FNR (RFNR) is believed to provide electrons to ferredoxin (Fd)-dependent enzymes, including nitrite reductase (NiR) and Fd-glutamine-oxoglutarate aminotransferase (Fd-GOGAT) in non-photosynthetic conditions. In some herbal species, however, most nitrate reductase activity is located in photosynthetic organs, and ammonium in roots is assimilated mainly by Fd-independent NADH-GOGAT. Therefore, RFNR might have a limited impact on N assimilation in roots grown with nitrate or ammonium nitrogen sources. AtRFNR genes are rapidly induced by application of toxic nitrite. Thus, we tested the hypothesis that RFNR could contribute to nitrite reduction in roots by comparing Arabidopsis thaliana seedlings of the wild type with loss-of-function mutants of RFNR2 When these seedlings were grown under nitrate, nitrite or ammonium, only nitrite nutrition caused impaired growth and nitrite accumulation in roots of rfnr2 Supplementation of nitrite with nitrate or ammonium as N sources did not restore the root growth in rfnr2 Also, a scavenger for nitric oxide (NO) could not effectively rescue the growth impairment. Thus, nitrite toxicity, rather than N depletion or nitrite-dependent NO production, probably causes the rfnr2 root growth defect. Our results strongly suggest that RFNR2 has a major role in reduction of toxic nitrite in roots. A specific set of genes related to nitrite reduction and the supply of reducing power responded to nitrite concomitantly, suggesting that the products of these genes act co-operatively with RFNR2 to reduce nitrite in roots. © The Author 2016. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.
Caccialanza, Riccardo; Palladini, Giovanni; Klersy, Catherine; Cereda, Emanuele; Bonardi, Chiara; Cameletti, Barbara; Montagna, Elisabetta; Russo, Paola; Foli, Andrea; Milani, Paolo; Lavatelli, Francesca; Merlini, Giampaolo
2012-03-01
Nutritional status is an independent prognostic factor in immunoglobulin light-chain amyloidosis (AL), but its influence on quality of life (QoL) is unknown. The aim of this cross-sectional study was to investigate the association between nutritional status and QoL in AL patients at diagnosis. One hundred and fifty consecutive patients with biopsy-proven AL were assessed for nutritional status by anthropometry [body mass index, unintentional weight loss (WL) in the previous 6 months and mid-arm muscle circumference (MAMC)], biochemistry (serum prealbumin), and semiquantitative food intake at referral. QoL was assessed by the Medical Outcomes Study 36-item Short Form General Health Survey. The composite physical component summary (PCS) and the mental component summary (MCS) for AL outpatients were 36.2 ± 10.1 and 44.9 ± 11.3, respectively (p performance status, the number of organs involved, the severity of cardiac damage, C-reactive protein, energy intake, and WL, PCS was significantly lower for serum prealbumin Nutritional status independently affects QoL in AL patients since diagnosis. Nutritional evaluation should be integral part of the clinical assessment of AL patients. Nutritional support intervention trials are warranted in such patients' population.
Chemically induced and light-independent cryptochrome photoreceptor activation.
Rosenfeldt, Gesa; Viana, Rafael Muñoz; Mootz, Henning D; von Arnim, Albrecht G; Batschauer, Alfred
2008-01-01
The cryptochrome photoreceptors of higher plants are dimeric proteins. Their N-terminal photosensory domain mediates dimerization, and the unique C-terminal extension (CCT) mediates signaling. We made use of the human FK506-binding protein (FKBP) that binds with high affinity to rapamycin or rapamycin analogs (rapalogs). The FKBP-rapamycin complex is recognized by another protein, FRB, thus allowing rapamycin-induced dimerization of two target proteins. Here we demonstrate by bioluminescence resonance energy transfer (BRET) assays the applicability of this regulated dimerization system to plants. Furthermore, we show that fusion proteins consisting of the C-terminal domain of Arabidopsis cryptochrome 2 fused to FKBP and FRB and coexpressed in Arabidopsis cells specifically induce the expression of cryptochrome-controlled reporter and endogenous genes in darkness upon incubation with the rapalog. These results demonstrate that the activation of cryptochrome signal transduction can be chemically induced in a dose-dependent fashion and uncoupled from the light signal, and provide the groundwork for gain-of-function experiments to study specifically the role of photoreceptors in darkness or in signaling cross-talk even under light conditions that activate members of all photoreceptor families.
Bystrykh, Leonid V.; Vonck, Janet; Bruggen, Ernst F.J. van; Beeumen, Jozef van; Samyn, Bart; Govorukhina, Natalya I.; Arfman, Nico; Duine, Johannis A.; Dijkhuizen, Lubbert
The quaternary protein structure of two methanol:N,N'-dimethyl-4-nitrosoaniline (NDMA) oxidoreductases purified from Amycolatopsis methanolica and Mycobacterium gastri MB19 was analyzed by electron microscopy and image processing. The enzymes are decameric proteins (displaying fivefold symmetry)
International Nuclear Information System (INIS)
Beckmann, J.D.; Frerman, F.E.
1985-01-01
The oxidative half-reaction of electron-transfer flavoprotein (ETF), electron transfer from ETF to electron-transfer flavoprotein-ubiquinone oxidoreductase (ETF-QO), is dependent on complementary surface charges on the two proteins. ETF is the positively charged member of the redox pair. The evidence is based on the pH and ionic strength dependencies of the comproportionation of oxidized ETF and ETF hydroquinone catalyzed by ETF-QO and on the effects of chemical modification of ETF on the comproportionation reaction. Acetylation of one and five epsilon-amino groups of lysyl residues results in 3- and 13-fold increases, respectively, in the K/sub m/ of ETF-QO for ETF but no change in V/sub max/. Amidination, which maintains positive charge at modified loci, has no effect on steady-state kinetic constants. These chemical modifications have no effect on the equilibrium constant for equilibration of ETF redox states. The K/sub m/ of ETF-QO for ETF is pH dependent above pH 8.5, suggesting titration of lysyl residues. The ionic strength dependence of TN/KmETF for the reaction follows the limiting Bronsted equation. The ETF-QO-catalyzed comproportionation reaction exhibits a primary deuterium isotope effect in D 2 O, perhaps indicating the participation of solvent water in the electron-transfer reaction
NADPH–Cytochrome P450 Oxidoreductase: Roles in Physiology, Pharmacology, and Toxicology
Ding, Xinxin; Wolf, C. Roland; Porter, Todd D.; Pandey, Amit V.; Zhang, Qing-Yu; Gu, Jun; Finn, Robert D.; Ronseaux, Sebastien; McLaughlin, Lesley A.; Henderson, Colin J.; Zou, Ling; Flück, Christa E.
2013-01-01
This is a report on a symposium sponsored by the American Society for Pharmacology and Experimental Therapeutics and held at the Experimental Biology 2012 meeting in San Diego, California, on April 25, 2012. The symposium speakers summarized and critically evaluated our current understanding of the physiologic, pharmacological, and toxicological roles of NADPH–cytochrome P450 oxidoreductase (POR), a flavoprotein involved in electron transfer to microsomal cytochromes P450 (P450), cytochrome b5, squalene mono-oxygenase, and heme oxygenase. Considerable insight has been derived from the development and characterization of mouse models with conditional Por deletion in particular tissues or partial suppression of POR expression in all tissues. Additional mouse models with global or conditional hepatic deletion of cytochrome b5 are helping to clarify the P450 isoform- and substrate-specific influences of cytochrome b5 on P450 electron transfer and catalytic function. This symposium also considered studies using siRNA to suppress POR expression in a hepatoma cell–culture model to explore the basis of the hepatic lipidosis phenotype observed in mice with conditional deletion of Por in liver. The symposium concluded with a strong translational perspective, relating the basic science of human POR structure and function to the impacts of POR genetic variation on human drug and steroid metabolism. PMID:23086197
Influence of 120 kDa Pyruvate:Ferredoxin Oxidoreductase on Pathogenicity of Trichomonas vaginalis.
Song, Hyun-Ouk
2016-02-01
Trichomonas vaginalis is a flagellate protozoan parasite and commonly infected the lower genital tract in women and men. Iron is a known nutrient for growth of various pathogens, and also reported to be involved in establishment of trichomoniasis. However, the exact mechanism was not clarified. In this study, the author investigated whether the 120 kDa protein of T. vaginalis may be involved in pathogenicity of trichomonads. Antibodies against 120 kDa protein of T. vaginalis, which was identified as pyruvate:ferredoxin oxidoreductase (PFOR) by peptide analysis of MALDI-TOF-MS, were prepared in rabbits. Pretreatment of T. vaginalis with anti-120 kDa Ab decreased the proliferation and adherence to vaginal epithelial cells (MS74) of T. vaginalis. Subcutaneous tissue abscess in anti-120 kDa Ab-treated T. vaginalis-injected mice was smaller in size than that of untreated T. vaginalis-infected mice. Collectively, the 120 kDa protein expressed by iron may be involved in proliferation, adhesion to host cells, and abscess formation, thereby may influence on the pathogenicity of T. vaginalis.
Schultz, W.; Valcke, P.; Irion, K.
2014-01-01
Media independence is vital for democracies, and so is the independence of the regulatory bodies governing it. The Independence of the Media and its Regulatory Agencies explores the complex relationship between media governance and independence of media regulatory authorities within Europe, which
Wang, X; Miller, E N; Yomano, L P; Zhang, X; Shanmugam, K T; Ingram, L O
2011-08-01
Furfural is an important fermentation inhibitor in hemicellulose sugar syrups derived from woody biomass. The metabolism of furfural by NADPH-dependent oxidoreductases, such as YqhD (low K(m) for NADPH), is proposed to inhibit the growth and fermentation of xylose in Escherichia coli by competing with biosynthesis for NADPH. The discovery that the NADH-dependent propanediol oxidoreductase (FucO) can reduce furfural provided a new approach to improve furfural tolerance. Strains that produced ethanol or lactate efficiently as primary products from xylose were developed. These strains included chromosomal mutations in yqhD expression that permitted the fermentation of xylose broths containing up to 10 mM furfural. Expression of fucO from plasmids was shown to increase furfural tolerance by 50% and to permit the fermentation of 15 mM furfural. Product yields with 15 mM furfural were equivalent to those of control strains without added furfural (85% to 90% of the theoretical maximum). These two defined genetic traits can be readily transferred to enteric biocatalysts designed to produce other products. A similar strategy that minimizes the depletion of NADPH pools by native detoxification enzymes may be generally useful for other inhibitory compounds in lignocellulosic sugar streams and with other organisms.
Wang, X.; Miller, E. N.; Yomano, L. P.; Zhang, X.; Shanmugam, K. T.; Ingram, L. O.
2011-01-01
Furfural is an important fermentation inhibitor in hemicellulose sugar syrups derived from woody biomass. The metabolism of furfural by NADPH-dependent oxidoreductases, such as YqhD (low Km for NADPH), is proposed to inhibit the growth and fermentation of xylose in Escherichia coli by competing with biosynthesis for NADPH. The discovery that the NADH-dependent propanediol oxidoreductase (FucO) can reduce furfural provided a new approach to improve furfural tolerance. Strains that produced ethanol or lactate efficiently as primary products from xylose were developed. These strains included chromosomal mutations in yqhD expression that permitted the fermentation of xylose broths containing up to 10 mM furfural. Expression of fucO from plasmids was shown to increase furfural tolerance by 50% and to permit the fermentation of 15 mM furfural. Product yields with 15 mM furfural were equivalent to those of control strains without added furfural (85% to 90% of the theoretical maximum). These two defined genetic traits can be readily transferred to enteric biocatalysts designed to produce other products. A similar strategy that minimizes the depletion of NADPH pools by native detoxification enzymes may be generally useful for other inhibitory compounds in lignocellulosic sugar streams and with other organisms. PMID:21685167
Tao, Yimin; Lyu, Ming-Ju Amy; Zhu, Xin-Guang
2016-05-01
C4 photosynthesis evolved independently from C3 photosynthesis in more than 60 lineages. Most of the C4 lineages are clustered together in the order Poales and the order Caryophyllales while many other angiosperm orders do not have C4 species, suggesting the existence of biological pre-conditions in the ancestral C3 species that facilitate the evolution of C4 photosynthesis in these lineages. To explore pre-adaptations for C4 photosynthesis evolution, we classified C4 lineages into the C4-poor and the C4-rich groups based on the percentage of C4 species in different genera and conducted a comprehensive comparison on the transcriptomic changes between the non-C4 species from the C4-poor and the C4-rich groups. Results show that species in the C4-rich group showed higher expression of genes related to oxidoreductase activity, light reaction components, terpene synthesis, secondary cell synthesis, C4 cycle related genes and genes related to nucleotide metabolism and senescence. In contrast, C4-poor group showed up-regulation of a PEP/Pi translocator, genes related to signaling pathway, stress response, defense response and plant hormone metabolism (ethylene and brassinosteroid). The implications of these transcriptomic differences between the C4-rich and C4-poor groups to C4 evolution are discussed.
Boušová, Iva; Bártíková, Hana; Matoušková, Petra; Lněničková, Kateřina; Zappe, Lukáš; Valentová, Kateřina; Szotáková, Barbora; Martin, Jan; Skálová, Lenka
2015-10-01
Consumption of antioxidant-enriched diets is 1 method of addressing obesity, which is associated with chronic oxidative stress and changes in the activity/expression of various enzymes. In this study, we hypothesized that the modulation of antioxidant enzymes and redox status through a cranberry extract (CBE)-enriched diet would differ between obese and nonobese mice. The CBE used in this study was obtained from the American cranberry (Vaccinium macrocarpon, Ericaceae), a popular constituent of dietary supplements that is a particularly rich source of (poly)phenols and has strong antioxidant properties. The present study was designed to test and compare the in vivo effects of 28-day consumption of a CBE-enriched diet (2%) on the antioxidant status of nonobese mice and mice with monosodium glutamate-induced obesity. Plasma, erythrocytes, liver, and small intestine were studied concurrently to obtain more complex information. The specific activities, protein, and messenger RNA expression levels of antioxidant enzymes as well as the levels of malondialdehyde and thiol (SH) groups were analyzed. Cranberry extract treatment increased the SH group content in plasma and the glutathione S-transferase activity in the erythrocytes of the obese and nonobese mice. In addition, in the obese animals, the CBE treatment reduced the malondialdehyde content in erythrocytes and increased quinone oxidoreductase (liver) and catalase (erythrocytes and small intestine) activities. The elevation of hepatic quinone oxidoreductase activity was accompanied by an increase in the corresponding messenger RNA levels. The effects of CBE on the activity of antioxidant enzymes and redox status were more pronounced in the obese mice compared with the nonobese mice. Copyright © 2015 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Chigang Chen
Full Text Available Xanthine oxidoreductase (XOR is a cytoplasmic molybdenum-containing oxidoreductase, catalyzing both endogenous purines and exogenous compounds. It is suggested that XOR in porcine hepatocytes catalyzes the N-oxide reduction of quinoxaline 1,4-di-N-oxides (QdNOs. To elucidate the molecular mechanism underlying this metabolism, the cDNA of porcine XOR was cloned and heterologously expressed in Spodoptera frugiperda insect cells. The bovine XOR, showing sequence identity of 91% to porcine XOR, was employed as template for homology modeling. By docking cyadox, a representative compound of QdNOs, into porcine XOR model, eight amino acid residues, Gly47, Asn352, Ser360, Arg427, Asp430, Asp431, Ser1227 and Lys1230, were located at distances of less than 4Å to cyadox. Site-directed mutagenesis was performed to analyze their catalytic functions. Compared with wild type porcine XOR, G47A, S360P, D431A, S1227A, and K1230A displayed altered kinetic parameters in cyadox reduction, similarly to that in xanthine oxidation, indicating these mutations influenced electron-donating process of xanthine before subsequent electron transfer to cyadox to fulfill the N-oxide reduction. Differently, R427E and D430H, both located in the 424-434 loop, exhibited a much lower K(m and a decreased V(max respectively in cyadox reduction. Arg427 may be related to the substrate binding of porcine XOR to cyadox, and Asp430 is suggested to be involved in the transfer of electron to cyadox. This study initially reveals the possible catalytic mechanism of porcine XOR in cyadox metabolism, providing with novel insights into the structure-function relationship of XOR in the reduction of exogenous di-N-oxides.
Unpolarized state of light revisited
International Nuclear Information System (INIS)
Prakash, H.; Chandra, N.
1981-04-01
The general form of probability distribution function of analytic signal for unpolarized light is found using simple classical arguments. It is shown that the concepts of unpolarized light given in some common standard books are, strictly speaking, not correct. It is proved that if any two orthogonally polarized components of unpolarized light are statistically independent of each other, the light is of chaotic nature. (author)
Directory of Open Access Journals (Sweden)
Takeshi Nishino
2012-11-01
Full Text Available Xanthine oxidoreductase (XOR catalyzes the conversion of hypoxanthine to xanthine and xanthine to uric acid with concomitant reduction of either NAD+ or O2. The enzyme is a target of drugs to treat hyperuricemia, gout and reactive oxygen-related diseases. Human diseases associated with genetically determined dysfunction of XOR are termed xanthinuria, because of the excretion of xanthine in urine. Xanthinuria is classified into two subtypes, type I and type II. Type I xanthinuria involves XOR deficiency due to genetic defect of XOR, whereas type II xanthinuria involves dual deficiency of XOR and aldehyde oxidase (AO, a molybdoflavo enzyme similar to XOR due to genetic defect in the molybdenum cofactor sulfurase. Molybdenum cofactor deficiency is associated with triple deficiency of XOR, AO and sulfite oxidase, due to defective synthesis of molybdopterin, which is a precursor of molybdenum cofactor for all three enzymes. The present review focuses on mutation or chemical modification studies of mammalian XOR, as well as on XOR mutations identified in humans, aimed at understanding the reaction mechanism of XOR and the relevance of mutated XORs as models to estimate the possible side effects of clinical application of XOR inhibitors.
Structural basis for human NADPH-cytochrome P450 oxidoreductase deficiency
Energy Technology Data Exchange (ETDEWEB)
Xia, Chuanwu; Panda, Satya P.; Marohnic, Christopher C.; Martásek, Pavel; Masters, Bettie Sue; Kim, Jung-Ja P. (MCW); (Charles U); (UTSMC)
2012-03-15
NADPH-cytochrome P450 oxidoreductase (CYPOR) is essential for electron donation to microsomal cytochrome P450-mediated monooxygenation in such diverse physiological processes as drug metabolism (approximately 85-90% of therapeutic drugs), steroid biosynthesis, and bioactive metabolite production (vitamin D and retinoic acid metabolites). Expressed by a single gene, CYPOR's role with these multiple redox partners renders it a model for understanding protein-protein interactions at the structural level. Polymorphisms in human CYPOR have been shown to lead to defects in bone development and steroidogenesis, resulting in sexual dimorphisms, the severity of which differs significantly depending on the degree of CYPOR impairment. The atomic structure of human CYPOR is presented, with structures of two naturally occurring missense mutations, V492E and R457H. The overall structures of these CYPOR variants are similar to wild type. However, in both variants, local disruption of H bonding and salt bridging, involving the FAD pyrophosphate moiety, leads to weaker FAD binding, unstable protein, and loss of catalytic activity, which can be rescued by cofactor addition. The modes of polypeptide unfolding in these two variants differ significantly, as revealed by limited trypsin digestion: V492E is less stable but unfolds locally and gradually, whereas R457H is more stable but unfolds globally. FAD addition to either variant prevents trypsin digestion, supporting the role of the cofactor in conferring stability to CYPOR structure. Thus, CYPOR dysfunction in patients harboring these particular mutations may possibly be prevented by riboflavin therapy in utero, if predicted prenatally, or rescued postnatally in less severe cases.
Elguindy, Mahmoud M.; Nakamaru-Ogiso, Eiko
2015-01-01
Apoptosis-inducing factor (AIF) and AMID (AIF-homologous mitochondrion-associated inducer of death) are flavoproteins. Although AIF was originally discovered as a caspase-independent cell death effector, bioenergetic roles of AIF, particularly relating to complex I functions, have since emerged. However, the role of AIF in mitochondrial respiration and redox metabolism has remained unknown. Here, we investigated the redox properties of human AIF and AMID by comparing them with yeast Ndi1, a type 2 NADH:ubiquinone oxidoreductase (NDH-2) regarded as alternative complex I. Isolated AIF and AMID containing naturally incorporated FAD displayed no NADH oxidase activities. However, after reconstituting isolated AIF or AMID into bacterial or mitochondrial membranes, N-terminally tagged AIF and AMID displayed substantial NADH:O2 activities and supported NADH-linked proton pumping activities in the host membranes almost as efficiently as Ndi1. NADH:ubiquinone-1 activities in the reconstituted membranes were highly sensitive to 2-n-heptyl-4-hydroxyquinoline-N-oxide (IC50 = ∼1 μm), a quinone-binding inhibitor. Overexpressing N-terminally tagged AIF and AMID enhanced the growth of a double knock-out Escherichia coli strain lacking complex I and NDH-2. In contrast, C-terminally tagged AIF and NADH-binding site mutants of N-terminally tagged AIF and AMID failed to show both NADH:O2 activity and the growth-enhancing effect. The disease mutant AIFΔR201 showed decreased NADH:O2 activity and growth-enhancing effect. Furthermore, we surprisingly found that the redox activities of N-terminally tagged AIF and AMID were sensitive to rotenone, a well known complex I inhibitor. We propose that AIF and AMID are previously unidentified mammalian NDH-2 enzymes, whose bioenergetic function could be supplemental NADH oxidation in cells. PMID:26063804
Elguindy, Mahmoud M; Nakamaru-Ogiso, Eiko
2015-08-21
Apoptosis-inducing factor (AIF) and AMID (AIF-homologous mitochondrion-associated inducer of death) are flavoproteins. Although AIF was originally discovered as a caspase-independent cell death effector, bioenergetic roles of AIF, particularly relating to complex I functions, have since emerged. However, the role of AIF in mitochondrial respiration and redox metabolism has remained unknown. Here, we investigated the redox properties of human AIF and AMID by comparing them with yeast Ndi1, a type 2 NADH:ubiquinone oxidoreductase (NDH-2) regarded as alternative complex I. Isolated AIF and AMID containing naturally incorporated FAD displayed no NADH oxidase activities. However, after reconstituting isolated AIF or AMID into bacterial or mitochondrial membranes, N-terminally tagged AIF and AMID displayed substantial NADH:O₂ activities and supported NADH-linked proton pumping activities in the host membranes almost as efficiently as Ndi1. NADH:ubiquinone-1 activities in the reconstituted membranes were highly sensitive to 2-n-heptyl-4-hydroxyquinoline-N-oxide (IC₅₀ = ∼1 μm), a quinone-binding inhibitor. Overexpressing N-terminally tagged AIF and AMID enhanced the growth of a double knock-out Escherichia coli strain lacking complex I and NDH-2. In contrast, C-terminally tagged AIF and NADH-binding site mutants of N-terminally tagged AIF and AMID failed to show both NADH:O₂ activity and the growth-enhancing effect. The disease mutant AIFΔR201 showed decreased NADH:O₂ activity and growth-enhancing effect. Furthermore, we surprisingly found that the redox activities of N-terminally tagged AIF and AMID were sensitive to rotenone, a well known complex I inhibitor. We propose that AIF and AMID are previously unidentified mammalian NDH-2 enzymes, whose bioenergetic function could be supplemental NADH oxidation in cells. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.
International Nuclear Information System (INIS)
Phalen, Daniel J.; Thomas, Brooks; Wells, James D.
2007-01-01
For a standard model Higgs boson with mass between 115 GeV and 150 GeV, the two-photon decay mode is important for discovery at the Large Hadron Collider (LHC). We describe the interactions of a light Higgs boson in a more model-independent fashion and consider the parameter space where there is no two-photon decay mode. We argue from generalities that analysis of the tth discovery mode outside its normal thought of range of applicability is especially needed under these circumstances. We demonstrate the general conclusion with a specific example of parameters of a type I two-Higgs doublet theory, motivated by ideas in strongly coupled model building. We then specify a complete set of branching fractions and discuss the implications for the LHC
Directory of Open Access Journals (Sweden)
Roberto Yunes
2015-01-01
Full Text Available There is a growing amount of evidence for a neuroprotective role of progesterone and its neuroactive metabolite, allopregnanolone, in animal models of neurodegenerative diseases. By using a model of hemiparkinsonism in male rats, injection of the neurotoxic 6-OHDA in left striatum, we studied progesterone’s effects on rotational behavior induced by amphetamine or apomorphine. Also, in order to find potential explanatory mechanisms, we studied expression and activity of nigrostriatal 3α-hydroxysteroid oxidoreductase, the enzyme that catalyzes progesterone to its active metabolite allopregnanolone. Coherently, we tested allopregnanolone for a possible neuromodulatory effect on rotational behavior. Also, since allopregnanolone is known as a GABAA modulator, we finally examined the action of GABAA antagonist bicuculline. We found that progesterone, in addition to an apparent neuroprotective effect, also increased ipsilateral expression and activity of 3α-hydroxysteroid oxidoreductase. It was interesting to note that ipsilateral administration of allopregnanolone reversed a clear sign of motor neurodegeneration, that is, contralateral rotational behavior. A possible GABAA involvement modulated by allopregnanolone was shown by the blocking effect of bicuculline. Our results suggest that early administration of progesterone possibly activates genomic mechanisms that promote neuroprotection subchronically. This, in turn, could be partially mediated by fast, nongenomic, actions of allopregnanolone acting as an acute modulator of GABAergic transmission.
Characterization of the Arabidopsis thaliana 2-Cys peroxiredoxin interactome.
Cerveau, Delphine; Kraut, Alexandra; Stotz, Henrik U; Mueller, Martin J; Couté, Yohann; Rey, Pascal
2016-11-01
Peroxiredoxins are ubiquitous thiol-dependent peroxidases for which chaperone and signaling roles have been reported in various types of organisms in recent years. In plants, the peroxidase function of the two typical plastidial 2-Cys peroxiredoxins (2-Cys PRX A and B) has been highlighted while the other functions, particularly in ROS-dependent signaling pathways, are still elusive notably due to the lack of knowledge of interacting partners. Using an ex vivo approach based on co-immunoprecipitation of leaf extracts from Arabidopsis thaliana wild-type and mutant plants lacking 2-Cys PRX expression followed by mass spectrometry-based proteomics, 158 proteins were found associated with 2-Cys PRXs. Already known partners like thioredoxin-related electron donors (Chloroplastic Drought-induced Stress Protein of 32kDa, Atypical Cysteine Histidine-rich Thioredoxin 2) and enzymes involved in chlorophyll synthesis (Protochlorophyllide OxidoReductase B) or carbon metabolism (Fructose-1,6-BisPhosphatase) were identified, validating the relevance of the approach. Bioinformatic and bibliographic analyses allowed the functional classification of the identified proteins and revealed that more than 40% are localized in plastids. The possible roles of plant 2-Cys PRXs in redox signaling pathways are discussed in relation with the functions of the potential partners notably those involved in redox homeostasis, carbon and amino acid metabolisms as well as chlorophyll biosynthesis. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.
DEFF Research Database (Denmark)
Jørgensen, Peter Løchte
This paper introduces, prices, and analyzes traffic light options. The traffic light option is an innovative structured OTC derivative developed independently by several London-based investment banks to suit the needs of Danish life and pension (L&P) companies, which must comply with the traffic...... 2006, and supervisory authorities in many other European countries have implemented similar regulation. Traffic light options are therefore likely to attract the attention of a wider audience of pension fund managers in the future. Focusing on the valuation of the traffic light option we set up a Black...... light scenarios. These stress scenarios entail drops in interest rates as well as in stock prices, and traffic light options are thus designed to pay off and preserve sufficient capital when interest rates and stock prices fall simultaneously. Sweden's FSA implemented a traffic light system in January...
DEFF Research Database (Denmark)
Jørgensen, Peter Løchte
2007-01-01
This paper introduces, prices, and analyzes traffic light options. The traffic light option is an innovative structured OTC derivative developed independently by several London-based investment banks to suit the needs of Danish life and pension (L&P) companies, which must comply with the traffic...... 2006, and supervisory authorities in many other European countries have implemented similar regulation. Traffic light options are therefore likely to attract the attention of a wider audience of pension fund managers in the future. Focusing on the valuation of the traffic light option we set up a Black...... light scenarios. These stress scenarios entail drops in interest rates as well as in stock prices, and traffic light options are thus designed to pay off and preserve sufficient capital when interest rates and stock prices fall simultaneously. Sweden's FSA implemented a traffic light system in January...
Energy Technology Data Exchange (ETDEWEB)
Lockhart, Ainsley; Zvenigorodsky, Natasha; Pedraza, Mary Ann; Lindquist, Erika
2011-08-11
The biosynthesis of chlorophyll and other tetrapyrroles is a vital but poorly understood process. Recent genomic advances with the unicellular green algae Chlamydomonas reinhardtii have created opportunity to more closely examine the mechanisms of the chlorophyll biosynthesis pathway via transcriptome analysis. Manganese is a nutrient of interest for complex reactions because of its multiple stable oxidation states and role in molecular oxygen coordination. C. reinhardtii was cultured in Manganese-deplete Tris-acetate-phosphate (TAP) media for 24 hours and used to create cDNA libraries for sequencing using Illumina TruSeq technology. Transcriptome analysis provided intriguing insight on possible regulatory mechanisms in the pathway. Evidence supports similarities of GTR (Glutamyl-tRNA synthase) to its Chlorella vulgaris homolog in terms of Mn requirements. Data was also suggestive of Mn-related compensatory up-regulation for pathway proteins CHLH1 (Manganese Chelatase), GUN4 (Magnesium chelatase activating protein), and POR1 (Light-dependent protochlorophyllide reductase). Intriguingly, data suggests possible reciprocal expression of oxygen dependent CPX1 (coproporphyrinogen III oxidase) and oxygen independent CPX2. Further analysis using RT-PCR could provide compelling evidence for several novel regulatory mechanisms in the chlorophyll biosynthesis pathway.
Directory of Open Access Journals (Sweden)
Dzyadevych S. V.
2009-06-01
Full Text Available Aim. Development of amperometric biosensor based on L-lactate-cytochrome c-oxidoreductase (flavocytochrome b2, FC b2 for lactate determination. Methods. All experiments were performed using the amperometric method of detection. The methods of electrochemical polymerization and immobilization in glutaraldehyde vapors were used for FC b2 immobilization on the surface of electrodes. Results. The FC b2 preparation, which demonstrated the best operational characteristics after immobilization in poly (3,4-ethylen dioxythiophene, was selected. The selectivity, operational and storage stability, and pH-optimum for operation of the created biosensor were determined. The analysis of L-lactate in the model solutions and wine samples was carried outusing the developed biosensor. Conclusion. The FC b2-based biosensor due to its high stability can be effectively used for lactate determination in blood and other liquids containing no ethanol. After the selectivity optimization, the devise can be also applied for wine analysis.
Reduction of nitric oxide catalyzed by hydroxylamine oxidoreductase from an anammox bacterium.
Irisa, Tatsuya; Hira, Daisuke; Furukawa, Kenji; Fujii, Takao
2014-12-01
The hydroxylamine oxidoreductase (HAO) from the anammox bacterium, Candidatus Kuenenia stuttgartiensis has been reported to catalyze the oxidation of hydroxylamine (NH2OH) to nitric oxide (NO) by using bovine cytochrome c as an oxidant. In contrast, we investigated whether the HAO from anammox bacterium strain KSU-1 could catalyze the reduction of NO with reduced benzyl viologen (BVred) and the NO-releasing reagent, NOC 7. The reduction proceeded, resulting in the formation of NH2OH as a product. The oxidation rate of BVred was proportional to the concentration of BVred itself for a short period in each experiment, a situation that was termed quasi-steady state. The analyses of the states at various concentrations of HAO allowed us to determine the rate constant for the catalytic reaction, (2.85 ± 0.19) × 10(5) M(-1) s(-1), governing NO reduction by BVred and HAO, which was comparable to that reported for the HAO from the ammonium oxidizer, Nitrosomonas with reduced methyl viologen. These results suggest that the anammox HAO functions to adjust anammox by inter-conversion of NO and NH2OH depending on the redox potential of the physiological electron transfer protein in anammox bacteria. Copyright © 2014 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.
Effects of weather conditions, light conditions, and road lighting on vehicle speed.
Jägerbrand, Annika K; Sjöbergh, Jonas
2016-01-01
Light conditions are known to affect the number of vehicle accidents and fatalities but the relationship between light conditions and vehicle speed is not fully understood. This study examined whether vehicle speed on roads is higher in daylight and under road lighting than in darkness, and determined the combined effects of light conditions, posted speed limit and weather conditions on driving speed. The vehicle speed of passenger cars in different light conditions (daylight, twilight, darkness, artificial light) and different weather conditions (clear weather, rain, snow) was determined using traffic and weather data collected on an hourly basis for approximately 2 years (1 September 2012-31 May 2014) at 25 locations in Sweden (17 with road lighting and eight without). In total, the data included almost 60 million vehicle passes. The data were cleaned by removing June, July, and August, which have different traffic patterns than the rest of the year. Only data from the periods 10:00 A.M.-04:00 P.M. and 06:00 P.M.-10:00 P.M. were used, to remove traffic during rush hour and at night. Multivariate adaptive regression splines was used to evaluate the overall influence of independent variables on vehicle speed and nonparametric statistical testing was applied to test for speed differences between dark-daylight, dark-twilight, and twilight-daylight, on roads with and without road lighting. The results show that vehicle speed in general depends on several independent variables. Analyses of vehicle speed and speed differences between daylight, twilight and darkness, with and without road lighting, did not reveal any differences attributable to light conditions. However, vehicle speed decreased due to rain or snow and the decrease was higher on roads without road lighting than on roads with lighting. These results suggest that the strong association between traffic accidents and darkness or low light conditions could be explained by drivers failing to adjust their
Energy Technology Data Exchange (ETDEWEB)
Levova, Katerina; Moserova, Michaela [Department of Biochemistry, Faculty of Science, Charles University, Prague (Czech Republic); Nebert, Daniel W. [Department of Environmental Health, University of Cincinnati Medical Center, Cincinnati (United States); Phillips, David H. [Analytical and Environmental Sciences Division, MRC-HPA Centre for Environment and Health, King' s College London, London (United Kingdom); Frei, Eva [Division of Preventive Oncology, National Center for Tumor Diseases, German Cancer Research Center (DKFZ), Heidelberg (Germany); Schmeiser, Heinz H. [Research Group Genetic Alterations in Carcinogenesis, German Cancer Research Center (DKFZ), Heidelberg (Germany); Arlt, Volker M. [Analytical and Environmental Sciences Division, MRC-HPA Centre for Environment and Health, King' s College London, London (United Kingdom); Stiborova, Marie, E-mail: stiborov@natur.cuni.cz [Department of Biochemistry, Faculty of Science, Charles University, Prague (Czech Republic)
2012-12-15
Aristolochic acid causes a specific nephropathy (AAN), Balkan endemic nephropathy, and urothelial malignancies. Using Western blotting suitable to determine protein expression, we investigated in several transgenic mouse lines expression of NAD(P)H:quinone oxidoreductase (NQO1)—the most efficient cytosolic enzyme that reductively activates aristolochic acid I (AAI). The mouse tissues used were from previous studies [Arlt et al., Chem. Res. Toxicol. 24 (2011) 1710; Stiborova et al., Toxicol. Sci. 125 (2012) 345], in which the role of microsomal cytochrome P450 (CYP) enzymes in AAI metabolism in vivo had been determined. We found that NQO1 levels in liver, kidney and lung of Cyp1a1(−/−), Cyp1a2(−/−) and Cyp1a1/1a2(−/−) knockout mouse lines, as well as in two CYP1A-humanized mouse lines harboring functional human CYP1A1 and CYP1A2 and lacking the mouse Cyp1a1/1a2 orthologs, differed from NQO1 levels in wild-type mice. NQO1 protein and enzymic activity were induced in hepatic and renal cytosolic fractions isolated from AAI-pretreated mice, compared with those in untreated mice. Furthermore, this increase in hepatic NQO1 enzyme activity was associated with bioactivation of AAI and elevated AAI-DNA adduct levels in ex vivo incubations of cytosolic fractions with DNA and AAI. In conclusion, AAI appears to increase its own metabolic activation by inducing NQO1, thereby enhancing its own genotoxic potential. Highlights: ► NAD(P)H:quinone oxidoreductase expression in Cyp1a knockout and humanized CYP1A mice ► Reductive activation of the nephrotoxic and carcinogenic aristolochic acid I (AAI) ► NAD(P)H:quinone oxidoreductase is induced in mice treated with AAI. ► Induced hepatic enzyme activity resulted in elevated AAI-DNA adduct levels.
International Nuclear Information System (INIS)
Levova, Katerina; Moserova, Michaela; Nebert, Daniel W.; Phillips, David H.; Frei, Eva; Schmeiser, Heinz H.; Arlt, Volker M.; Stiborova, Marie
2012-01-01
Aristolochic acid causes a specific nephropathy (AAN), Balkan endemic nephropathy, and urothelial malignancies. Using Western blotting suitable to determine protein expression, we investigated in several transgenic mouse lines expression of NAD(P)H:quinone oxidoreductase (NQO1)—the most efficient cytosolic enzyme that reductively activates aristolochic acid I (AAI). The mouse tissues used were from previous studies [Arlt et al., Chem. Res. Toxicol. 24 (2011) 1710; Stiborova et al., Toxicol. Sci. 125 (2012) 345], in which the role of microsomal cytochrome P450 (CYP) enzymes in AAI metabolism in vivo had been determined. We found that NQO1 levels in liver, kidney and lung of Cyp1a1(−/−), Cyp1a2(−/−) and Cyp1a1/1a2(−/−) knockout mouse lines, as well as in two CYP1A-humanized mouse lines harboring functional human CYP1A1 and CYP1A2 and lacking the mouse Cyp1a1/1a2 orthologs, differed from NQO1 levels in wild-type mice. NQO1 protein and enzymic activity were induced in hepatic and renal cytosolic fractions isolated from AAI-pretreated mice, compared with those in untreated mice. Furthermore, this increase in hepatic NQO1 enzyme activity was associated with bioactivation of AAI and elevated AAI-DNA adduct levels in ex vivo incubations of cytosolic fractions with DNA and AAI. In conclusion, AAI appears to increase its own metabolic activation by inducing NQO1, thereby enhancing its own genotoxic potential. Highlights: ► NAD(P)H:quinone oxidoreductase expression in Cyp1a knockout and humanized CYP1A mice ► Reductive activation of the nephrotoxic and carcinogenic aristolochic acid I (AAI) ► NAD(P)H:quinone oxidoreductase is induced in mice treated with AAI. ► Induced hepatic enzyme activity resulted in elevated AAI-DNA adduct levels.
Damacena-Angelis, Célio; Oliveira-Paula, Gustavo H; Pinheiro, Lucas C; Crevelin, Eduardo J; Portella, Rafael L; Moraes, Luiz Alberto B; Tanus-Santos, Jose E
2017-08-01
Nitrite and nitrate restore deficient endogenous nitric oxide (NO) production as they are converted back to NO, and therefore complement the classic enzymatic NO synthesis. Circulating nitrate and nitrite must cross membrane barriers to produce their effects and increased nitrate concentrations may attenuate the nitrite influx into cells, decreasing NO generation from nitrite. Moreover, xanthine oxidoreductase (XOR) mediates NO formation from nitrite and nitrate. However, no study has examined whether nitrate attenuates XOR-mediated NO generation from nitrite. We hypothesized that nitrate attenuates the vascular and blood pressure responses to nitrite either by interfering with nitrite influx into vascular tissue, or by competing with nitrite for XOR, thus inhibiting XOR-mediated NO generation. We used two independent vascular function assays in rats (aortic ring preparations and isolated mesenteric arterial bed perfusion) to examine the effects of sodium nitrate on the concentration-dependent responses to sodium nitrite. Both assays showed that nitrate attenuated the vascular responses to nitrite. Conversely, the aortic responses to the NO donor DETANONOate were not affected by sodium nitrate. Further confirming these results, we found that nitrate attenuated the acute blood pressure lowering effects of increasing doses of nitrite infused intravenously in freely moving rats. The possibility that nitrate could compete with nitrite and decrease nitrite influx into cells was tested by measuring the accumulation of nitrogen-15-labeled nitrite ( 15 N-nitrite) by aortic rings using ultra-performance liquid chromatography tandem mass-spectrometry (UPLC-MS/MS). Nitrate exerted no effect on aortic accumulation of 15 N-nitrite. Next, we used chemiluminescence-based NO detection to examine whether nitrate attenuates XOR-mediated nitrite reductase activity. Nitrate significantly shifted the Michaelis Menten saturation curve to the right, with a 3-fold increase in the
Yuan, Haibo; Li, Jianghua; Shin, Hyun-Dong; Du, Guocheng; Chen, Jian; Shi, Zhongping; Liu, Long
2018-01-01
2,5-Furandicarboxylic acid (FDCA) is a promising bio-based building block and can be produced by biotransformation of 5-hydroxymethylfurfural (HMF). To improve the FDCA production, two genes-one encoding HMF oxidase (HMFO; from Methylovorus sp. strain MP688) and another encoding for HMF/Furfural oxidoreductase (HmfH; from Cupriavidus basilensis HMF14)-were introduced into Raoultella ornithinolytica BF60. The FDCA production in the engineered whole-cell biocatalyst increased from 51.0 to 93.6mM, and the molar conversion ratio of HMF to FDCA increased from 51.0 to 93.6%. Copyright © 2017 Elsevier Ltd. All rights reserved.
Wiebe, Marilyn G; Nygård, Yvonne; Oja, Merja; Andberg, Martina; Ruohonen, Laura; Koivula, Anu; Penttilä, Merja; Toivari, Mervi
2015-11-01
An open reading frame CC1225 from the Caulobacter crescentus CB15 genome sequence belongs to the Gfo/Idh/MocA protein family and has 47 % amino acid sequence identity with the glucose-fructose oxidoreductase from Zymomonas mobilis (Zm GFOR). We expressed the ORF CC1225 in the yeast Saccharomyces cerevisiae and used a yeast strain expressing the gene coding for Zm GFOR as a reference. Cell extracts of strains overexpressing CC1225 (renamed as Cc aaor) showed some Zm GFOR type of activity, producing D-gluconate and D-sorbitol when a mixture of D-glucose and D-fructose was used as substrate. However, the activity in Cc aaor expressing strain was >100-fold lower compared to strains expressing Zm gfor. Interestingly, C. crescentus AAOR was clearly more efficient than the Zm GFOR in converting in vitro a single sugar substrate D-xylose (10 mM) to xylitol without an added cofactor, whereas this type of activity was very low with Zm GFOR. Furthermore, when cultured in the presence of D-xylose, the S. cerevisiae strain expressing Cc aaor produced nearly equal concentrations of D-xylonate and xylitol (12.5 g D-xylonate l(-1) and 11.5 g D-xylitol l(-1) from 26 g D-xylose l(-1)), whereas the control strain and strain expressing Zm gfor produced only D-xylitol (5 g l(-1)). Deletion of the gene encoding the major aldose reductase, Gre3p, did not affect xylitol production in the strain expressing Cc aaor, but decreased xylitol production in the strain expressing Zm gfor. In addition, expression of Cc aaor together with the D-xylonolactone lactonase encoding the gene xylC from C. crescentus slightly increased the final concentration and initial volumetric production rate of both D-xylonate and D-xylitol. These results suggest that C. crescentus AAOR is a novel type of oxidoreductase able to convert the single aldose substrate D-xylose to both its oxidized and reduced product.
Directory of Open Access Journals (Sweden)
Jason eMarmon
2016-03-01
Full Text Available Modern electronics are developing electronic-optical integrated circuits, while their electronic backbone, e.g. field-effect transistors (FETs, remains the same. However, further FET down scaling is facing physical and technical challenges. A light-effect transistor (LET offers electronic-optical hybridization at the component level, which can continue Moore’s law to quantum region without requiring a FET’s fabrication complexity, e.g. physical gate and doping, by employing optical gating and photoconductivity. Multiple independent gates are therefore readily realized to achieve unique functionalities without increasing chip space. Here we report LET device characteristics and novel digital and analog applications, such as optical logic gates and optical amplification. Prototype CdSe-nanowire-based LETs show output and transfer characteristics resembling advanced FETs, e.g. on/off ratios up to ~1.0x106 with a source-drain voltage of ~1.43 V, gate-power of ~260 nW, and subthreshold swing of ~0.3 nW/decade (excluding losses. Our work offers new electronic-optical integration strategies and electronic and optical computing approaches.
DEFF Research Database (Denmark)
Raina, Medha; Elgamal, Sara; Santangelo, Thomas J
2012-01-01
-dependent methyltransferase 144, GTP cyclohydrolase 398, DNA topoisomerase VI subunit A 209, DNA topoisomerase VI subunit B 192, Type A Flavoprotein 911, NAD(P)H:rubredoxin oxidoreductase (Fatty acid metabolism) 120, NAD(P)H:rubredoxin oxidoreductase 120, cofactor-independent phosphoglycerate mutase 909, bis(5'-adenosyl...... subunit 2 255, glycerol kinase 257, phosphomannomutase-related protein 321, ribose-5-phosphate isomerase A 107, phosphate transport regulator 193, isopentenyl pyrophosphate isomerase (mevanolate Pathway) 500, amino acid kinase 203, NADH:polysulfide oxidoreductase 203, 5'-methylthioadenosine phosphorylase......, cysteine desulfurase 521, hydrogenase maturation protein HypF 235, iron-molybdenum cofactor-binding protein 192, ATPase 260, 4Fe-4S cluster-binding protein 254, phosphopyruvate hydratase 650, fructose-1,6-bisphosphatase 140, aspartate carbamoyltransferase catalytic subunit 158, Bipolar DNA helicase 448...
Nutrition in the spotlight: metabolic effects of environmental light
Versteeg, Ruth I.; Stenvers, Dirk J.; Kalsbeek, Andries; Bisschop, Peter H.; Serlie, Mireille J.; la Fleur, Susanne E.
2016-01-01
Use of artificial light resulted in relative independence from the natural light-dark (LD) cycle, allowing human subjects to shift the timing of food intake and work to convenient times. However, the increase in artificial light exposure parallels the increase in obesity prevalence. Light is the
Nutrition in the spotlight metabolic effects of environmental light
Versteeg, Ruth I; Stenvers, Dirk J; Kalsbeek, A.; Bisschop, Peter H; Serlie, Mireille J; la Fleur, Susanne E
2016-01-01
Use of artificial light resulted in relative independence from the natural light-dark (LD) cycle, allowing human subjects to shift the timing of food intake and work to convenient times. However, the increase in artificial light exposure parallels the increase in obesity prevalence. Light is the
Protein (Cyanobacteria): 15634 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available YP_007110409.1 1117:287 1150:4700 63132:1220 1173025:1220 Proto-chlorophyllide reductase 57 kD subunit Geit...lerinema sp. PCC 7407 MSDACQWTPEAEARLKEIPFFVRPAARKKIEKFAQDAGITEITAEVYDQAKQKFGSN ...
Light-Front Holography and the Light-Front Schrodinger Equation
Energy Technology Data Exchange (ETDEWEB)
Brodsky, Stanley J.; de Teramond, Guy
2012-08-15
One of the most important nonperturbative methods for solving QCD is quantization at fixed light-front time {tau} = t+z=c - Dirac's 'Front Form'. The eigenvalues of the light-front QCD Hamiltonian predict the hadron spectrum and the eigensolutions provide the light-front wavefunctions which describe hadron structure. More generally, we show that the valence Fock-state wavefunctions of the light-front QCD Hamiltonian satisfy a single-variable relativistic equation of motion, analogous to the nonrelativistic radial Schrodinger equation, with an effective confining potential U which systematically incorporates the effects of higher quark and gluon Fock states. We outline a method for computing the required potential from first principles in QCD. The holographic mapping of gravity in AdS space to QCD, quantized at fixed light-front time, yields the same light front Schrodinger equation; in fact, the soft-wall AdS/QCD approach provides a model for the light-front potential which is color-confining and reproduces well the light-hadron spectrum. One also derives via light-front holography a precise relation between the bound-state amplitudes in the fifth dimension of AdS space and the boost-invariant light-front wavefunctions describing the internal structure of hadrons in physical space-time. The elastic and transition form factors of the pion and the nucleons are found to be well described in this framework. The light-front AdS/QCD holographic approach thus gives a frame-independent first approximation of the color-confining dynamics, spectroscopy, and excitation spectra of relativistic light-quark bound states in QCD.
A platform independent communication library for distributed computing
Groen, D.; Rieder, S.; Grosso, P.; de Laat, C.; Portegies Zwart, S.
2010-01-01
We present MPWide, a platform independent communication library for performing message passing between supercomputers. Our library couples several local MPI applications through a long distance network using, for example, optical links. The implementation is deliberately kept light-weight, platform
Light scattering by small particles
Hulst, H C van de
1981-01-01
""A must for researchers using the techniques of light scattering."" ? S. C. Snowdon, Journal of the Franklin InstituteThe measurement of light scattering of independent, homogeneous particles has many useful applications in physical chemistry, meteorology and astronomy. There is, however, a sizeable gap between the abstract formulae related to electromagnetic-wave-scattering phenomena, and the computation of reliable figures and curves. Dr. van de Hulst's book enables researchers to bridge that gap. The product of twelve years of work, it is an exhaustive study of light-scattering properties
Directory of Open Access Journals (Sweden)
Yune-Fang Ueng
2015-09-01
Full Text Available Ruta graveolens (the common rue has been used for various therapeutic purposes, including relief of rheumatism and treatment of circulatory disorder. To elucidate the effects of rue on main drug-metabolizing enzymes, effects of an aqueous extract of the aerial part of rue and its ingredients on cytochrome P450 (P450/CYP, uridine diphosphate (UDP-glucuronosyltransferase, and reduced nicotinamide adenine dinucleotide (phosphate (NAD(PH:quinone oxidoreductase were studied in C57BL/6JNarl mice. Oral administration of rue extract to males increased hepatic Cyp1a and Cyp2b activities in a dose-dependent manner. Under a 7-day treatment regimen, rue extract (0.5 g/kg induced hepatic Cyp1a and Cyp2b activities and protein levels in males and females. This treatment increased hepatic UDP-glucuronosyltransferase activity only in males. However, NAD(PH:quinone oxidoreductase activity remained unchanged. Based on the contents of rutin and furanocoumarins of mouse dose of rue extract, rutin increased hepatic Cyp1a activity and the mixture of furanocoumarins (Fmix increased Cyp2b activities in males. The mixture of rutin and Fmix increased Cyp1a and Cyp2b activities. These results revealed that rutin and Fmix contributed at least in part to the P450 induction by rue.
PERIPHERAL SENSORY NEURONS EXPRESSING MELANOPSIN RESPOND TO LIGHT
Directory of Open Access Journals (Sweden)
Anna Matynia
2016-08-01
Full Text Available The ability of light to cause pain is paradoxical. The retina detects light but is devoid of nociceptors while the trigeminal sensory ganglia (TG contain nociceptors but not photoreceptors. Melanopsin-expressing intrinsically photosensitive retinal ganglion cells (ipRGCs are thought to mediate light-induced pain but recent evidence raises the possibility of an alternative light responsive pathway independent of the retina and optic nerve. Here, we show that melanopsin is expressed in both human and mouse TG neurons. In mice, they represent 3% of small TG neurons that are preferentially localized in the ophthalmic branch of the trigeminal nerve and are likely nociceptive C fibers and high-threshold mechanoreceptor Aδ fibers based on a strong size-function association. These isolated neurons respond to blue light stimuli with a delayed onset and sustained firing, similar to the melanopsin-dependent intrinsic photosensitivity observed in ipRGCs. Mice with severe bilateral optic nerve crush exhibit no light-induced responses including behavioral light aversion until treated with nitroglycerin, an inducer of migraine in people and migraine-like symptoms in mice. With nitroglycerin, these same mice with optic nerve crush exhibit significant light aversion. Furthermore, this retained light aversion remains dependent on melanopsin-expressing neurons. Our results demonstrate a novel light-responsive neural function independent of the optic nerve that may originate in the peripheral nervous system to provide the first direct mechanism for an alternative light detection pathway that influences motivated behavior.
Hadronic light-by-light scattering and the muon g −2
International Nuclear Information System (INIS)
Stoffer, P.; Colangelo, G.; Hoferichter, M.; Procura, M.
2015-01-01
The largest uncertainties in the Standard Model calculation of the anomalous magnetic moment of the muon (g − 2) μ come from hadronic contributions. In particular, it can be expected that in a few years the sub leading hadronic light-by-light (HLbL) contribution will dominate the theory uncertainty. We present a dispersive description of the HLbL tensor, which is based on unitarity, analyticity, crossing symmetry, and gauge invariance. Such a model-independent approach opens up an avenue towards a data-driven determination of the HLbL contribution to the (g − 2) μ .
Directory of Open Access Journals (Sweden)
Ma'ayan Semo
Full Text Available Melanopsin photoreception plays a vital role in irradiance detection for non-image forming responses to light. However, little is known about the involvement of melanopsin in emotional processing of luminance. When confronted with a gradient in light, organisms exhibit spatial movements relative to this stimulus. In rodents, behavioural light aversion (BLA is a well-documented but poorly understood phenomenon during which animals attribute salience to light and remove themselves from it. Here, using genetically modified mice and an open field behavioural paradigm, we investigate the role of melanopsin in BLA. While wildtype (WT, melanopsin knockout (Opn4(-/- and rd/rd cl (melanopsin only (MO mice all exhibit BLA, our novel methodology reveals that isolated melanopsin photoreception produces a slow, potentiating response to light. In order to control for the involvement of pupillary constriction in BLA we eliminated this variable with topical atropine application. This manipulation enhanced BLA in WT and MO mice, but most remarkably, revealed light aversion in triple knockout (TKO mice, lacking three elements deemed essential for conventional photoreception (Opn4(-/- Gnat1(-/- Cnga3(-/-. Using a number of complementary strategies, we determined this response to be generated at the level of the retina. Our findings have significant implications for the understanding of how melanopsin signalling may modulate aversive responses to light in mice and humans. In addition, we also reveal a clear potential for light perception in TKO mice.
International Nuclear Information System (INIS)
Huf, P.A.; Bourne, A.R.; Watson, T.G.
1989-01-01
The metabolism of androgens in the testis of the lizard Tiliqua rugosa has been studied in vitro by incubating cellular homogenates with radiolabeled C19-steroid substrates. The identification 17 beta-oxidoreductase and 3 beta-hydroxysteroid dehydrogenase/isomerase activities. Aromatase, 5 alpha-reductase, and 17 alpha/beta-epimerase activities were not detected. The 17 alpha-oxidoreductase activity was temperature dependent (maximal at 32 degrees), while the 17 beta-oxidoreductase activity was temperature independent. Time yield and dual-label studies indicated that testosterone biosynthesis mainly involves the 4-ene pathway (via androstenedione), whereas the formation of epitestosterone uses both the 4-ene and 5-ene (via 5-androstene-3 beta, 17 alpha-diol) pathways. The function of alternative pathways in androgen biosynthesis is discussed, as is the role of temperature in the intratesticular regulation of androgen production
Light-Front Holography, Light-Front Wavefunctions, and Novel QCD Phenomena
Energy Technology Data Exchange (ETDEWEB)
Brodsky, Stanley J.; /SLAC /Southern Denmark U., CP3-Origins; de Teramond, Guy F.; /Costa Rica U.
2012-02-16
Light-Front Holography is one of the most remarkable features of the AdS/CFT correspondence. In spite of its present limitations it provides important physical insights into the nonperturbative regime of QCD and its transition to the perturbative domain. This novel framework allows hadronic amplitudes in a higher dimensional anti-de Sitter (AdS) space to be mapped to frame-independent light-front wavefunctions of hadrons in physical space-time. The model leads to an effective confining light-front QCD Hamiltonian and a single-variable light-front Schroedinger equation which determines the eigenspectrum and the light-front wavefunctions of hadrons for general spin and orbital angular momentum. The coordinate z in AdS space is uniquely identified with a Lorentz-invariant coordinate {zeta} which measures the separation of the constituents within a hadron at equal light-front time and determines the off-shell dynamics of the bound-state wavefunctions, and thus the fall-off as a function of the invariant mass of the constituents. The soft-wall holographic model modified by a positive-sign dilaton metric, leads to a remarkable one-parameter description of nonperturbative hadron dynamics - a semi-classical frame-independent first approximation to the spectra and light-front wavefunctions of meson and baryons. The model predicts a Regge spectrum of linear trajectories with the same slope in the leading orbital angular momentum L of hadrons and the radial quantum number n. The hadron eigensolutions projected on the free Fock basis provides the complete set of valence and non-valence light-front Fock state wavefunctions {Psi}{sub n/H} (x{sub i}, k{sub {perpendicular}i}, {lambda}{sub i}) which describe the hadron's momentum and spin distributions needed to compute the direct measures of hadron structure at the quark and gluon level, such as elastic and transition form factors, distribution amplitudes, structure functions, generalized parton distributions and transverse
Hypoxia independent drivers of melanoma angiogenesis
Directory of Open Access Journals (Sweden)
Svenja eMeierjohann
2015-05-01
Full Text Available Tumor angiogenesis is a process which is traditionally regarded as the tumor`s response to low nutrient supply occurring under hypoxic conditions. However, hypoxia is not a prerequisite for angiogenesis. The fact that even single tumor cells or small tumor cell aggregates are capable of attracting blood vessels reveals the early metastatic capability of tumor cells. This review sheds light on the hypoxia independent mechanisms of tumor angiogenesis in melanoma.
Directory of Open Access Journals (Sweden)
Bravo S.
2004-01-01
Full Text Available A hybrid neural network model for simulating the process of enzymatic reduction of fructose to sorbitol process catalyzed by glucose-fructose oxidoreductase in Zymomonas mobilis CP4 is presented. Data used to derive and validate the model was obtained from experiments carried out under different conditions of pH, temperature and concentrations of both substrates (glucose and fructose involved in the reaction. Sonicated and lyophilized cells were used as source of the enzyme. The optimal pH for sorbitol synthesis at 30º C is 6.5. For a value of pH of 6, the optimal temperature is 35º C. The neural network in the model computes the value of the kinetic relationship. The hybrid neural network model is able to simulate changes in the substrates and product concentrations during sorbitol synthesis under pH and temperature conditions ranging between 5 and 7.5 and 25 and 40º C, respectively. Under these conditions the rate of sorbitol synthesis shows important differences. Values computed using the hybrid neural network model have an average error of 1.7·10-3 mole.
International Nuclear Information System (INIS)
Alcantara D, D.
1995-09-01
The objective of this work is to study the adaptation mechanisms of Escherichia coli to the ultraviolet light of 254 nm (W), a component of the solar light that induces a variety of damages in the DNA of the cells exposed, which should be eliminated in order to avoid its lethal and mutagenic effects. Inside this first report, the results obtained about the resistance to UV radiation of 5 independent populations of Escherichia coli, which were subjected in parallel form to 80 successive exposures of UV light with inserted periods of growth are reported. (Author)
Energy Technology Data Exchange (ETDEWEB)
Vivian, Julian P.; Scoullar, Jessica; Robertson, Amy L.; Bottomley, Stephen P.; Horne, James; Chin, Yanni; Wielens, Jerome; Thompson, Philip E.; Velkov, Tony; Piek, Susannah; Byres, Emma; Beddoe, Travis; Wilce, Matthew C.J.; Kahler, Charlene M.; Rossjohn, Jamie; Scanlon, Martin J. (UWA); (Monash)
2009-09-02
DsbA is an enzyme found in the periplasm of Gram-negative bacteria that catalyzes the formation of disulfide bonds in a diverse array of protein substrates, many of which are involved in bacterial pathogenesis. Although most bacteria possess only a single essential DsbA, Neisseria meningitidis is unusual in that it possesses three DsbAs, although the reason for this additional redundancy is unclear. Two of these N. meningitidis enzymes (NmDsbA1 and NmDsbA2) play an important role in meningococcal attachment to human epithelial cells, whereas NmDsbA3 is considered to have a narrow substrate repertoire. To begin to address the role of DsbAs in the pathogenesis of N. meningitidis, we have determined the structure of NmDsbA3 to 2.3-{angstrom} resolution. Although the sequence identity between NmDsbA3 and other DsbAs is low, the NmDsbA3 structure adopted a DsbA-like fold. Consistent with this finding, we demonstrated that NmDsbA3 acts as a thiol-disulfide oxidoreductase in vitro and is reoxidized by Escherichia coli DsbB (EcDsbB). However, pronounced differences in the structures between DsbA3 and EcDsbA, which are clustered around the active site of the enzyme, suggested a structural basis for the unusual substrate specificity that is observed for NmDsbA3.
Performance of Water-Based Liquid Scintillator: An Independent Analysis
Directory of Open Access Journals (Sweden)
D. Beznosko
2014-01-01
Full Text Available The water-based liquid scintillator (WbLS is a new material currently under development. It is based on the idea of dissolving the organic scintillator in water using special surfactants. This material strives to achieve the novel detection techniques by combining the Cerenkov rings and scintillation light, as well as the total cost reduction compared to pure liquid scintillator (LS. The independent light yield measurement analysis for the light yield measurements using three different proton beam energies (210 MeV, 475 MeV, and 2000 MeV for water, two different WbLS formulations (0.4% and 0.99%, and pure LS conducted at Brookhaven National Laboratory, USA, is presented. The results show that a goal of ~100 optical photons/MeV, indicated by the simulation to be an optimal light yield for observing both the Cerenkov ring and the scintillation light from the proton decay in a large water detector, has been achieved.
Energy Technology Data Exchange (ETDEWEB)
Maeda, Tomoji, E-mail: t-maeda@nichiyaku.ac.jp [Department of Neuroscience, School of Pharmacy, Iwate Medical University, 2-1-1 Nishitokuta, Yahaba-Cho, Shiwagun, Iwate, 028-3603 (Japan); Tanabe-Fujimura, Chiaki; Fujita, Yu; Abe, Chihiro; Nanakida, Yoshino; Zou, Kun; Liu, Junjun; Liu, Shuyu [Department of Neuroscience, School of Pharmacy, Iwate Medical University, 2-1-1 Nishitokuta, Yahaba-Cho, Shiwagun, Iwate, 028-3603 (Japan); Nakajima, Toshihiro [Institute of Medical Science, Tokyo Medical University, 6-1-1 Shinjyuku, Shinjyuku, Tokyo, Tokyo, 160-8402 (Japan); Komano, Hiroto, E-mail: hkomano@iwate-med.ac.jp [Department of Neuroscience, School of Pharmacy, Iwate Medical University, 2-1-1 Nishitokuta, Yahaba-Cho, Shiwagun, Iwate, 028-3603 (Japan)
2016-05-13
Homocysteine-induced endoplasmic reticulum (ER) protein (Herp) is an ER stress-inducible key regulatory component of ER-associated degradation (ERAD) that has been implicated in insulin hypersecretion in diabetic mouse models. Herp expression is tightly regulated. Additionally, Herp is a highly labile protein and interacts with various proteins, which are characteristic features of ubiquitinated protein. Previously, we reported that ubiquitination is not required for Herp degradation. In addition, we found that the lysine residues of Herp (which are ubiquitinated by E3 ubiquitin ligase) are not sufficient for regulation of Herp degradation. In this study, we found that NAD(P)H quinone oxidoreductase 1 (NQO1)-mediated targeting of Herp to the proteasome was involved in Herp degradation. In addition, we found that Herp protein levels were markedly elevated in synoviolin-null cells. The E3 ubiquitin ligase synoviolin is a central component of ERAD and is involved in the degradation of nuclear factor E2-related factor-2 (Nrf2), which regulates cellular reactive oxygen species. Additionally, NQO1 is a target of Nrf2. Thus, our findings indicated that NQO1 could stabilize Herp protein expression via indirect regulation of synoviolin. -- Highlights: •Herp interacts with NQO1. •NQO1 regulates Herp degradation.
International Nuclear Information System (INIS)
Tao, Minli; Türk, Karin; Diez, Joachim; Grütter, Markus G.; Fritz, Günter; Steuber, Julia
2006-01-01
The FAD domain of the NqrF subunit from the Na + -translocating NADH dehydrogenase from V. cholerae has been purified and crystallized. A complete data set was recorded at 3.1 Å. The Na + -translocating NADH:quinone oxidoreductase (Na + -NQR) from pathogenic and marine bacteria is a respiratory complex that couples the exergonic oxidation of NADH by quinone to the transport of Na + across the membrane. The NqrF subunit oxidizes NADH and transfers the electrons to other redox cofactors in the enzyme. The FAD-containing domain of NqrF has been expressed, purified and crystallized. The purified NqrF FAD domain exhibited high rates of NADH oxidation and contained stoichiometric amounts of the FAD cofactor. Initial crystallization of the flavin domain was achieved by the sitting-drop technique using a Cartesian MicroSys4000 robot. Optimization of the crystallization conditions yielded yellow hexagonal crystals with dimensions of 30 × 30 × 70 µm. The protein mainly crystallizes in long hexagonal needles with a diameter of up to 30 µm. Crystals diffract to 2.8 Å and belong to space group P622, with unit-cell parameters a = b = 145.3, c = 90.2 Å, α = β = 90, γ = 120°
International Nuclear Information System (INIS)
Maeda, Tomoji; Tanabe-Fujimura, Chiaki; Fujita, Yu; Abe, Chihiro; Nanakida, Yoshino; Zou, Kun; Liu, Junjun; Liu, Shuyu; Nakajima, Toshihiro; Komano, Hiroto
2016-01-01
Homocysteine-induced endoplasmic reticulum (ER) protein (Herp) is an ER stress-inducible key regulatory component of ER-associated degradation (ERAD) that has been implicated in insulin hypersecretion in diabetic mouse models. Herp expression is tightly regulated. Additionally, Herp is a highly labile protein and interacts with various proteins, which are characteristic features of ubiquitinated protein. Previously, we reported that ubiquitination is not required for Herp degradation. In addition, we found that the lysine residues of Herp (which are ubiquitinated by E3 ubiquitin ligase) are not sufficient for regulation of Herp degradation. In this study, we found that NAD(P)H quinone oxidoreductase 1 (NQO1)-mediated targeting of Herp to the proteasome was involved in Herp degradation. In addition, we found that Herp protein levels were markedly elevated in synoviolin-null cells. The E3 ubiquitin ligase synoviolin is a central component of ERAD and is involved in the degradation of nuclear factor E2-related factor-2 (Nrf2), which regulates cellular reactive oxygen species. Additionally, NQO1 is a target of Nrf2. Thus, our findings indicated that NQO1 could stabilize Herp protein expression via indirect regulation of synoviolin. -- Highlights: •Herp interacts with NQO1. •NQO1 regulates Herp degradation.
P450 oxidoreductase deficiency: a disorder of steroidogenesis with multiple clinical manifestations.
Miller, Walter L
2012-10-23
Cytochrome P450 enzymes catalyze the biosynthesis of steroid hormones and metabolize drugs. There are seven human type I P450 enzymes in mitochondria and 50 type II enzymes in endoplasmic reticulum. Type II enzymes, including both drug-metabolizing and some steroidogenic enzymes, require electron donation from a two-flavin protein, P450 oxidoreductase (POR). Although knockout of the POR gene causes embryonic lethality in mice, we discovered human POR deficiency as a disorder of steroidogenesis associated with the Antley-Bixler skeletal malformation syndrome and found mild POR mutations in phenotypically normal adults with infertility. Assay results of mutant forms of POR using the traditional but nonphysiologic assay (reduction of cytochrome c) did not correlate with patient phenotypes; assays based on the 17,20 lyase activity of P450c17 (CYP17) correlated with clinical phenotypes. The POR sequence in 842 normal individuals revealed many polymorphisms; amino acid sequence variant A503V is encoded by ~28% of human alleles. POR A503V has about 60% of wild-type activity in assays with CYP17, CYP2D6, and CYP3A4, but nearly wild-type activity with P450c21, CYP1A2, and CYP2C19. Activity of a particular POR variant with one P450 enzyme will not predict its activity with another P450 enzyme: Each POR-P450 combination must be studied individually. Human POR transcription, initiated from an untranslated exon, is regulated by Smad3/4, thyroid receptors, and the transcription factor AP-2. A promoter polymorphism reduces transcription to 60% in liver cells and to 35% in adrenal cells. POR deficiency is a newly described disorder of steroidogenesis, and POR variants may account for some genetic variation in drug metabolism.
Polarization-independent electromagnetically induced transparency-like metasurface
Jia, Xiuli; Wang, Xiaoou
2018-01-01
A classical electromagnetically induced transparency-like (EIT-like) metasurface is numerically simulated. This metasurface is composed of two identical and orthogonal double-end semitoroidals (DESTs) metal resonators. Under the excitation of the normal incidence waves, each of the two DESTs structure exhibits electromagnetic dipole responses at different frequencies, which leads to the polarization-independent EIT-like effect. The features of the EIT-like effect are qualitatively analyzed based on the surface current and magnetic field distribution. In addition, the large index is extracted to verify the slow-light property within the transmission window. The EIT-like metasurface structure with the above-mentioned characteristics may have potential applications in some areas, such as sensing, slow light, and filtering devices.
Angle-independent structural colors of silicon
DEFF Research Database (Denmark)
Højlund-Nielsen, Emil; Weirich, Johannes; Nørregaard, Jesper
2014-01-01
Structural colors are optical phenomena of physical origin, where microscale and nanoscale structures determine the reflected spectrum of light. Artificial structural colors have been realized within recent years. However, multilayer structures require substantial fabrication. Instead we considered...... one-layer surface textures of silicon.We explored four patterns of square structures in a square lattice with periods of 500, 400, 300, and 200 nm. The reflectivity and daylight-colors were measured and compared with simulations based on rigorously coupledwave analysis with excellent agreement. Based...... on the 200-nm periodic pattern, it was found that angle-independent specular colors up to 60 deg of incidence may be provided. The underlying mechanisms include (1) the suppression of diffraction and (2) a strong coupling of light to localized surface states. The strong coupling yields absorption anomalies...
AdS/QCD and Applications of Light-Front Holography
DEFF Research Database (Denmark)
Brodsky, S. J.; Cao, F. G.; de Teramond, G. F.
2012-01-01
Light-front holography leads to a rigorous connection between hadronic amplitudes in a higher dimensional anti-de Sitter (AdS) space and frame-independent light-front wavefunctions of hadrons in (3+1)-dimensional physical space-time, thus providing a compelling physical interpretation of the Ad...
Guskov, Albert; Kern, Jan; Gabdulkhakov, Azat; Broser, Matthias; Zouni, Athina; Saenger, Wolfram
Photosystem II (PSII) is a large homodimeric protein-cofactor complex located in the photosynthetic thylakoid membrane that acts as light-driven water:plastoquinone oxidoreductase. The crystal structure of PSII from Thermosynechococcus elongatus at 2.9-A resolution allowed the unambiguous assignment
Levine, Lanfang H.; Paré, Paul W.
2009-10-01
Long-duration manned space missions mandate the development of a sustainable life support system and effective countermeasures against damaging space radiation. To mitigate the risk of inevitable exposure to space radiation, cultivation of fresh fruits and vegetables rich in antioxidants is an attractive alternative to pharmacological agents. However it has yet to be established whether antioxidant properties of crops can be preserved or enhanced in a space environment where environmental conditions differ from that which plants have acclimated to on earth. Scallion ( Allium fistulosum) rich in antioxidant vitamins C and A, and flavonoids was used as a model plant to study the impact of a range of CO 2 concentrations and light intensities that are likely encountered in a space habitat on food quality traits. Scallions were hydroponically grown in controlled environmental chambers under a combination of 3 CO 2 concentrations of 400, 1200 and 4000 μmol mol -1 and 3 light intensity levels of 150, 300, 450 μmol m -2 s -1. Total antioxidant activity (TAA) of scallion extracts was determined using a radical cation scavenging assay. Both elevated CO 2 and increasing light intensity enhanced biomass accumulation, but effects on TAA (based on dry weight) differed. TAA was reduced for plants grown under elevated CO 2, but remained unchanged with increases in light intensity. Elevated CO 2 stimulated greater biomass production than antioxidants, while an increase in photosynthetic photo flux promoted the synthesis of antioxidant compounds at a rate similar to that of biomass. Consequently light is a more effective stimulus than CO 2 for antioxidant production.
Filipino Mothers' Beliefs about Parenting: A Question of Independence
Schulze, Pamela A.
2004-01-01
The author discusses research on Filipino mothers' socialization goals and beliefs about the role of other adults in disciplining their children. The results reveal that Filipinos have a collectivistic orientation, but that they nevertheless encourage independence in their children. The implications of these results are discussed in light of the…
Spin-1 particles with light-front approach
Directory of Open Access Journals (Sweden)
de Melo J.P.B.C.
2014-06-01
Full Text Available For the vector sector, i.e, mesons with spin-1, the electromagnetic form factors and anothers observables are calculated with the light-front approach. However, the light-front quantum field theory have some problems, for example, the rotational symmetry breaking. We solve that problem added the zero modes contribuition to the matrix elements of the electromagnetic current, besides the valence contribuition. We found that among the four independent matrix elements of the plus component in the light-front helicity basis only the 0 → 0 one carries zero mode contributions.
The Device-Independent Outlook On Quantum Physics
International Nuclear Information System (INIS)
Scarani, V.
2012-01-01
This text is an introduction to an operational outlook on Bell inequalities, which has been very fruitful in the past few years. It has lead to the recognition that Bell tests have their own place in applied quantum technologies, because they quantify non-classicality in a device-independent way, that is, without any need to describe the degrees of freedom under study and the measurements that are performed. At the more fundamental level, the same device-independent outlook has allowed the falsification of several other alternative models that could hope to reproduce the observed statistics while keeping some classical features that quantum theory denies; and it has shed new light on the long-standing quest for deriving quantum theory from physical principles. (author)
Directory of Open Access Journals (Sweden)
Grauman Peter L
2007-07-01
Full Text Available Abstract Background Frataxin is discussed as involved in the biogenesis of iron-sulfur clusters. Recently it was discovered that a frataxin homologue is a structural component of the respiratory NADH:ubiquinone oxidoreductase (complex I in Thermus thermophilus. It was not clear whether frataxin is in general a component of complex I from bacteria. The Escherichia coli homologue of frataxin is coined CyaY. Results We report that complex I is completely assembled to a stable and active enzyme complex equipped with all known iron-sulfur clusters in a cyaY mutant of E. coli. However, the amount of complex I is reduced by one third compared to the parental strain. Western blot analysis and live cell imaging of CyaY engineered with a GFP demonstrated that CyaY is located in the cytoplasm and not attached to the membrane as to be expected if it were a component of complex I. Conclusion CyaY plays a non-essential role in the assembly of complex I in E. coli. It is not a structural component but may transiently interact with the complex.
The little book of light and shadow
Thornton, Linda
2013-01-01
Encourage your Early Learners to becom investigators by exploring the concept of light and shadow. These simple and effective activities can be carried out independently with the focus on natural resources.
An independent distance estimate to the AGB star R Sculptoris
Maercker, M.; Brunner, M.; Mecina, M.; De Beck, E.
2018-04-01
Context. Distance measurements to astronomical objects are essential for understanding their intrinsic properties. For asymptotic giant branch (AGB) stars it is particularly difficult to derive accurate distance estimates. Period-luminosity relationships rely on the correlation of different physical properties of the stars, while the angular sizes and variability of AGB stars make parallax measurements inherently inaccurate. For the carbon AGB star R Sculptoris, the uncertain distance significantly affects the interpretation of observations regarding the evolution of the stellar mass loss during and after the most recent thermal pulse. Aim. We aim to provide a new, independent measurement of the distance to R Sculptoris, reducing the absolute uncertainty of the distance estimate to this source. Methods: R Scl is a semi-regular pulsating star, surrounded by a thin shell of dust and gas created during a thermal pulse ≈2000 years ago. The stellar light is scattered by the dust particles in the shell at a radius of ≈19″. The variation in the stellar light affects the amount of dust-scattered light with the same period and amplitude ratio, but with a phase lag that depends on the absolute size of the shell. We measured this phase lag by observing the star R Scl and the dust-scattered stellar light from the shell at five epochs between June-December 2016. By observing in polarised light, we imaged the shell in the plane of the sky, removing any uncertainty due to geometrical effects. The phase lag gives the absolute size of the shell, and together with the angular size of the shell directly gives the absolute distance to R Sculptoris. Results: We measured a phase lag between the stellar variations and the variation in the shell of 40.0 ± 4.0 days. The angular size of the shell is measured to be 19.″1 ± 0.″7. Combined, this gives an absolute distance to R Sculptoris of 361 ± 44 pc. Conclusions: We independently determined the absolute distance to R Scl with
Devour, Brian M.; Bell, Eric F.
2017-06-01
Accurate measurement of galaxy structures is a prerequisite for quantitative investigation of galaxy properties or evolution. Yet, the impact of galaxy inclination and dust on commonly used metrics of galaxy structure is poorly quantified. We use infrared data sets to select inclination-independent samples of disc and flattened elliptical galaxies. These samples show strong variation in Sérsic index, concentration and half-light radii with inclination. We develop novel inclination-independent galaxy structures by collapsing the light distribution in the near-infrared on to the major axis, yielding inclination-independent 'linear' measures of size and concentration. With these new metrics we select a sample of Milky Way analogue galaxies with similar stellar masses, star formation rates, sizes and concentrations. Optical luminosities, light distributions and spectral properties are all found to vary strongly with inclination: When inclining to edge-on, r-band luminosities dim by >1 magnitude, sizes decrease by a factor of 2, 'dust-corrected' estimates of star formation rate drop threefold, metallicities decrease by 0.1 dex and edge-on galaxies are half as likely to be classified as star forming. These systematic effects should be accounted for in analyses of galaxy properties.
International Nuclear Information System (INIS)
James, P.F.; Lee, J.; Rizzo, W.B.; Zoeller, R.A.
1990-01-01
The authors have isolated a mutant Chinese hamster ovary cell line that is defective in long-chain fatty alcohol oxidation. The ability of the mutant cells to convert labeled hexadecanol to the corresponding fatty acid in vivo was reduced to 5% of the parent strain. Whole-cell homogenates from the mutant strain, FAA.1, were deficient in long-chain fatty alcohol:NAD + oxidoreductase activity, which catalyzes the oxidation of hexadecanol to hexadecanoic acid, although the intermediate fatty aldehyde was formed normally. A direct measurement of fatty aldehyde dehydrogenase showed that the FAA.1, strain was defective in this component of FAO activity. FAA.1 is a two-stage mutant that was selected from a previously described parent strain, ZR-82, which is defective in ether lipid biosynthesis and peroxisome assembly. Because of combined defects in ether lipid biosynthesis and fatty alcohol oxidation, the ability of the FAA.1 cells to incorporate hexadecanol into complex lipids was greatly impaired, resulting in a 60-fold increase in cellular fatty alcohol levels. As the FAO deficiency in FAA.1 cells appears to be identical to the defect associated with the human genetic disorder Sjoegren-Larsson syndrome, the FAA.1 cell line may be useful in studying this disease
Energy Technology Data Exchange (ETDEWEB)
Noinaj, Nicholas; Bosserman, Mary A.; Schickli, M. Alexandra; Piszczek, Grzegorz; Kharel, Madan K.; Pahari, Pallab; Buchanan, Susan K.; Rohr, Jürgen (NIH); (Kentucky)
2012-11-26
GilR is a recently identified oxidoreductase that catalyzes the terminal step of gilvocarcin V biosynthesis and is a unique enzyme that establishes the lactone core of the polyketide-derived gilvocarcin chromophore. Gilvocarcin-type compounds form a small distinct family of anticancer agents that are involved in both photo-activated DNA-alkylation and histone H3 cross-linking. High resolution crystal structures of apoGilR and GilR in complex with its substrate pregilvocarcin V reveals that GilR belongs to the small group of a relatively new type of the vanillyl-alcohol oxidase flavoprotein family characterized by bicovalently tethered cofactors. GilR was found as a dimer, with the bicovalently attached FAD cofactor mediated through His-65 and Cys-125. Subsequent mutagenesis and functional assays indicate that Tyr-445 may be involved in reaction catalysis and in mediating the covalent attachment of FAD, whereas Tyr-448 serves as an essential residue initiating the catalysis by swinging away from the active site to accommodate binding of the 6R-configured substrate and consequently abstracting the proton of the hydroxyl residue of the substrate hemiacetal 6-OH group. These studies lay the groundwork for future enzyme engineering to broaden the substrate specificity of this bottleneck enzyme of the gilvocarcin biosynthetic pathway for the development of novel anti-cancer therapeutics.
Directory of Open Access Journals (Sweden)
Agnes eKeszler
2014-08-01
Full Text Available Far red/near-infrared light (NIR promotes a wide range of biological effects including tissue protection but whether and how NIR is capable of acutely protecting myocardium against ischemia and reperfusion injury in vivo is not fully elucidated. Our previous work indicates that NIR exposure immediately before and during early reperfusion protects the myocardium against infarction through mechanisms that are nitric oxide (NO-dependent. Here we tested the hypothesis that NIR elicits protection in a diabetic mouse model where other cardioprotective interventions such as pre- and postconditioning fail, and that the protection is independent of nitric oxide synthase (NOS. NIR reduced infarct size dose dependently. Importantly, NIR-induced protection was preserved in a diabetic mouse model (db/db and during acute hyperglycemia, as well as in endothelial NOS-/- mice and in wild type mice treated with NOS inhibitor L-NAME. In in vitro experiments NIR light liberates NO from nitrosyl hemoglobin (HbNO and nitrosyl myoglobin (MbNO in a wavelength (660-830 nm and dose-dependent manner. Irradiation at 660 nm yields the highest release of NO, while at longer wavelengths a dramatic decrease of NO release can be observed. Similar wavelength dependence was observed for the protection of mice against cardiac ischemia and reperfusion injury in vivo. NIR-induced NO release from deoxymyoglobin in the presence of nitrite mildly inhibits respiration of isolated mitochondria after hypoxia. In summary, NIR applied during reperfusion protects the myocardium against infarction in an NO dependent, but NOS-independent mechanisms, whereby mitochondria may be a target of NO released by NIR, leading to reduced reactive oxygen species generation during reperfusion. This unique mechanism preserves protection even during diabetes where other protective strategies fail.
International Nuclear Information System (INIS)
Li, Bin; Elliott, Sean J.
2016-01-01
Enzymes from the 2-oxoacid: ferredoxin oxidoreductase (OFOR) family engage in both CO_2 evolution and reduction in nature, depending on their physiological roles. Two enzymes and their redox partner ferredoxins (Fds) from Hydrogenobacter thermophilus and Desulfovibrio africanus were examined to investigate the basis of the catalytic bias. The Fd1 from H. thermophilus demonstrated a potential of ∼ −485 mV at room temperature, the lowest for known single [4Fe-4S] cluster Fds. It suggests a low potential electron donor may be the key factor in overcoming the large thermodynamic barrier of CO_2 reduction. The Fd-mediated electrocatalytic experiments further demonstrated the impact of Fd’s potential on the direction of the OFOR reaction: as OFOR enzymes could essentially catalyze both CO_2 evolution and reduction in vitro, the difference in their physiological roles is associated with the reduction potential of the redox partner Fd. The electrocatalytic assay could study both CO_2 evolution and reduction in one setup and is a good tool to probe Fds’ reactivity that arise from their reduction potentials.
Ramirez, M Desmond; Oakley, Todd H
2015-05-15
Cephalopods are renowned for changing the color and pattern of their skin for both camouflage and communication. Yet, we do not fully understand how cephalopods control the pigmented chromatophore organs in their skin and change their body pattern. Although these changes primarily rely on eyesight, we found that light causes chromatophores to expand in excised pieces of Octopus bimaculoides skin. We call this behavior light-activated chromatophore expansion (or LACE). To uncover how octopus skin senses light, we used antibodies against r-opsin phototransduction proteins to identify sensory neurons that express r-opsin in the skin. We hypothesized that octopus LACE relies on the same r-opsin phototransduction cascade found in octopus eyes. By creating an action spectrum for the latency to LACE, we found that LACE occurred most quickly in response to blue light. We fit our action spectrum data to a standard opsin curve template and estimated the λmax of LACE to be 480 nm. Consistent with our hypothesis, the maximum sensitivity of the light sensors underlying LACE closely matches the known spectral sensitivity of opsin from octopus eyes. LACE in isolated preparations suggests that octopus skin is intrinsically light sensitive and that this dispersed light sense might contribute to their unique and novel patterning abilities. Finally, our data suggest that a common molecular mechanism for light detection in eyes may have been co-opted for light sensing in octopus skin and then used for LACE. © 2015. Published by The Company of Biologists Ltd.
Investigation of the statistical properties of light
International Nuclear Information System (INIS)
Jensen, A.S.
1976-09-01
The report describes the coherence properties and the statistical properties of light from a classical and quantum mechanical point of view. The theoretical part is used to describe some more specific examples within the field of light scattering such as light scattering from a collection of independent scatters, measurement of wind velocity, and single burst detection in a Laser-Doppler velocitimeter system where the description gives a figure of merit for such a system. An experimental investigation was made of Brillouin scattering in some organic liquids. The experimental equipment is described and the results reported. (Auth.)
The second-order interference of two independent single-mode He-Ne lasers
Liu, Jianbin; Le, Mingnan; Bai, Bin; Wang, Wentao; Chen, Hui; Zhou, Yu; Li, Fu-li; Xu, Zhuo
2015-09-01
The second-order spatial and temporal interference patterns with two independent single-mode continuous-wave He-Ne lasers are observed when these two lasers are incident to two adjacent input ports of a 1:1 non-polarizing beam splitter, respectively. Two-photon interference based on the superposition principle in Feynman's path integral theory is employed to interpret the experimental results. The conditions to observe the second-order interference pattern with two independent single-mode continuous-wave lasers are discussed. It is concluded that frequency stability is important to observe the second-order interference pattern with two independent light beams.
Are Independent Probes Truly Independent?
Camp, Gino; Pecher, Diane; Schmidt, Henk G.; Zeelenberg, Rene
2009-01-01
The independent cue technique has been developed to test traditional interference theories against inhibition theories of forgetting. In the present study, the authors tested the critical criterion for the independence of independent cues: Studied cues not presented during test (and unrelated to test cues) should not contribute to the retrieval…
Haidari, Fatemeh; Keshavarz, Seid Ali; Mohammad Shahi, Majid; Mahboob, Soltan-Ali; Rashidi, Mohammad-Reza
2011-01-01
Increased serum uric acid is known to be a major risk related to the development of several oxidative stress diseases. The aim of this study was to investigate the effect of parsley, quercetin and kaempferol on serum uric acid levels, liver xanthine oxidoreductase activity and two non-invasive biomarkers of oxidative stress (total antioxidant capacity and malondialdehyde concentration) in normal and oxonate-induced hyperuricemic rats. A total of 60 male Wistar rats were randomly divided into ten equal groups; including 5 normal groups (vehicle, parsley, quercetin, kaempferol and allopurinol) and 5 hyperuricemic groups (vehicle, parsley, quercetin, kaempferol and allopurinol). Parsley (5 g/Kg), quercetin (5 mg/Kg), kaempferol (5 mg/Kg) and allopurinol (5 mg/Kg) were administrated to the corresponding groups by oral gavage once a day for 2 weeks. The results showed that parsley and its flavonol did not cause any significant reduction in the serum uric acid levels in normal rats, but significantly reduced the serum uric acid levels of hyperuricemic rats in a time-dependent manner. All treatments significantly inhibited liver xanthine oxidoreductase activity. Parsley, kaempferol and quercetin treatment led also to a significant increase in total antioxidant capacity and decrease in malondialdehyde concentration in hyperuricemic rats. Although the hypouricemic effect of allopurinol was much higher than that of parsley and its flavonol constituents, it could not significantly change oxidative stress biomarkers. These features of parsley and its flavonols make them as a possible alternative for allopurinol, or at least in combination therapy to minimize the side effects of allopurinol to treat hyperuricemia and oxidative stress diseases.
Signature proteins for the major clades of Cyanobacteria
Directory of Open Access Journals (Sweden)
Mathews Divya W
2010-01-01
Full Text Available Abstract Background The phylogeny and taxonomy of cyanobacteria is currently poorly understood due to paucity of reliable markers for identification and circumscription of its major clades. Results A combination of phylogenomic and protein signature based approaches was used to characterize the major clades of cyanobacteria. Phylogenetic trees were constructed for 44 cyanobacteria based on 44 conserved proteins. In parallel, Blastp searches were carried out on each ORF in the genomes of Synechococcus WH8102, Synechocystis PCC6803, Nostoc PCC7120, Synechococcus JA-3-3Ab, Prochlorococcus MIT9215 and Prochlor. marinus subsp. marinus CCMP1375 to identify proteins that are specific for various main clades of cyanobacteria. These studies have identified 39 proteins that are specific for all (or most cyanobacteria and large numbers of proteins for other cyanobacterial clades. The identified signature proteins include: (i 14 proteins for a deep branching clade (Clade A of Gloebacter violaceus and two diazotrophic Synechococcus strains (JA-3-3Ab and JA2-3-B'a; (ii 5 proteins that are present in all other cyanobacteria except those from Clade A; (iii 60 proteins that are specific for a clade (Clade C consisting of various marine unicellular cyanobacteria (viz. Synechococcus and Prochlorococcus; (iv 14 and 19 signature proteins that are specific for the Clade C Synechococcus and Prochlorococcus strains, respectively; (v 67 proteins that are specific for the Low B/A ecotype Prochlorococcus strains, containing lower ratio of chl b/a2 and adapted to growth at high light intensities; (vi 65 and 8 proteins that are specific for the Nostocales and Chroococcales orders, respectively; and (vii 22 and 9 proteins that are uniquely shared by various Nostocales and Oscillatoriales orders, or by these two orders and the Chroococcales, respectively. We also describe 3 conserved indels in flavoprotein, heme oxygenase and protochlorophyllide oxidoreductase proteins that
Experience-independent development of the hamster circadian visual system.
Directory of Open Access Journals (Sweden)
August Kampf-Lassin
2011-04-01
Full Text Available Experience-dependent functional plasticity is a hallmark of the primary visual system, but it is not known if analogous mechanisms govern development of the circadian visual system. Here we investigated molecular, anatomical, and behavioral consequences of complete monocular light deprivation during extended intervals of postnatal development in Syrian hamsters. Hamsters were raised in constant darkness and opaque contact lenses were applied shortly after eye opening and prior to the introduction of a light-dark cycle. In adulthood, previously-occluded eyes were challenged with visual stimuli. Whereas image-formation and motion-detection were markedly impaired by monocular occlusion, neither entrainment to a light-dark cycle, nor phase-resetting responses to shifts in the light-dark cycle were affected by prior monocular deprivation. Cholera toxin-b subunit fluorescent tract-tracing revealed that in monocularly-deprived hamsters the density of fibers projecting from the retina to the suprachiasmatic nucleus (SCN was comparable regardless of whether such fibers originated from occluded or exposed eyes. In addition, long-term monocular deprivation did not attenuate light-induced c-Fos expression in the SCN. Thus, in contrast to the thalamocortical projections of the primary visual system, retinohypothalamic projections terminating in the SCN develop into normal adult patterns and mediate circadian responses to light largely independent of light experience during development. The data identify a categorical difference in the requirement for light input during postnatal development between circadian and non-circadian visual systems.
Light-Front Quantization of Gauge Theories
Energy Technology Data Exchange (ETDEWEB)
Brodsky, Stanley J.
2003-03-25
Light-front wavefunctions provide a frame-independent representation of hadrons in terms of their physical quark and gluon degrees of freedom. The light-front Hamiltonian formalism provides new nonperturbative methods for obtaining the QCD spectrum and eigensolutions, including resolvant methods, variational techniques, and discretized light-front quantization. A new method for quantizing gauge theories in light-cone gauge using Dirac brackets to implement constraints is presented. In the case of the electroweak theory, this method of light-front quantization leads to a unitary and renormalizable theory of massive gauge particles, automatically incorporating the Lorentz and 't Hooft conditions as well as the Goldstone boson equivalence theorem. Spontaneous symmetry breaking is represented by the appearance of zero modes of the Higgs field leaving the light-front vacuum equal to the perturbative vacuum. I also discuss an ''event amplitude generator'' for automatically computing renormalized amplitudes in perturbation theory. The importance of final-state interactions for the interpretation of diffraction, shadowing, and single-spin asymmetries in inclusive reactions such as deep inelastic lepton-hadron scattering is emphasized.
Light-Front Quantization of Gauge Theories
Energy Technology Data Exchange (ETDEWEB)
Brodskey, Stanley
2002-12-01
Light-front wavefunctions provide a frame-independent representation of hadrons in terms of their physical quark and gluon degrees of freedom. The light-front Hamiltonian formalism provides new nonperturbative methods for obtaining the QCD spectrum and eigensolutions, including resolvant methods, variational techniques, and discretized light-front quantization. A new method for quantizing gauge theories in light-cone gauge using Dirac brackets to implement constraints is presented. In the case of the electroweak theory, this method of light-front quantization leads to a unitary and renormalizable theory of massive gauge particles, automatically incorporating the Lorentz and 't Hooft conditions as well as the Goldstone boson equivalence theorem. Spontaneous symmetry breaking is represented by the appearance of zero modes of the Higgs field leaving the light-front vacuum equal to the perturbative vacuum. I also discuss an ''event amplitude generator'' for automatically computing renormalized amplitudes in perturbation theory. The importance of final-state interactions for the interpretation of diffraction, shadowing, and single-spin asymmetries in inclusive reactions such as deep inelastic lepton-hadron scattering is emphasized.
A new adaptive light beam focusing principle for scanning light stimulation systems.
Bitzer, L A; Meseth, M; Benson, N; Schmechel, R
2013-02-01
In this article a novel principle to achieve optimal focusing conditions or rather the smallest possible beam diameter for scanning light stimulation systems is presented. It is based on the following methodology: First, a reference point on a camera sensor is introduced where optimal focusing conditions are adjusted and the distance between the light focusing optic and the reference point is determined using a laser displacement sensor. In a second step, this displacement sensor is used to map the topography of the sample under investigation. Finally, the actual measurement is conducted, using optimal focusing conditions in each measurement point at the sample surface, that are determined by the height difference between camera sensor and the sample topography. This principle is independent of the measurement values, the optical or electrical properties of the sample, the used light source, or the selected wavelength. Furthermore, the samples can be tilted, rough, bent, or of different surface materials. In the following the principle is implemented using an optical beam induced current system, but basically it can be applied to any other scanning light stimulation system. Measurements to demonstrate its operation are shown, using a polycrystalline silicon solar cell.
Novel Perspectives from Light-Front QCD, Super-Conformal Algebra, and Light-Front Holography
Energy Technology Data Exchange (ETDEWEB)
Brodsky, Stanley J. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2015-12-01
Light-Front Quantization – Dirac’s “Front Form” – provides a physical, frame-independent formalism for hadron dynamics and structure. Observables such as structure functions, transverse momentum distributions, and distribution amplitudes are defined from the hadronic LFWFs. One obtains new insights into the hadronic mass scale, the hadronic spectrum, and the functional form of the QCD running coupling in the nonperturbative domain using light-front holography. In addition, superconformal algebra leads to remarkable supersymmetric relations between mesons and baryons. I also discuss evidence that the antishadowing of nuclear structure functions is nonuniversal; i.e., flavor dependent, and why shadowing and antishadowing phenomena may be incompatible with the momentum and other sum rules for the nuclear parton distribution functions.
Light-cone quantization of quantum chromodynamics
International Nuclear Information System (INIS)
Brodsky, S.J.; Pauli, H.C.
1991-06-01
We discuss the light-cone quantization of gauge theories from two perspectives: as a calculational tool for representing hadrons as QCD bound-states of relativistic quarks and gluons, and also as a novel method for simulating quantum field theory on a computer. The light-cone Fock state expansion of wavefunctions at fixed light cone time provides a precise definition of the parton model and a general calculus for hadronic matrix elements. We present several new applications of light-cone Fock methods, including calculations of exclusive weak decays of heavy hadrons, and intrinsic heavy-quark contributions to structure functions. A general nonperturbative method for numerically solving quantum field theories, ''discretized light-cone quantization,'' is outlined and applied to several gauge theories, including QCD in one space and one time dimension, and quantum electrodynamics in physical space-time at large coupling strength. The DLCQ method is invariant under the large class of light-cone Lorentz transformations, and it can be formulated such at ultraviolet regularization is independent of the momentum space discretization. Both the bound-state spectrum and the corresponding relativistic light-cone wavefunctions can be obtained by matrix diagonalization and related techniques. We also discuss the construction of the light-cone Fock basis, the structure of the light-cone vacuum, and outline the renormalization techniques required for solving gauge theories within the light-cone Hamiltonian formalism
Light-cone quantization of quantum chromodynamics
Energy Technology Data Exchange (ETDEWEB)
Brodsky, S.J. (Stanford Linear Accelerator Center, Menlo Park, CA (USA)); Pauli, H.C. (Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany, F.R.))
1991-06-01
We discuss the light-cone quantization of gauge theories from two perspectives: as a calculational tool for representing hadrons as QCD bound-states of relativistic quarks and gluons, and also as a novel method for simulating quantum field theory on a computer. The light-cone Fock state expansion of wavefunctions at fixed light cone time provides a precise definition of the parton model and a general calculus for hadronic matrix elements. We present several new applications of light-cone Fock methods, including calculations of exclusive weak decays of heavy hadrons, and intrinsic heavy-quark contributions to structure functions. A general nonperturbative method for numerically solving quantum field theories, discretized light-cone quantization,'' is outlined and applied to several gauge theories, including QCD in one space and one time dimension, and quantum electrodynamics in physical space-time at large coupling strength. The DLCQ method is invariant under the large class of light-cone Lorentz transformations, and it can be formulated such at ultraviolet regularization is independent of the momentum space discretization. Both the bound-state spectrum and the corresponding relativistic light-cone wavefunctions can be obtained by matrix diagonalization and related techniques. We also discuss the construction of the light-cone Fock basis, the structure of the light-cone vacuum, and outline the renormalization techniques required for solving gauge theories within the light-cone Hamiltonian formalism.
Anisotropic light scattering of individual sickle red blood cells.
Kim, Youngchan; Higgins, John M; Dasari, Ramachandra R; Suresh, Subra; Park, YongKeun
2012-04-01
We present the anisotropic light scattering of individual red blood cells (RBCs) from a patient with sickle cell disease (SCD). To measure light scattering spectra along two independent axes of elongated-shaped sickle RBCs with arbitrary orientation, we introduce the anisotropic Fourier transform light scattering (aFTLS) technique and measured both the static and dynamic anisotropic light scattering. We observed strong anisotropy in light scattering patterns of elongated-shaped sickle RBCs along its major axes using static aFTLS. Dynamic aFTLS analysis reveals the significantly altered biophysical properties in individual sickle RBCs. These results provide evidence that effective viscosity and elasticity of sickle RBCs are significantly different from those of the healthy RBCs.
Vector mesons on the light front
International Nuclear Information System (INIS)
Naito, K.; Maedan, S.; Itakura, K.
2004-01-01
We apply the light-front quantization to the Nambu-Jona-Lasinio model with the vector interaction, and compute vector meson's mass and light-cone wavefunction in the large N limit. Following the same procedure as in the previous analyses for scalar and pseudo-scalar mesons, we derive the bound-state equations of a qq-bar system in the vector channel. We include the lowest order effects of the vector interaction. The resulting transverse and longitudinal components of the bound-state equation look different from each other. But eventually after imposing an appropriate cutoff, one finds these two are identical, giving the same mass and the same (spin-independent) light-cone wavefunction. Mass of the vector meson decreases as one increases the strength of the vector interaction
Light-front view of the axial anomaly
International Nuclear Information System (INIS)
Ji, C.; Rey, S.
1996-01-01
Motivated by an apparent puzzle of the light-front vacua incompatible with the axial anomaly, we have considered the two-dimensional massless Schwinger model for an arbitrary interpolating angle of Hornbostel close-quote s interpolating quantization surface. By examining spectral deformation of the Dirac sea under an external electric field semiclassically, we have found that the axial anomaly is quantization angle independent. This indicates an intricate nontrivial vacuum structure present even in the light-front limit. copyright 1996 The American Physical Society
Lasecka, Lidia; Baron, Michael D
2014-01-01
Nairobi sheep disease virus (NSDV) of the genus Nairovirus causes a haemorrhagic gastroenteritis in sheep and goats with mortality up to 90%; the virus is found in East and Central Africa, and in India, where the virus is called Ganjam virus. NSDV is closely related to the human pathogen Crimean-Congo haemorrhagic fever virus, which also causes a haemorrhagic disease. As with other nairoviruses, replication of NSDV takes place in the cytoplasm and the new virus particles bud into the Golgi apparatus; however, the effect of viral replication on cellular compartments has not been studied extensively. We have found that the overall structure of the endoplasmic reticulum (ER), the ER-Golgi intermediate compartment and the Golgi were unaffected by infection with NSDV. However, we observed that NSDV infection led to the loss of protein disulphide isomerase (PDI), an oxidoreductase present in the lumen of the endoplasmic reticulum (ER) and which assists during protein folding, from the ER. Further investigation showed that NSDV-infected cells have high levels of PDI at their surface, and PDI is also secreted into the culture medium of infected cells. Another chaperone from the PDI family, ERp57, was found to be similarly affected. Analysis of infected cells and expression of individual viral glycoproteins indicated that the NSDV PreGn glycoprotein is involved in redistribution of these soluble ER oxidoreductases. It has been suggested that extracellular PDI can activate integrins and tissue factor, which are involved respectively in pro-inflammatory responses and disseminated intravascular coagulation, both of which manifest in many viral haemorrhagic fevers. The discovery of enhanced PDI secretion from NSDV-infected cells may be an important finding for understanding the mechanisms underlying the pathogenicity of haemorrhagic nairoviruses.
Directory of Open Access Journals (Sweden)
Lidia Lasecka
Full Text Available Nairobi sheep disease virus (NSDV of the genus Nairovirus causes a haemorrhagic gastroenteritis in sheep and goats with mortality up to 90%; the virus is found in East and Central Africa, and in India, where the virus is called Ganjam virus. NSDV is closely related to the human pathogen Crimean-Congo haemorrhagic fever virus, which also causes a haemorrhagic disease. As with other nairoviruses, replication of NSDV takes place in the cytoplasm and the new virus particles bud into the Golgi apparatus; however, the effect of viral replication on cellular compartments has not been studied extensively. We have found that the overall structure of the endoplasmic reticulum (ER, the ER-Golgi intermediate compartment and the Golgi were unaffected by infection with NSDV. However, we observed that NSDV infection led to the loss of protein disulphide isomerase (PDI, an oxidoreductase present in the lumen of the endoplasmic reticulum (ER and which assists during protein folding, from the ER. Further investigation showed that NSDV-infected cells have high levels of PDI at their surface, and PDI is also secreted into the culture medium of infected cells. Another chaperone from the PDI family, ERp57, was found to be similarly affected. Analysis of infected cells and expression of individual viral glycoproteins indicated that the NSDV PreGn glycoprotein is involved in redistribution of these soluble ER oxidoreductases. It has been suggested that extracellular PDI can activate integrins and tissue factor, which are involved respectively in pro-inflammatory responses and disseminated intravascular coagulation, both of which manifest in many viral haemorrhagic fevers. The discovery of enhanced PDI secretion from NSDV-infected cells may be an important finding for understanding the mechanisms underlying the pathogenicity of haemorrhagic nairoviruses.
Energy Technology Data Exchange (ETDEWEB)
Brodsky, S.
2004-11-30
In these lectures, I survey a number of applications of light-front methods to hadron and nuclear physics phenomenology and dynamics, including light-front statistical physics. Light-front Fock-state wavefunctions provide a frame-independent representation of hadrons in terms of their fundamental quark and gluon degrees of freedom. Nonperturbative methods for computing LFWFs in QCD are discussed, including string/gauge duality which predicts the power-law fall-off at high momentum transfer of light-front Fock-state hadronic wavefunctions with an arbitrary number of constituents and orbital angular momentum. The AdS/CFT correspondence has important implications for hadron phenomenology in the conformal limit, including an all-orders derivation of counting rules for exclusive processes. One can also compute the hadronic spectrum of near-conformal QCD assuming a truncated AdS/CFT space. Given the LFWFs, one can compute form factors, heavy hadron decay amplitudes, hadron distribution amplitudes, and the generalized parton distributions underlying deeply virtual Compton scattering. The quantum fluctuations represented by the light-front Fock expansion leads to novel QCD phenomena such as color transparency, intrinsic heavy quark distributions, diffractive dissociation, and hidden-color components of nuclear wavefunctions. A new test of hidden color in deuteron photodisintegration is proposed. The origin of leading-twist phenomena such as the diffractive component of deep inelastic scattering, single-spin asymmetries, nuclear shadowing and antishadowing is also discussed; these phenomena cannot be described by light-front wavefunctions of the target computed in isolation. Part of the anomalous NuTeV results for the weak mixing angle {theta}{sub W} could be due to the non-universality of nuclear antishadowing for charged and neutral currents.
Role of NAD(P)H:quinone oxidoreductase 1 in clofibrate-mediated hepatoprotection from acetaminophen
International Nuclear Information System (INIS)
Moffit, Jeffrey S.; Aleksunes, Lauren M.; Kardas, Michael J.; Slitt, Angela L.; Klaassen, Curtis D.; Manautou, Jose E.
2007-01-01
Mice pretreated with the peroxisome proliferator clofibrate (CFB) are resistant to acetaminophen (APAP) hepatotoxicity. Whereas the mechanism of protection is not entirely known, CFB decreases protein adducts formed by the reactive metabolite of APAP, N-acetyl-p-benzoquinone imine (NAPQI). NAD(P)H:quinone oxidoreductase 1 (NQO1) is an enzyme with antioxidant properties that is responsible for the reduction of cellular quinones. We hypothesized that CFB increases NQO1 activity, which in turn enhances the conversion of NAPQI back to the parent APAP. This could explain the decreases in APAP covalent binding and glutathione depletion produced by CFB without affecting APAP bioactivation to NAPQI. Administration of CFB (500 mg/kg, i.p.) to male CD-1 mice for 5 or 10 days increased NQO1 protein and activity levels. To evaluate the capacity of NQO1 to reduce NAPQI back to APAP, we utilized a microsomal activating system. Cytochrome P450 enzymes present in microsomes bioactivate APAP to NAPQI, which binds the electrophile trapping agent, N-acetyl cysteine (NAC). We analyzed the formation of APAP-NAC metabolite in the presence of human recombinant NQO1. Results indicate that NQO1 is capable of reducing NAPQI. The capacity of NQO1 to amelioriate APAP toxicity was then evaluated in primary hepatocytes. Primary hepatocytes isolated from mice dosed with CFB are resistant to APAP toxicity. These hepatocytes were also exposed to ES936, a high affinity, and irreversible inhibitor of NQO1 in the presence of APAP. Concentrations of ES936 that resulted in over 94% inhibition of NQO1 activity did not increase the susceptibility of hepatocytes from CFB treated mice to APAP. Whereas NQO1 is mechanistically capable of reducing NAPQI, CFB-mediated hepatoprotection does not appear to be dependent upon enhanced expression of NQO1
International Nuclear Information System (INIS)
Zahran, A.M.; Azab, Kh.Sh.; Abbady, M.I.
2006-01-01
Allopurinol is a xanthine oxidase (XO) inhibitor, used for management of hyperuricaema. It acts on purine catabolism without disrupting the biosynthesis of purine. The present work was conducted to examine the role of xanthine oxidase inhibitor (allopurinol) in minimizing radiation injuries in male albino rats. Allopurinol was given to rats via intraperitoneal (i.p) injection at a dose of 30 mg/kg body wt/day for 7 successive days before starting irradiation and 14 successive days during and in between exposure to gamma radiation. Rats were exposed to whole body gamma radiation, delivered as 1 Gy every other day up to total dose 8 Gy. Results demonstrate that treatment with allopurinol by the regime assumed in the present study minimized significantly the amount of thiobarbituric acid reactive substances (TBARS), product of lipid peroxidation, in liver, intestine and plasma. This effect was associated with significant amelioration in xanthine oxidoreductase (XOR) system as observed on the 1st and 7th days post last radiation fraction. The severity of changes in antioxidant parameters namely: superoxide dismutase (SOD), Catalase (CAT) and reduced glutathione (GSH) were less manifested in liver, intestine and blood as compared to irradiated rats. The levels of nitric oxide (NO) were significantly improved in plasma and the two investigated tissues as compared to irradiated rats. A significant decrease in plasma uric acid concentration was recorded on the 1st and 7th days post last allopurinol dose. However, significant amelioration was recorded in the plasma uric acid of rats treated with allopurinol before and during radiation exposure as compared to irradiated rats. Accordingly, it could be concluded that XO inhibitor (allopurinol) play a significant role in minimizing the tissue damages upon exposure to ionizing radiation via preventing the over production of reactive oxygen species (ROS) in irradiated cells through the XOR system of irradiation rats
Marginalia. The Literary Independence of Spanish America
Directory of Open Access Journals (Sweden)
Juan Guillermo Gómez García
2010-12-01
Full Text Available This article discusses some of the characteristic problems and issues of the so-called “literary independence” of Spanish America in the light of its political emancipation from Spain. This topic goes beyond the temporal framework or the periodization of the wars of independence; instead, it covers the entire nineteenth century and part of the twentieth, and appears discontinuously and non-simultaneously in the different nations. The path followed by Spanish American literature was filled with vicissitudes,manifestations, and regressions of diverse types. The paper specifically analyzes La biblioteca americana and El repertorio americano by the Venezuelan, Andrés Bello, and Juan García del Río, a native of Cartagena, as well as the role of the young Argentinean Domingo F. Sarmiento, author of Facundo, in the genesis and first outlines of an independent Spanish American “literary expression”.
Thioredoxin and NADPH-Dependent Thioredoxin Reductase C Regulation of Tetrapyrrole Biosynthesis.
Da, Qingen; Wang, Peng; Wang, Menglong; Sun, Ting; Jin, Honglei; Liu, Bing; Wang, Jinfa; Grimm, Bernhard; Wang, Hong-Bin
2017-10-01
In chloroplasts, thioredoxin (TRX) isoforms and NADPH-dependent thioredoxin reductase C (NTRC) act as redox regulatory factors involved in multiple plastid biogenesis and metabolic processes. To date, less is known about the functional coordination between TRXs and NTRC in chlorophyll biosynthesis. In this study, we aimed to explore the potential functions of TRX m and NTRC in the regulation of the tetrapyrrole biosynthesis (TBS) pathway. Silencing of three genes, TRX m1 , TRX m2 , and TRX m4 ( TRX ms ), led to pale-green leaves, a significantly reduced 5-aminolevulinic acid (ALA)-synthesizing capacity, and reduced accumulation of chlorophyll and its metabolic intermediates in Arabidopsis ( Arabidopsis thaliana ). The contents of ALA dehydratase, protoporphyrinogen IX oxidase, the I subunit of Mg-chelatase, Mg-protoporphyrin IX methyltransferase (CHLM), and NADPH-protochlorophyllide oxidoreductase were decreased in triple TRX m- silenced seedlings compared with the wild type, although the transcript levels of the corresponding genes were not altered significantly. Protein-protein interaction analyses revealed a physical interaction between the TRX m isoforms and CHLM. 4-Acetoamido-4-maleimidylstilbene-2,2-disulfonate labeling showed the regulatory impact of TRX ms on the CHLM redox status. Since CHLM also is regulated by NTRC (Richter et al., 2013), we assessed the concurrent functions of TRX m and NTRC in the control of CHLM. Combined deficiencies of three TRX m isoforms and NTRC led to a cumulative decrease in leaf pigmentation, TBS intermediate contents, ALA synthesis rate, and CHLM activity. We discuss the coordinated roles of TRX m and NTRC in the redox control of CHLM stability with its corollary activity in the TBS pathway. © 2017 American Society of Plant Biologists. All Rights Reserved.
Directory of Open Access Journals (Sweden)
James R Fuller
2011-12-01
Full Text Available Staphylococcus aureus is an important human pathogen commonly infecting nearly every host tissue. The ability of S. aureus to resist innate immunity is critical to its success as a pathogen, including its propensity to grow in the presence of host nitric oxide (NO·. Upon exogenous NO· exposure, S. aureus immediately excretes copious amounts of L-lactate to maintain redox balance. However, after prolonged NO·-exposure, S. aureus reassimilates L-lactate specifically and in this work, we identify the enzyme responsible for this L-lactate consumption as a L-lactate-quinone oxidoreductase (Lqo, SACOL2623. Originally annotated as Mqo2 and thought to oxidize malate, we show that this enzyme exhibits no affinity for malate but reacts specifically with L-lactate (KM = ~330 µM. In addition to its requirement for reassimilation of L-lactate during NO·-stress, Lqo is also critical to respiratory growth on L-lactate as a sole carbon source. Moreover, ∆lqo mutants exhibit attenuation in a murine model of sepsis, particularly in their ability to cause myocarditis. Interestingly, this cardiac-specific attenuation is completely abrogated in mice unable to synthesize inflammatory NO· (iNOS-/-. We demonstrate that S. aureus NO·-resistance is highly dependent on the availability of a glycolytic carbon sources. However, S. aureus can utilize the combination of peptides and L-lactate as carbon sources during NO·-stress in an Lqo-dependent fashion. Murine cardiac tissue has markedly high levels of L-lactate in comparison to renal or hepatic tissue consistent with the NO·-dependent requirement for Lqo in S. aureus myocarditis. Thus, Lqo provides S. aureus with yet another means of replicating in the presence of host NO·.
Bonnineau, Chloé; Sague, Irene Gallardo; Urrea, Gemma; Guasch, Helena
2012-05-01
In multiple stress situations, the co-occurrence of environmental and chemical factors can influence organisms' ability to cope with toxicity. In this context, the influence of light adaptation on the response of freshwater biofilms to sudden light changes or to herbicides exposure was investigated by determining various parameters: diatom community composition, photosynthetic parameters, chlorophyll a content, antioxidant enzyme activities. Biofilms were grown in microcosms under sub-optimal, saturating, and high light intensities and showed already described characteristics of shade/light adaptation (community structure, photosynthetic adaptation, etc.). Light history modulated antioxidant and photosynthetic responses of biofilms to the stress caused by short-term exposure to sudden light changes or to herbicides. First biofilms adapted to sub-optimal light intensity (shade-adapted) were found to be more sensitive to an increase in light intensity than high-light adapted ones to a reduction in light intensity. Second, while light history influenced biofilms' response to glyphosate, it had little influence on biofilms' response to copper and none on its response to oxyfluorfen. Indeed glyphosate exposure led to a stronger decrease in photosynthetic efficiency of shade-adapted biofilms (EC(50) = 11.7 mg L(-1)) than of high-light adapted communities (EC(50) = 35.6 mg L(-1)). Copper exposure led to an activation of ascorbate peroxidase (APX) in biofilms adapted to sub-optimal and saturating light intensity while the protein content decreased in all biofilms exposed to copper. Oxyfluorfen toxicity was independent of light history provoking an increase in APX activity. In conclusion this study showed that both previous exposure to contaminants and physical habitat characteristics might influence community tolerance to disturbances strongly.
Arango Gutierrez, Erik Uwe
2015-01-01
Glucose oxidase is an oxidoreductase exhibiting a high β-D-glucose specificity and high stability which renders glucose oxidase well-suited for applications in diabetes care. Nevertheless, GOx activity is highly oxygen dependent which can lead to inaccuracies in amperometric β-D-glucose determinations. Therefore a directed evolution campaign with two rounds of random mutagenesis (SeSaM followed by epPCR), site saturation mutagenesis studies, and one simultaneous site saturation library (OmniC...
Directory of Open Access Journals (Sweden)
Ana Rita Otrelo-Cardoso
2014-01-01
Full Text Available The periplasmic aldehyde oxidoreductase PaoABC from Escherichia coli is a molybdenum enzyme involved in detoxification of aldehydes in the cell. It is an example of an αβγ heterotrimeric enzyme of the xanthine oxidase family of enzymes which does not dimerize via its molybdenum cofactor binding domain. In order to structurally characterize PaoABC, X-ray crystallography and small angle X-ray scattering (SAXS have been carried out. The protein crystallizes in the presence of 20% (w/v polyethylene glycol 3350 using the hanging-drop vapour diffusion method. Although crystals were initially twinned, several experiments were done to overcome twinning and lowering the crystallization temperature (293 K to 277 K was the solution to the problem. The non-twinned crystals used to solve the structure diffract X-rays to beyond 1.80 Å and belong to the C2 space group, with cell parameters a = 109.42 Å, b = 78.08 Å, c = 151.77 Å, β = 99.77°, and one molecule in the asymmetric unit. A molecular replacement solution was found for each subunit separately, using several proteins as search models. SAXS data of PaoABC were also collected showing that, in solution, the protein is also an αβγ heterotrimer.
The light-cone Fock state expansion and hadron physics phenomenology
International Nuclear Information System (INIS)
Brodsky, S.J.
1997-06-01
The light-cone Fock expansion is defined in the following way: one first constructs the light-cone time evolution operator and the invariant mass operator in light-cone gauge from the QCD Lagrangian. The total longitudinal momentum and transverse momenta are conserved, i.e. are independent of the interactions. The matrix elements of the invariant mass operator on the complete orthonormal basis of the free theory can then be constructed. The matrix elements connect Fock states differing by 0, 1, or 2 quark or gluon quanta, and they include the instantaneous quark and gluon contributions imposed by eliminating dependent degrees of freedom in light-cone gauge. Applications of light-cone methods to QCD phenomenology are briefly described
Yao, Jianchu; Warren, Steve
2005-01-01
Motion artifact reduction and separation become critical when medical sensors are used in wearable monitoring scenarios. Previous research has demonstrated that independent component analysis (ICA) can be applied to pulse oximeter signals to separate photoplethysmographic (PPG) data from motion artifacts, ambient light, and other interference in low-motion environments. However, ICA assumes that all source signal component pairs are mutually independent. It is important to assess the statistical independence of the source components in PPG data, especially if ICA is to be applied in ambulatory monitoring environments, where motion artifacts can have a substantial effect on the quality of data received from light-based sensors. This paper addresses the statistical relationship between motion artifacts and PPG data by calculating the correlation coefficients between arterial volume variations and motion over a range of stationary to high-motion conditions. Analyses indicate that motion significantly affects arterial flow, so care must be taken when applying ICA to light-based sensor data acquired from wearable platforms.
Radiative decay of light and heavy mesons
International Nuclear Information System (INIS)
Barik, N.; Dash, P.C.
1994-01-01
The M1 transition among the vector (V) and pseudoscalar (P) mesons in the light and heavy flavor sectors has been investigated in a potential model of independent quarks. Going beyond the static approximation, to add some momentum dependence due to the recoil effect in a more realistic calculation, we find an improvement in the results for the radiative decay of light flavored mesons. However, our prediction on the decay rates for the mesons (D * and B * ) in the heavy flavor sector remains unaffected and compares well with those of other model calculations
QCD Phenomenology and Light-Front Wavefunctions
International Nuclear Information System (INIS)
Brodsky, Stanley J.
2001-01-01
A natural calculus for describing the bound-state structure of relativistic composite systems in quantum field theory is the light-front Fock expansion which encodes the properties of a hadrons in terms of a set of frame-independent n-particle wavefunctions. Light-front quantization in the doubly-transverse light-cone gauge has a number of remarkable advantages, including explicit unitarity, a physical Fock expansion, the absence of ghost degrees of freedom, and the decoupling properties needed to prove factorization theorems in high momentum transfer inclusive and exclusive reactions. A number of applications are discussed in these lectures, including semileptonic B decays, two-photon exclusive reactions, diffractive dissociation into jets, and deeply virtual Compton scattering. The relation of the intrinsic sea to the light-front wavefunctions is discussed. Light-front quantization can also be used in the Hamiltonian form to construct an event generator for high energy physics reactions at the amplitude level. The light-cone partition function, summed over exponentially weighted light-cone energies, has simple boost properties which may be useful for studies in heavy ion collisions. I also review recent work which shows that the structure functions measured in deep inelastic lepton scattering are affected by final-state rescattering, thus modifying their connection to light-front probability distributions. In particular, the shadowing of nuclear structure functions is due to destructive interference effects from leading-twist diffraction of the virtual photon, physics not included in the nuclear light-cone wavefunctions
Cullen, Joseph J; Hinkhouse, Marilyn M; Grady, Matthew; Gaut, Andrew W; Liu, Jingru; Zhang, Yu Ping; Weydert, Christine J Darby; Domann, Frederick E; Oberley, Larry W
2003-09-01
NADPH:quinone oxidoreductase (NQO(1)), a homodimeric, ubiquitous, flavoprotein, catalyzes the two-electron reduction of quinones to hydroquinones. This reaction prevents the one-electron reduction of quinones by cytochrome P450 reductase and other flavoproteins that would result in oxidative cycling with generation of superoxide (O(2)(.-)). NQO(1) gene regulation may be up-regulated in some tumors to accommodate the needs of rapidly metabolizing cells to regenerate NAD(+). We hypothesized that pancreatic cancer cells would exhibit high levels of this enzyme, and inhibiting it would suppress the malignant phenotype. Reverse transcription-PCR, Western blots, and activity assays demonstrated that NQO(1) was up-regulated in the pancreatic cancer cell lines tested but present in very low amounts in the normal human pancreas. To determine whether inhibition of NQO(1) would alter the malignant phenotype, MIA PaCa-2 pancreatic cancer cells were treated with a selective inhibitor of NQO(1), dicumarol. Dicumarol increased intracellular production of O(2)(.-), as measured by hydroethidine staining, and inhibited cell growth. Both of these effects were blunted with infection of an adenoviral vector containing the cDNA for manganese superoxide dismutase. Dicumarol also inhibited cell growth, plating efficiency, and growth in soft agar. We conclude that inhibition of NQO(1) increases intracellular O(2)(.-) production and inhibits the in vitro malignant phenotype of pancreatic cancer. These mechanisms suggest that altering the intracellular redox environment of pancreatic cancer cells may inhibit growth and delineate a potential strategy directed against pancreatic cancer.
Hirota, R; Yamagata, A; Kato, J; Kuroda, A; Ikeda, T; Takiguchi, N; Ohtake, H
2000-02-01
Pulsed-field gel electrophoresis of PmeI digests of the Nitrosomonas sp. strain ENI-11 chromosome produced four bands ranging from 1,200 to 480 kb in size. Southern hybridizations suggested that a 487-kb PmeI fragment contained two copies of the amoCAB genes, coding for ammonia monooxygenase (designated amoCAB(1) and amoCAB(2)), and three copies of the hao gene, coding for hydroxylamine oxidoreductase (hao(1), hao(2), and hao(3)). In this DNA fragment, amoCAB(1) and amoCAB(2) were about 390 kb apart, while hao(1), hao(2), and hao(3) were separated by at least about 100 kb from each other. Interestingly, hao(1) and hao(2) were located relatively close to amoCAB(1) and amoCAB(2), respectively. DNA sequence analysis revealed that hao(1) and hao(2) shared 160 identical nucleotides immediately upstream of each translation initiation codon. However, hao(3) showed only 30% nucleotide identity in the 160-bp corresponding region.
Are Independent Fiscal Institutions Really Independent?
Directory of Open Access Journals (Sweden)
Slawomir Franek
2015-08-01
Full Text Available In the last decade the number of independent fiscal institutions (known also as fiscal councils has tripled. They play an important oversight role over fiscal policy-making in democratic societies, especially as they seek to restore public finance stability in the wake of the recent financial crisis. Although common functions of such institutions include a role in analysis of fiscal policy, forecasting, monitoring compliance with fiscal rules or costing of spending proposals, their roles, resources and structures vary considerably across countries. The aim of the article is to determine the degree of independence of such institutions based on the analysis of the independence index of independent fiscal institutions. The analysis of this index values may be useful to determine the relations between the degree of independence of fiscal councils and fiscal performance of particular countries. The data used to calculate the index values will be derived from European Commission and IMF, which collect sets of information about characteristics of activity of fiscal councils.
In a Heartbeat: Light and Cardiovascular Physiology
Directory of Open Access Journals (Sweden)
Sarah L. Chellappa
2017-10-01
Full Text Available Light impinging on the retina fulfils a dual function: it serves for vision and it is required for proper entrainment of the endogenous circadian timing system to the 24-h day, thus influencing behaviors that promote health and optimal quality of life but are independent of image formation. The circadian pacemaker located in the suprachiasmatic nuclei modulates the cardiovascular system with an intrinsic ability to anticipate morning solar time and with a circadian nature of adverse cardiovascular events. Here, we infer that light exposure might affect cardiovascular function and provide evidence from existing research. Findings show a time-of-day dependent increase in relative sympathetic tone associated with bright light in the morning but not in the evening hours. Furthermore, dynamic light in the early morning hours can reduce the deleterious sleep-to-wake evoked transition on cardiac modulation. On the contrary, effects of numerous light parameters, such as illuminance level and wavelength of monochromatic light, on cardiac function are mixed. Therefore, in future research studies, light modalities, such as timing, duration, and its wavelength composition, should be taken in to account when testing the potential of light as a non-invasive countermeasure for adverse cardiovascular events.
Quantum electrodynamics in the light-front Weyl gauge
International Nuclear Information System (INIS)
Przeszowski, J.; Naus, H.W.; Kalloniatis, A.C.
1996-01-01
We examine (3+1)-dimensional QED quantized in the open-quote open-quote front form close-quote close-quote with finite open-quote open-quote volume close-quote close-quote regularization, namely, in discretized light-cone quantization. Instead of the light-cone or Coulomb gauges, we impose the light-front Weyl gauge A - =0. The Dirac method is used to arrive at the quantum commutation relations for the independent variables. We apply open-quote open-quote quantum-mechanical gauge fixing close-quote close-quote to implement Gauss close-quote law, and derive the physical Hamiltonian in terms of unconstrained variables. As in the instant form, this Hamiltonian is invariant under global residual gauge transformations, namely, displacements. On the light cone the symmetry manifests itself quite differently. copyright 1996 The American Physical Society
Xu, Lu-Hai; Ou, Qing-Dong; Li, Yan-Qing; Zhang, Yi-Bo; Zhao, Xin-Dong; Xiang, Heng-Yang; Chen, Jing-De; Zhou, Lei; Lee, Shuit-Tong; Tang, Jian-Xin
2016-01-26
Flexible organic light-emitting diodes (OLEDs) hold great promise for future bendable display and curved lighting applications. One key challenge of high-performance flexible OLEDs is to develop new flexible transparent conductive electrodes with superior mechanical, electrical, and optical properties. Herein, an effective nanostructured metal/dielectric composite electrode on a plastic substrate is reported by combining a quasi-random outcoupling structure for broadband and angle-independent light outcoupling of white emission with an ultrathin metal alloy film for optimum optical transparency, electrical conduction, and mechanical flexibility. The microcavity effect and surface plasmonic loss can be remarkably reduced in white flexible OLEDs, resulting in a substantial increase in the external quantum efficiency and power efficiency to 47.2% and 112.4 lm W(-1).
Laviale, Martin; Prygiel, Jean; Créach, Anne
2010-05-10
This study tested if a variation in light intensity, in comparison to constant light required in well-designed toxicity test, could have measurable consequences on the sensitivity of phototrophic biofilms (periphyton) to isoproturon. Two independent experiments were carried out to investigate the combined effects of light and isoproturon on the photochemical behavior of intact natural biofilms by measurements of chlorophyll fluorescence and pigment composition. Experiment 1 consisted of exposing biofilms to series of isoproturon concentrations (0-2 mg L(-1)) for 7 h under constant light at different irradiance levels (25-300 micromol m(-2) s(-1)). In experiment 2, biofilms were exposed using more environmentally realistic conditions to three selected concentrations of isoproturon (2, 6 and 20 microg L(-1)) during a 7-h-simulated daily light cycle. Our results demonstrated that light, considered here as a direct physical stressor, slightly modulated the acute toxicity of isoproturon on these diatom dominated communities. This was attributed to the fact that these two factors act specifically on the photosynthetic activity. Furthermore, it was shown that a dynamic light regime increased periphyton sensitivity to isoproturon by challenging its photoprotective mechanisms such as the xanthophyll cycle, therefore implying that traditional ecotoxicological bioassays lead to underestimate the effect of isoproturon. 2010 Elsevier B.V. All rights reserved.
What Can We Learn from Hadronic and Radiative Decays of Light Mesons?
Kubis, Bastian
2013-04-01
Chiral perturbation theory offers a powerful tool for the investigation of light pseudoscalar mesons. It incorporates the fundamental symmetries of QCD, interrelates various processes, and allows to link these to the light quark masses. Its shortcomings lie in a limited energy range: the radius of convergence of the chiral expansion is confined to below resonance scales. Furthermore, the strongest consequences of chiral symmetry are manifest for pseudoscalars (pions, kaons, eta) only: vector mesons, e.g., have a severe impact in particular for reactions involving photons. In this talk, I advocate dispersions relations as another model-independent tool to extend the applicability range of chiral perturbation theory. They even allow to tackle the physics of vector mesons in a rigorous way. It will be shown how dispersive methods can be used to resum large rescattering effects, and to provide model-independent links between hadronic and radiative decay modes. Examples to be discussed will include decays of the eta meson, giving access to light-quark-mass ratios or allowing to test the chiral anomaly; and meson transition form factors, which have an important impact on the hadronic light-by-light-scattering contribution to the anomalous magnetic moment of the muon.
Retino-hypothalamic regulation of light-induced murine sleep
Directory of Open Access Journals (Sweden)
Fanuel eMuindi
2014-08-01
Full Text Available The temporal organization of sleep is regulated by an interaction between the circadian clock and homeostatic processes. Light indirectly modulates sleep through its ability to phase shift and entrain the circadian clock. Light can also exert a direct, circadian-independent effect on sleep. For example, acute exposure to light promotes sleep in nocturnal animals and wake in diurnal animals. The mechanisms whereby light directly influences sleep and arousal are not well understood. In this review, we discuss the direct effect of light on sleep at the level of the retina and hypothalamus in rodents. We review murine data from recent publications showing the roles of rod-, cone- and melanopsin-based photoreception on the initiation and maintenance of light-induced sleep. We also present hypotheses about hypothalamic mechanisms that have been advanced to explain the acute control of sleep by light. Specifically, we review recent studies assessing the roles of the ventrolateral preoptic area and the suprachiasmatic nucleus. We also discuss how light might differentially promote sleep and arousal in nocturnal and diurnal animals respectively. Lastly, we suggest new avenues for research on this topic which is still in its early stages.
Serôdio, João; Ezequiel, João; Frommlet, Jörg; Laviale, Martin; Lavaud, Johann
2013-11-01
Light-response curves (LCs) of chlorophyll fluorescence are widely used in plant physiology. Most commonly, LCs are generated sequentially, exposing the same sample to a sequence of distinct actinic light intensities. These measurements are not independent, as the response to each new light level is affected by the light exposure history experienced during previous steps of the LC, an issue particularly relevant in the case of the popular rapid light curves. In this work, we demonstrate the proof of concept of a new method for the rapid generation of LCs from nonsequential, temporally independent fluorescence measurements. The method is based on the combined use of sample illumination with digitally controlled, spatially separated beams of actinic light and a fluorescence imaging system. It allows the generation of a whole LC, including a large number of actinic light steps and adequate replication, within the time required for a single measurement (and therefore named "single-pulse light curve"). This method is illustrated for the generation of LCs of photosystem II quantum yield, relative electron transport rate, and nonphotochemical quenching on intact plant leaves exhibiting distinct light responses. This approach makes it also possible to easily characterize the integrated dynamic light response of a sample by combining the measurement of LCs (actinic light intensity is varied while measuring time is fixed) with induction/relaxation kinetics (actinic light intensity is fixed and the response is followed over time), describing both how the response to light varies with time and how the response kinetics varies with light intensity.
Development of independent production in Europe: institutional diversity
International Nuclear Information System (INIS)
Krause, G.G.
1995-01-01
The industrial model of the power sector is being challenged in all but a few countries. Being stable for many years, the power sector is now constrained to evolve to more flexible structures, pushed by financing, political and environmental issues. More so, recent innovations within the financing or entrepreneurial background, as well as in the main equipment suppliers' strategies, have attracted new actors to a formerly closed sector. The independent power production could be seen as a vector leading sector's reforms in several countries, being recognized an a careful path, a way to gradually opening the sector. The analysis of the institutional structures within which the independent production evolves can point out relevant elements and directions of sector's changes. One can find, for instances, within a relatively restraint universe, i.e. that one of the European countries, a variety of situations putting light on the complexity of the debate. This paper aims at discussing the role of the independent power production through such a diversity of institutional structures, avoiding any polarization around themes like privatization or deregulation. (author). 1 fig., 2 tabs., 13 refs
Seo, Daisuke; Soeta, Takahiro; Sakurai, Hidehiro; Sétif, Pierre; Sakurai, Takeshi
2016-06-01
Ferredoxin-NADP(+) oxidoreductase ([EC1.18.1.2], FNR) from Bacillus subtilis (BsFNR) is a homodimeric flavoprotein sharing structural homology with bacterial NADPH-thioredoxin reductase. Pre-steady-state kinetics of the reactions of BsFNR with NADP(+), NADPH, NADPD (deuterated form) and B. subtilis ferredoxin (BsFd) using stopped-flow spectrophotometry were studied. Mixing BsFNR with NADP(+) and NADPH yielded two types of charge-transfer (CT) complexes, oxidized FNR (FNR(ox))-NADPH and reduced FNR (FNR(red))-NADP(+), both having CT absorption bands centered at approximately 600n m. After mixing BsFNR(ox) with about a 10-fold molar excess of NADPH (forward reaction), BsFNR was almost completely reduced at equilibrium. When BsFNR(red) was mixed with NADP(+), the amount of BsFNR(ox) increased with increasing NADP(+) concentration, but BsFNR(red) remained as the major species at equilibrium even with about 50-fold molar excess NADP(+). In both directions, the hydride-transfer was the rate-determining step, where the forward direction rate constant (~500 s(-1)) was much higher than the reverse one (reaction. The characteristics of the BsFNR reactions with NADP(+)/NADPH were compared with those of other types of FNRs. Copyright © 2016 Elsevier B.V. All rights reserved.
Light Curve Variations of AR Lacertae
Directory of Open Access Journals (Sweden)
Il-Seong Nha
1991-12-01
Full Text Available Sixteen unitary Light curves of AR Lac in B and V are made at Yonsei University Observatory in the period of 1980-1988. Some overview findings of light variations are made. (1 The light variations outside eclipse follow none of the wave migration patterns reported by previous investigators. (2 Complicated shapes outside eclipse are apparently much reduced in the light curves of 1983-1984. This suggests that, in the future, AR Lac has a chance to attain a normal state with mo complicated interactions. (3 The depths of the primary and the secondary mid-eclipses are changing year-to-year. (4 The K0 star, the larger component, has brightened by 0.m14 V, while the G2 star has shown a fluctuation of about 0.m05 in V. (5 The B-V values at primary mid-eclipse have no correlation with the depth variations. (6 Independently of the increase of maximum brightness, the B-V colors in the non-eclipsed phases changed slightly over the years.
The Independent Evolution Method Is Not a Viable Phylogenetic Comparative Method.
Directory of Open Access Journals (Sweden)
Randi H Griffin
Full Text Available Phylogenetic comparative methods (PCMs use data on species traits and phylogenetic relationships to shed light on evolutionary questions. Recently, Smaers and Vinicius suggested a new PCM, Independent Evolution (IE, which purportedly employs a novel model of evolution based on Felsenstein's Adaptive Peak Model. The authors found that IE improves upon previous PCMs by producing more accurate estimates of ancestral states, as well as separate estimates of evolutionary rates for each branch of a phylogenetic tree. Here, we document substantial theoretical and computational issues with IE. When data are simulated under a simple Brownian motion model of evolution, IE produces severely biased estimates of ancestral states and changes along individual branches. We show that these branch-specific changes are essentially ancestor-descendant or "directional" contrasts, and draw parallels between IE and previous PCMs such as "minimum evolution". Additionally, while comparisons of branch-specific changes between variables have been interpreted as reflecting the relative strength of selection on those traits, we demonstrate through simulations that regressing IE estimated branch-specific changes against one another gives a biased estimate of the scaling relationship between these variables, and provides no advantages or insights beyond established PCMs such as phylogenetically independent contrasts. In light of our findings, we discuss the results of previous papers that employed IE. We conclude that Independent Evolution is not a viable PCM, and should not be used in comparative analyses.
Spatial light modulators for full cross-connections in optical networks
Juday, Richard D. (Inventor)
2004-01-01
A polarization-independent optical switch is disclosed for switching at least one incoming beam from at least one input source to at least one output drain. The switch includes a polarizing beam splitter to split each of the at least one incoming beam into a first input beam and a second input beam, wherein the first input beam and the second input beams are independently polarized; a wave plate optically coupled to the second input beam for converting the polarization of the second input beam to an appropriately polarized second input beam; a beam combiner optically coupled to the first input beam and the modified second input beam, wherein the beam combiner accepts the first input beam and the modified second input beam to produce a combined beam; the combined beam is invariant to the polarization state of the input source's polarization; and a controllable spatial light modulator optically coupled to the combined beam, wherein the combined beam is diffracted by the controllable spatial light modulator to place light at a plurality of output locations.
International Nuclear Information System (INIS)
Patel, Ananddeep; Zhang, Shaojie; Shrestha, Amrit Kumar; Maturu, Paramahamsa; Moorthy, Bhagavatula; Shivanna, Binoy
2016-01-01
Omeprazole (OM) is an aryl hydrocarbon receptor (AhR) agonist and a proton pump inhibitor that is used to treat humans with gastric acid related disorders. Recently, we showed that OM induces NAD (P) H quinone oxidoreductase-1 (NQO1) via nuclear factor erythroid 2-related factor 2 (Nrf2)-dependent mechanism. Heme oxygenase-1 (HO-1) is another cytoprotective and antioxidant enzyme that is regulated by Nrf2. Whether OM induces HO-1 in fetal human pulmonary microvascular endothelial cells (HPMEC) is unknown. Therefore, we tested the hypothesis that OM will induce HO-1 expression via Nrf2 in HPMEC. OM induced HO-1 mRNA and protein expression in a dose-dependent manner. siRNA-mediated knockdown of AhR failed to abrogate, whereas knockdown of Nrf2 abrogated HO-1 induction by OM. To identify the underlying molecular mechanisms, we determined the effects of OM on cellular hydrogen peroxide (H 2 O 2 ) levels since oxidative stress mediated by the latter is known to activate Nrf2. Interestingly, the concentration at which OM induced HO-1 also increased H 2 O 2 levels. Furthermore, H 2 O 2 independently augmented HO-1 expression. Although N-acetyl cysteine (NAC) significantly decreased H 2 O 2 levels in OM-treated cells, we observed that OM further increased HO-1 mRNA and protein expression in NAC-pretreated compared to vehicle-pretreated cells, suggesting that OM induces HO-1 via H 2 O 2 -independent mechanisms. In conclusion, we provide evidence that OM transcriptionally induces HO-1 via AhR - and H 2 O 2 - independent, but Nrf2 - dependent mechanisms. These results have important implications for human disorders where Nrf2 and HO-1 play a beneficial role. - Highlights: • Omeprazole induces HO-1 in human fetal lung cells. • AhR deficiency fails to abrogate omeprazole-mediated induction of HO-1. • Nrf2 knockdown abrogates omeprazole-mediated HO-1 induction in human lung cells. • Hydrogen peroxide depletion augments omeprazole-mediated induction of HO-1.
Dual light-activated microfluidic pumps based on an optopiezoelectric composite
International Nuclear Information System (INIS)
Wang, Hsin-Hu; Lee, Chih-Kung; Hsu, Yu-Hsiang; Wu, Ting-Jui; Cheng, I-Chun; Lin, Shih-Jue; Gu, Jen-Tau
2017-01-01
In this paper, a new type of microfluidic pump that can be activated and controlled by a masked light source is presented. The actuation of this micropump is based on an optopiezoelectric composite. This composite is constructed by having one of the electrodes of a piezoelectric PVDF (polyvinylidene fluoride) polymer replaced by a layer of TiOPc (titanyl phthalocyanine) photoconductive coating and an ITO (indium-tin-oxide) transparent electrode. This layer of photoconductive electrode provides the capability to activate multiple locations of this optopiezoelectric composite independently using a masked light source and a single voltage source. To verify the feasibility of this concept, dual light-activated microfluidic pumps based on this optopiezoelectric composite are implemented and studied. Experimental results verify that two microfluidic pumps can be created by one optopiezoelectric composite and that each pump can be optically turned on and off independently or be turned on simultaneously. These results suggest that integrating an optopiezoelectric composite into a lab-on-a-chip system can reduce the size and the number of driving units significantly, since every operation can be done optically and only one driving source is needed. The equivalent circuit, design, and implementation of dual light-activated optopiezoelectric micropumps are discussed in this paper. (paper)
Chen, Horng-Shyang; Liu, Zhan Hui; Shih, Pei-Ying; Su, Chia-Ying; Chen, Chih-Yen; Lin, Chun-Han; Yao, Yu-Feng; Kiang, Yean-Woei; Yang, C C
2014-04-07
A reverse-biased voltage is applied to either device in the vertical configuration of two light-emitting diodes (LEDs) grown on patterned and flat Si (110) substrates with weak and strong quantum-confined Stark effects (QCSEs), respectively, in the InGaN/GaN quantum wells for independently controlling the applied voltage across and the injection current into the p-i-n junction in the lateral configuration of LED operation. The results show that more carrier supply is needed in the LED of weaker QCSE to produce a carrier screening effect for balancing the potential tilt in increasing the forward-biased voltage, when compared with the LED of stronger QCSE. The small spectral shift range in increasing injection current in the LED of weaker QCSE is attributed not only to the weaker QCSE, but also to its smaller device resistance such that a given increment of applied voltage leads to a larger increment of injection current. From a viewpoint of practical application in LED operation, by applying a reverse-biased voltage in the vertical configuration, the applied voltage and injection current in the lateral configuration can be independently controlled by adjusting the vertical voltage for keeping the emission spectral peak fixed.
Effect of light quality on somatic embryogenesis of quince leaves
International Nuclear Information System (INIS)
D'Onofrio, C.; Morini, S.; Bellocchi, G.
1998-01-01
The effect of light quality on somatic embryogenesis in quince BA 29 was investigated. 2,4-D induced leaves were exposed for 25 days to the following light quality treatments: dark, far-red, far-red+blue, far-red+red, blue, white, red+blue, red. After a further 20 days of white light exposure, somatic embryo production was recorded. Somatic embryogenesis was highest in cultures subjected to red light treatment, and decreased progressively with the transition to red+blue and to white. Overall, embryogenic competence showed a correlation with photoequilibrium. Phytochrome appeared to be inductive although this effect was adversely influenced by the blue absorbing photoreceptor, in particular at low photoequilibrium. Independently of light treatments applied, somatic embryos frequently showed severe morphological abnormalities. Conversion of somatic embryos to plantlets was not observed. (author)
Doustvandi, Mohammad Amin; Mohammadnejad, Fateme; Mansoori, Behzad; Mohammadi, Ali; Navaeipour, Farzaneh; Baradaran, Behzad; Tajalli, Habib
2017-11-01
The aim of this study is to determine the behavior of relative expression of Bcl-2, caspase-8, caspase-9, and caspase-3 genes of/in SK-MEL-3 cancer cells and explore molecular mechanisms responsible for the apoptosis response during an in vitro photodynamic therapy (PDT) with Zinc Phthalocyanine (ZnPc) using different doses of the light source. In this study, firstly the cytotoxic effects of ZnPc-PDT on SK-MEL-3 cells were evaluated. By irradiating the laser, ZnPc induced a significant amount of apoptosis on SK-MEL-3 cells in three IC 50 s including 0.064±0.01, 0.043±0.01, and 0.036±0.01μg/mL at the doses of 8, 16, and 24J/cm 2 , respectively. Moreover, flow cytometry and QRT-PCR experiments were done. The high percentage of apoptotic cells was seen in the early apoptosis stage. The expression of Bcl-2 and caspase-8 genes at all doses of laser experienced an obvious reduction in comparison to the control group. On the other hand, although the expression of caspase-9 and caspase-3 genes remains almost constant at 8J/cm 2 , but they faced an increment at 16 and 24J/cm 2 doses. These data reveal caspase-dependent apoptosis in high and caspase-independent apoptosis in low doses of laser. Based on the results of present work, it can be suggested that the dose of the light source is a key factor in induction of caspase-dependent and caspase-independent apoptosis pathways following PDT. Copyright © 2017. Published by Elsevier B.V.
Mass-to-light ratios of nearby groups of galaxies
Materne, J
1980-01-01
The application of a probability density function gives the possibility of determining groups of galaxies and membership probabilities of the galaxies in a reliable unbiased way. For the five nearest groups so defined, the mean mass-to-light ratio was derived using the concept of negative energy. These groups have a mass-to- light ratio of 16 M/sub (.)//L/sub (.)/. The probability function gives also the possibility of deriving masses of groups in a direct and independent way. (22 refs).
Herbivores and nutrients control grassland plant diversity via light limitation
Borer, Elizabeth T.; Seabloom, Eric W.; Gruner, Daniel S.; Harpole, W. Stanley; Hillebrand, Helmut; Lind, Eric M.; Alder, Peter B.; Alberti, Juan; Anderson, T. Michael; Bakker, Jonathan D.; Biederman, Lori; Blumenthal, Dana; Brown, Cynthia S.; Brudvig, Lars A.; Buckley, Yvonne M.; Cadotte, Marc; Chu, Cheng-Jin; Cleland, Elsa E.; Crawley, Michael J.; Daleo, Pedro; Damschen, Ellen Ingman; Davies, Kendi F.; DeCrappeo, Nicole M.; Du, Guozhen; Firn, Jennifer; Hautier, Yann; Heckman, Robert W.; Hector, Andy; HilleRisLambers, Janneke; Iribarne, Oscar; Klein, Julia A.; Knops, Johannes M.H.; La Pierre, Kimberly J.; Leakey, Andrew D.B.; Li, Wei; MacDougall, Andrew S.; McCulley, Rebecca L.; Melbourne, Brett A.; Mitchell, Charles E.; Moore, Joslin L.; Mortensen, Brent; O'Halloran, Lydia R.; Orrock, John L.; Pascual, Jesús; Prober, Suzanne M.; Pyke, David A.; Risch, Anita C.; Schuetz, Martin; Smith, Melinda D.; Stevens, Carly J.; Sullivan, Lauren L.; Williams, Ryan J.; Wragg, Peter D.; Wright, Justin P.; Yang, Louie H.
2014-01-01
Human alterations to nutrient cycles and herbivore communities are affecting global biodiversity dramatically. Ecological theory predicts these changes should be strongly counteractive: nutrient addition drives plant species loss through intensified competition for light, whereas herbivores prevent competitive exclusion by increasing ground-level light, particularly in productive systems. Here we use experimental data spanning a globally relevant range of conditions to test the hypothesis that herbaceous plant species losses caused by eutrophication may be offset by increased light availability due to herbivory. This experiment, replicated in 40 grasslands on 6 continents, demonstrates that nutrients and herbivores can serve as counteracting forces to control local plant diversity through light limitation, independent of site productivity, soil nitrogen, herbivore type and climate. Nutrient addition consistently reduced local diversity through light limitation, and herbivory rescued diversity at sites where it alleviated light limitation. Thus, species loss from anthropogenic eutrophication can be ameliorated in grasslands where herbivory increases ground-level light.
QCD Phenomenology and Light-Front Wave Functions
International Nuclear Information System (INIS)
Brodsky, St.J.
2001-01-01
A natural calculus for describing the bound-state structure of relativistic composite systems in quantum field theory is the light-front Fock expansion which encodes the properties of a hadrons in terms of a set of frame-independent n-particle wave functions. Light-front quantization in the doubly-transverse light-cone gauge has a number of remarkable advantages, including explicit unitarity, a physical Fock expansion, the absence of ghost degrees of freedom, and the decoupling properties needed to prove factorization theorems in high momentum transfer inclusive and exclusive reactions. A number of applications are discussed in these lectures, including semileptonic B decays, two-photon exclusive reactions, diffractive dissociation into jets, and deeply virtual Compton scattering. The relation of the intrinsic sea to the light-front wave functions is discussed. Light-front quantization can also be used in the Hamiltonian form to construct an event generator for high energy physics reactions at the amplitude level. The light-cone partition function, summed over exponentially-weighted light-cone energies, has simple boost properties which may be useful for studies in heavy ion collisions. I also review recent work which shows that the structure functions measured in deep inelastic lepton scattering are affected by final-state rescattering, thus modifying their connection to light-front probability distributions. In particular, the shadowing of nuclear structure functions is due to destructive interference effects from leading-twist diffraction of the virtual photon, physics not included in the nuclear light-cone wave functions. (author)
Zhou, Wenke; Zhao, Yicheng; Zhou, Xu; Fu, Rui; Li, Qi; Zhao, Yao; Liu, Kaihui; Yu, Dapeng; Zhao, Qing
2017-09-07
Due to light-induced effects in CH 3 NH 3 -based perovskites, such as ion migration, defects formation, and halide segregation, the degradation of CH 3 NH 3 -based perovskite solar cells under maximum power point is generally implicated. Here we demonstrated that the effect of light-enhanced ion migration in CH 3 NH 3 PbI 3 can be eliminated by inorganic Cs substitution, leading to an ultrastable perovskite solar cell. Quantitatively, the ion migration barrier for CH 3 NH 3 PbI 3 is 0.62 eV under dark conditions, larger than that of CsPbI 2 Br (0.45 eV); however, it reduces to 0.07 eV for CH 3 NH 3 PbI 3 under illumination, smaller than that for CsPbI 2 Br (0.43 eV). Meanwhile, photoinduced halide segregation is also suppressed in Cs-based perovskites. Cs-based perovskite solar cells retained >99% of the initial efficiency (10.3%) after 1500 h of maximum power point tracking under AM1.5G illumination, while CH 3 NH 3 PbI 3 solar cells degraded severely after 50 h of operation. Our work reveals an uncovered mechanism for stability improvement by inorganic cation substitution in perovskite-based optoelectronic devices.
Polarization-independent transparency window induced by complementary graphene metasurfaces
International Nuclear Information System (INIS)
Lu, Wei Bing; Liu, Ji Long; Zhang, Jin; Wang, Jian; Liu, Zhen Guo
2017-01-01
A fourfold symmetric graphene-based complementary metasurface featuring a polarization-independent transparency window is proposed and numerically analysed in this paper. The unit cell of the metamaterial consists of a monolayer graphene perforated with a cross and four identical split-ring resonators deposited on a substrate. Our analysis shows that the transparency window can be interpreted as a plasmonic analogy of Autler–Townes splitting. The polarization independence is achieved due to the fourfold symmetry of graphene’s complementary structure. In addition, the frequency range of the transparency window can be dynamically tuned over a broad band by changing the chemical potential of graphene, and the width of the transparency window can also be controlled by changing the split-gap orientation. This work may lead to potential applications in many area, such as slow-light devices and optical sensing. (paper)
International Nuclear Information System (INIS)
Brodsky, Stanley J.; de Teramond, Guy F.
2011-01-01
AdS/QCD, the correspondence between theories in a dilaton-modified five-dimensional anti-de Sitter space and confining field theories in physical space-time, provides a remarkable semiclassical model for hadron physics. Light-front holography allows hadronic amplitudes in the AdS fifth dimension to be mapped to frame-independent light-front wavefunctions of hadrons in physical space-time. The result is a single-variable light-front Schroedinger equation which determines the eigenspectrum and the light-front wavefunctions of hadrons for general spin and orbital angular momentum. The coordinate z in AdS space is uniquely identified with a Lorentz-invariant coordinate ζ which measures the separation of the constituents within a hadron at equal light-front time and determines the off-shell dynamics of the bound state wavefunctions as a function of the invariant mass of the constituents. The hadron eigenstates generally have components with different orbital angular momentum; e.g., the proton eigenstate in AdS/QCD with massless quarks has L = 0 and L = 1 light-front Fock components with equal probability. Higher Fock states with extra quark-anti quark pairs also arise. The soft-wall model also predicts the form of the nonperturbative effective coupling and its β-function. The AdS/QCD model can be systematically improved by using its complete orthonormal solutions to diagonalize the full QCD light-front Hamiltonian or by applying the Lippmann-Schwinger method to systematically include QCD interaction terms. Some novel features of QCD are discussed, including the consequences of confinement for quark and gluon condensates. A method for computing the hadronization of quark and gluon jets at the amplitude level is outlined.
Energy Technology Data Exchange (ETDEWEB)
Brodsky, Stanley J.; de Teramond, Guy F.; /SLAC /Southern Denmark U., CP3-Origins /Costa Rica U.
2011-01-10
AdS/QCD, the correspondence between theories in a dilaton-modified five-dimensional anti-de Sitter space and confining field theories in physical space-time, provides a remarkable semiclassical model for hadron physics. Light-front holography allows hadronic amplitudes in the AdS fifth dimension to be mapped to frame-independent light-front wavefunctions of hadrons in physical space-time. The result is a single-variable light-front Schroedinger equation which determines the eigenspectrum and the light-front wavefunctions of hadrons for general spin and orbital angular momentum. The coordinate z in AdS space is uniquely identified with a Lorentz-invariant coordinate {zeta} which measures the separation of the constituents within a hadron at equal light-front time and determines the off-shell dynamics of the bound state wavefunctions as a function of the invariant mass of the constituents. The hadron eigenstates generally have components with different orbital angular momentum; e.g., the proton eigenstate in AdS/QCD with massless quarks has L = 0 and L = 1 light-front Fock components with equal probability. Higher Fock states with extra quark-anti quark pairs also arise. The soft-wall model also predicts the form of the nonperturbative effective coupling and its {beta}-function. The AdS/QCD model can be systematically improved by using its complete orthonormal solutions to diagonalize the full QCD light-front Hamiltonian or by applying the Lippmann-Schwinger method to systematically include QCD interaction terms. Some novel features of QCD are discussed, including the consequences of confinement for quark and gluon condensates. A method for computing the hadronization of quark and gluon jets at the amplitude level is outlined.
RecA-independent resistance to irradiation with u.v. light in acid-habituated Escherichia coli
International Nuclear Information System (INIS)
Goodson, M.; Rowbury, R.J.
1991-01-01
Growth of Escherichia coli 1829 ColV, I-K94 at pH 5.0 led to an increase in u.v. resistance compared with cells grown at pH 7.0. This was due to a phenotypic change, since organisms grown at pH 7.0 showed increased resistance after only 2.5-5.0 min incubation at the mildly acid pH. Other E. coli K12 derivatives became more u.v.-resistant at pH 5.0 including uvrA, recA and polAl mutants. Organisms grown at pH 5.0 also showed increased Weigle reactivation of u.v. irradiated λ phage and this applied to the repair-deficient mutants as well as the parent strains. Both the increased u.v. resistance of acid-habituated cells and their increased ability to bring about Weigle reactivation appear to involve RecA-independent processes and are presumably, therefore, independent of the SOS response. (author)
Heavy-light fermion mixtures at unitarity
Energy Technology Data Exchange (ETDEWEB)
Gezerlis, Alexandros [Los Alamos National Laboratory; Carlson, Joseph [Los Alamos National Laboratory; Gandol, S [UNIV. ILL; Schmidt, E [ITALY
2009-01-01
We investigate fermion pairing in the unitary regime for a mass ratio corresponding to a {sup 6}Li-{sup 40}K mixture using quantum Monte Carlo methods. The ground-state energy and the average light- and heavy-particle excitation spectrum for the unpolarized superfluid state are nearly independent of the mass ratio. In the majority light system, the polarized superfluid is close to the energy of a phase separated mixture of nearly fully polarized normal and unpolarized superfluid. For a majority of heavy particles, we find an energy minimum for a normal state with a ratio of {approx}3:1 heavy to light particles. A slight increase in attraction to k{sub F}a{approx}2.5 yields a ground state energy of nearly zero for this ratio. A cold unpolarized system in a harmonic trap at unitarity should phase separate into three regions, with a shell of unpolarized superfluid in the middle.
Cloaks and antiobject-independent illusion optics based on illusion media
Li, Zhou; Zang, XiaoFei; Cai, Bin; Shi, Cheng; Zhu, YiMing
2013-11-01
Based on the transformation optics, we propose a new strategy of illusion media consisting of homogeneous and anisotropic materials. By utilizing the illusion media, invisible cloak is theoretically realized, in which objects covered with the illusion media could not be detected. The cloak here allows neither the propagation of light around the concealed region nor compensates the scattering field of object outside the media. What the cloak does is to shift the region into another place where outside the trace of light, so that objects in that region can disappear. Another application of the illusion media is to create the antiobject-independent illusion optics which means that two objects appear to be like some other objects of our choice. Finite element simulations for two-dimensional cases have been performed to prove these ideas.
ORF Alignment: NC_004757 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004757 gi|30248965 >1fgjA 1 499 25 523 0.0 ... ref|NP_842336.1| hydroxylamine oxid...oreductase [Nitrosomonas europaea ATCC 19718] ... ref|NP_842054.1| hydroxylamine oxidoreductase ... ... ... [Nitrosomonas europaea ATCC 19718] ref|NP_841035.1| ... hydroxylamine oxidoreductase [Nitrosomo...nas europaea ATCC ... 19718] emb|CAD85955.1| hydroxylamine oxidoreductase ... ... [Nitrosomonas europaea ATCC 19718] emb|CAD84873.1| ... hydroxylamine oxidoreductase [Nitro
ORF Alignment: NC_004757 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004757 gi|30250266 >1fgjA 1 499 25 523 0.0 ... ref|NP_842336.1| hydroxylamine oxid...oreductase [Nitrosomonas europaea ATCC 19718] ... ref|NP_842054.1| hydroxylamine oxidoreductase ... ... ... [Nitrosomonas europaea ATCC 19718] ref|NP_841035.1| ... hydroxylamine oxidoreductase [Nitrosomo...nas europaea ATCC ... 19718] emb|CAD85955.1| hydroxylamine oxidoreductase ... ... [Nitrosomonas europaea ATCC 19718] emb|CAD84873.1| ... hydroxylamine oxidoreductase [Nitro
ORF Alignment: NC_004757 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004757 gi|30249984 >1fgjA 1 499 25 523 0.0 ... ref|NP_842336.1| hydroxylamine oxid...oreductase [Nitrosomonas europaea ATCC 19718] ... ref|NP_842054.1| hydroxylamine oxidoreductase ... ... ... [Nitrosomonas europaea ATCC 19718] ref|NP_841035.1| ... hydroxylamine oxidoreductase [Nitrosomo...nas europaea ATCC ... 19718] emb|CAD85955.1| hydroxylamine oxidoreductase ... ... [Nitrosomonas europaea ATCC 19718] emb|CAD84873.1| ... hydroxylamine oxidoreductase [Nitro
Directory of Open Access Journals (Sweden)
Keith S Wong
Full Text Available MoxR ATPases are widespread throughout bacteria and archaea. The experimental evidence to date suggests that these proteins have chaperone-like roles in facilitating the maturation of dedicated protein complexes that are functionally diverse. In Escherichia coli, the MoxR ATPase RavA and its putative cofactor ViaA are found to exist in early stationary-phase cells at 37 °C at low levels of about 350 and 90 molecules per cell, respectively. Both proteins are predominantly localized to the cytoplasm, but ViaA was also unexpectedly found to localize to the cell membrane. Whole genome microarrays and synthetic lethality studies both indicated that RavA-ViaA are genetically linked to Fe-S cluster assembly and specific respiratory pathways. Systematic analysis of mutant strains of ravA and viaA indicated that RavA-ViaA sensitizes cells to sublethal concentrations of aminoglycosides. Furthermore, this effect was dependent on RavA's ATPase activity, and on the presence of specific subunits of NADH:ubiquinone oxidoreductase I (Nuo Complex, or Complex I. Importantly, both RavA and ViaA were found to physically interact with specific Nuo subunits. We propose that RavA-ViaA facilitate the maturation of the Nuo complex.
Bounds on an Energy-Dependent and Observer-Independent Speed of Light from Violations of Locality
International Nuclear Information System (INIS)
Hossenfelder, Sabine
2010-01-01
We show that models with deformations of special relativity that have an energy-dependent speed of light have nonlocal effects. The requirement that the arising nonlocality is not in conflict with known particle physics allows us to derive strong bounds on deformations of special relativity and rule out a modification to first order in energy over the Planck mass.
Scotland as an Independent Small State: Where would it seek shelter?
Directory of Open Access Journals (Sweden)
Alyson J.K. Bailes
2013-06-01
Full Text Available A planned referendum in 2014 on Scottish independence gives cause to examine that scenario in the light of small state studies and recent European experience. One of the best-supported assumptions in small state literature is that small countries need to form alliances and seek protection from larger neighboring states and/or international institutions. Small European states have generally sought shelter from the European Union (EU and NATO. This study confirms that an independent Scotland would need strategic, political, economic and societal shelter, and could look for the various elements within existing European institutions, from its closest southern and northern neightbours, and from the US. However, protection may come with a certain cost - just as union with another entity does at present.
Coral photobiology: new light on old views.
Iluz, David; Dubinsky, Zvy
2015-04-01
The relationship between reef-building corals and light-harvesting pigments of zooxanthellae (Symbiodinium sp.) has been acknowledged for decades. The photosynthetic activity of the algal endocellular symbionts may provide up to 90% of the energy needed for the coral holobiont. This relationship limits the bathymetric distribution of coral reefs to the upper 100 m of tropical shorelines. However, even corals growing under high light intensities have to supplement the photosynthates translocated from the algae by predation on nutrient-rich zooplankton. New information has revealed how the fate of carbon acquired through photosynthesis differs from that secured by predation, whose rates are controlled by light-induced tentacular extension. The Goreau paradigm of "light-enhanced calcification" is being reevaluated, based on evidence that blue light stimulates coral calcification independently from photosynthesis rates. Furthermore, under dim light, calcification rates were stoichiometrically uncoupled from photosynthesis. The rates of photosynthesis of the zooxanthellae exhibit a clear endogenous rhythmicity maintained by light patterns. This daily pattern is concomitant with a periodicity of all the antioxidant protective mechanisms that wax and wane to meet the concomitant fluctuation in oxygen evolution. The phases of the moon are involved in the triggering of coral reproduction and control the spectacular annual mass-spawning events taking place in several reefs. The intensity and directionality of the underwater light field affect the architecture of coral colonies, leading to an optimization of the exposure of the zooxanthellae to light. We present a summary of major gaps in our understanding of the relationship between light and corals as a roadmap for future research. Copyright © 2014 Elsevier GmbH. All rights reserved.
DEFF Research Database (Denmark)
Hjorth, Mads F.; Sørensen, Louise B.; Andersen, Rikke
2016-01-01
% of expected learning within one school year (P breakfast consumption, fewer sleep problems, higher CRF, less total physical activity, more sedentary time, and less light physical activity were associated with higher cognitive performance independently of each other in at least one of the three...
Light and noise pollution interact to disrupt interspecific interactions.
McMahon, Taegan A; Rohr, Jason R; Bernal, Ximena E
2017-05-01
Studies on the consequences of urbanization often examine the effects of light, noise, and heat pollution independently on isolated species providing a limited understanding of how these combined stressors affect species interactions. Here, we investigate how these factors interact to affect parasitic frog-biting midges (Corethrella spp.) and their túngara frog (Engystomops pustulosus) hosts. A survey of túngara frog calling sites revealed that frog abundance was not significantly correlated with urbanization, light, noise, or temperature. In contrast, frog-biting midges were sensitive to light pollution and noise pollution. Increased light intensity significantly reduced midge abundance at low noise levels. At high noise intensity, there were no midges regardless of light level. Two field experiments controlling light and noise levels to examine attraction of the midges to their host and their feeding behavior confirmed the causality of these field patterns. These findings demonstrate that both light and noise pollution disrupt this host-parasite interaction and highlight the importance of considering interactions among species and types of pollutants to accurately assess the impacts of urbanization on ecological communities. © 2017 by the Ecological Society of America.
Dependence of electromagnetic form factors of hadrons on light-cone frames
International Nuclear Information System (INIS)
Weber, H.J.; Xu Xiaoming; Chinese Acad. of Sci., Shanghai
1996-01-01
A constituent quark model is developed for an arbitrary light-cone direction so that the light-front time is x LF + =ω.x with a constant lightlike four-vector ω. Form factors are obtained from free one-body electromagnetic current matrix elements. They are found to be ω-independent for spin-0 mesons, nucleons and the Λ-hyperon, while there is an ω-dependence for spin-1 systems like the deuteron. (orig.)
Miller, E. N.; Jarboe, L. R.; Yomano, L. P.; York, S. W.; Shanmugam, K. T.; Ingram, L. O.
2009-01-01
Low concentrations of furfural are formed as a side product during the dilute acid hydrolysis of hemicellulose. Growth is inhibited by exposure to furfural but resumes after the complete reduction of furfural to the less toxic furfuryl alcohol. Growth-based selection was used to isolate a furfural-resistant mutant of ethanologenic Escherichia coli LY180, designated strain EMFR9. Based on mRNA expression levels in the parent and mutant in response to furfural challenge, genes encoding 12 oxidoreductases were found to vary by more than twofold (eight were higher in EMFR9; four were higher in the parent). All 12 genes were cloned. When expressed from plasmids, none of the eight genes in the first group increased furfural tolerance in the parent (LY180). Expression of three of the silenced genes (yqhD, dkgA, and yqfA) in EMFR9 was found to decrease furfural tolerance compared to that in the parent. Purified enzymes encoded by yqhD and dkgA were shown to have NADPH-dependent furfural reductase activity. Both exhibited low Km values for NADPH (8 μM and 23 μM, respectively), similar to those of biosynthetic reactions. Furfural reductase activity was not associated with yqfA. Deleting yqhD and dkgA in the parent (LY180) increased furfural tolerance, but not to the same extent observed in the mutant EMFR9. Together, these results suggest that the process of reducing furfural by using an enzyme with a low Km for NADPH rather than a direct inhibitory action is the primary cause for growth inhibition by low concentrations of furfural. PMID:19429550
Goss, Tatjana; Hanke, Guy
2014-01-01
At the end of the linear photosynthetic electron transfer (PET) chain, the small soluble protein ferredoxin (Fd) transfers electrons to Fd:NADP(H) oxidoreductase (FNR), which can then reduce NADP+ to support C assimilation. In addition to this linear electron flow (LEF), Fd is also thought to mediate electron flow back to the membrane complexes by different cyclic electron flow (CEF) pathways: either antimycin A sensitive, NAD(P)H complex dependent, or through FNR located at the cytochrome b6f complex. Both Fd and FNR are present in higher plant genomes as multiple gene copies, and it is now known that specific Fd iso-proteins can promote CEF. In addition, FNR iso-proteins vary in their ability to dynamically interact with thylakoid membrane complexes, and it has been suggested that this may also play a role in CEF. We will highlight work on the different Fd-isoproteins and FNR-membrane association found in the bundle sheath (BSC) and mesophyll (MC) cell chloroplasts of the C4 plant maize. These two cell types perform predominantly CEF and LEF, and the properties and activities of Fd and FNR in the BSC and MC are therefore specialized for CEF and LEF respectively. A diversity of Fd isoproteins and dynamic FNR location has also been recorded in C3 plants, algae and cyanobacteria. This indicates that the principles learned from the extreme electron transport situations in the BSC and MC of maize might be usefully applied to understanding the dynamic transition between these states in other systems. PMID:24678667
Impact of light on Hypocrea jecorina and the multiple cellular roles of ENVOY in this process
Directory of Open Access Journals (Sweden)
Druzhinina Irina S
2007-12-01
Full Text Available Abstract Background In fungi, light is primarily known to influence general morphogenesis and both sexual and asexual sporulation. In order to expand the knowledge on the effect of light in fungi and to determine the role of the light regulatory protein ENVOY in the implementation of this effect, we performed a global screen for genes, which are specifically effected by light in the fungus Hypocrea jecorina (anamorph Trichoderma reesei using Rapid Subtraction Hybridization (RaSH. Based on these data, we analyzed whether these genes are influenced by ENVOY and if overexpression of ENVOY in darkness would be sufficient to execute its function. Results The cellular functions of the detected light responsive genes comprised a variety of roles in transcription, translation, signal transduction, metabolism, and transport. Their response to light with respect to the involvement of ENVOY could be classified as follows: (i ENVOY-mediated upregulation by light; (ii ENVOY-independent upregulation by light; (iii ENVOY-antagonized upregulation by light; ENVOY-dependent repression by light; (iv ENVOY-independent repression by light; and (v both positive and negative regulation by ENVOY of genes not responsive to light in the wild-type. ENVOY was found to be crucial for normal growth in light on various carbon sources and is not able to execute its regulatory function if overexpressed in the darkness. Conclusion The different responses indicate that light impacts fungi like H. jecorina at several cellular processes, and that it has both positive and negative effects. The data also emphasize that ENVOY has an apparently more widespread cellular role in this process than only in modulating the response to light.
A Stroboscopic Light Source for Experiments in Mechanics
Mayer, V. V.; Varaksina, E. I.
2017-01-01
We propose to attach a small stroboscopic light source to a moving object and connect the source to a pulse generator with the help of insulated thin flexible multi-cored wires. Students can assemble such a device independently in a school laboratory. The device can be used to obtain trajectories with time marks in students' research projects in…
On the nature of directed behavior to drug-associated light cues in rhesus monkeys (Macaca mulatta).
Reilly, Mark P; Berndt, Sonja I; Woods, James H
2016-11-01
The present study investigated the role of drug-paired stimuli in controlling the behavior of rhesus monkeys. Systematic observations were made with nine monkeys who had a history of drug self-administration; they had been lever pressing to produce intravenous infusions of various drugs. These observations revealed that the stimulus light co-occurring with drug infusion produced robust and cue-directed behavior such as orienting, touching and biting. Experiment 1 showed that this light-directed behavior would occur in naïve monkeys exposed to a Pavlovian pairing procedure. Four monkeys were given response-independent injections of cocaine. In two monkeys, a red light preceded cocaine injections by 5 s, and a green light co-occurred with the 5-s cocaine injections. In the other two monkeys, the light presentations and cocaine injections occurred independently. Light-directed behavior occurred in all four monkeys within the first couple of trials and at high levels but decreased across sessions. The cocaine-paired stimulus maintained behavior longer and at higher levels than the uncorrelated stimuli. Furthermore, light-directed behavior was not maintained when cocaine was replaced with saline. Light-directed behavior did not occur in the absence of the lights. When these monkeys were subsequently trained to lever press for cocaine, light-directed behavior increased to levels higher than previously observed. Behavior directed towards drug-paired stimuli is robust, reliable and multiply determined; the mechanisms underlying this activity likely include Pavlovian conditioning, stimulus novelty, habituation and operant conditioning.
Role of xanthine oxidoreductase in the anti-thrombotic effects of nitrite in rats in vivo.
Kramkowski, K; Leszczynska, A; Przyborowski, K; Kaminski, T; Rykaczewska, U; Sitek, B; Zakrzewska, A; Proniewski, B; Smolenski, R T; Chabielska, E; Buczko, W; Chlopicki, S
2016-01-01
The mechanisms underlying nitrite-induced effects on thrombosis and hemostasis in vivo are not clear. The goal of the work described here was to investigate the role of xanthine oxidoreductase (XOR) in the anti-platelet and anti-thrombotic activities of nitrite in rats in vivo. Arterial thrombosis was induced electrically in rats with renovascular hypertension by partial ligation of the left renal artery. Sodium nitrite (NaNO2, 0.17 mmol/kg twice daily for 3 days, p.o) was administered with or without one of the XOR-inhibitors: allopurinol (ALLO) and febuxostat (FEB) (100 and 5 mg/kg, p.o., for 3 days). Nitrite treatment (0.17 mmol/kg), which was associated with a significant increase in NOHb, nitrite/nitrate plasma concentration, resulted in a substantial decrease in thrombus weight (TW) (0.48 ± 0.03 mg vs. vehicle [VEH] 0.88 ± 0.08 mg, p < 0.001) without a significant hypotensive effect. The anti-thrombotic effect of nitrite was partially reversed by FEB (TW = 0.63 ± 0.06 mg, p < 0.05 vs. nitrites), but not by ALLO (TW = 0.43 ± 0.02 mg). In turn, profound anti-platelet effect of nitrite measured ex vivo using collagen-induced whole-blood platelet aggregation (70.5 ± 7.1% vs. VEH 100 ± 4.5%, p < 0.05) and dynamic thromboxaneB2 generation was fully reversed by both XOR-inhibitors. In addition, nitrite decreased plasminogen activator inhibitor-1 concentration (0.47 ± 0.13 ng/ml vs. VEH 0.62 ± 0.04 ng/ml, p < 0.05) and FEB/ALLO reversed this effect. In vitro the anti-platelet effect of nitrite (1 mM) was reversed by FEB (0.1 mM) under hypoxia (0.5%O2) and normoxia (20%O2). Nitrite treatment had no effect on coagulation parameters. In conclusion, the nitrite-induced anti-platelet effect in rats in vivo is mediated by XOR, but XOR does not fully account for the anti-thrombotic effects of nitrite.
QCD and Light-Front Holography
Energy Technology Data Exchange (ETDEWEB)
Brodsky, Stanley J.; /SLAC /Southern Denmark U., CP3-Origins; de Teramond, Guy F.; /Costa Rica U.
2010-10-27
The soft-wall AdS/QCD model, modified by a positive-sign dilaton metric, leads to a remarkable one-parameter description of nonperturbative hadron dynamics. The model predicts a zero-mass pion for zero-mass quarks and a Regge spectrum of linear trajectories with the same slope in the leading orbital angular momentum L of hadrons and the radial quantum number N. Light-Front Holography maps the amplitudes which are functions of the fifth dimension variable z of anti-de Sitter space to a corresponding hadron theory quantized on the light front. The resulting Lorentz-invariant relativistic light-front wave equations are functions of an invariant impact variable {zeta} which measures the separation of the quark and gluonic constituents within the hadron at equal light-front time. The result is to a semi-classical frame-independent first approximation to the spectra and light-front wavefunctions of meson and baryon light-quark bound states, which in turn predict the behavior of the pion and nucleon form factors. The theory implements chiral symmetry in a novel way: the effects of chiral symmetry breaking increase as one goes toward large interquark separation, consistent with spectroscopic data, and the the hadron eigenstates generally have components with different orbital angular momentum; e.g., the proton eigenstate in AdS/QCD with massless quarks has L = 0 and L = 1 light-front Fock components with equal probability. The soft-wall model also predicts the form of the non-perturbative effective coupling {alpha}{sub s}{sup AdS} (Q) and its {beta}-function which agrees with the effective coupling {alpha}{sub g1} extracted from the Bjorken sum rule. The AdS/QCD model can be systematically improved by using its complete orthonormal solutions to diagonalize the full QCD light-front Hamiltonian or by applying the Lippmann-Schwinger method in order to systematically include the QCD interaction terms. A new perspective on quark and gluon condensates is also reviewed.
Light transmittance under diffuse radiation circumstances
International Nuclear Information System (INIS)
Kieboom, A.M.G. van den; Stoffers, J.A.
1985-01-01
For a grower it is important to know the light transmittance of a greenhouse. With this date (and many others) he is able to make a decision about which greenhouse and covering is the most economical in his situation. It is absolute impossible for a grower to use figures that are functions of: • the orientation of the greenhouse, • the relation between direct and global radiation, • the amount of radiation, etc. • He needs one comparable figure. As a comparable figure for light transmittance of a greenhouse we use the transmittance factor that is estimated with a diffuse radiation source. This figure will be the same as the mean transmittance over one year for that greenhouse, even with extreme direct radiation and independent of the orientation of the greenhouse. (author)
Wide frequency independently controlled dual-band inkjet-printed antenna
AbuTarboush, Hattan F.
2014-01-08
A low-cost inkjet-printed multiband monopole antenna is presented. The unique advantage of the proposed antenna is the freedom to adjust and set the dual-band of the antenna independently over a wide range (148.83%). To demonstrate the independent control feature, the 2.4 and 3.4 GHz bands for the wireless local area network (WLAN) and worldwide interoperability for microwave access (WiMAX) applications are selected as an example. The measured impedance bandwidths for the 2.4 and 3.4 GHz are 15.2 and 23.7%, respectively. These dual-bands have the ability to be controlled independently between 1.1 and 7.5 GHz without affecting the other band. In addition, the proposed antenna can be assigned for different mobile and wireless applications such as GPS, PCS, GSM 1800, 1900, UMTS, and up to 5-GHz WLAN and WiMAX applications. The mechanism of independent control of each radiator through dimensional variation is discussed in detail. The antenna has a compact size of 10 × 37.3 × 0.44 mm3, leaving enough space for the driving electronics on the paper substrate. The measured results from the prototype are in good agreement with the simulated results. Owing to inkjet printing on an ordinary paper, the design is extremely light weight and highly suitable for low cost and large volume manufacturing. © The Institution of Engineering and Technology 2013.
Abiko, Seiya
2005-01-01
Einstein, who had already developed the light-quantum theory, knew the inadequacy of Maxwell's theory in the microscopic sphere. Therefore, in writing his paper on special relativity, he had to set up the light-velocity postulate independently of the relativity postulate in order to make the electromagnetic foundation of physics compatible with…
Length Contraction Should not be Independent of Time
Smarandache, Florentin
2013-10-01
In Special Theory of Relativity it looks that the length contraction along the direction of the motion is independent of time, i.e. if a rocket flies one second, or the rocket flies one year the rocket's along-the-motion length contraction is the same, since the contraction factor C (v) =√{ 1 -v2/c2 } depends on the rocket's relativistic speed (v) and on the light speed in vacuum (c) only. We find this as unrealistic, incomplete. It is logical that flying more and more it should increase the length contraction. What about the cosmic bodies that continuously travel, do they contract only once or are they continuously contracting?
WOW: light print, light propel, light point
DEFF Research Database (Denmark)
Glückstad, Jesper; Bañas, Andrew Rafael; Aabo, Thomas
2012-01-01
anywhere in a sample at any orientation using real-time 3D optical micromanipulation with six degrees of freedom. One of the key aspects of our demonstrated WOWs is the change in direction of in-coupled light and the marked increase in numerical aperture of the out-coupled light. Hence, each light...... propelled WOW can tap from a relatively broad incident beam and generate a much more tightly confined light at its tip. The presentation contains both numerical simulations related to the propagation of light through a WOW and preliminary experimental demonstrations on our BioPhotonics Workstation...
Fast imaging of live organisms with sculpted light sheets
Chmielewski, Aleksander K.; Kyrsting, Anders; Mahou, Pierre; Wayland, Matthew T.; Muresan, Leila; Evers, Jan Felix; Kaminski, Clemens F.
2015-04-01
Light-sheet microscopy is an increasingly popular technique in the life sciences due to its fast 3D imaging capability of fluorescent samples with low photo toxicity compared to confocal methods. In this work we present a new, fast, flexible and simple to implement method to optimize the illumination light-sheet to the requirement at hand. A telescope composed of two electrically tuneable lenses enables us to define thickness and position of the light-sheet independently but accurately within milliseconds, and therefore optimize image quality of the features of interest interactively. We demonstrated the practical benefit of this technique by 1) assembling large field of views from tiled single exposure each with individually optimized illumination settings; 2) sculpting the light-sheet to trace complex sample shapes within single exposures. This technique proved compatible with confocal line scanning detection, further improving image contrast and resolution. Finally, we determined the effect of light-sheet optimization in the context of scattering tissue, devising procedures for balancing image quality, field of view and acquisition speed.
The origin of the infrared light of cataclysmic variable stars
International Nuclear Information System (INIS)
Berriman, G.; Szkody, P.; Capps, R.W.
1985-01-01
This paper presents a model-independent overview of the origin of the near infrared (1-2 μm) light of a sample of 28 cataclysmic binary stars, largely dwarf novae in quiescence. The infrared light comes from the red dwarf that supplies matter to the white dwarf companion and the accretion disc around the white dwarf. The complex nature of the disc prevents near-infrared photometry from being a good probe of the red dwarfs, even in those systems where they are seen in the visual. All that can be found reliably is an upper limit to the proportion light that the red dwarfs supply, and consequently lower limits to the distances to the systems. The infrared light of the discs comes from opaque material and from the optically thin gas that gives rise to the visual and UV emission lines. (author)
Chiral symmetry and dispersion relations: from $\\pi \\pi$ scattering to hadronic light-by-light.
CERN. Geneva
2018-01-01
Chiral symmetry provides strong constraints on hadronic matrix elements at low energy, which are most efficiently derived with chiral perturbation theory. As an effective quantum field theory the latter also accounts for rescattering or unitarity effects, albeit only perturbatively, via the loop expansion. In cases where rescattering effects are important it becomes necessary to go beyond the perturbative expansion, e.g. by using dispersion relations. A matching between the chiral and the dispersive representation provides in several cases results of high precision. I will discuss this approach with the help of a few examples, like $\\pi \\pi$ scattering (which has been tested successfully by CERN experiments like NA48/2 and DIRAC), $\\eta \\to 3 \\pi$ and the hadronic light-by-light contribution to $(g-2)_\\mu$. For the latter quantity the implementation of the dispersive approach has opened up the way to a model-independent calculation and the concrete possibility to significantly reduce the theoretical uncertain...
Architecture independent environment for developing engineering software on MIMD computers
Valimohamed, Karim A.; Lopez, L. A.
1990-01-01
Engineers are constantly faced with solving problems of increasing complexity and detail. Multiple Instruction stream Multiple Data stream (MIMD) computers have been developed to overcome the performance limitations of serial computers. The hardware architectures of MIMD computers vary considerably and are much more sophisticated than serial computers. Developing large scale software for a variety of MIMD computers is difficult and expensive. There is a need to provide tools that facilitate programming these machines. First, the issues that must be considered to develop those tools are examined. The two main areas of concern were architecture independence and data management. Architecture independent software facilitates software portability and improves the longevity and utility of the software product. It provides some form of insurance for the investment of time and effort that goes into developing the software. The management of data is a crucial aspect of solving large engineering problems. It must be considered in light of the new hardware organizations that are available. Second, the functional design and implementation of a software environment that facilitates developing architecture independent software for large engineering applications are described. The topics of discussion include: a description of the model that supports the development of architecture independent software; identifying and exploiting concurrency within the application program; data coherence; engineering data base and memory management.
The social basis of separatism: explaining support for the Puerto Rican Independence Movement
Directory of Open Access Journals (Sweden)
Astrid Arrarás
2007-12-01
Full Text Available In the 1990s, particularly in the wake of the fall of the Soviet Union, comparativists rediscovered the enduring appeal of separatist movements around the globe. Many of the most significant political events of the past decade have revolved around issues of nationalism, ethnicity, irredenta, and the like. In light of these renewed preoccupations, it is surprising that U.S. scholars have largely ignored a nationalist movement closer to home. The Puerto Rican independence movement is by far the most significant separatist tendency under the U.S. flag, and is one of the few major anticolonialist movements to survive into the twenty-first century. Although supporters of Puerto Rican independence have typically drawn only three to five percent support in local elections and in plebiscites on the island’s political status, neither have they disappeared from the political scene. The remarkable durability of the independence movement demands systematic explanation. However, as strange as it may seem, to date there have been no serious scholarly studies of the social bases of the Puerto Rican independence movement.
Gayam, Srivardhan Reddy; Venkatesan, Parthiban; Sung, Yi-Ming; Sung, Shuo-Yuan; Hu, Shang-Hsiu; Hsu, Hsin-Yun; Wu, Shu-Pao
2016-06-01
The synthesis and characterization of an NAD(P)H:quinone oxidoreductase 1 (NQO1) enzyme responsive nanocarrier based on mesoporous silica nanoparticles (MSNPs) for on-command delivery applications has been described in this paper. Gatekeeping of MSNPs is achieved by the integration of mechanically interlocked rotaxane nanovalves on the surface of MSNPs. The rotaxane nanovalve system is composed of a linear stalk anchoring on the surface of MSNPs, an α-cyclodextrin ring that encircles it and locks the payload ``cargo'' molecules in the mesopores, and a benzoquinone stopper incorporated at the end of the stalk. The gate opening and controlled release of the cargo are triggered by cleavage of the benzoquinone stopper using an endogenous NQO1 enzyme. In addition to having efficient drug loading and controlled release mechanisms, this smart biocompatible carrier system showed obvious uptake and consequent release of the drug in tumor cells, could selectively induce the tumor cell death and enhance the capability of inhibition of tumor growth in vivo. The controlled drug delivery system demonstrated its use as a potential theranostic material.The synthesis and characterization of an NAD(P)H:quinone oxidoreductase 1 (NQO1) enzyme responsive nanocarrier based on mesoporous silica nanoparticles (MSNPs) for on-command delivery applications has been described in this paper. Gatekeeping of MSNPs is achieved by the integration of mechanically interlocked rotaxane nanovalves on the surface of MSNPs. The rotaxane nanovalve system is composed of a linear stalk anchoring on the surface of MSNPs, an α-cyclodextrin ring that encircles it and locks the payload ``cargo'' molecules in the mesopores, and a benzoquinone stopper incorporated at the end of the stalk. The gate opening and controlled release of the cargo are triggered by cleavage of the benzoquinone stopper using an endogenous NQO1 enzyme. In addition to having efficient drug loading and controlled release mechanisms, this
Directory of Open Access Journals (Sweden)
Lauren Davey
Full Text Available Streptococcus gordonii is a commensal inhabitant of human oral biofilms. Previously, we identified an enzyme called SdbA that played an important role in biofilm formation by S. gordonii. SdbA is thiol-disulfide oxidoreductase that catalyzes disulfide bonds in secreted proteins. Surprisingly, inactivation of SdbA results in enhanced biofilm formation. In this study we investigated the basis for biofilm formation by the ΔsdbA mutant. The results revealed that biofilm formation was mediated by the interaction between the CiaRH and ComDE two-component signalling systems. Although it did not affect biofilm formation by the S. gordonii parent strain, CiaRH was upregulated in the ΔsdbA mutant and it was essential for the enhanced biofilm phenotype. The biofilm phenotype was reversed by inactivation of CiaRH or by the addition of competence stimulating peptide, the production of which is blocked by CiaRH activity. Competition assays showed that the enhanced biofilm phenotype also corresponded to increased oral colonization in mice. Thus, the interaction between SdbA, CiaRH and ComDE affects biofilm formation both in vitro and in vivo.
Energy Technology Data Exchange (ETDEWEB)
Freitag, Patricia; Reineke, Sebastian; Furno, Mauro; Luessem, Bjoern; Leo, Karl [Institut fuer Angewandte Photophysik, TU Dresden (Germany)
2010-07-01
The demand for highly efficient and energy saving illumination has increased considerably during the last decades. Organic light emitting diodes (OLEDs) are promising candidates for future lighting technologies. They offer high efficiency along with excellent color quality, allowing substantially lower power consumption than traditional illuminants. Recently, especially top-emitting devices have attracted high interest due to their compatibility with opaque substrates like metal sheets. In this contribution, we demonstrate top-emitting OLEDs with white emission spectra employing a multilayer hybrid cavity structure with two highly efficient phosphorescent emitter materials for orange-red (Ir(MDQ)2(acac)) and green (Ir(ppy)3) emission as well as the stable fluorescent blue emitter TBPe. To improve the OLED performance and modify the color quality, two different electron blocking layers and anode material combinations are tested. Compared to Lambertian emission, our devices show considerably enhanced forward emission, which is preferred for most lighting applications. Besides broadband emission and angle independent emission maxima, power efficiencies of 13.3 lm/W at 3 V and external quantum efficiencies of 5.3% are achieved. The emission shows excellent CIE coordinates of (0.420,0.407) at approx. 1000 cd/m{sup 2} and color rendering indices up to 77.
Thick filament mechano-sensing is a calcium-independent regulatory mechanism in skeletal muscle.
Fusi, L; Brunello, E; Yan, Z; Irving, M
2016-10-31
Recent X-ray diffraction studies on actively contracting fibres from skeletal muscle showed that the number of myosin motors available to interact with actin-containing thin filaments is controlled by the stress in the myosin-containing thick filaments. Those results suggested that thick filament mechano-sensing might constitute a novel regulatory mechanism in striated muscles that acts independently of the well-known thin filament-mediated calcium signalling pathway. Here we test that hypothesis using probes attached to the myosin regulatory light chain in demembranated muscle fibres. We show that both the extent and kinetics of thick filament activation depend on thick filament stress but are independent of intracellular calcium concentration in the physiological range. These results establish direct control of myosin motors by thick filament mechano-sensing as a general regulatory mechanism in skeletal muscle that is independent of the canonical calcium signalling pathway.
10 CFR 490.203 - Light Duty Alternative Fueled Vehicle Plan.
2010-01-01
... Efficiency and Renewable Energy, EE-33, 1000 Independence Ave., SW., Washington, DC 20585, or to such other... 10 Energy 3 2010-01-01 2010-01-01 false Light Duty Alternative Fueled Vehicle Plan. 490.203 Section 490.203 Energy DEPARTMENT OF ENERGY ENERGY CONSERVATION ALTERNATIVE FUEL TRANSPORTATION PROGRAM...
Energy Technology Data Exchange (ETDEWEB)
Shtykov, N. M., E-mail: nshtykov@mail.ru; Palto, S. P.; Umanskii, B. A. [Russian Academy of Sciences, Shubnikov Institute of Crystallography (Russian Federation)
2013-08-15
We report on the results of calculating the conditions for light generation in cholesteric liquid crystals doped with fluorescent dyes using kinetic equations. Specific features of spectral properties of the chiral cholesteric medium as a photonic structure and spatially distributed type of the feedback in the active medium are taken into account. The expression is derived for the threshold pump radiation intensity as a function of the dye concentration and sample thickness. The importance of taking into account the distributed loss level in the active medium for calculating the optimal parameters of the medium and for matching the calculated values with the results of experiments is demonstrated.
Energy Technology Data Exchange (ETDEWEB)
Patel, Ananddeep; Zhang, Shaojie; Shrestha, Amrit Kumar; Maturu, Paramahamsa; Moorthy, Bhagavatula; Shivanna, Binoy, E-mail: shivanna@bcm.edu
2016-11-15
Omeprazole (OM) is an aryl hydrocarbon receptor (AhR) agonist and a proton pump inhibitor that is used to treat humans with gastric acid related disorders. Recently, we showed that OM induces NAD (P) H quinone oxidoreductase-1 (NQO1) via nuclear factor erythroid 2-related factor 2 (Nrf2)-dependent mechanism. Heme oxygenase-1 (HO-1) is another cytoprotective and antioxidant enzyme that is regulated by Nrf2. Whether OM induces HO-1 in fetal human pulmonary microvascular endothelial cells (HPMEC) is unknown. Therefore, we tested the hypothesis that OM will induce HO-1 expression via Nrf2 in HPMEC. OM induced HO-1 mRNA and protein expression in a dose-dependent manner. siRNA-mediated knockdown of AhR failed to abrogate, whereas knockdown of Nrf2 abrogated HO-1 induction by OM. To identify the underlying molecular mechanisms, we determined the effects of OM on cellular hydrogen peroxide (H{sub 2}O{sub 2}) levels since oxidative stress mediated by the latter is known to activate Nrf2. Interestingly, the concentration at which OM induced HO-1 also increased H{sub 2}O{sub 2} levels. Furthermore, H{sub 2}O{sub 2} independently augmented HO-1 expression. Although N-acetyl cysteine (NAC) significantly decreased H{sub 2}O{sub 2} levels in OM-treated cells, we observed that OM further increased HO-1 mRNA and protein expression in NAC-pretreated compared to vehicle-pretreated cells, suggesting that OM induces HO-1 via H{sub 2}O{sub 2}-independent mechanisms. In conclusion, we provide evidence that OM transcriptionally induces HO-1 via AhR - and H{sub 2}O{sub 2} - independent, but Nrf2 - dependent mechanisms. These results have important implications for human disorders where Nrf2 and HO-1 play a beneficial role. - Highlights: • Omeprazole induces HO-1 in human fetal lung cells. • AhR deficiency fails to abrogate omeprazole-mediated induction of HO-1. • Nrf2 knockdown abrogates omeprazole-mediated HO-1 induction in human lung cells. • Hydrogen peroxide depletion augments
Pump-probe nonlinear magneto-optical rotation with frequency-modulated light
International Nuclear Information System (INIS)
Pustelny, S.; Gawlik, W.; Jackson Kimball, D. F.; Rochester, S. M.; Yashchuk, V. V.; Budker, D.
2006-01-01
Specific types of atomic coherences between Zeeman sublevels can be generated and detected using a method based on nonlinear magneto-optical rotation with frequency-modulated light. Linearly polarized, frequency-modulated light is employed to selectively generate ground-state coherences between Zeeman sublevels for which Δm=2 and Δm=4 in 85 Rb and 87 Rb atoms, and additionally Δm=6 in 85 Rb. The atomic coherences are detected with a separate, unmodulated probe light beam. Separation of the pump and probe beams enables independent investigation of the processes of creation and detection of the atomic coherences. With the present technique the transfer of the Zeeman coherences, including high-order coherences, from excited to ground state by spontaneous emission has been observed
Dark Matter in Light of the LUX Results
Energy Technology Data Exchange (ETDEWEB)
Fox, Patrick J. [Fermilab; Jung, Gabriel [Fermilab; Sorensen, Peter [LLNL, Livermore; Weiner, Neal [New York U.
2014-05-22
The landscape of dark matter direct detection has been profoundly altered by the slew of recent experiments. While some have claimed signals consistent with dark matter, others have seen few, if any, events consistent with dark matter. The results of the putative detections are often incompatible with each other in the context of naive spin-independent scattering, as well as with the null results. In particular, in light of the conflicts between the DM interpretation of the three events recently reported by the CDMS-Si experiment and the first results of the LUX experiment, there is a strong need to revisit the assumptions that go into the DM interpretations of both signals and limits. We attempt to reexamine a number of particle physics, astrophysics and experimental uncertainties. Specifically, we examine exothermic scattering, isospin-dependent couplings, modified halo models through astrophysics independent techniques, and variations in the assumptions about the scintillation light in liquid Xenon. We find that only a highly tuned isospin-dependent scenario remains as a viable explanation of the claimed detections, unless the scintillation properties of LXe are dramatically different from the assumptions used by the LUX experiment.
van Meeningen, Ylva; Schurgers, Guy; Rinnan, Riikka; Holst, Thomas
2017-09-01
Light is an important environmental factor controlling biogenic volatile organic compound (BVOC) emissions, but in natural conditions its impact is hard to separate from other influential factors such as temperature. We studied the light response of foliar BVOC emissions, photosynthesis and stomatal conductance on three common European tree species, namely English oak (Quercus robur), European beech (Fagus sylvatica) and two provenances of Norway spruce (Picea abies) in Taastrup, Denmark. Leaf scale measurements were performed on the lowest positioned branches of the tree in July 2015. Light intensity was increased in four steps (0, 500, 1000 and 1500 µmol m-2 s-1), whilst other chamber conditions such as temperature, humidity and CO2 levels were fixed. Whereas the emission rate differed between individuals of the same species, the relative contributions of compounds to the total isoprenoid emission remained similar. Whilst some compounds were species specific, the compounds α-pinene, camphene, 3-carene, limonene and eucalyptol were emitted by all of the measured tree species. Some compounds, like isoprene and sabinene, showed an increasing emission response with increasing light intensity, whereas other compounds, like camphene, had no significant emission response to light for most of the measured trees. English oak and European beech showed high light-dependent emission fractions from isoprene and sabinene, but other emitted compounds were light independent. For the two provenances of Norway spruce, the compounds α-pinene, 3-carene and eucalyptol showed high light-dependent fractions for many of the measured trees. This study highlights differences between compound emissions in their response to a change in light and a possible light independence for certain compounds, which might be valid for a wider range of tree species. This information could be of importance when improving emission models and to further emphasize the discussion regarding light or
Directory of Open Access Journals (Sweden)
Vasile DEDU
2012-08-01
Full Text Available In this paper we present the key aspects regarding central bank’s independence. Most economists consider that the factor which positively influences the efficiency of monetary policy measures is the high independence of the central bank. We determined that the National Bank of Romania (NBR has a high degree of independence. NBR has both goal and instrument independence. We also consider that the hike of NBR’s independence played an important role in the significant disinflation process, as headline inflation dropped inside the targeted band of 3% ± 1 percentage point recently.
Gando, Yuko; Murakami, Haruka; Kawakami, Ryoko; Tanaka, Noriko; Sanada, Kiyoshi; Tabata, Izumi; Higuchi, Mitsuru; Miyachi, Motohiko
2014-02-01
It is unclear whether light physical activity is beneficially associated with insulin resistance, similar to moderate and/or vigorous physical activity. This cross-sectional study was performed to determine the relationship between the amount of light physical activity, as determined with a triaxial accelerometer, and insulin resistance. A total of 807 healthy men and women participated in this study. Physical activity was measured using a triaxial accelerometer worn for 28 days and summarized as light intensity (1.1-2.9 METs) or moderate to vigorous intensity (≥ 3.0 METs). Insulin resistance was evaluated by HOMA_R (FPG [mg/dL] × IRI [μU/mL]/405). The daily time spent in light physical activity was inversely associated with HOMA_R (r = -0.173, P physical activity and HOMA_R remained statistically significant (β = -0.119, P physical activity remained significantly associated with HOMA_R following further adjustment for moderate to vigorous intensity activity (β = -0.125, P physical activity was modeled as quartiles, especially in elderly women. These cross-sectional data suggest that light-intensity physical activity is beneficially associated with insulin resistance in elderly Japanese women.
2018-05-01
Heart involvement is the most important prognostic determinant in AL amyloidosis patients. Echocardiography is a cornerstone for the diagnosis and provides important prognostic information. We studied 754 patients with AL amyloidosis who underwent echocardiographic assessment at the Mayo Clinic, including a Doppler-derived measurement of stroke volume (SV) within 30 days of their diagnosis to explore the prognostic role of echocardiographic variables in the context of a well-established soluble cardiac biomarker staging system. Reproducibility of SV, myocardial contraction fraction, and left ventricular strain was assessed in a separate, yet comparable, study cohort of 150 patients from the Pavia Amyloidosis Center. The echocardiographic measures most predictive for overall survival were SV index <33 mL/min, myocardial contraction fraction <34%, and cardiac index <2.4 L/min/m 2 with respective hazard ratios (95% confidence intervals) of 2.95 (2.37-3.66), 2.36 (1.96-2.85), and 2.32 (1.91-2.80). For the subset that had left ventricular strain performed, the prognostic cut point was -14% (hazard ratios, 2.70; 95% confidence intervals, 1.84-3.96). Each parameter was independent of systolic blood pressure, Mayo staging system (NT-proBNP [N-terminal pro-B-type natriuretic peptide] and troponin), and ejection fraction on multivariable analysis. Simple predictive models for survival, including biomarker staging along with SV index or left ventricular strain, were generated. SV index prognostic performance was similar to left ventricular strain in predicting survival in AL amyloidosis, independently of biomarker staging. Because SV index is routinely calculated and widely available, it could serve as the preferred echocardiographic measure to predict outcomes in AL amyloidosis patients. © 2018 American Heart Association, Inc.
On the Measurement of the Velocity of Light Emitted by an Ultrarelativistic Source
Kupryaev, N. V.
2015-01-01
By analytical calculations it has been shown that in papers on the measurement of the velocity of light published in 2011 in the journals Uspekhi Fizicheskikh Nauk [Physics-Uspekhi] and Pis'ma v ZhETF [JRTP Letters], in actual fact the velocity of a light pulse from a relativistic clot of electrons was not measured. All that was done was to compare the velocity of light emitted by an ultrarelativistic source with the velocity of light from a fixed source, i.e., both in the first and second variants (one independent quantity was compared with another), in essence, it was simply postulated. In the first variant a glass plate was used as the fixed light source, and in the second variants, a synchrotron pulse was used as the reference signal. The velocity of light was calculated using a calculated time based on the postulate of the special theory of relativity (STR) on the invariance of the velocity of light. This, of course, contradicts the Newton-Ritz hypothesis on ballistic addition of velocities, but at the present time this idea is not taken seriously. Practically none of the serious contemporary critics of STR, apart, of course, from amateurs, holds this point of view. The result cannot be considered as a direct experimental confirmation of the second postulate of Einstein's special theory of relativity, i.e., its main part, which speaks of the constancy of the velocity of light in all inertial reference frames, but only of that part which speaks of the independence of the velocity of light on motion of the source. Moreover, this same result stands as equal proof of the so-called theory of the luminiferous ether, which held sway up to the creation of the special theory of relativity and which has now been revived, i.e., it does not distinguish between these two theories. It is fundamentally impossible in principle to measure the velocity of light by the proposed method, it is only possible to postulate it.
Light scattering in plane dielectric layers: Modeling in the 2d reciprocal space
International Nuclear Information System (INIS)
Shcherbakov, Alexey A.; Tishchenko, Alexandre V.
2012-01-01
The generalized source method previously developed for the light diffraction calculation on periodic dielectric structures is applied for the light scattering calculation in non-periodic planar media. This significantly enlarges the domain of applicability of Fourier-methods in light scattering modeling since the generalized source method is of much less numerical complexity than other rigorous methods used. -- Highlights: ► Method for light scattering simulation in planar layers. ► The approach is fairly independent of scattering particles’ shape. ► The method is based on the rigorous solution of Maxwell's equations. ► Each calculation stage allows the accuracy control by the convergence monitoring. ► Possibility to consider any practically possible dielectric materials.
Technology programs in support of advanced light water reactor plants: Construction
International Nuclear Information System (INIS)
Eichen, E.P.
1989-10-01
Stone ampersand Webster Engineering Corporation (SWEC) is conducting several independent, yet interrelated, studies of light water reactor plants to improve constructibility and quality, to reduce costs and schedule duration, and to simplify design. This document discusses construction approaches. 77 refs., 5 figs., 6 tabs
Near-infrared light-controlled tunable grating based on graphene/elastomer composites
Wang, Fei; Jia, Shuhai; Wang, Yonglin; Tang, Zhenhua
2018-02-01
A near-infrared (nIR) light actuated tunable transmission optical grating based on graphene nanoplatelet (GNP)/polydimethylsiloxane (PDMS) and PDMS is proposed. A simple fabrication protocol is studied that allows integration of the grating with the actuation mechanism; both components are made from soft elastomers, and this ensure the tunability and the light-driven operation of the grating. The resulting grating structure demonstrates continuous period tunability of 2.7% under an actuation power density of 220 mW cm-2 within a period of 3 s and also demonstrates a time-independent characteristic. The proposed infrared activated grating can be developed for wireless remote light splitting in bio/chemical sensing and optical telecommunications applications.
Tetracyclines function as dual-action light-activated antibiotics.
Directory of Open Access Journals (Sweden)
Ya He
Full Text Available Antimicrobial photodynamic inactivation (aPDI employs photosensitizing dyes activated by visible light to produce reactive oxygen species. aPDI is independent of the antibiotic resistance status of the target cells, and is thought unlikely to produce resistance itself. Among many PS that have been investigated, tetracyclines occupy a unique niche. They are potentially dual-action compounds that can both kill bacteria under illumination, and prevent bacterial regrowth by inhibiting ribosomes. Tetracycline antibiotics are regarded as bacteriostatic rather than bactericidal. Doxycycline (DOTC is excited best by UVA light (365 nm while demeclocycline (DMCT can be efficiently activated by blue light (415 nm as well as UVA. Both compounds were able to eradicate Gram-positive (methicillin-resistant Staphylococcus aureus and Gram-negative (Escherichia coli bacteria (>6 log(10 steps of killing at concentrations (10-50μM and fluences (10-20J/cm2. In contrast to methylene blue, MB plus red light, tetracyclines photoinactivated bacteria in rich growth medium. When ~3 logs of bacteria were killed with DMCT/DOTC+light and the surviving cells were added to growth medium, further bacterial killing was observed, while the same experiment with MB allowed complete regrowth. MIC studies were carried out either in the dark or exposed to 0.5mW/cm2 blue light. Up to three extra steps (8-fold increased antibiotic activity was found with light compared to dark, with MRSA and tetracycline-resistant strains of E. coli. Tetracyclines can accumulate in bacterial ribosomes, where they could be photoactivated with blue/UVA light producing microbial killing via ROS generation.
International Nuclear Information System (INIS)
Le Tien Thanh; Nguyen Tuong Mien; Huynh Thi Trung; Vu Thi Trac; Pham Van Nhi
2016-01-01
Eleven independent monochromatic light combination systems were established using super blue and red light LEDs. These are adjustable for mixing ratio of red and blue lights, the intensity and time for illumination. A fluorescent light illumination system was included as control. These were used to implement experiments for investigation effects of monochromatic lights combination in in vitro plantlet fully-forming stage on in vitro plantlet fully-forming and on the development of plant in nursery of chrysanthemum and Phalaenopsis orchid. Results from these experiments showed that illumination with intensity of 750 lx and light mixture of 20% blue-80% red is suitable for Phalaenopsis orchid; illumination with intensity of 1100 lx and light mixture of 90% red light-10% blue light is suitable for chrysanthemum. (author)
Moreadith, R W; Batshaw, M L; Ohnishi, T; Kerr, D; Knox, B; Jackson, D; Hruban, R; Olson, J; Reynafarje, B; Lehninger, A L
1984-09-01
We report the case of an infant with hypoglycemia, progressive lactic acidosis, an increased serum lactate/pyruvate ratio, and elevated plasma alanine, who had a moderate to profound decrease in the ability of mitochondria from four organs to oxidize pyruvate, malate plus glutamate, citrate, and other NAD+-linked respiratory substrates. The capacity to oxidize the flavin adenine dinucleotide-linked substrate, succinate, was normal. The most pronounced deficiency was in skeletal muscle, the least in kidney mitochondria. Enzymatic assays on isolated mitochondria ruled out defects in complexes II, III, and IV of the respiratory chain. Further studies showed that the defect was localized in the inner membrane mitochondrial NADH-ubiquinone oxidoreductase (complex I). When ferricyanide was used as an artificial electron acceptor, complex I activity was normal, indicating that electrons from NADH could reduce the flavin mononucleotide cofactor. However, electron paramagnetic resonance spectroscopy performed on liver submitochondrial particles showed an almost total loss of the iron-sulfur clusters characteristic of complex I, whereas normal signals were noted for other mitochondrial iron-sulfur clusters. This infant is presented as the first reported case of congenital lactic acidosis caused by a deficiency of the iron-sulfur clusters of complex I of the mitochondrial electron transport chain.
Evolving Our Evaluation of Lighting Environments Project
Terrier, Douglas; Clayton, Ronald; Clark, Toni Anne
2016-01-01
Imagine you are an astronaut on their 100th day of your three year exploration mission. During your daily routine to the small hygiene compartment of the spacecraft, you realize that no matter what you do, your body blocks the light from the lamp. You can clearly see your hands or your toes but not both! What were those design engineers thinking! It would have been nice if they could have made the walls glow instead! The reason the designers were not more innovative is that their interpretation of the system lighting requirements didn't allow them to be so! Currently, our interior spacecraft lighting standards and requirements are written around the concept of a quantity of light illuminating a spacecraft surface. The natural interpretation for the engineer is that a lamp that throws light to the surface is required. Because of certification costs, only one lamp is designed and small rooms can wind up with lamps that may be inappropriate for the room architecture. The advances in solid state light emitting technologies and optics for lighting and visual communication necessitates the evaluation of how NASA envisions spacecraft lighting architectures and how NASA uses industry standards for the design and evaluation of lighting system. Current NASA lighting standards and requirements for existing architectures focus on the separate ability of a lighting system to throw light against a surface or the ability of a display system to provide the appropriate visual contrast. Realization that these systems can be integrated is not realized. The result is that the systems are developed independent from one another and potential efficiencies that could be realized from borrowing from the concept of one technology and applying it for the purpose of the other does not occur. This project investigated the possibility of incorporating large luminous surface lamps as an alternative or supplement to overhead lighting. We identified existing industry standards for architectural
Opposite influence of light and blindness on pituitary-gonadal function
Directory of Open Access Journals (Sweden)
Antonio eBellastella
2014-01-01
Full Text Available Some environmental factors may influence the pituitary-gonadal function. Among these, light plays an important role in animal and in humans. The effect of light on the endocrine system is mediated by the pineal gland, through the modulation of melatonin secretion. In fact, melatonin secretion is stimulated by darkness and suppressed by light, thus its circadian rhythm peaks at night. Light plays a favourable action on the hypothalamic-pituitary axis likely inhibiting melatonin secretion, even if the exogenous melatonin administration does not seem to impair the hormonal secretions of this axis. The basal and rhythmic pituitary-gonadal hormone secretions is regulated by a central clock gene and some independent clock genes present in the peripheral tissues. Light is able to induce the expression of some of these genes, thus playing an important role in regulating the hormonal secretions of pituitary -gonadal axis and the sexual and reproductive function in animals and humans. The lack of light stimulus in blind subjects induces increased plasma melatonin concentrations with a free-running rhythm of secretion, which impairs the hormonal secretions of pituitary-gonadal axis, causing disorders of reproductive processes in both sexes.
Super-leading logarithms in non-global observables in QCD colour basis independent calculation
Forshaw, J R; Seymour, M H
2008-01-01
In a previous paper we reported the discovery of super-leading logarithmic terms in a non-global QCD observable. In this short update we recalculate the first super-leading logarithmic contribution to the 'gaps between jets' cross-section using a colour basis independent notation. This sheds light on the structure and origin of the super-leading terms and allows them to be calculated for gluon scattering processes for the first time.
Technology programs in support of advanced light water reactor plants: Construction
International Nuclear Information System (INIS)
Eichen, E.P.
1987-12-01
Stone ampersand Webster Engineering Corporation (SWEC) is conducting several independent, yet interrelated, studies of light water reactor plants to improve constructibility and quality, to reduce costs and schedule durations, and to simplify design. This document discusses successes and problems in construction. 49 refs., 16 figs., 8 tabs
Ratcliff, Erin L.; Veneman, P. Alex; Simmonds, Adam; Zacher, Brian; Huebner, Daniel
2010-01-01
We present a simple chip-based refractometer with a central organic light emitting diode (OLED) light source and two opposed organic photovoltaic (OPV) detectors on an internal reflection element (IRE) substrate, creating a true dual-beam sensor platform. For first-generation platforms, we demonstrate the use of a single heterojunction OLED based on electroluminescence emission from an Alq3/TPD heterojunction (tris-(8-hydroxyquinoline)aluminum/N,N′-Bis(3-methylphenyl)-N,N′-diphenylbenzidine) and light detection with planar heterojunction pentacene/C60 OPVs. The sensor utilizes the considerable fraction of emitted light from conventional thin film OLEDs that is coupled into guided modes in the IRE instead of into the forward (display) direction. A ray-optics description is used to describe light throughput and efficiency-limiting factors for light coupling from the OLED into the substrate modes, light traversing through the IRE substrate, and light coupling into the OPV detectors. The arrangement of the OLED at the center of the chip provides for two sensing regions, a “sample” and “reference” channel, with detection of light by independent OPV detectors. This configuration allows for normalization of the sensor response against fluctuations in OLED light output, stability, and local fluctuations (temperature) which might influence sensor response. The dual beam configuration permits significantly enhanced sensitivity to refractive index changes relative to single-beam protocols, and is easily integrated into a field-portable instrumentation package. Changes in refractive index (ΔR.I.) between 10−2 and 10−3 R.I. units could be detected for single channel operation, with sensitivity increased to ΔR.I. ≈ 10−4 units when the dual beam configuration is employed. PMID:20218580
Cope, K. R.; Bugbee, B.
2011-12-01
Light-emitting diodes (LEDs) are an emerging technology for plant growth lighting. Due to their narrow spectral output, colored LEDs provide many options for studying the spectral effects of light on plants. Early on, efficient red LEDs were the primary focus of photobiological research; however, subsequent studies have shown that normal plant growth and development cannot be achieved under red light without blue light supplementation. More recent studies have shown that red and blue (RB) LEDs supplemented with green light increase plant dry mass. This is because green light transmits more effectively through the leaf canopy than red and blue light, thus illuminating lower plant leaves and increasing whole-plant photosynthesis. Red, green and blue (RGB) light can be provided by either a conventional white light source (such as fluorescent lights), a combination of RGB LEDs, or from recently developed white LEDs. White LEDs exceed the efficiency of fluorescent lights and have a comparable broad spectrum. As such, they have the potential to replace fluorescent lighting for growth-chamber-based crop production both on Earth and in space. Here we report the results of studies on the effects of three white LED types (warm, neutral and cool) on plant growth and development compared to combinations of RB and RGB LEDs. Plants were grown under two constant light intensities (200 and 500 μmol m-2 s-1). Temperature, environmental conditions and root-zone environment were uniformly maintained across treatments. Phytochrome photoequilbria and red/far-red ratios were similar among treatments and were comparable to conventional fluorescent lights. Blue light had a significant effect on both plant growth (dry mass gain) and development (dry mass partitioning). An increase in the absolute amount (μmol m-2 s-1) of blue light from 0-80 μmol m-2 s-1 resulted in a decrease in stem elongation, independent of the light intensity. However, an increase in the relative amount (%) of blue
Directory of Open Access Journals (Sweden)
Pirko Tõugu
2017-12-01
Full Text Available Independent and interdependent self-construal values of three generations and the intergenerational similarity of self-construal was compared in three countries. The participants were 837 adolescents, their mothers (227 from Russia, 311 from Germany, and 299 from Estonia and 293 maternal grandmothers. In Germany, all three generations displayed higher scores on independence than participants from other countries. Russian participants had higher scores on interdependence compared to participants from other countries. Adolescents scored significantly higher on the interdependent self-construal than the two older generations, and higher than the mothers’ generation on the independent self-construal. Grandmothers’ self-construal was related to mothers’ in all three countries. In Germany and Estonia, mothers’ interdependent self-construal was related to adolescents’ interdependent self-construal. Grandmothers’ (but not mothers’ independent self-construal predicted adolescents’ independent self-construal. The results are discussed in light of the Family Change Theory and the different roles the participants have.
Charged particle multiplicities in heavy and light quark initiated events above the $Z^0$ peak
Abbiendi, G.; Akesson, P.F.; Alexander, G.; Allison, John; Amaral, P.; Anagnostou, G.; Anderson, K.J.; Arcelli, S.; Asai, S.; Axen, D.; Azuelos, G.; Bailey, I.; Barberio, E.; Barlow, R.J.; Batley, R.J.; Bechtle, P.; Behnke, T.; Bell, Kenneth Watson; Bell, P.J.; Bella, G.; Bellerive, A.; Benelli, G.; Bethke, S.; Biebel, O.; Bloodworth, I.J.; Boeriu, O.; Bock, P.; Bonacorsi, D.; Boutemeur, M.; Braibant, S.; Brigliadori, L.; Brown, Robert M.; Buesser, K.; Burckhart, H.J.; Campana, S.; Carnegie, R.K.; Caron, B.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Csilling, A.; Cuffiani, M.; Dado, S.; Dallison, S.; De Roeck, A.; De Wolf, E.A.; Desch, K.; Dienes, B.; Donkers, M.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Elfgren, E.; Etzion, E.; Fabbri, F.; Feld, L.; Ferrari, P.; Fiedler, F.; Fleck, I.; Ford, M.; Frey, A.; Furtjes, A.; Gagnon, P.; Gary, John William; Gaycken, G.; Geich-Gimbel, C.; Giacomelli, G.; Giacomelli, P.; Giunta, Marina; Goldberg, J.; Gross, E.; Grunhaus, J.; Gruwe, M.; Gunther, P.O.; Gupta, A.; Hajdu, C.; Hamann, M.; Hanson, G.G.; Harder, K.; Harel, A.; Harin-Dirac, M.; Hauschild, M.; Hauschildt, J.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Hensel, C.; Herten, G.; Heuer, R.D.; Hill, J.C.; Hoffman, Kara Dion; Homer, R.J.; Horvath, D.; Howard, R.; Igo-Kemenes, P.; Ishii, K.; Jeremie, H.; Jovanovic, P.; Junk, T.R.; Kanaya, N.; Kanzaki, J.; Karapetian, G.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kim, D.H.; Klein, K.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Komamiya, S.; Kormos, Laura L.; Kramer, T.; Kress, T.; Krieger, P.; von Krogh, J.; Krop, D.; Kruger, K.; Kuhl, T.; Kupper, M.; Lafferty, G.D.; Landsman, H.; Lanske, D.; Layter, J.G.; Leins, A.; Lellouch, D.; Lettso, J.; Levinson, L.; Lillich, J.; Lloyd, S.L.; Loebinger, F.K.; Lu, J.; Ludwig, J.; Macpherson, A.; Mader, W.; Marcellini, S.; Marchant, T.E.; Martin, A.J.; Martin, J.P.; Masetti, G.; Mashimo, T.; Mattig, Peter; McDonald, W.J.; McKenna, J.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Mendez-Lorenzo, P.; Menges, W.; Merritt, F.S.; Mes, H.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Moed, S.; Mohr, W.; Mori, T.; Mutter, A.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nisius, R.; O'Neale, S.W.; Oh, A.; Okpara, A.; Oreglia, M.J.; Orito, S.; Pahl, C.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poli, B.; Polok, J.; Pooth, O.; Przybycien, M.; Quadt, A.; Rabbertz, K.; Rembser, C.; Renkel, P.; Rick, H.; Roney, J.M.; Rosati, S.; Rozen, Y.; Runge, K.; Sachs, K.; Saeki, T.; Sahr, O.; Sarkisyan, E.K.G.; Schaile, A.D.; Schaile, O.; Scharff-Hansen, P.; Schieck, J.; Schoerner-Sadenius, Thomas; Schroder, Matthias; Schumacher, M.; Schwick, C.; Scott, W.G.; Seuster, R.; Shears, T.G.; Shen, B.C.; Sherwood, P.; Siroli, G.; Skuja, A.; Smith, A.M.; Sobie, R.; Soldner-Rembold, S.; Spano, F.; Stahl, A.; Stephens, K.; Strom, David M.; Strohmer, R.; Tarem, S.; Tasevsky, M.; Taylor, R.J.; Teuscher, R.; Thomson, M.A.; Torrence, E.; Toya, D.; Tran, P.; Trefzger, T.; Tricoli, A.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turner-Watson, M.F.; Ueda, I.; Ujvari, B.; Vachon, B.; Vollmer, C.F.; Vannerem, P.; Verzocchi, M.; Voss, H.; Vossebeld, J.; Waller, D.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wengler, T.; Wermes, N.; Wetterling, D.; Wilson, G.W.; Wilson, J.A.; Wolf, G.; Wyatt, T.R.; Yamashita, S.; Zer-Zion, D.; Zivkovic, Lidija
2002-01-01
We have measured the mean charged particle multiplicities separately for bbbar, ccbar and light quark (uubar, ddbar, ssbar) initiated events produced in e+e- annihilations at LEP. The data were recorded with the OPAL detector at eleven different energies above Z0 peak, corresponding to the full statistics collected at LPE1.5 and LEP2. The difference in mean charged and particle multiplicities for bbbar and light quark events, delta_bl, measured over this energy range is consistent with an energy independent behaviour, as predicted by QCD, but is inconsistent with the prediction of a more phenomenological approach which assumes that the multiplicity accompanying the decay of a heavy quark is independent of the quark mass itself. Our results, which can be combined into the single measurement delta_bl = 3.44+-0.40(stat)+-0.89(syst) at a luminosity weighted average centre-of mass energy of 195 GeV, are also consistent with an energy independent behaviour as extrapolated from lower energy data.
Leininger, Elizabeth C; Kelley, Darcy B
2013-04-07
Independent or convergent evolution can underlie phenotypic similarity of derived behavioural characters. Determining the underlying neural and neuromuscular mechanisms sheds light on how these characters arose. One example of evolutionarily derived characters is a temporally simple advertisement call of male African clawed frogs (Xenopus) that arose at least twice independently from a more complex ancestral pattern. How did simplification occur in the vocal circuit? To distinguish shared from divergent mechanisms, we examined activity from the calling brain and vocal organ (larynx) in two species that independently evolved simplified calls. We find that each species uses distinct neural and neuromuscular strategies to produce the simplified calls. Isolated Xenopus borealis brains produce fictive vocal patterns that match temporal patterns of actual male calls; the larynx converts nerve activity faithfully into muscle contractions and single clicks. In contrast, fictive patterns from isolated Xenopus boumbaensis brains are short bursts of nerve activity; the isolated larynx requires stimulus bursts to produce a single click of sound. Thus, unlike X. borealis, the output of the X. boumbaensis hindbrain vocal pattern generator is an ancestral burst-type pattern, transformed by the larynx into single clicks. Temporally simple advertisement calls in genetically distant species of Xenopus have thus arisen independently via reconfigurations of central and peripheral vocal neuroeffectors.
Directory of Open Access Journals (Sweden)
Aryo Tedjo
2009-12-01
Full Text Available Skin cancer is a malignant growth on the skin caused by many factors. The most common skin cancers are Basal Cell Cancer (BCC and Squamous Cell Cancer (SCC. This research uses a discriminant analysis to classify some tissues of skin cancer based on criterion number of independent variables. An independent variable is variation of excitation light sources (LED lamp, filters, and sensors to measure Autofluorescence Intensity (IAF of visible light to near infrared (VIS/NIR ratio of paraffin embedded tissue biopsy from BCC, SCC, and Lipoma. From the result of discriminant analysis, it is known that the discriminant function is determined by 4 (four independent variables i.e., Blue LED-Red Filter, Blue LED-Yellow Filter, UV LED-Blue Filter, and UV LED-Yellow Filter. The accuracy of discriminant in classifying the analysis of three skin cancer tissues is 100 %.
Natural light exposure, healthy elderly people and sleep : a field study
Aarts, M.P.J.; Schoutens, A.M.C.; Stapel, J.C.
2006-01-01
Among 14 independently living, mobile and healthy elderly people in The Netherlands was conducted to see whether exposure duration of high intensity, natural, light is related to sleep quality, and more general the amplitude of the sleep-wake cycle. The elderly wore for 5 consecutive days in summer
Light scattering by microstructures in plastic nuclear track detector plane surfaces
International Nuclear Information System (INIS)
Wipasuramonton, O.
1985-01-01
The angular distributions of light elastically scattered by finite dielectric conical and cylindrical microstructures in plastic nuclear track detector plane surfaces have been measured. These microstructures are the chemically etched tracks of various nuclei, viz., protons, neutrons, 3 He, alphas, and 56 Fe. The base diameters of the structures are larger than twice the wavelength of the incident light. The results show the dependence of the scattering patterns on shape, size, orientation, and refractive index of the structures as well as the polarization of the incident light. It is also observed that in the single and independent scattering regime, the intensity at the intermediate angular region exhibits linear proportionality to the number of the microstructures per unit area. 84 refs., 96 figs., 4 tabs
Nishiyama, Takahito; Izawa, Tadashi; Usami, Mami; Ohnuma, Tomokazu; Ogura, Kenichiro; Hiratsuka, Akira
2010-04-09
Previous studies have shown that NAD(P)H:quinone oxidoreductase 1 (NQO1) plays an important role in the detoxification of menadione (2-methyl-1,4-naphthoquinone, also known as vitamin K3). However, menadiol (2-methyl-1,4-naphthalenediol) formed from menadione by NQO1-mediated reduction continues to be an unstable substance, which undergoes the reformation of menadione with concomitant formation of reactive oxygen species (ROS). Hence, we focused on the roles of phase II enzymes, with particular attention to UDP-glucuronosyltransferases (UGTs), in the detoxification process of menadione. In this study, we established an HEK293 cell line stably expressing NQO1 (HEK293/NQO1) and HEK293/NQO1 cell lines with doxycycline (DOX)-regulated expression of UGT1A6 (HEK293/NQO1/UGT1A6) and UGT1A10 (HEK293/NQO1/UGT1A10), and evaluated the role of NQO1 and UGTs against menadione-induced cytotoxicity. Our results differed from those of previous studies. HEK293/NQO1 was the most sensitive cell line to menadione cytotoxicity among cell lines established in this study. These phenomena were also observed in HEK293/NQO1/UGT1A6 and HEK293/NQO1/UGT1A10 cells in which the expression of UGT was suppressed by DOX treatment. On the contrary, HEK293/NQO1/UGT1A6 and HEK293/NQO1/UGT1A10 cells without DOX treatment were resistant to menadione-induced cytotoxicity. These results demonstrated that NQO1 is not a detoxification enzyme for menadione and that UGT-mediated glucuronidation of menadiol is the most important detoxification process. Copyright 2009 Elsevier Inc. All rights reserved.
Kelley, Eric E
2015-08-01
Xanthine oxidoreductase (XOR), the molybdoflavin enzyme responsible for the terminal steps of purine degradation in humans, is also recognized as a significant source of reactive species contributory to inflammatory disease. In animal models and clinical studies, inhibition of XOR has resulted in diminution of symptoms and enhancement of function in a number of pathologies including heart failure, diabetes, sickle cell anemia, hypertension and ischemia-reperfusion injury. For decades, XOR involvement in pathologic processes has been established by salutary outcomes attained from treatment with the XOR inhibitor allopurinol. This has served to frame a working dogma that elevation of XOR-specific activity is associated with enhanced rates of reactive species generation that mediate negative outcomes. While adherence to this narrowly focused practice of designating elevated XOR activity to be "bad" has produced some benefit, it has also led to significant underdevelopment of the processes mediating XOR regulation, identification of alternative reactants and products as well as micro-environmental factors that alter enzymatic activity. This is exemplified by recent reports: (1) identifying XOR as a nitrite reductase and thus a source of beneficial nitric oxide ((•)NO) under in vivo conditions similar to those where XOR inhibition has been assumed an optimal treatment choice, (2) describing XOR-derived uric acid (UA) as a critical pro-inflammatory mediator in vascular and metabolic disease and (3) ascribing an antioxidant/protective role for XOR-derived UA. When taken together, these proposed and countervailing functions of XOR affirm the need for a more comprehensive evaluation of product formation as well as the factors that govern product identity. As such, this review will critically evaluate XOR-catalyzed oxidant, (•)NO and UA formation as well as identify factors that mediate their production, inhibition and the resultant impact on inflammatory disease.
International Nuclear Information System (INIS)
Flueck, Christa E.; Mallet, Delphine; Hofer, Gaby; Samara-Boustani, Dinane; Leger, Juliane; Polak, Michel; Morel, Yves; Pandey, Amit V.
2011-01-01
Highlights: → Mutations in human POR cause congenital adrenal hyperplasia. → We are reporting a novel 3 amino acid deletion mutation in POR P399 E 401del. → POR mutation P399 E 401del decreased P450 activities by 60-85%. → Impairment of steroid metabolism may be caused by multiple hits. → Severity of aromatase inhibition is related to degree of in utero virilization. -- Abstract: P450 oxidoreductase (POR) is the electron donor for all microsomal P450s including steroidogenic enzymes CYP17A1, CYP19A1 and CYP21A2. We found a novel POR mutation P399 E 401del in two unrelated Turkish patients with 46,XX disorder of sexual development. Recombinant POR proteins were produced in yeast and tested for their ability to support steroid metabolizing P450 activities. In comparison to wild-type POR, the P399 E 401del protein was found to decrease catalytic efficiency of 21-hydroxylation of progesterone by 68%, 17α-hydroxylation of progesterone by 76%, 17,20-lyase action on 17OH-pregnenolone by 69%, aromatization of androstenedione by 85% and cytochrome c reduction activity by 80%. Protein structure analysis of the three amino acid deletion P399 E 401 revealed reduced stability and flexibility of the mutant. In conclusion, P399 E 401del is a novel mutation in POR that provides valuable genotype-phenotype and structure-function correlation for mutations in a different region of POR compared to previous studies. Characterization of P399 E 401del provides further insight into specificity of different P450s for interaction with POR as well as nature of metabolic disruptions caused by more pronounced effect on specific P450s like CYP17A1 and aromatase.
DEFF Research Database (Denmark)
Van Meeningen, Ylva; Schurgers, Guy; Rinnan, Riikka
2017-01-01
and stomatal conductance on three common European tree species, namely English oak (Quercus robur), European beech (Fagus sylvatica) and two provenances of Norway spruce (Picea abies) in Taastrup, Denmark. Leaf scale measurements were performed on the lowest positioned branches of the tree in July 2015. Light......, whereas other compounds, like camphene, had no significant emission response to light for most of the measured trees. English oak and European beech showed high light-dependent emission fractions from isoprene and sabinene, but other emitted compounds were light independent. For the two provenances...... be valid for a wider range of tree species. This information could be of importance when improving emission models and to further emphasize the discussion regarding light or temperature dependencies for individual compounds across species. Light is an important environmental factor controlling biogenic...
New results in light-front phenomenology
International Nuclear Information System (INIS)
Brodsky, S.J.
2005-01-01
The light-front quantization of gauge theories in light-cone gauge provides a frame-independent wavefunction representation of relativistic bound states, simple forms for current matrix elements, explicit unitarity, and a trivial vacuum. In this talk I review the theoretical methods and constraints which can be used to determine these central elements of QCD phenomenology. The freedom to choose the light-like quantization four-vector provides an explicitly covariant formulation of light-front quantization and can be used to determine the analytic structure of light-front wave functions and define a kinematical definition of angular momentum. The AdS/CFT correspondence of large N c supergravity theory in higher-dimensional anti-de Sitter space with supersymmetric QCD in four-dimensional space-time has interesting implications for hadron phenomenology in the conformal limit, including an all-orders demonstration of counting rules for exclusive processes. String/gauge duality also predicts the QCD power-law behavior of light-front Fock-state hadronic wavefunctions with arbitrary orbital angular momentum at high momentum transfer. The form of these near-conformal wavefunctions can be used as an initial ansatz for a variational treatment of the light-front QCD Hamiltonian. The light-front Fock-state wavefunctions encode the bound state properties of hadrons in terms of their quark and gluon degrees of freedom at the amplitude level. The nonperturbative Fock-state wavefunctions contain intrinsic gluons, and sea quarks at any scale Q with asymmetries such as s(x) ≠ s-bar(x), u-bar(x) ≠ d-bar(x). Intrinsic charm and bottom quarks appear at large x in the light-front wavefunctions since this minimizes the invariant mass and off-shellness of the higher Fock state. In the case of nuclei, the Fock state expansion contains 'hidden color' states which cannot be classified in terms of of nucleonic degrees of freedom. I also briefly review recent analyses which show that some
Carcinogenesis related to intense pulsed light and UV exposure
DEFF Research Database (Denmark)
Hedelund, L; Lerche, C; Wulf, H C
2006-01-01
This study examines whether intense pulsed light (IPL) treatment has a carcinogenic potential itself or may influence ultraviolet (UV)-induced carcinogenesis. Secondly, it evaluates whether UV exposure may influence IPL-induced side effects. Hairless, lightly pigmented mice (n=144) received three...... observation period. Side effects were evaluated clinically. No tumors appeared in untreated control mice or in just IPL-treated mice. Skin tumors developed in UV-exposed mice independently of IPL treatments. The time it took for 50% of the mice to first develop skin tumor ranged from 47 to 49 weeks...... in preoperative UV-exposed mice (p=0.94) and from 22 to 23 weeks in pre- and postoperative UV-exposed mice (p=0.11). IPL rejuvenation of lightly pigmented skin did not induce pigmentary changes (p=1.00). IPL rejuvenation of UV-pigmented skin resulted in an immediate increased skin pigmentation and a subsequent...
Conception of a sub aquatic lighting system for nuclear fuels storage pools
International Nuclear Information System (INIS)
Bracco, P.; Rosenthal, E.
1990-01-01
Restrictions like contaminated water, irradiated fuel elements in racks located on the bottom of the pool and the impossibility of removing the water, require a non conventional design of pool lamps. The model developed is independent of the pool, permitting easily fabrication and maintenance. They are made of stainless steel tubes with borosilicate windows, where floodlight or light are located. The lamp assembly is fixed at the border of the pool. The system offers advantages over the conventional pool lighting systems in fabrication, operation and maintenance. (author)
Directory of Open Access Journals (Sweden)
Artavazd Badalyan
2014-11-01
Full Text Available Biosensors for the detection of benzaldehyde and g-aminobutyric acid (GABA are reported using aldehyde oxidoreductase PaoABC from Escherichia coli immobilized in a polymer containing bound low potential osmium redox complexes. The electrically connected enzyme already electrooxidizes benzaldehyde at potentials below −0.15 V (vs. Ag|AgCl, 1 M KCl. The pH-dependence of benzaldehyde oxidation can be strongly influenced by the ionic strength. The effect is similar with the soluble osmium redox complex and therefore indicates a clear electrostatic effect on the bioelectrocatalytic efficiency of PaoABC in the osmium containing redox polymer. At lower ionic strength, the pH-optimum is high and can be switched to low pH-values at high ionic strength. This offers biosensing at high and low pH-values. A “reagentless” biosensor has been formed with enzyme wired onto a screen-printed electrode in a flow cell device. The response time to addition of benzaldehyde is 30 s, and the measuring range is between 10–150 µM and the detection limit of 5 µM (signal to noise ratio 3:1 of benzaldehyde. The relative standard deviation in a series (n = 13 for 200 µM benzaldehyde is 1.9%. For the biosensor, a response to succinic semialdehyde was also identified. Based on this response and the ability to work at high pH a biosensor for GABA is proposed by coimmobilizing GABA-aminotransferase (GABA-T and PaoABC in the osmium containing redox polymer.
Kelce, W R; Krause, W J; Ganjam, V K
1987-09-01
The epididymal epithelial ultrastructure has been described in the adult male North American opossum, Didelphis virginiana. Morphological results have suggested that absorptive activity is prominent in the proximal epididymal region by virtue of numerous microvilli, an endocytotic complex, dense granules, and multivesicular bodies in the apical cytoplasm. In contrast, the middle and distal epididymal regions exhibit ultrastructural features indicative of protein synthesis such as large invaginated euchromatic nuclei, large nucleoli, and increased amounts of granular endoplasmic reticulum. It is in the middle and distal epididymal regions where sperm head rotation and sperm pairing take place. Epididymal delta 4-3-ketosteroid-5 alpha-oxidoreductase (5 alpha-reductase) activity also has been measured. It has been found that the level of enzyme activity differs significantly (p less than 0.01) between the proximal, middle, and distal epididymal regions. Enzyme-specific activity has been found to be highest in the middle region (47.6 +/- 5.4 picomoles 5 alpha-reduced androgens formed/b/mg protein), lower in the distal region (18.3 +/- 0.7 picomoles 5 alpha-reduced androgens formed/b/mg protein), with little activity (2.4 +/- 1.2 picomoles 5 alpha-reduced androgens formed/h/mg protein) found in the proximal epididymal region. This regional distribution of enzyme activity differs markedly from that reported for eutherian mammals. Both the suggested epididymal protein synthetic and secretory activity and the level of epididymal 5 alpha-reductase activity appear to correlate regionally with the morphological changes that occur in the opossum spermatozoa as they transit the epididymis.
Lighting system for the lower core plate of a nuclear reactor
International Nuclear Information System (INIS)
Feuillet, P.; Bonin, J.P.
1986-01-01
The invention proposes a grazing lighting system for the lower core plate, creating an excellent contrast and offering a good estimation of the relief; it can stay at the same place during the whole or at least the greater part of the core refueling operation. This lighting system is proposed for a reactor of which the lower core plate has fuel assembly centering elements. It has a sealed vessel with a transparent side wall containing several lights independently controlled and each one illuminating a sector of its wall. The vessel has a bottom aimed at resting on the lower plate and provided with centering and holding means acting with several of the said centering means through the plate, and/or apertures for coolant through the plate, and an upper container provided with gripping and handling elements and sealed conduits for electrical cables feeding the lights [fr
Directory of Open Access Journals (Sweden)
Denes Szaz
Full Text Available Ecological photopollution created by artificial night lighting can alter animal behavior and lead to population declines and biodiversity loss. Polarized light pollution is a second type of photopollution that triggers water-seeking insects to ovisposit on smooth and dark man-made objects, because they simulate the polarization signatures of natural water bodies. We document a case study of the interaction of these two forms of photopollution by conducting observations and experiments near a lamp-lit bridge over the river Danube that attracts mass swarms of the mayfly Ephoron virgo away from the river to oviposit on the asphalt road of the bridge. Millions of mayflies swarmed near bridge-lights for two weeks. We found these swarms to be composed of 99% adult females performing their upstream compensatory flight and were attracted upward toward unpolarized bridge-lamp light, and away from the horizontally polarized light trail of the river. Imaging polarimetry confirmed that the asphalt surface of the bridge was strongly and horizontally polarized, providing a supernormal ovipositional cue to Ephoron virgo, while other parts of the bridge were poor polarizers of lamplight. Collectively, we confirm that Ephoron virgo is independently attracted to both unpolarized and polarized light sources, that both types of photopollution are being produced at the bridge, and that spatial patterns of swarming and oviposition are consistent with evolved behaviors being triggered maladaptively by these two types of light pollution. We suggest solutions to bridge and lighting design that should prevent or mitigate the impacts of such scenarios in the future. The detrimental impacts of such scenarios may extend beyond Ephoron virgo.
Szaz, Denes; Horvath, Gabor; Barta, Andras; Robertson, Bruce A; Farkas, Alexandra; Egri, Adam; Tarjanyi, Nikolett; Racz, Gergely; Kriska, Gyorgy
2015-01-01
Ecological photopollution created by artificial night lighting can alter animal behavior and lead to population declines and biodiversity loss. Polarized light pollution is a second type of photopollution that triggers water-seeking insects to ovisposit on smooth and dark man-made objects, because they simulate the polarization signatures of natural water bodies. We document a case study of the interaction of these two forms of photopollution by conducting observations and experiments near a lamp-lit bridge over the river Danube that attracts mass swarms of the mayfly Ephoron virgo away from the river to oviposit on the asphalt road of the bridge. Millions of mayflies swarmed near bridge-lights for two weeks. We found these swarms to be composed of 99% adult females performing their upstream compensatory flight and were attracted upward toward unpolarized bridge-lamp light, and away from the horizontally polarized light trail of the river. Imaging polarimetry confirmed that the asphalt surface of the bridge was strongly and horizontally polarized, providing a supernormal ovipositional cue to Ephoron virgo, while other parts of the bridge were poor polarizers of lamplight. Collectively, we confirm that Ephoron virgo is independently attracted to both unpolarized and polarized light sources, that both types of photopollution are being produced at the bridge, and that spatial patterns of swarming and oviposition are consistent with evolved behaviors being triggered maladaptively by these two types of light pollution. We suggest solutions to bridge and lighting design that should prevent or mitigate the impacts of such scenarios in the future. The detrimental impacts of such scenarios may extend beyond Ephoron virgo.
One-sided measurement-device-independent quantum key distribution
Cao, Wen-Fei; Zhen, Yi-Zheng; Zheng, Yu-Lin; Li, Li; Chen, Zeng-Bing; Liu, Nai-Le; Chen, Kai
2018-01-01
Measurement-device-independent quantum key distribution (MDI-QKD) protocol was proposed to remove all the detector side channel attacks, while its security relies on the trusted encoding systems. Here we propose a one-sided MDI-QKD (1SMDI-QKD) protocol, which enjoys detection loophole-free advantage, and at the same time weakens the state preparation assumption in MDI-QKD. The 1SMDI-QKD can be regarded as a modified MDI-QKD, in which Bob's encoding system is trusted, while Alice's is uncharacterized. For the practical implementation, we also provide a scheme by utilizing coherent light source with an analytical two decoy state estimation method. Simulation with realistic experimental parameters shows that the protocol has a promising performance, and thus can be applied to practical QKD applications.
Yuzo, Shioi; Tsutomu, Sasa; Division of Biology, Miyazaki Medical College; Division of Biology, Miyazaki Medical College
1982-01-01
Reversed-phase high-performance liquid chromatography was used to separate protochlorophyllide esters isolated from inner seed coats of three Cucurbitaceae. At least 17 protochlorophylls esterified with different alcohols were separated on an octadecyl silica (ODS) column from purified pigments of pumpkin (Cucurbita moschata) and balsam pear (Momordica charantica) seeds with a single elution using 100% methanol within 22 min. The separation was done according to the numbers of carbon atoms in...
Nucleon parton distributions in a light-front quark model
International Nuclear Information System (INIS)
Gutsche, Thomas; Lyubovitskij, Valery E.; Schmidt, Ivan
2017-01-01
Continuing our analysis of parton distributions in the nucleon, we extend our light-front quark model in order to obtain both the helicity-independent and the helicity-dependent parton distributions, analytically matching the results of global fits at the initial scale μ∝ 1 GeV; they also contain the correct Dokshitzer-Gribov-Lipatov-Altarelli-Parisi evolution. We also calculate the transverse parton, Wigner and Husimi distributions from a unified point of view, using our light-front wave functions and expressing them in terms of the parton distributions q_v(x) and δq_v(x). Our results are very relevant for the current and future program of the COMPASS experiment at SPS (CERN). (orig.)
Regarding light resonance interpretations of the B decay anomalies
Bishara, Fady; Haisch, Ulrich; Monni, Pier Francesco
2017-09-01
We sketch a novel method to search for light di-leptonic resonances by exploiting precision measurements of Drell-Yan production. Motivated by the recent hints of lepton flavor universality violation in B →K*ℓ+ℓ-, we illustrate our proposal by studying the case of spin-1 resonances that couple to muons and have masses in the range of a few GeV. We show that the existing LHC data on p p →Z/γ* →μ+μ- put nontrivial constraints on light di-muon resonance interpretations of B decay anomalies in a model-independent fashion. The impact of our proposal on the long-standing discrepancy in the anomalous magnetic moment of the muon is also briefly discussed.
Nucleon parton distributions in a light-front quark model
Energy Technology Data Exchange (ETDEWEB)
Gutsche, Thomas [Universitaet Tuebingen, Institut fuer Theoretische Physik, Kepler Center for Astro and Particle Physics, Tuebingen (Germany); Lyubovitskij, Valery E. [Universitaet Tuebingen, Institut fuer Theoretische Physik, Kepler Center for Astro and Particle Physics, Tuebingen (Germany); Tomsk State University, Department of Physics, Tomsk (Russian Federation); Tomsk Polytechnic University, Laboratory of Particle Physics, Mathematical Physics Department, Tomsk (Russian Federation); Universidad Tecnica Federico Santa Maria, Departamento de Fisica y Centro Cientifico Tecnologico de Valparaiso (CCTVal), Valparaiso (Chile); Schmidt, Ivan [Universidad Tecnica Federico Santa Maria, Departamento de Fisica y Centro Cientifico Tecnologico de Valparaiso (CCTVal), Valparaiso (Chile)
2017-02-15
Continuing our analysis of parton distributions in the nucleon, we extend our light-front quark model in order to obtain both the helicity-independent and the helicity-dependent parton distributions, analytically matching the results of global fits at the initial scale μ∝ 1 GeV; they also contain the correct Dokshitzer-Gribov-Lipatov-Altarelli-Parisi evolution. We also calculate the transverse parton, Wigner and Husimi distributions from a unified point of view, using our light-front wave functions and expressing them in terms of the parton distributions q{sub v}(x) and δq{sub v}(x). Our results are very relevant for the current and future program of the COMPASS experiment at SPS (CERN). (orig.)
Energy Technology Data Exchange (ETDEWEB)
Alcantara D, D [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)
1995-09-15
The objective of this work is to study the adaptation mechanisms of Escherichia coli to the ultraviolet light of 254 nm (W), a component of the solar light that induces a variety of damages in the DNA of the cells exposed, which should be eliminated in order to avoid its lethal and mutagenic effects. Inside this first report, the results obtained about the resistance to UV radiation of 5 independent populations of Escherichia coli, which were subjected in parallel form to 80 successive exposures of UV light with inserted periods of growth are reported. (Author)
Directory of Open Access Journals (Sweden)
Y. van Meeningen
2017-09-01
Full Text Available Light is an important environmental factor controlling biogenic volatile organic compound (BVOC emissions, but in natural conditions its impact is hard to separate from other influential factors such as temperature. We studied the light response of foliar BVOC emissions, photosynthesis and stomatal conductance on three common European tree species, namely English oak (Quercus robur, European beech (Fagus sylvatica and two provenances of Norway spruce (Picea abies in Taastrup, Denmark. Leaf scale measurements were performed on the lowest positioned branches of the tree in July 2015. Light intensity was increased in four steps (0, 500, 1000 and 1500 µmol m−2 s−1, whilst other chamber conditions such as temperature, humidity and CO2 levels were fixed. Whereas the emission rate differed between individuals of the same species, the relative contributions of compounds to the total isoprenoid emission remained similar. Whilst some compounds were species specific, the compounds α-pinene, camphene, 3-carene, limonene and eucalyptol were emitted by all of the measured tree species. Some compounds, like isoprene and sabinene, showed an increasing emission response with increasing light intensity, whereas other compounds, like camphene, had no significant emission response to light for most of the measured trees. English oak and European beech showed high light-dependent emission fractions from isoprene and sabinene, but other emitted compounds were light independent. For the two provenances of Norway spruce, the compounds α-pinene, 3-carene and eucalyptol showed high light-dependent fractions for many of the measured trees. This study highlights differences between compound emissions in their response to a change in light and a possible light independence for certain compounds, which might be valid for a wider range of tree species. This information could be of importance when improving emission models and to further emphasize the
The vectorial control of magnetization by light.
Kanda, Natsuki; Higuchi, Takuya; Shimizu, Hirokatsu; Konishi, Kuniaki; Yoshioka, Kosuke; Kuwata-Gonokami, Makoto
2011-06-21
Application of coherent light-matter interactions has recently been extended to the ultrafast control of magnetization. An important but unrealized technique is the manipulation of magnetization vector motion to make it follow an arbitrarily designed multidimensional trajectory. Here we demonstrate a full manipulation of two-dimensional magnetic oscillations in antiferromagnetic NiO with a pair of polarization-twisted femtosecond laser pulses. We employ Raman-type nonlinear optical processes, wherein magnetic oscillations are impulsively induced with a controlled initial phase. Their azimuthal angle follows well-defined selection rules that have been determined by the symmetries of the materials. We emphasize that the temporal variation of the laser-pulse polarization angle enables us to control the phase and amplitude of the two degenerate modes, independently. These results lead to a new concept of the vectorial control of magnetization by light.
Universal Behavior in Excited Heavy-Light and Light-Light Mesons
Olsson, M. G.
1996-01-01
A common pattern of large orbital and radial excitations in heavy-light and light-light mesons is demonstrated. Within a general potential model the Regge slopes of the light degrees of freedom for these mesons are shown to be in the ratio of two. The possibility of ``tower'' degeneracy occurs only with pure scalar confinement.
Structured Light-Matter Interactions Enabled By Novel Photonic Materials
Energy Technology Data Exchange (ETDEWEB)
Litchinitser, Natalia [Univ. at Buffalo, NY (United States); Feng, Liang [Univ. at Buffalo, NY (United States)
2017-05-02
The synergy of complex materials and complex light is expected to add a new dimension to the science of light and its applications [1]. The goal of this program is to investigate novel phenomena emerging at the interface of these two branches of modern optics. While metamaterials research was largely focused on relatively “simple” linearly or circularly polarized light propagation in “complex” nanostructured, carefully designed materials with properties not found in nature, many singular optics studies addressed “complex” structured light transmission in “simple” homogeneous, isotropic, nondispersive transparent media, where both spin and orbital angular momentum are independently conserved. However, if both light and medium are complex so that structured light interacts with a metamaterial whose optical materials properties can be designed at will, the spin or angular momentum can change, which leads to spin-orbit interaction and many novel optical phenomena that will be studied in the proposed project. Indeed, metamaterials enable unprecedented control over light propagation, opening new avenues for using spin and quantum optical phenomena, and design flexibility facilitating new linear and nonlinear optical properties and functionalities, including negative index of refraction, magnetism at optical frequencies, giant optical activity, subwavelength imaging, cloaking, dispersion engineering, and unique phase-matching conditions for nonlinear optical interactions. In this research program we focused on structured light-matter interactions in complex media with three particularly remarkable properties that were enabled only with the emergence of metamaterials: extreme anisotropy, extreme material parameters, and magneto-electric coupling–bi-anisotropy and chirality.
Light box for investigation of characteristics of optoelectronics detectors
Szreder, Agnieszka; Mazikowski, Adam
2017-09-01
In this paper, a light box for investigation of characteristics of optoelectronic detectors is described. The light box consists of an illumination device, an optical power sensor and a mechanical enclosure. The illumination device is based on four types of high-power light emitting diodes (LED): white light, red, green and blue. The illumination level can be varied for each LED independently by the driver and is measured by optical power sensor. The mechanical enclosure provides stable mounting points for the illumination device, sensor and the examined detector and protects the system from external light, which would otherwise strongly influence the measurement results. Uniformity of illumination distribution provided by the light box for all colors is good, making the measurement results less dependent on the position of the examined detector. The response of optoelectronic detectors can be investigated using the developed light box for each LED separately or for any combination of up to four LED types. As the red, green and blue LEDs are rather narrow bandwidth sources, spectral response of different detectors can be examined for these wavelength ranges. The described light box can be used for different applications. Its primary use is in a student laboratory setup for investigation of characteristics of optoelectronic detectors. Moreover, it can also be used in various colorimetric or photographic applications. Finally, it will be used as a part of demonstrations from the fields of vision and color, performed during science fairs and outreach activities increasing awareness of optics and photonics.
Light curves for ''bump Cepheids'' computed with a dynamically zoned pulsation code
International Nuclear Information System (INIS)
Adams, T.F.; Castor, J.E.; Davis, C.G.
1978-01-01
The dynamically zoned pulsation code developed by Castor, Davis, and Davison has been used to recalculate the Goddard model and to calculate three other Cepheid models with the same period (9.8 days). This family of models shows how the bumps and other features of the light and velocity curves change as the mass is varied at constant period. This study, with a code that is capable of producing reliable light curves, shows again that the light and velocity curves for 9.8-day Cepheid models with standard homogeneous compositions do not show bumps like those that are observed unless the mass is significantly lower than the ''evolutionary mass.'' The light and velocity curves for the Goddard model presented here are similar to those computed independently by Fischel, Sparks, and Karp. They should be useful as standards for future investigators
Phenomenology of the Equivalence Principle with Light Scalars
Damour, Thibault; Donoghue, John F.
2010-01-01
Light scalar particles with couplings of sub-gravitational strength, which can generically be called 'dilatons', can produce violations of the equivalence principle. However, in order to understand experimental sensitivities one must know the coupling of these scalars to atomic systems. We report here on a study of the required couplings. We give a general Lagrangian with five independent dilaton parameters and calculate the "dilaton charge" of atomic systems for each of these. Two combinatio...
Application of a Light-Front Coupled Cluster Method
International Nuclear Information System (INIS)
Chabysheva, S.S.; Hiller, J.R.
2012-01-01
As a test of the new light-front coupled-cluster method in a gauge theory, we apply it to the nonperturbative construction of the dressed-electron state in QED, for an arbitrary covariant gauge, and compute the electron's anomalous magnetic moment. The construction illustrates the spectator and Fock-sector independence of vertex and self-energy contributions and indicates resolution of the difficulties with uncanceled divergences that plague methods based on Fock-space truncation. (author)
Light sources and light pollution
International Nuclear Information System (INIS)
Pichler, G.
2005-01-01
From the dawn of mankind fire and light sources in general played an essential role in everyday life and protection over night. The development of new light sources went through many stages and is now an immense technological achievement, but also a threat for the wildlife at night, mainly because of the so-called light pollution. This paper discusses several very successful light sources connected with low pressure mercury and sodium vapour electric discharges. The luminous efficacy, colour rendering index and other lighting features cannot be always satisfactory, but at least some of the features can be much better than those met by the standard tungsten filament bulbs. High-pressure metal-vapour discharge lamps definitely have a good colour rendering index and a relatively high luminosity. Different light sources with burners at high pressure are discussed, paying special attention to their spectrum. The paper investigates new trends in development through a number of examples with non-toxic elements and pulsed electric discharge, which may be good news in terms of clean environment and energy savings. Light emitting diodes have recently appeared as worthy competitors to conventional light sources. White LEDs have approached 100 lumen/Watt efficacy in laboratories. This suggests that in some not very distant future they could completely replace high-pressure lamps, at least in indoor lighting. The article speculates on new developments which combine trends in nano technology and material science. The paper concludes with light pollution in view of several recent observations of plant and animal life at night in the vicinity of strong light sources. Photo-induced changes at the cell level may completely alter the normal life of plants and animals.(author)
Brodsky, Stanley J.
2018-05-01
Light-front holography, together with superconformal algebra, have provided new insights into the physics of color confinement and the spectroscopy and dynamics of hadrons. As shown by de Alfaro, Fubini and Furlan, a mass scale can appear in the equations of motion without affecting the conformal invariance of the action if one adds a term to the Hamiltonian proportional to the dilatation operator or the special conformal operator. If one applies the procedure of de Alfaro et al. to the frame-independent light-front Hamiltonian, it leads uniquely to a confining q \\bar{q} potential κ ^4 ζ ^2, where ζ ^2 is the light-front radial variable related in momentum space to the q \\bar{q} invariant mass. The same result, including spin terms, is obtained using light-front holography—the duality between the front form and AdS_5, the space of isometries of the conformal group—if one modifies the action of AdS_5 by the dilaton e^{κ ^2 z^2} in the fifth dimension z. When one generalizes this procedure using superconformal algebra, the resulting light-front eigensolutions lead to a a unified Regge spectroscopy of meson, baryon, and tetraquarks, including supersymmetric relations between their masses and their wavefunctions. One also predicts hadronic light-front wavefunctions and observables such as structure functions, transverse momentum distributions, and the distribution amplitudes. The mass scale κ underlying confinement and hadron masses can be connected to the parameter Λ_{\\overline{MS}} in the QCD running coupling by matching the nonperturbative dynamics to the perturbative QCD regime. The result is an effective coupling α _s(Q^2) defined at all momenta. The matching of the high and low momentum transfer regimes determines a scale Q_0 which sets the interface between perturbative and nonperturbative hadron dynamics. I also discuss a number of applications of light-front phenomenology.
WOW: light print, light propel, light point
Glückstad, Jesper; Bañas, Andrew; Aabo, Thomas; Palima, Darwin
2012-10-01
We are presenting so-called Wave-guided Optical Waveguides (WOWs) fabricated by two-photon polymerization and capable of being optically manipulated into any arbitrary orientation. By integrating optical waveguides into the structures we have created freestanding waveguides which can be positioned anywhere in a sample at any orientation using real-time 3D optical micromanipulation with six degrees of freedom. One of the key aspects of our demonstrated WOWs is the change in direction of in-coupled light and the marked increase in numerical aperture of the out-coupled light. Hence, each light propelled WOW can tap from a relatively broad incident beam and generate a much more tightly confined light at its tip. The presentation contains both numerical simulations related to the propagation of light through a WOW and preliminary experimental demonstrations on our BioPhotonics Workstation. In a broader context, this research shows that optically trapped micro-fabricated structures can potentially help bridge the diffraction barrier. This structure-mediated paradigm may be carried forward to open new possibilities for exploiting beams from far-field optics down to the sub-wavelength domain.
Independence and Product Systems
Skeide, Michael
2003-01-01
Starting from elementary considerations about independence and Markov processes in classical probability we arrive at the new concept of conditional monotone independence (or operator-valued monotone independence). With the help of product systems of Hilbert modules we show that monotone conditional independence arises naturally in dilation theory.
Technology programs in support of advanced light water reactor plants: Construction
International Nuclear Information System (INIS)
Eichen, E.P.
1989-01-01
Under Contract No. AC03-86SF16565, Stone ampersand Webster Engineering Corporation (SWEC) is conducting several independent, yet interrelated, studies of light water reactor plants to improve constructibility and quality, to reduce costs and schedule durations, and to simplify design. This document discusses design requirements. 36 refs., 57 figs., 56 tabs
Blue Light Enhances Bacterial Clearance and Reduces Organ Injury During Sepsis.
Lewis, Anthony J; Zhang, Xianghong; Griepentrog, John E; Yuan, Du; Collage, Richard D; Waltz, Paul K; Angus, Derek C; Zuckerbraun, Brian S; Rosengart, Matthew R
2018-05-04
The physiology of nearly all mammalian organisms are entrained by light and exhibit circadian rhythm. The data derived from animal studies show that light influences immunity, and these neurophysiologic pathways are maximally entrained by the blue spectrum. Here, we hypothesize that bright blue light reduces acute kidney injury by comparison with either bright red or standard, white fluorescent light in mice subjected to sepsis. To further translational relevance, we performed a pilot clinical trial of blue light therapy in human subjects with appendicitis. Laboratory animal research, pilot human feasibility trial. University basic science laboratory and tertiary care hospital. Male C57BL/6J mice, adult (> 17 yr) patients with acute appendicitis. Mice underwent cecal ligation and puncture and were randomly assigned to a 24-hour photoperiod of bright blue, bright red, or ambient white fluorescent light. Subjects with appendicitis were randomized to receive postoperatively standard care or standard care plus high-illuminance blue light. Exposure to bright blue light enhanced bacterial clearance from the peritoneum, reduced bacteremia and systemic inflammation, and attenuated the degree of acute kidney injury. The mechanism involved an elevation in cholinergic tone that augmented tissue expression of the nuclear orphan receptor REV-ERBα and occurred independent of alterations in melatonin or corticosterone concentrations. Clinically, exposure to blue light after appendectomy was feasible and reduced serum interleukin-6 and interleukin-10 concentrations. Modifying the spectrum of light may offer therapeutic utility in sepsis.
The light gluino mass window revisited
Janot, Patrick
2003-01-01
The precise measurements of the ``electroweak observables'' performed at LEP and SLC are well consistent with the standard model predictions. Deviations from the standard model arising from vacuum polarization diagrams (also called ``weak loop corrections'') have been constrained in a model-independent manner with the epsilon formalism. Within the same formalism, additional deviations from new physics production processes can also be constrained, still in a model-independent way. For instance, a 95% C.L. limit of Delta Gamma_had} q qbar gluino gluino process, it allows an absolute lower limit to be set on the gluino mass, m_gluino > 6.3 GeV/c2 at 95% C.L., which definitely closes the so-called light gluino mass window. The precise measurements of the "electroweak observables" performed at LEP and SLC are well consistent with the standard model predictions. Deviations from the standard model arising from vacuum polarization diagrams (also called "weak loop corrections") have been constrained in a model-indepe...
Smart street lighting solution for remote rural areas of India
Hajra, Debdyut
2017-09-01
Though many smart street lighting solutions is available for urban areas, comparatively fewer solutions exist for rural areas. In the recent times, village streets have been illuminated with artificial lights as a part of rural development drive undertaken by the governments of respective countries. But, vehicle and pedestrian traffic is quite low through village roads. Hence, if light remains on all night long on such roads, then there is a huge wastage of energy. This calls for solutions to reduce this energy loss in an efficient manner. There are a lot of factors which must be kept in mind while designing solutions. Many villages lack the proper infrastructure to support new technologies. Communication facilities are limited, lack of local technically skilled labor, lack of security, etc. After evaluating these opportunities and challenges, an attempt has been made to devise a smart street lighting solution tailored for remote rural areas in India. One part of the solution discusses how intensity of the LED street lights can be varied according to the ambient lighting conditions using sensors and LED switching in LED matrix. An artificial intelligence (AI) has also been modelled to identify traffic conditions using PIR sensors and object identification through image processing and independently control the lights. It also tracks the performance and status of each light. It would send this data and necessary notifications to a distant control center for human evaluation. This solution is also applicable for other rural areas throughout the world.
Halo-independent direct detection of momentum-dependent dark matter
Energy Technology Data Exchange (ETDEWEB)
Cherry, John F. [Theoretical Division, Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States); Frandsen, Mads T.; Shoemaker, Ian M., E-mail: jcherry@lanl.gov, E-mail: frandsen@cp3-origins.net, E-mail: shoemaker@cp3-origins.net [CP3-Origins and the Danish Institute for Advanced Study, University of Southern Denmark, Campusvej 55, DK-5230 Odense M (Denmark)
2014-10-01
We show that the momentum dependence of dark matter interactions with nuclei can be probed in direct detection experiments without knowledge of the dark matter velocity distribution. This is one of the few properties of DM microphysics that can be determined with direct detection alone, given a signal of dark matter in multiple direct detection experiments with different targets. Long-range interactions arising from the exchange of a light mediator are one example of momentum-dependent DM. For data produced from the exchange of a massless mediator we find for example that the mediator mass can be constrained to be ∼< 10 MeV for DM in the 20-1000 GeV range in a halo-independent manner.
Halo-independent direct detection of momentum-dependent dark matter
International Nuclear Information System (INIS)
Cherry, John F.; Frandsen, Mads T.; Shoemaker, Ian M.
2014-01-01
We show that the momentum dependence of dark matter interactions with nuclei can be probed in direct detection experiments without knowledge of the dark matter velocity distribution. This is one of the few properties of DM microphysics that can be determined with direct detection alone, given a signal of dark matter in multiple direct detection experiments with different targets. Long-range interactions arising from the exchange of a light mediator are one example of momentum-dependent DM. For data produced from the exchange of a massless mediator we find for example that the mediator mass can be constrained to be ∼< 10 MeV for DM in the 20-1000 GeV range in a halo-independent manner
Light quantity affects the regulation of cell shape in Fremyella diplosiphon
Directory of Open Access Journals (Sweden)
Bagmi ePattanaik
2012-05-01
Full Text Available In some cyanobacteria, the color or prevalent wavelengths of ambient light can impact the protein or pigment composition of the light-harvesting complexes. In some cases, light color or quality impacts cellular morphology. The significance of changes in pigmentation is associated strongly with optimizing light absorption for photosynthesis, whereas the significance of changes in light quality-dependent cellular morphology is less well understood. In natural aquatic environments, light quality and intensity change simultaneously at varying depths of the water column. Thus, we hypothesize that changes in morphology that also have been attributed to differences in the prevalent wavelengths of available light may largely be associated with changes in light intensity. Fremyella diplosiphon shows highly reproducible light-dependent changes in pigmentation and morphology. Under red light (RL, F. diplosiphon cells are blue-green in color, due to the accumulation of high levels of phycocyanin, a RL- absorbing pigment in the light-harvesting complexes or phycobilisomes (PBSs, and the shape of cells are short and rounded. Conversely, under green light (GL, F. diplosiphon cells are red in color due to accumulation of GL- absorbing phycoerythrin in PBSs, and are longer and brick-shaped. GL is enriched at lower depths in the water column, where overall levels of light also are reduced, i.e., to 10% or less of the intensity found at the water surface. We hypothesize that longer cells under low light intensity, which is generally enriched in green wavelengths, are associated with greater levels of total photosynthetic pigments in the thylakoid membranes. To test this hypothesis, we grew F. diplosiphon under increasing intensities of GL and observed whether the length of cells diminished due to reduced pressure to maintain larger cells and the associated increased photosynthetic membrane capacity under high light intensity, independent of whether it is light of
Directory of Open Access Journals (Sweden)
Ilse M Remmers
Full Text Available Lipid production in microalgae is highly dependent on the applied light intensity. However, for the EPA producing model-diatom Phaeodactylum tricornutum, clear consensus on the impact of incident light intensity on lipid productivity is still lacking. This study quantifies the impact of different incident light intensities on the biomass, TAG and EPA yield on light in nitrogen starved batch cultures of P. tricornutum. The maximum biomass concentration and maximum TAG and EPA contents were found to be independent of the applied light intensity. The lipid yield on light was reduced at elevated light intensities (>100 μmol m-2 s-1. The highest TAG yield on light (112 mg TAG molph-1 was found at the lowest light intensity tested (60 μmol m-2 s-1, which is still relatively low to values reported in literature for other algae. Furthermore, mass balance analysis showed that the EPA fraction in TAG may originate from photosynthetic membrane lipids.
Directory of Open Access Journals (Sweden)
Kaustubh S Gadave
Full Text Available BACKGROUND: Xanthine oxidoreductase (XOR existing in two interconvertible forms, xanthine dehydrogenase (XDH and xanthine oxidase (XO, catabolises xanthine to uric acid that is further broken down to antioxidative agent allantoin. XOR also produces free radicals serving as second messenger and microbicidal agent. Large variation in the XO activity has been observed among various species. Both hypo and hyper activity of XOR leads to pathophysiological conditions. Given the important nutritional role of buffalo milk in human health especially in south Asia, it is crucial to understand the functional properties of buffalo XOR and the underlying structural basis of variations in comparison to other species. METHODS AND FINDINGS: Buffalo XO activity of 0.75 U/mg was almost half of cattle XO activity. Enzymatic efficiency (k cat/K m of 0.11 sec(-1 µM(-1 of buffalo XO was 8-10 times smaller than that of cattle XO. Buffalo XOR also showed lower antibacterial activity than cattle XOR. A CD value (Δε430 nm of 46,000 M(-1 cm(-1 suggested occupancy of 77.4% at Fe/S I centre. Buffalo XOR contained 0.31 molybdenum atom/subunit of which 48% existed in active sulfo form. The active form of XO in buffalo was only 16% in comparison to ∼30% in cattle. Sequencing revealed 97.4% similarity between buffalo and cattle XOR. FAD domain was least conserved, while metal binding domains (Fe/S and Molybdenum were highly conserved. Homology modelling of buffalo XOR showed several variations occurring in clusters, especially close to FAD binding pocket which could affect NAD(+ entry in the FAD centre. The difference in XO activity seems to be originating from cofactor deficiency, especially molybdenum. CONCLUSION: A major fraction of buffalo milk XOR exists in a catalytically inactive form due to high content of demolybdo and desulfo forms. Lower Fe/S content and structural factors might be contributing to lower enzymatic efficiency of buffalo XOR in a minor way.
Directory of Open Access Journals (Sweden)
María Alejandra Vorphal
Full Text Available Abstract Backgroud Ferredoxin NADP(H oxidoreductases (EC 1.18.1.2 (FNR are flavoenzymes present in photosynthetic organisms; they are relevant for the production of reduced donors to redox reactions, i.e. in photosynthesis, the reduction of NADP+ to NADPH using the electrons provided by Ferredoxin (Fd, a small FeS soluble protein acceptor of electrons from PSI in chloroplasts. In rhodophyta no information about this system has been reported, this work is a contribution to the molecular and functional characterization of FNR from Gracilaria chilensis, also providing a structural analysis of the complex FNR/Fd. Methods The biochemical and kinetic characterization of FNR was performed from the enzyme purified from phycobilisomes enriched fractions. The sequence of the gene that codifies for the enzyme, was obtained using primers designed by comparison with sequences of Synechocystis and EST from Gracilaria. 5′RACE was used to confirm the absence of a CpcD domain in FNRPBS of Gracilaria chilensis. A three dimensional model for FNR and Fd, was built by comparative modeling and a model for the complex FNR: Fd by docking. Results The kinetic analysis shows KMNADPH of 12.5 M and a kcat of 86 s−1, data consistent with the parameters determined for the enzyme purified from a soluble extract. The sequence for FNR was obtained and translated to a protein of 33646 Da. A FAD and a NADP+ binding domain were clearly identified by sequence analysis as well as a chloroplast signal sequence. Phycobilisome binding domain, present in some cyanobacteria was absent. Transcriptome analysis of Gch revealed the presence of two Fd; FdL and FdS, sharing the motif CX5CX2CX29X. The analysis indicated that the most probable partner for FNR is FdS. Conclusion The interaction model produced, was consistent with functional properties reported for FNR in plants leaves, and opens the possibilities for research in other rhodophyta of commercial interest.
Universal behavior in excited heavy-light and light-light mesons
International Nuclear Information System (INIS)
Olsson, M.G.
1997-01-01
A common pattern of large orbital and radial excitations in heavy-light and light-light mesons is demonstrated. For a general potential model with linear confinement the Regge slopes of the light degrees of freedom for these mesons are shown to be in the ratio of 2. The possibility of 'tower' degeneracy occurs only with pure scalar confinement. copyright 1997 The American Physical Society
Organizing Independent Student Work
Directory of Open Access Journals (Sweden)
Zhadyra T. Zhumasheva
2015-03-01
Full Text Available This article addresses issues in organizing independent student work. The author defines the term “independence”, discusses the concepts of independent learner work and independent learner work under the guidance of an instructor, proposes a classification of assignments to be done independently, and provides methodological recommendations as to the organization of independent student work. The article discusses the need for turning the student from a passive consumer of knowledge into an active creator of it, capable of formulating a problem, analyzing the ways of solving it, coming up with an optimum outcome, and proving its correctness. The preparation of highly qualified human resources is the primary condition for boosting Kazakhstan’s competitiveness. Independent student work is a means of fostering the professional competence of future specialists. The primary form of self-education is independent work.
Energy Technology Data Exchange (ETDEWEB)
United States. Bonneville Power Administration.
1992-09-01
Since lighting accounts for about one-third of the energy used in commercial buildings, there is opportunity to conserve. There are two ways to reduce lighting energy use: modify lighting systems so that they used less electricity and/or reduce the number of hours the lights are used. This booklet presents a number of ways to do both. Topics covered include: reassessing lighting levels, reducing lighting levels, increasing bulb & fixture efficiency, using controls to regulate lighting, and taking advantage of daylight.
Iriyama, Takayuki; Wang, Wei; Parchim, Nicholas F; Song, Anren; Blackwell, Sean C; Sibai, Baha M; Kellems, Rodney E; Xia, Yang
2015-06-01
Accumulation of hypoxia inducible factor-1α (HIF-1α) is commonly an acute and beneficial response to hypoxia, whereas chronically elevated HIF-1α is associated with multiple disease conditions, including preeclampsia, a serious hypertensive disease of pregnancy. However, the molecular basis underlying the persistent elevation of placental HIF-1α in preeclampsia and its role in the pathogenesis of preeclampsia are poorly understood. Here we report that Hif-1α mRNA and HIF-1α protein were elevated in the placentas of pregnant mice infused with angiotensin II type I receptor agonistic autoantibody, a pathogenic factor in preeclampsia. Knockdown of placental Hif-1α mRNA by specific siRNA significantly attenuated hallmark features of preeclampsia induced by angiotensin II type I receptor agonistic autoantibody in pregnant mice, including hypertension, proteinuria, kidney damage, impaired placental vasculature, and elevated maternal circulating soluble fms-like tyrosine kinase-1 levels. Next, we discovered that Hif-1α mRNA levels and HIF-1α protein levels were induced in an independent preeclampsia model with infusion of the inflammatory cytokine tumor necrosis factor superfamily member 14 (LIGHT). SiRNA knockdown experiments also demonstrated that elevated HIF-1α contributed to LIGHT-induced preeclampsia features. Translational studies with human placentas showed that angiotensin II type I receptor agonistic autoantibody or LIGHT is capable of inducing HIF-1α in a hypoxia-independent manner. Moreover, increased HIF-1α was found to be responsible for angiotensin II type I receptor agonistic autoantibody or LIGHT-induced elevation of Flt-1 gene expression and production of soluble fms-like tyrosine kinase-1 in human villous explants. Overall, we demonstrated that hypoxia-independent stimulation of HIF-1α gene expression in the placenta is a common pathogenic mechanism promoting disease progression. Our findings reveal new insight to preeclampsia and highlight
Baumschlager, Armin; Aoki, Stephanie K; Khammash, Mustafa
2017-11-17
Light has emerged as a control input for biological systems due to its precise spatiotemporal resolution. The limited toolset for light control in bacteria motivated us to develop a light-inducible transcription system that is independent from cellular regulation through the use of an orthogonal RNA polymerase. Here, we present our engineered blue light-responsive T7 RNA polymerases (Opto-T7RNAPs) that show properties such as low leakiness of gene expression in the dark state, high expression strength when induced with blue light, and an inducible range of more than 300-fold. Following optimization of the system to reduce expression variability, we created a variant that returns to the inactive dark state within minutes once the blue light is turned off. This allows for precise dynamic control of gene expression, which is a key aspect for most applications using optogenetic regulation. The regulators, which only require blue light from ordinary light-emitting diodes for induction, were developed and tested in the bacterium Escherichia coli, which is a crucial cell factory for biotechnology due to its fast and inexpensive cultivation and well understood physiology and genetics. Opto-T7RNAP, with minor alterations, should be extendable to other bacterial species as well as eukaryotes such as mammalian cells and yeast in which the T7 RNA polymerase and the light-inducible Vivid regulator have been shown to be functional. We anticipate that our approach will expand the applicability of using light as an inducer for gene expression independent from cellular regulation and allow for a more reliable dynamic control of synthetic and natural gene networks.
Lasers, light-atom interaction
International Nuclear Information System (INIS)
Cagnac, B.; Faroux, J.P.
2002-01-01
This book has a double purpose: first to explain in a way as simple as possible the interaction processes occurring between atoms and light waves, and secondly to help any scientist that needs further information to improve his knowledge of lasers. The content of this book has been parted into 3 more or less independent sections: 1) effect of an electromagnetic field on a 2-quantum state system, 2) operating mode of lasers in the framework of transition probabilities, and 3) calculation of the emitted wave. Einstein's phenomenological hypothesis has led to probability equations called rate equations, these equations do not give a true representation of the interaction process at the scale of the atom but this representation appears to be true on an average over a large population of atoms. Only quantum mechanics can describe accurately the light-atom interaction but at the cost of a far higher complexity. In the first part of the book quantum mechanics is introduced and applied under 2 simplifying hypothesis: -) the atom system has only 2 non-degenerate states and -) the intensity of the light wave is high enough to involve a large population of photons. Under these hypothesis, Rabi oscillations, Ramsey pattern and the splitting of Autler-Townes levels are explained. The second part is dedicated to the phenomenological model of Einstein that gives good results collectively. In the third part of the book, Maxwell equations are used to compute field spatial distribution that are currently found in experiments involving lasers. (A.C.)
Light-Intensity Physical Activity and All-Cause Mortality.
Loprinzi, Paul D
2017-07-01
Research demonstrates that moderate-to-vigorous physical activity (MVPA) is associated with a reduced risk of all-cause mortality. Few studies have examined the effects of light-intensity physical activity on mortality. Therefore, the purpose of this study was to examine the association between objectively measured light-intensity physical activity and all-cause mortality risk. Longitudinal. National Health and Nutrition Examination Survey 2003-2006 with follow-up through December 31, 2011. Five thousand five hundred seventy-five U.S. adults. Participants wore an accelerometer for at least 4 days and completed questionnaires to assess sociodemographics and chronic disease information, with blood samples taken to assess biological markers. Follow-up mortality status was assessed via death certificate data from the National Death Index. Cox proportional hazard model. After adjusting for accelerometer-determined MVPA, age, gender, race-ethnicity, cotinine, weight status, poverty level, C-reactive protein, and comorbid illness, for every 60-minute increase in accelerometer-determined light-intensity physical activity, participants had a 16% reduced hazard of all-cause mortality (hazard ratio = .84; 95% confidence interval: .78-.91; p physical activity was inversely associated with all-cause mortality risk, independent of age, MVPA, and other potential confounders. In addition to MVPA, promotion of light-intensity physical activity is warranted.
Solution-Grown ZnO Films toward Transparent and Smart Dual-Color Light-Emitting Diode.
Huang, Xiaohu; Zhang, Li; Wang, Shijie; Chi, Dongzhi; Chua, Soo Jin
2016-06-22
An individual light-emitting diode (LED) capable of emitting different colors of light under different bias conditions not only allows for compact device integration but also extends the functionality of the LED beyond traditional illumination and display. Herein, we report a color-switchable LED based on solution-grown n-type ZnO on p-GaN/n-GaN heterojunction. The LED emits red light with a peak centered at ∼692 nm and a full width at half-maximum of ∼90 nm under forward bias, while it emits green light under reverse bias. These two lighting colors can be switched repeatedly by reversing the bias polarity. The bias-polarity-switched dual-color LED enables independent control over the lighting color and brightness of each emission with two-terminal operation. The results offer a promising strategy toward transparent, miniaturized, and smart LEDs, which hold great potential in optoelectronics and optical communication.
Urban lighting, light pollution and society
Meier, Josiane; Krause, Katharina; Pottharst, Merle
2014-01-01
After decades "in the shadows", urban lighting is re-emerging as a matter of public debate. Long-standing truths are increasingly questioned as a confluence of developments affects lighting itself and the way it is viewed. Light has become an integral element of place-making and energy-saving initiatives alike. Rapidly evolving lighting technologies are opening up new possibilities, but also posing new challenges to planners, and awareness is growing that artificial illumination is not purely benign but can actually constitute a form of pollution. As a result, public policy frameworks, incentives and initiatives are undergoing a phase of innovation and change that will affect how cities are lit for years to come. The first comprehensive compilation of current scientific discussions on urban lighting and light pollution from a social science and humanities perspective, Urban Lighting, Light Pollution and Society contributes to an evolving international debate on an increasingly controversial topic. The contrib...
Weak decay constants of light and heavy pseudoscalar mesons
Energy Technology Data Exchange (ETDEWEB)
Barik, N [Physics Department, Utkal Univ., Bhubaneswar (India); Kar, S; Dash, P C [Physics Dept., Prananath College, Khurda (India)
1997-05-01
We investigate the weak leptonic decays of light and heavy pseudoscalar mesons in a relativistic quark model of independent quarks. We perform a static calculation of the decay constant f{sub M} purely on grounds of simplicity. In order to minimize the possible uncertainty in the static calculation, we estimate the ratios of the decay constants which are found to be in good agreement, in the heavy flavor sector, with the predictions of other models available in the literature and existing experimental data. However, there is a noticeable discrepancy in the current prediction for pion decay constant which demonstrates the inherent limitations of the static approximation in the study of non-strange light mesons. (author). 25 refs., 1 fig., 3 tabs.
On the k-independence required by linear probing and minwise independence
DEFF Research Database (Denmark)
Pǎtraşcu, Mihai; Thorup, Mikkel
2016-01-01
We show that linear probing requires 5-independent hash functions for expected constant-time performance, matching an upper bound of Pagh et al. [2009]. More precisely, we construct a random 4-independent hash function yielding expected logarithmic search time for certain keys. For (1 + ε......)-approximate minwise independence, we show that Ω(lg1 ε)-independent hash functions are required, matching an upper bound of Indyk [2001]. We also show that the very fast 2-independent multiply-shift scheme of Dietzfelbinger [1996] fails badly in both applications....
Directory of Open Access Journals (Sweden)
Maged A. Abu Adma
2017-12-01
Full Text Available This study explains a design of a fully independent -off grid- hybrid solar and wind road lighting system according to geography and weather conditions recorded from the Egyptian National Research Institute of Astronomy and Geophysics.Presenting here the virtual simulation by using Matlab/Simulink & real-time implementation of road lighting system consists of 150 W photovoltaic cell, 420 W wind generator, 100 Ah acid gel battery and LED lighting luminar 30 W -12 VDC . Over three different stages; 1.Operating the system with PV only as power source, 2. Switching to Wind generator only configuration and 3. Running the hybrid design with both PV & Wind power sources ; load characteristics and output real-time data will be recorded, evaluated ,compared and validated against the virtual simulation generated by Matlab/Simulink model.The results of this research will be used to investigate the advantages of using a hybrid system to counteract the limitations of solar and wind as solo renewable energy sources due to adverse weather conditions ,the efficiency of the proposed system as an alternative for the current conventional road lighting poles as well as the accuracy of the virtual model data in order to be used for future adaptation of the model for different geographical locations.
AdS/QCD and Applications of Light-Front Holography
Energy Technology Data Exchange (ETDEWEB)
Brodsky, Stanley J.; /SLAC /Southern Denmark U., CP3-Origins; Cao, Fu-Guang; /Massey U.; de Teramond, Guy F.; /Costa Rica U.
2012-02-16
Light-Front Holography leads to a rigorous connection between hadronic amplitudes in a higher dimensional anti-de Sitter (AdS) space and frame-independent light-front wavefunctions of hadrons in 3 + 1 physical space-time, thus providing a compelling physical interpretation of the AdS/CFT correspondence principle and AdS/QCD, a useful framework which describes the correspondence between theories in a modified AdS5 background and confining field theories in physical space-time. To a first semiclassical approximation, where quantum loops and quark masses are not included, this approach leads to a single-variable light-front Schroedinger equation which determines the eigenspectrum and the light-front wavefunctions of hadrons for general spin and orbital angular momentum. The coordinate z in AdS space is uniquely identified with a Lorentz-invariant coordinate {zeta} which measures the separation of the constituents within a hadron at equal light-front time. The internal structure of hadrons is explicitly introduced and the angular momentum of the constituents plays a key role. We give an overview of the light-front holographic approach to strongly coupled QCD. In particular, we study the photon-to-meson transition form factors (TFFs) F{sub M{gamma}}(Q{sup 2}) for {gamma}{gamma}* {yields} M using light-front holographic methods. The results for the TFFs for the {eta} and {eta}' mesons are also presented. Some novel features of QCD are discussed, including the consequences of confinement for quark and gluon condensates. A method for computing the hadronization of quark and gluon jets at the amplitude level is outlined.
Renormalizability and model-independent description of Z' signals at low energies
International Nuclear Information System (INIS)
Gulov, A.V.; Skalozub, V.V.
2000-01-01
The model-independent search for signals of heavy Z' gauge bosons in low-energy four-fermion processes is analyzed. It is shown that the renormalizability of the underlying theory containing Z', formulated as a scattering in the field of heavy virtual states, can be implemented in specific relations between different processes. Considering the two-Higgs-doublet model as the low-energy basis theory, the two types of Z' interactions with light particles are found to be compatible with the renormalizability. They are called the Abelian and the ''chiral'' couplings. Observables giving the possibility to uniquely detect Z' in both cases are introduced. (orig.)
Directory of Open Access Journals (Sweden)
W. Lucca-Junior
2009-02-01
Full Text Available Chaperone members of the protein disulfide isomerase family can catalyze the thiol-disulfide exchange reaction with pairs of cysteines. There are 14 protein disulfide isomerase family members, but the ability to catalyze a thiol disulfide exchange reaction has not been demonstrated for all of them. Human endoplasmic reticulum protein chaperone thio-oxidoreductase (ERp18 shows partial oxidative activity as a protein disulfide isomerase. The aim of the present study was to evaluate the participation of ERp18 in gonadotropin-releasing hormone receptor (GnRHR expression at the plasma membrane. Cos-7 cells were cultured, plated, and transfected with 25 ng (unless indicated wild-type human GnRHR (hGnRHR or mutant GnRHR (Cys14Ala and Cys200Ala and pcDNA3.1 without insert (empty vector or ERp18 cDNA (75 ng/well, pre-loaded for 18 h with 1 µCi myo-[2-3H(N]-inositol in 0.25 mL DMEM and treated for 2 h with buserelin. We observed a decrease in maximal inositol phosphate (IP production in response to buserelin in the cells co-transfected with hGnRHR, and a decrease from 20 to 75 ng of ERp18 compared with cells co-transfected with hGnRHR and empty vector. The decrease in maximal IP was proportional to the amount of ERp18 DNA over the range examined. Mutants (Cys14Ala and Cys200Ala that could not form the Cys14-Cys200 bridge essential for plasma membrane routing of the hGnRHR did not modify maximal IP production when they were co-transfected with ERp18. These results suggest that ERp18 has a reduction role on disulfide bonds in wild-type hGnRHR folding.
Energy Technology Data Exchange (ETDEWEB)
Flueck, Christa E., E-mail: christa.flueck@dkf.unibe.ch [Pediatric Endocrinology, Diabetology and Metabolism, University Children' s Hospital, Bern (Switzerland); Mallet, Delphine [Service d' Endocrinologie Moleculaire et Maladies Rares, Hospices Civils de Lyon, Bron (France); Hofer, Gaby [Pediatric Endocrinology, Diabetology and Metabolism, University Children' s Hospital, Bern (Switzerland); Samara-Boustani, Dinane [Hopital Necker-Enfants malades, Paris (France); Leger, Juliane [Hopital Robert Debre, Paris (France); Polak, Michel [Hopital Necker-Enfants malades, Paris (France); Morel, Yves [Service d' Endocrinologie Moleculaire et Maladies Rares, Hospices Civils de Lyon, Bron (France); Pandey, Amit V., E-mail: amit@pandeylab.org [Pediatric Endocrinology, Diabetology and Metabolism, University Children' s Hospital, Bern (Switzerland)
2011-09-09
Highlights: {yields} Mutations in human POR cause congenital adrenal hyperplasia. {yields} We are reporting a novel 3 amino acid deletion mutation in POR P399{sub E}401del. {yields} POR mutation P399{sub E}401del decreased P450 activities by 60-85%. {yields} Impairment of steroid metabolism may be caused by multiple hits. {yields} Severity of aromatase inhibition is related to degree of in utero virilization. -- Abstract: P450 oxidoreductase (POR) is the electron donor for all microsomal P450s including steroidogenic enzymes CYP17A1, CYP19A1 and CYP21A2. We found a novel POR mutation P399{sub E}401del in two unrelated Turkish patients with 46,XX disorder of sexual development. Recombinant POR proteins were produced in yeast and tested for their ability to support steroid metabolizing P450 activities. In comparison to wild-type POR, the P399{sub E}401del protein was found to decrease catalytic efficiency of 21-hydroxylation of progesterone by 68%, 17{alpha}-hydroxylation of progesterone by 76%, 17,20-lyase action on 17OH-pregnenolone by 69%, aromatization of androstenedione by 85% and cytochrome c reduction activity by 80%. Protein structure analysis of the three amino acid deletion P399{sub E}401 revealed reduced stability and flexibility of the mutant. In conclusion, P399{sub E}401del is a novel mutation in POR that provides valuable genotype-phenotype and structure-function correlation for mutations in a different region of POR compared to previous studies. Characterization of P399{sub E}401del provides further insight into specificity of different P450s for interaction with POR as well as nature of metabolic disruptions caused by more pronounced effect on specific P450s like CYP17A1 and aromatase.
Bailleul, B.; Park, J.; Brown, C. M.; Bidle, K. D.; Lee, S.; Falkowski, P. G.
2016-02-01
For decades, a lack of understanding of how respiration is influenced by light has been stymying our ability to quantitatively analyze how phytoplankton allocate carbon in situ and the biological mechanisms that participate to the fate of blooms. Using membrane inlet mass spectrometry (MIMS), the light dependencies of gross photosynthesis and oxygen uptake rates were measured during the bloom demises of two prymnesiophytes, in two open ocean regions. In the North Atlantic, dominated by Emiliania huxleyi, respiration was independent of irradiance and was higher than the gross photosynthetic rate at all irradiances. In the Amundsen Sea (Antarctica), dominated by Phaeocystis antarctica, the situation was very different. Dark respiration was one order of magnitude lower than the maximal gross photosynthetic rate. ut the oxygen uptake rate increased by 10 fold at surface irradiances, where it becomes higher than gross photosynthesis. Our results suggest that the light dependence of oxygen uptake in P. antarctica has two sources: one is independent of photosynthesis, and is possibly associated with the photo-reduction of O2 mediated by dissolved organic matter; the second reflects the activity of an oxidase fueled in the light with photosynthetic electron flow. Interestingly, these dramatic light-dependent changes in oxygen uptake were not reproduced in nutrient-replete P. antarctica cultures, in the laboratory. Our measurements highlight the importance of improving our understanding of oxygen consuming reactions in the euphotic zone, which is critical to investigating the physiology of phytoplankton and tracing the fate of phytoplankton blooms.
Behavioural environments and niche construction: the evolution of dim-light foraging in bees.
Wcislo, William T; Tierney, Simon M
2009-02-01
Most bees forage for floral resources during the day, but temporal patterns of foraging activity vary extensively, and foraging in dim-light environments has evolved repeatedly. Facultative dim-light foraging behaviour is known in five of nine families of bees, while obligate behaviour is known in four families and evolved independently at least 19 times. The light intensity under which bees forage varies by a factor of 10(8), and therefore the evolution of dim-light foraging represents the invasion of a new, extreme niche. The repeated evolution of dim-light foraging behaviour in bees allows tests of the hypothesis that behaviour acts as an evolutionary pacemaker. With the exception of one species of Apis, facultative dim-light foragers show no external structural traits that are thought to enable visually mediated flight behaviour in low-light environments. By contrast, most obligate dim-light foragers show a suite of convergent optical traits such as enlarged ocelli and compound eyes. In one intensively studied species (Megalopta genalis) these optical changes are associated with neurobiological changes to enhance photon capture. The available ecological evidence suggests that an escape from competition for pollen and nectar resources and avoidance of natural enemies are driving factors in the evolution of obligate dim-light foraging.
Dissipation and entanglement dynamics for two interacting qubits coupled to independent reservoirs
Energy Technology Data Exchange (ETDEWEB)
Scala, M [Departamento de Optica, Facultad de Fisica, Universidad Complutense de Madrid, 28040 (Spain); Migliore, R [CNR-INFM, CNISM and Dipartimento di Scienze Fisiche ed Astronomiche dell' Universita di Palermo, via Archirafi 36, I-90123 Palermo (Italy); Messina, A [MIUR and Dipartimento di Scienze Fisiche ed Astronomiche dell' Universita di Palermo, via Archirafi 36, I-90123 Palermo (Italy)], E-mail: matteo.scala@fisica.unipa.it, E-mail: rosanna@fisica.unipa.it, E-mail: messina@fisica.unipa.it
2008-10-31
We derive the master equation of a system of two coupled qubits by taking into account their interaction with two independent bosonic baths. Important features of the dynamics are brought to light, such as the structure of the stationary state at general temperatures and the behaviour of the entanglement at zero temperature, showing the phenomena of sudden death and sudden birth as well as the presence of stationary entanglement for long times. The model presented here is quite versatile and can be of interest in the study of both Josephson junction architectures and cavity-QED.
Hirose, Fumiaki; Inagaki, Noritoshi; Hanada, Atsushi; Yamaguchi, Shinjiro; Kamiya, Yuji; Miyao, Akio; Hirochika, Hirohiko; Takano, Makoto
2012-01-01
In contrast to a wealth of knowledge about the photoregulation of gibberellin metabolism in dicots, that in monocots remains largely unclear. In this study, we found that a blue light signal triggers reduction of active gibberellin content in rice seedlings with simultaneous repression of two gibberellin 20-oxidase genes (OsGA20ox2 and OsGA20ox4) and acute induction of four gibberellin 2-oxidase genes (OsGA2ox4–OsGA2ox7). For further examination of the regulation of these genes, we establishe...
A Priori Implementation Effort Estimation for HW Design Based on Independent-Path Analysis
DEFF Research Database (Denmark)
Abildgren, Rasmus; Diguet, Jean-Philippe; Bomel, Pierre
2008-01-01
that with the proposed approach it is possible to estimate the hardware implementation effort. This approach, part of our light design space exploration concept, is implemented in our framework ‘‘Design-Trotter'' and offers a new type of tool that can help designers and managers to reduce the time-to-market factor......This paper presents a metric-based approach for estimating the hardware implementation effort (in terms of time) for an application in relation to the number of linear-independent paths of its algorithms. We exploit the relation between the number of edges and linear-independent paths...... in an algorithm and the corresponding implementation effort. We propose an adaptation of the concept of cyclomatic complexity, complemented with a correction function to take designers' learning curve and experience into account. Our experimental results, composed of a training and a validation phase, show...
Establishing a green lights revolving fund
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-07-01
The report details the experiences of the City of Houston in establishing a Green Lights Revolving Fund. It provides examples of key documents and guidelines which can be used in other jurisdictions to establish an internal revolving fund to provide continuing monies through recapture of cost savings for an ongoing program of energy improvements in governmental facilities. It provides guidelines on how to establish a continuing source of funds for governmental facility energy improvements. The report provides background information on the ongoing energy improvement programs in the City of Houston, including its participation in the Environmental Protection Agency`s Green Lights Program. It reviews the steps required to establish a Green Lights Revolving Fund, including the administrative, legal, budgetary, accounting, interdepartmental, mayoral, and governing body approvals and actions needed to create a self-sustaining revolving fund devoted to energy improvements. The report also describes two funding sources in addition to the grant seed funds which were used to increase the initial funds available in the Green Lights Revolving Fund. It provides sample documents for modification and use in other jurisdictions that want to use similar funding sources. It reports the initial project submission and selection procedure and criteria, and provides a transferable project application kit based on the criteria specified. It also details a sample repayment memorandum of understanding between departments, which can be used in other governments. Other transferable products provided in the report are sample energy audit summaries which were conducted by qualified, independent staff to determine the accuracy of the departmental project costs and savings payback calculations.
Huang, D Y; Ichikawa, Y
1997-03-07
Rabbit liver cytosol exhibits very high retinol dehydrogenase activity. At least two retinol dehydrogenases were demonstrated to exist in rabbit liver cytosol, and the major one, a cytosolic NADP(H)-dependent retinol dehydrogenase (systematic name: retinol oxidoreductase) was purified about 1795-fold to electrophoretic and column chromatographic homogeneity by a procedure involving column chromatography on AF-Red Toyopearl twice and then hydroxyapatite. Its molecular mass was estimated to be 34 kDa by SDS-PAGE, and 144 kDa by HPLC gel filtration, suggesting that it is a homo-tetramer. The enzyme uses free retinol and retinal, and their complexes with CRBP as substrates in vitro. The optimum pH values for retinol oxidation of free retinol and CRBP-retinol were 8.8-9.2 and 8.0-9.0, respectively, and those for retinal reduction of free retinal and retinal-CRBP were the same, 7.0-7.6. Km for free retinol and Vmax for retinal formation were 2.8 microM and 2893 nmol/min per mg protein at 37 degrees C (pH 9.0) and the corresponding values with retinol-CRBP as a substrate were 2.5 microM and 2428 nmol/min per mg protein at 37 degrees C (pH 8.6); Km for free retinal and Vmax for retinol formation were 6.5 microM and 4108 nmol/min per mg protein, and the corresponding values with retinal-CRBP as a substrate were 5.1 microM and 3067 nmol/min per mg protein at 37 degrees C, pH 7.4. NAD(H) was not effective as a cofactor. 4-Methylpyrazole was a weak inhibitor (IC50 = 28 mM) of the enzyme, and ethanol was neither a substrate nor an inhibitor of the enzyme. This enzyme exhibits relatively broad aldehyde reductase activity and some ketone reductase activity, the activity for aromatic substitutive aldehydes being especially high and effective. Whereas, except in the case of retinol, oxidative activity toward the corresponding alcohols was not detected. This novel cytosolic enzyme may play an important role in vivo in maintaining the homeostasis of retinal, the substrate of retinoic
2011-12-09
... and 72-3] In the Matter of Carolina Power & Light Company, H.B. Robinson Steam Electric Plant, Unit No. 2, H. B. Robinson Steam Electric Plant, Unit 2, Independent Spent Fuel Storage Installation; Order Approving Indirect Transfer of Control of Licenses I. Carolina Power & Light Company (CP&L, the licensee) is...
Concealing with structured light.
Sun, Jingbo; Zeng, Jinwei; Wang, Xi; Cartwright, Alexander N; Litchinitser, Natalia M
2014-02-13
While making objects less visible (or invisible) to a human eye or a radar has captured people's imagination for centuries, current attempts towards realization of this long-awaited functionality range from various stealth technologies to recently proposed cloaking devices. A majority of proposed approaches share a number of common deficiencies such as design complexity, polarization effects, bandwidth, losses and the physical size or shape requirement complicating their implementation especially at optical frequencies. Here we demonstrate an alternative way to conceal macroscopic objects by structuring light itself. In our approach, the incident light is transformed into an optical vortex with a dark core that can be used to conceal macroscopic objects. Once such a beam passed around the object it is transformed back into its initial Gaussian shape with minimum amplitude and phase distortions. Therefore, we propose to use that dark core of the vortex beam to conceal an object that is macroscopic yet small enough to fit the dark (negligibly low intensity) region of the beam. The proposed concealing approach is polarization independent, easy to fabricate, lossless, operates at wavelengths ranging from 560 to 700 nm, and can be used to hide macroscopic objects providing they are smaller than vortex core.
Directory of Open Access Journals (Sweden)
Roberto Vincis
2015-07-01
Full Text Available Functional brain-imaging techniques used in humans and animals, such as functional MRI and intrinsic optical signal (IOS imaging, are thought to largely rely on neurovascular coupling and hemodynamic responses. Here, taking advantage of the well-described micro-architecture of the mouse olfactory bulb, we dissected the nature of odor-evoked IOSs. Using in vivo pharmacology in transgenic mouse lines reporting activity in different cell types, we show that parenchymal IOSs are largely independent of neurotransmitter release and neurovascular coupling. Furthermore, our results suggest that odor-evoked parenchymal IOSs originate from changes in light scattering of olfactory sensory neuron axons, mostly due to water movement following action potential propagation. Our study sheds light on a direct correlate of neuronal activity, which may be used for large-scale functional brain imaging.
Distributed Large Independent Sets in One Round On Bounded-independence Graphs
Halldorsson , Magnus M.; Konrad , Christian
2015-01-01
International audience; We present a randomized one-round, single-bit messages, distributed algorithm for the maximum independent set problem in polynomially bounded-independence graphs with poly-logarithmic approximation factor. Bounded-independence graphs capture various models of wireless networks such as the unit disc graphs model and the quasi unit disc graphs model. For instance, on unit disc graphs, our achieved approximation ratio is O((log(n)/log(log(n)))^2).A starting point of our w...
Simultaneous fit of the spectra of light and heavy self-conjugate mesons
International Nuclear Information System (INIS)
Jena, S.N.
1983-01-01
It is shown that a simultaneous nonrelativistic fit of the spectra of both the light and heavy self-conjugate mesons is possible by an effective non-Coulombic power-law potential of the form V(r) = Ar/sup 0.1/+V 0 . This purely phenomenological potential is found to provide a very good account of the mass spectra and the leptonic decay widths of the rho 0 , theta, psi, and UPSILON systems in a flavor-independent manner. In spite of the smallness of the constituent quark masses involved, the nonrelativistic fit for the light mesons of rho 0 and theta systems is excellent
NCBI nr-aa BLAST: CBRC-TSYR-01-0989 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TSYR-01-0989 ref|XP_002627763.1| glucose-methanol-choline oxidoreductase [Ajel...lomyces dermatitidis SLH14081] gb|EEQ75403.1| glucose-methanol-choline oxidoreductase [Ajellomyces dermatiti...dis SLH14081] gb|EEQ88001.1| glucose-methanol-choline oxidoreductase [Ajellomyces dermatitidis ER-3] XP_002627763.1 9.8 28% ...
Segura-Jiménez, Víctor; Soriano-Maldonado, Alberto; Estévez-López, Fernando; Álvarez-Gallardo, Inmaculada C; Delgado-Fernández, Manuel; Ruiz, Jonatan R; Aparicio, Virginia A
We examined independent and joint associations of objectively measured physical activity (PA) and physical fitness (PF) with pain, fatigue and the overall impact of fibromyalgia in 386 fibromyalgia women aged 51.2 ± 7.6 years. Levels of PA (light, moderate and vigorous) and PF were measured with
Light-like noncommutativity, light-front quantization and new light on UV/IR mixing
International Nuclear Information System (INIS)
Sheikh-Jabbari, M.M.; Tureanu, A.
2011-01-01
We revisit the problem of quantizing field theories on noncommutative Moyal space-time with light-like noncommutativity. To tackle the issues arising from noncommuting and hence nonlocal time, we argue that for this case light-front quantization procedure should be employed. In this appropriate quantization scheme we perform the non-planar loop analysis for the light-like noncommutative field theories. One of the important and peculiar features of light-front quantization is that the UV cutoff of the light-cone Hamiltonian manifests itself as an IR cutoff for the light-cone momentum, p + . Due to this feature, the naive results of covariant quantization for the light-like case allude to the absence of the UV/IR mixing in the light-front quantization. However, by a careful analysis of non-planar loop integrals we show that this is not the case and the UV/IR mixing persists. In addition, we argue in favour of the perturbative unitarity of light-like noncommutative field theories in the light-front quantization scheme.
LightSavers : accelerating advanced outdoor lighting
Energy Technology Data Exchange (ETDEWEB)
Purcell, B.; Pickering, M.
2010-01-15
This paper provided an update to the Toronto Atmospheric Fund (TAF) LightSavers program. The program was designed to accelerate market transformation for light emitting diode (LED) and advanced lighting management systems in outdoor lighting applications. It is expected that the program will result in significant electricity savings and emissions reductions within the Greater Toronto Area (GTA) and other Ontario municipalities. The first phase of the program established advanced outdoor lighting pilot programs in parking lots, garages, and pathway lighting applications that were guided by a common monitoring protocol to ensure useful and reliable assessment of the pilot programs. The TAF has since developed a strategy to strengthen public understanding and support for the use of advanced lighting, and continues to address policy issues that may impact the future of LED lighting programs. The TAF has also activated an electronic newsletter, delivered public workshops, and has been represented at several conferences. A working partnership has been established with Toronto Hydro Energy Services. Five pilot sites have been installed and have begun to provide monitoring data. Details of the pilot programs were provided. 16 figs.
Matute-Blanch, Clara; Villar, Luisa M; Álvarez-Cermeño, José C; Rejdak, Konrad; Evdoshenko, Evgeniy; Makshakov, Gleb; Nazarov, Vladimir; Lapin, Sergey; Midaglia, Luciana; Vidal-Jordana, Angela; Drulovic, Jelena; García-Merino, Antonio; Sánchez-López, Antonio J; Havrdova, Eva; Saiz, Albert; Llufriu, Sara; Alvarez-Lafuente, Roberto; Schroeder, Ina; Zettl, Uwe K; Galimberti, Daniela; Ramió-Torrentà, Lluís; Robles, René; Quintana, Ester; Hegen, Harald; Deisenhammer, Florian; Río, Jordi; Tintoré, Mar; Sánchez, Alex; Montalban, Xavier; Comabella, Manuel
2018-04-01
The prognostic role of cerebrospinal fluid molecular biomarkers determined in early pathogenic stages of multiple sclerosis has yet to be defined. In the present study, we aimed to investigate the prognostic value of chitinase 3 like 1 (CHI3L1), neurofilament light chain, and oligoclonal bands for conversion to clinically isolated syndrome and to multiple sclerosis in 75 patients with radiologically isolated syndrome. Cerebrospinal fluid levels of CHI3L1 and neurofilament light chain were measured by enzyme-linked immunosorbent assay. Uni- and multivariable Cox regression models including as covariates age at diagnosis of radiologically isolated syndrome, number of brain lesions, sex and treatment were used to investigate associations between cerebrospinal fluid CHI3L1 and neurofilament light chain levels and time to conversion to clinically isolated syndrome and multiple sclerosis. Neurofilament light chain levels and oligoclonal bands were independent risk factors for the development of clinically isolated syndrome (hazard ratio = 1.02, P = 0.019, and hazard ratio = 14.7, P = 0.012, respectively) and multiple sclerosis (hazard ratio = 1.03, P = 0.003, and hazard ratio = 8.9, P = 0.046, respectively). The best cut-off to classify cerebrospinal fluid neurofilament light chain levels into high and low was 619 ng/l, and high neurofilament light chain levels were associated with a trend to shorter time to clinically isolated syndrome (P = 0.079) and significant shorter time to multiple sclerosis (P = 0.017). Similarly, patients with radiologically isolated syndrome presenting positive oligoclonal bands converted faster to clinically isolated syndrome and multiple sclerosis (P = 0.005 and P = 0.008, respectively). The effects of high neurofilament light chain levels shortening time to clinically isolated syndrome and multiple sclerosis were more pronounced in radiologically isolated syndrome patients with ≥37 years compared to younger patients. Cerebrospinal fluid
Optical parametric amplification of arbitrarily polarized light in periodically poled LiNbO3.
Shao, Guang-hao; Song, Xiao-shi; Xu, Fei; Lu, Yan-qing
2012-08-13
Optical parametric amplification (OPA) of arbitrarily polarized light is proposed in a multi-section periodically poled Lithium Niobate (PPLN). External electric field is applied on selected sections to induce the polarization rotation of involved lights, thus the quasi-phase matched optical parametric processes exhibit polarization insensitivity under suitable voltage. In addition to the amplified signal wave, an idler wave with the same polarization is generated simultaneously. As an example, a ~10 times OPA showing polarization independency is simulated. Applications of this technology are also discussed.
The design of the light-flash warning light
Wang, Junli
2018-05-01
In today's society, the warning light has been used widely in people's daily life and various industries and agricultures. It is important to protect people's life and security. Light-flashing warning light is a kind of warning light control equipment which can control warning light automatically open and work in the state of blinking after dark, and it can automatically shut down after the dawn. It can achieve the flashing light automatic control and dual function. At present, light-flashing warning lights are mainly used in the projects of municipal construction. It is helpful to warn people and vehicles that passed in the construction site and ensure personal safety through using light-flashing warning light. Its design is simple, its performance is stable and it is also very convince to use it.
Media independence and dividend policy
DEFF Research Database (Denmark)
Farooq, Omar; Dandoune, Salma
2012-01-01
independence and dividend policies in emerging markets. Using a dataset from twenty three emerging markets, we show a significantly negative relationship between dividend policies (payout ratio and decision to pay dividend) and media independence. We argue that independent media reduces information asymmetries...... for stock market participants. Consequently, stock market participants in emerging markets with more independent media do not demand as high and as much dividends as their counterparts in emerging markets with less independent media. We also show that press independence is more important in defining......Can media pressurize managers to disgorge excess cash to shareholders? Do firms in countries with more independent media follow different dividend policies than firms with less independent media? This paper seeks to answer these questions and aims to document the relationship between media...
Origin of Infrared Light Modulation in Reflectance-Mode Photoplethysmography.
Directory of Open Access Journals (Sweden)
Igor S Sidorov
Full Text Available We recently pointed out the important role of dermis deformation by pulsating arterial pressure in the formation of a photoplethysmographic signal at green light. The aim of this study was to explore the role of this novel finding in near-infrared (NIR light. A light-emitting diode (LED-based imaging photoplethysmography (IPPG system was used to detect spatial distribution of blood pulsations under frame-to-frame switching green and NIR illumination in the palms of 34 healthy individuals. We observed a significant increase of light-intensity modulation at the heartbeat frequency for both illuminating wavelengths after a palm was contacted with a glass plate. Strong positive correlation between data measured at green and NIR light was found, suggesting that the same signal was read independently from the depth of penetration. Analysis of the data shows that an essential part of remitted NIR light is modulated in time as a result of elastic deformations of dermis caused by variable blood pressure in the arteries. Our observations suggest that in contrast with the classical model, photoplethysmographic waveform originates from the modulation of the density of capillaries caused by the variable pressure applied to the skin from large blood vessels. Particularly, beat-to-beat transmural pressure in arteries compresses/decompresses the dermis and deforms its connective-tissue components, thus affecting the distance between the capillaries, which results in the modulation of absorption and scattering coefficients of both green and NIR light. These findings are important for the correct interpretation of this widely used medical technique, which may have novel applications in diagnosis and treatment monitoring of aging and skin diseases.
Concept of white light in stage lighting
Rinaldi, Mauricio R.
2002-06-01
In perceiving objects, generally we see them in a white light situation. But, actually, there is not an absolute white, in such a manner that the different light sources have a determined kind of white, what it is known as color temperature. Even the white light may be of different kinds (different color temperature), the individual mind tends to perceive it as the same kind of white, that is to say, there is in our mind a psychological function by which we operate an integration in the perception in order to do the object perceptually invariable. On the other hand, it is a common practice in stage lighting to use color light sources. It is a well known phenomenon that a color of light produces a change in the object color perception. However, when we go to theater, we see the objects as having their real color, even if the lighting is not white. In this paper the concept of white light in stage lighting is presented, showing its possibilities of aesthetical expression.
International Nuclear Information System (INIS)
Le Tien Thanh; Le Ngoc Trieu; Nguyen Tuong Mien; Huynh Thi Trung; Phan Quoc Minh
2014-01-01
Super blue and red light LEDs and other electric, electronic components are used to design and establish 11 independent illumination systems, each system can arbitrarily control to operate at 55 molarities of illumination which are different from together in monochromatic lights combination and total illumination intensity based on the microcontrollers. Programs for loading to microcontrollers were created to base on theoretical calculation and experimental correction. The illumination cycles can be controlled by setting the timer. These 11 systems and another fluorescent light illumination were used to execute the experiment for investigation the effects of monochromatic lights combination on in vitro shoot proliferation stage in Chrysanthemum and Phalaenopsis orchid. Results from this experiment showed that illumination intensity of 400 lux is suitable for chrysanthemum, 750 lux is suitable for Phalaenopsis orchid and rate of 70% red light-30% blue light are suitable for both kinds of these plants. (author)
Russo, Monia Teresa; Annunziata, Rossella; Sanges, Remo; Ferrante, Maria Immacolata; Falciatore, Angela
2015-12-01
Diatoms are a key phytoplankton group in the contemporary ocean, showing extraordinary adaptation capacities to rapidly changing environments. The recent availability of whole genome sequences from representative species has revealed distinct features in their genomes, like novel combinations of genes encoding distinct metabolisms and a significant number of diatom-specific genes. However, the regulatory mechanisms driving diatom gene expression are still largely uncharacterized. Considering the wide variety of fields of study orbiting diatoms, ranging from ecology, evolutionary biology to biotechnology, it is thus essential to increase our understanding of fundamental gene regulatory processes such as transcriptional regulation. To this aim, we explored the functional properties of the 5'-flanking region of the Phaeodatylum tricornutum Lhcf2 gene, encoding a member of the Light Harvesting Complex superfamily and we showed that this region enhances transcription of a GUS reporter gene in an orientation- and distance-independent fashion. This represents the first example of a cis-regulatory sequence with enhancer-like features discovered in diatoms and it is instrumental for the generation of novel genetic tools and diatom exploitation in different areas of study. Copyright © 2015 Elsevier B.V. All rights reserved.
Probing new light force-mediators by isotope shift spectroscopy
International Nuclear Information System (INIS)
Berengut, Julian C.; Budker, Dmitry; California Univ., Berkeley, CA; Lawrence Berkeley National Laboratory, Berkeley, CA; Delaunay, Cedric
2017-04-01
In this Letter we explore the potential of probing new light force-carriers, with spin-independent couplings to the electron and the neutron, using precision isotope shift spectroscopy. We develop a formalism to interpret linear King plots as bounds on new physics with minimal theory inputs. We focus only on bounding the new physics contributions that can be calculated independently of the Standard Model nuclear effects. We apply our method to existing Ca"+ data and project its sensitivity to possibly existing new bosons using narrow transitions in other atoms and ions (specifically, Sr and Yb). Future measurements are expected to improve the relative precision by five orders of magnitude, and can potentially lead to an unprecedented sensitivity for bosons within the 10 keV to 10 MeV mass range.
Probing new light force-mediators by isotope shift spectroscopy
Energy Technology Data Exchange (ETDEWEB)
Berengut, Julian C. [New South Wales Univ., Sydney, NSW (Australia). School of Physics; Budker, Dmitry [Mainz Univ. (Germany). Helmholtz-Inst. Mainz; California Univ., Berkeley, CA (United States). Physics Dept.; Lawrence Berkeley National Laboratory, Berkeley, CA (United States). Nuclear Science Div.; Delaunay, Cedric [Savoie Mont Blanc Univ., Annecy-le-Vieux (France). Laboratoire d' Annecy-le-Vieux de Physique Theorique LAPTh; and others
2017-04-15
In this Letter we explore the potential of probing new light force-carriers, with spin-independent couplings to the electron and the neutron, using precision isotope shift spectroscopy. We develop a formalism to interpret linear King plots as bounds on new physics with minimal theory inputs. We focus only on bounding the new physics contributions that can be calculated independently of the Standard Model nuclear effects. We apply our method to existing Ca{sup +} data and project its sensitivity to possibly existing new bosons using narrow transitions in other atoms and ions (specifically, Sr and Yb). Future measurements are expected to improve the relative precision by five orders of magnitude, and can potentially lead to an unprecedented sensitivity for bosons within the 10 keV to 10 MeV mass range.
Light mediators in dark matter direct detections
International Nuclear Information System (INIS)
Li, Tai; Miao, Sen; Zhou, Yu-Feng
2015-01-01
In an extended effective operator framework, we investigate in detail the effects of light mediators on the event spectra of dark matter (DM)-nucleus scatterings. The presence of light mediators changes the interpretation of the current experimental data, especially the determination of DM particle mass. We show by analytic and numerical illustrations that in general for all the operators relevant to spin-independent scatterings, the DM particle mass allowed by a given set of experimental data increases significantly when the mediator particle becomes lighter. For instance, in the case of CDMS-II-Si experiment, the allowed DM particle mass can reach ∼50 (100) GeV at 68% (90%) confidence level, which is much larger than ∼10 GeV in the case with contact interactions. The increase of DM particle mass saturates when the mediator mass is below O(10) MeV. The upper limits from other experiments such as SuperCDMS, CDMSlite, CDEX, XENON10/100, LUX, PandaX etc. all tend to be weaker toward high DM mass regions. In a combined analysis, we show that the presence of light mediators can partially relax the tension in the current results of CDMS-II-Si, SuperCDMS and LUX
Some properties of light propagation in relativity
International Nuclear Information System (INIS)
Bazanski, Stanislaw L.
1998-01-01
An outline of a formalism is proposed that describes relativistic effects associated with the propagation of light rays which after being initially split start to reconverge and intersect each other again. Beside a general geometric description that uses the approach of geometric optics, it has been shown how to compute both the difference of the proper times of arrivals of the two light beams to a measuring apparatus, as well as the frequency shifts of each of the beams taken separately. The formalism used here is applicable to both the special and the general theory of relativity, and it can be used equally well either when the light split is produced by a man-made optical device or when it is caused by the gravity field itself. The geometric description used in the formalism is independent of the physical origin of the frequency shift; of whether it is a Doppler, gravitational or cosmological frequency shift effect. Two simple examples of the application of the formalism have been worked out, which illustrate its results for families of inertial and noninertial observers respectively. Furthermore, a short description of a continuous version of the formalism has been presented in the last section of the article
Matrix converter applied to energy saving for street lighting systems
Román Lumbreras, Manuel; Velasco Quesada, Guillermo; Conesa Roca, Alfons
2010-01-01
This work presents a three-phase AC-AC converter, with independent phase control, based on matrix-converter structure. This converter is applied to electrical energy saving on the public lighting systems by means of regulation and control of the voltage applied to the lamps. The developed converter represents a technological improvement with respect to the traditional systems based on an autotransformer: it reduces system cost and volume, and increases lamps lifetime.
Experimental stations at I13 beamline at Diamond Light Source
Pešić, Z. D.; De Fanis, A.; Wagner, U.; Rau, C.
2013-03-01
The I13 beamline of Diamond Light Source has been operational since December 2011. The beamline encompass two fully independent branches devoted to coherent imaging experiments (coherent x-ray diffraction, coherent diffraction imaging and ptychography) and x-ray imaging (in-line phase contrast imaging, tomography and full-field microscopy). This paper gives an overview of the current status of experimental stations on both branches and outlines planned developments.
Experimental stations at I13 beamline at Diamond Light Source
International Nuclear Information System (INIS)
Pešić, Z D; Fanis, A De; Wagner, U; Rau, C
2013-01-01
The I13 beamline of Diamond Light Source has been operational since December 2011. The beamline encompass two fully independent branches devoted to coherent imaging experiments (coherent x-ray diffraction, coherent diffraction imaging and ptychography) and x-ray imaging (in-line phase contrast imaging, tomography and full-field microscopy). This paper gives an overview of the current status of experimental stations on both branches and outlines planned developments.
The plasma membrane-associated NADH oxidase of spinach leaves responds to blue light
Morre, D. James; Penel, Claude; Greppin, Hubert; Morre, Dorothy M.
2002-01-01
The plasma membrane-associated NADH oxidase (NOX) of spinach leaf disks is characterized by oscillations in activity with a regular period length of ca. 24 min. Within a single population of plants exposed to light at the same time, NOX activities of all plants function synchronously. Exposure of plants transferred from darkness to blue light (495 nm, 2 min, 50 micromoles m-2 s-1) resulted in a complex response pattern but with a new maximum in the rate of NOX activity 36 (24+12) min after illumination and then with maxima in the rate of NOX activity every 24 min thereafter. Transient maxima in NOX activity were observed as well after 9.3 + /- 1.4 and 20.7 +/- 2.1 min. The blue light response differed from the response to red (650 nm, 10 min, 50 micromoles m-2 s-1) or white light where activity maxima were initiated 12 min after the light exposure followed by maxima every 24 min thereafter. Green or yellow light was ineffective. The light response was independent of the time in the 24-min NOX cycle when the light was given. The net effects of blue and red light were ultimately the same with a new maximum in the rate of NOX activity at 12+24=36 min (and every 24 min thereafter), but the mechanisms appear to be distinct.
Two Higgs Doublet Model and Model Independent Interpretation of Neutral Higgs Boson Searches
Abbiendi, G.; Ainsley, C.; Akesson, P.F.; Alexander, G.; Allison, John; Anderson, K.J.; Arcelli, S.; Asai, S.; Ashby, S.F.; Axen, D.; Azuelos, G.; Bailey, I.; Ball, A.H.; Barberio, E.; Barlow, Roger J.; Baumann, S.; Behnke, T.; Bell, Kenneth Watson; Bella, G.; Bellerive, A.; Benelli, G.; Bentvelsen, S.; Bethke, S.; Biebel, O.; Bloodworth, I.J.; Boeriu, O.; Bock, P.; Bohme, J.; Bonacorsi, D.; Boutemeur, M.; Braibant, S.; Bright-Thomas, P.; Brigliadori, L.; Brown, Robert M.; Burckhart, H.J.; Cammin, J.; Capiluppi, P.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Clarke, P.E.L.; Clay, E.; Cohen, I.; Cooke, O.C.; Couchman, J.; Couyoumtzelis, C.; Coxe, R.L.; Csilling, A.; Cuffiani, M.; Dado, S.; Dallavalle, G.Marco; Dallison, S.; de Roeck, A.; de Wolf, E.; Dervan, P.; Desch, K.; Dienes, B.; Dixit, M.S.; Donkers, M.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Estabrooks, P.G.; Etzion, E.; Fabbri, F.; Fanti, M.; Feld, L.; Ferrari, P.; Fiedler, F.; Fleck, I.; Ford, M.; Frey, A.; Furtjes, A.; Futyan, D.I.; Gagnon, P.; Gary, J.W.; Gaycken, G.; Geich-Gimbel, C.; Giacomelli, G.; Giacomelli, P.; Glenzinski, D.; Goldberg, J.; Grandi, C.; Graham, K.; Gross, E.; Grunhaus, J.; Gruwe, M.; Gunther, P.O.; Hajdu, C.; Hanson, G.G.; Hansroul, M.; Hapke, M.; Harder, K.; Harel, A.; Harin-Dirac, M.; Hauke, A.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Hensel, C.; Herten, G.; Heuer, R.D.; Hill, J.C.; Hocker, James Andrew; Hoffman, Kara Dion; Homer, R.J.; Honma, A.K.; Horvath, D.; Hossain, K.R.; Howard, R.; Huntemeyer, P.; Igo-Kemenes, P.; Ishii, K.; Jacob, F.R.; Jawahery, A.; Jeremie, H.; Jones, C.R.; Jovanovic, P.; Junk, T.R.; Kanaya, N.; Kanzaki, J.; Karapetian, G.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kim, D.H.; Klein, K.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Kokott, T.P.; Komamiya, S.; Kowalewski, Robert V.; Kress, T.; Krieger, P.; von Krogh, J.; Kuhl, T.; Kupper, M.; Kyberd, P.; Lafferty, G.D.; Landsman, H.; Lanske, D.; Lawson, I.; Layter, J.G.; Leins, A.; Lellouch, D.; Letts, J.; Levinson, L.; Liebisch, R.; Lillich, J.; List, B.; Littlewood, C.; Lloyd, A.W.; Lloyd, S.L.; Loebinger, F.K.; Long, G.D.; Losty, M.J.; Lu, J.; Ludwig, J.; Macchiolo, A.; Macpherson, A.; Mader, W.; Marcellini, S.; Marchant, T.E.; Martin, A.J.; Martin, J.P.; Martinez, G.; Mashimo, T.; Mattig, Peter; McDonald, W.John; McKenna, J.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Mendez-Lorenzo, P.; Menges, W.; Merritt, F.S.; Mes, H.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Mohr, W.; Montanari, A.; Mori, T.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nisius, R.; O'Neale, S.W.; Oakham, F.G.; Odorici, F.; Ogren, H.O.; Oh, A.; Okpara, A.; Oreglia, M.J.; Orito, S.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Patt, J.; Pfeifenschneider, P.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poli, B.; Polok, J.; Pooth, O.; Przybycien, M.; Quadt, A.; Rembser, C.; Renkel, P.; Rick, H.; Rodning, N.; Roney, J.M.; Rosati, S.; Roscoe, K.; Rossi, A.M.; Rozen, Y.; Runge, K.; Runolfsson, O.; Rust, D.R.; Sachs, K.; Saeki, T.; Sahr, O.; Sarkisyan, E.K.G.; Sbarra, C.; Schaile, A.D.; Schaile, O.; Scharff-Hansen, P.; Schroder, Matthias; Schumacher, M.; Schwick, C.; Scott, W.G.; Seuster, R.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.P.; Skuja, A.; Smith, A.M.; Snow, G.A.; Sobie, R.; Soldner-Rembold, S.; Spagnolo, S.; Sproston, M.; Stahl, A.; Stephens, K.; Stoll, K.; Strom, David M.; Strohmer, R.; Stumpf, L.; Surrow, B.; Talbot, S.D.; Tarem, S.; Taylor, R.J.; Teuscher, R.; Thiergen, M.; Thomas, J.; Thomson, M.A.; Torrence, E.; Towers, S.; Toya, D.; Trefzger, T.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turner-Watson, M.F.; Ueda, I.; Vachon, B.; Vannerem, P.; Verzocchi, M.; Voss, H.; Vossebeld, J.; Waller, D.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wengler, T.; Wermes, N.; Wetterling, D.; White, J.S.; Wilson, G.W.; Wilson, J.A.; Wyatt, T.R.; Yamashita, S.; Zacek, V.; Zer-Zion, D.
2001-01-01
Searches for the neutral Higgs bosons h0 and A0, are used to obtain limits on the Type II Two Higgs Doublet Model (2HDM(II)) with no CP-violation in the Higgs sector and no additional particles besides the five Higgs bosons. The analysis combines approximately 170 pb-1 of data collected with the OPAL detector at sqrt{s} ~ 189 GeV with previous runs at sqrt{s} ~ mZ and sqrt{s} ~ 183 GeV. The searches are sensitive to the h0, A0 -> qq, gg, tau+tau- and h0 -> A0A0 decay modes of the Higgs bosons. For the first time, the 2HDM(II) parameter space is explored in a detailed scan, and new flavour independent analyses are applied to examine regions in which the neutral Higgs bosons decay predominantly into light quarks or gluons. Model-independent limits are also given.
Peyer, Suzanne M.; Pankey, M. Sabrina; Oakley, Todd H.; McFall-Ngai, Margaret J.
2013-01-01
The squid Euprymna scolopes has evolved independent sets of tissues capable of light detection, including a complex eye and a photophore or ‘light organ’, which houses the luminous bacterial symbiont Vibrio fischeri. As the eye and light organ originate from different embryonic tissues, we examined whether the eye-specification genes, pax6, eya, six, and dac, are shared by these two organs, and if so, whether they are regulated in the light organ by symbiosis. We obtained sequences of the fou...
Extinction of polarized light in ferrofluids with different magnetic particle concentrations
International Nuclear Information System (INIS)
Socoliuc, V.; Popescu, L.B.
2012-01-01
The magnetic field intensity and nanoparticle concentration dependence of the polarized light extinction in a ferrofluid made of magnetite particles stabilized with technical grade oleic acid dispersed in transformer oil was experimentally investigated. The magnetically induced optical anisotropy, i.e. the dichroism divided by concentration, was found to decrease with increasing sample concentration from 2% to 8%. The magnetically induced change in the optical extinction of light polarized at 54.74 o with respect to the magnetic field direction was found to be positive for the less concentrated sample (2%) and negative for the samples with 4% and 8% magnetic nanoparticle concentrations, the more negative the higher the concentration and field intensity. Based on the theoretically proven fact that the particle orientation mechanism has no effect on the extinction of light polarized at 54.74 o with respect to the field direction, we analyzed the experimental findings in the frames of the agglomeration and long-range pair correlations theories for the magnetically induced optical anisotropy in ferrofluids. We developed a theoretical model in the approximation of single scattering for the optical extinction coefficient of a ferrofluid with magnetically induced particle agglomeration. The model predicts the existence of a polarization independent component of the optical extinction coefficient that is experimentally measurable at 54.74 o polarization angle. The change in the optical extinction of light polarized at 54.74 o is positive if only the formation of straight n-particle chains is considered and may become negative in the hypothesis that the longer chains degenerate to more isotropic structures (polymer-like coils, globules or bundles of chains). The model for the influence on the light absorption of the long-range pair correlations, published elsewhere, predicts that the change in the optical extinction of light polarized at 54.74 o is always negative, the more
DEFF Research Database (Denmark)
Prescott, N.B.; Kristensen, Helle Halkjær; Wathes, C.M.
2004-01-01
This chapter presents the effect of artificial light environments (light levels, colour, photoperiod and flicker) on the welfare of broilers in terms of vision, behaviour, lameness and mortality......This chapter presents the effect of artificial light environments (light levels, colour, photoperiod and flicker) on the welfare of broilers in terms of vision, behaviour, lameness and mortality...
Gupta, Radhey S; Khadka, Bijendra
2016-02-01
Homologs showing high degree of sequence similarity to the three subunits of the protochlorophyllide oxidoreductase enzyme complex (viz. BchL, BchN, and BchB), which carries out a central role in chlorophyll-bacteriochlorophyll (Bchl) biosynthesis, are uniquely found in photosynthetic organisms. The results of BLAST searches and homology modeling presented here show that proteins exhibiting a high degree of sequence and structural similarity to the BchB and BchN proteins are also present in organisms from the high G+C Gram-positive phylum of Actinobacteria, specifically in members of the genus Rubrobacter (R. x ylanophilus and R. r adiotolerans). The results presented exclude the possibility that the observed BLAST hits are for subunits of the nitrogenase complex or the chlorin reductase complex. The branching in phylogenetic trees and the sequence characteristics of the Rubrobacter BchB/BchN homologs indicate that these homologs are distinct from those found in other photosynthetic bacteria and that they may represent ancestral forms of the BchB/BchN proteins. Although a homolog showing high degree of sequence similarity to the BchL protein was not detected in Rubrobacter, another protein, belonging to the ParA/Soj/MinD family, present in these bacteria, exhibits high degree of structural similarity to the BchL. In addition to the BchB/BchN homologs, Rubrobacter species also contain homologs showing high degree of sequence similarity to different subunits of magnesium chelatase (BchD, BchH, and BchI) as well as proteins showing significant similarity to the BchP and BchG proteins. Interestingly, no homologs corresponding to the BchX, BchY, and BchZ proteins were detected in the Rubrobacter species. These results provide the first suggestive evidence that some form of photosynthesis either exists or was anciently present within the phylum Actinobacteria (high G+C Gram-positive) in members of the genus Rubrobacter. The significance of these results concerning the
The importance of board independence
Zijl, N.J.M.
2012-01-01
Although the attributed importance of board independence is high, a clear definition of independence does not exist. Furthermore, the aim and consequences of independence are the subject of discussion and empirical evidence about the impact of independence is weak and disputable. Despite this lack
Light dependency of VOC emissions from selected Mediterranean plant species
Owen, S. M.; Harley, P.; Guenther, A.; Hewitt, C. N.
The light, temperature and stomatal conductance dependencies of volatile organic compound (VOC) emissions from ten plant species commonly found in the Mediterranean region were studied using a fully controlled leaf cuvette in the laboratory. At standard conditions of temperature and light (30°C and 1000 μmol m -2 s -1 PAR), low emitting species ( Arbutus unedo, Pinus halepensis, Cistus incanus, Cistus salvifolius, Rosmarinus officinalis and Thymus vulgaris) emitted between 0.1 and 5.0 μg (C) (total VOCs) g -1 dw h -1, a medium emitter ( Pinus pinea) emitted between 5 and 10 μg (C) g -1 dw h -1 and high emitters ( Cistus monspeliensis, Lavendula stoechas and Quercus sp.) emitted more than 10 μg (C) g -1 dw h -1. VOC emissions from all of the plant species investigated showed some degree of light dependency, which was distinguishable from temperature dependency. Emissions of all compounds from Quercus sp. were light dependent. Ocimene was one of several monoterpene compounds emitted by P. pinea and was strongly correlated to light. Only a fraction of monoterpene emissions from C. incanus exhibited apparent weak light dependency but emissions from this plant species were strongly correlated to temperature. Data presented here are consistent with past studies, which show that emissions are independent of stomatal conductance. These results may allow more accurate predictions of monoterpene emission fluxes from the Mediterranean region to be made.
Visual color matching system based on RGB LED light source
Sun, Lei; Huang, Qingmei; Feng, Chen; Li, Wei; Wang, Chaofeng
2018-01-01
In order to study the property and performance of LED as RGB primary color light sources on color mixture in visual psychophysical experiments, and to find out the difference between LED light source and traditional light source, a visual color matching experiment system based on LED light sources as RGB primary colors has been built. By simulating traditional experiment of metameric color matching in CIE 1931 RGB color system, it can be used for visual color matching experiments to obtain a set of the spectral tristimulus values which we often call color-matching functions (CMFs). This system consists of three parts: a monochromatic light part using blazed grating, a light mixing part where the summation of 3 LED illuminations are to be visually matched with a monochromatic illumination, and a visual observation part. The three narrow band LEDs used have dominant wavelengths of 640 nm (red), 522 nm (green) and 458 nm (blue) respectively and their intensities can be controlled independently. After the calibration of wavelength and luminance of LED sources with a spectrophotometer, a series of visual color matching experiments have been carried out by 5 observers. The results are compared with those from CIE 1931 RGB color system, and have been used to compute an average locus for the spectral colors in the color triangle, with white at the center. It has been shown that the use of LED is feasible and has the advantages of easy control, good stability and low cost.
Fielding, Alistair J.; Usselman, Robert J.; Watmough, Nicholas; Simkovic, Martin; Frerman, Frank E.; Eaton, Gareth R.; Eaton, Sandra S.
2008-02-01
Electron transfer flavoprotein-ubiquinone oxidoreductase (ETF-QO) is a membrane-bound electron transfer protein that links primary flavoprotein dehydrogenases with the main respiratory chain. Human, porcine, and Rhodobacter sphaeroides ETF-QO each contain a single [4Fe-4S] 2+,1+ cluster and one equivalent of FAD, which are diamagnetic in the isolated enzyme and become paramagnetic on reduction with the enzymatic electron donor or with dithionite. The anionic flavin semiquinone can be reduced further to diamagnetic hydroquinone. The redox potentials for the three redox couples are so similar that it is not possible to poise the proteins in a state where both the [4Fe-4S] + cluster and the flavoquinone are fully in the paramagnetic form. Inversion recovery was used to measure the electron spin-lattice relaxation rates for the [4Fe-4S] + between 8 and 18 K and for semiquinone between 25 and 65 K. At higher temperatures the spin-lattice relaxation rates for the [4Fe-4S] + were calculated from the temperature-dependent contributions to the continuous wave linewidths. Although mixtures of the redox states are present, it was possible to analyze the enhancement of the electron spin relaxation of the FAD semiquinone signal due to dipolar interaction with the more rapidly relaxing [4Fe-4S] + and obtain point-dipole interspin distances of 18.6 ± 1 Å for the three proteins. The point-dipole distances are within experimental uncertainty of the value calculated based on the crystal structure of porcine ETF-QO when spin delocalization is taken into account. The results demonstrate that electron spin relaxation enhancement can be used to measure distances in redox poised proteins even when several redox states are present.
Fielding, Alistair J; Usselman, Robert J; Watmough, Nicholas; Simkovic, Martin; Frerman, Frank E; Eaton, Gareth R; Eaton, Sandra S
2008-02-01
Electron transfer flavoprotein-ubiquinone oxidoreductase (ETF-QO) is a membrane-bound electron transfer protein that links primary flavoprotein dehydrogenases with the main respiratory chain. Human, porcine, and Rhodobacter sphaeroides ETF-QO each contain a single [4Fe-4S](2+,1+) cluster and one equivalent of FAD, which are diamagnetic in the isolated enzyme and become paramagnetic on reduction with the enzymatic electron donor or with dithionite. The anionic flavin semiquinone can be reduced further to diamagnetic hydroquinone. The redox potentials for the three redox couples are so similar that it is not possible to poise the proteins in a state where both the [4Fe-4S](+) cluster and the flavoquinone are fully in the paramagnetic form. Inversion recovery was used to measure the electron spin-lattice relaxation rates for the [4Fe-4S](+) between 8 and 18K and for semiquinone between 25 and 65K. At higher temperatures the spin-lattice relaxation rates for the [4Fe-4S](+) were calculated from the temperature-dependent contributions to the continuous wave linewidths. Although mixtures of the redox states are present, it was possible to analyze the enhancement of the electron spin relaxation of the FAD semiquinone signal due to dipolar interaction with the more rapidly relaxing [4Fe-4S](+) and obtain point-dipole interspin distances of 18.6+/-1A for the three proteins. The point-dipole distances are within experimental uncertainty of the value calculated based on the crystal structure of porcine ETF-QO when spin delocalization is taken into account. The results demonstrate that electron spin relaxation enhancement can be used to measure distances in redox poised proteins even when several redox states are present.
Independent procedure of checking dose calculations using an independent calculus algorithm
International Nuclear Information System (INIS)
Perez Rozos, A.; Jerez Sainz, I.; Carrasco Rodriguez, J. L.
2006-01-01
In radiotherapy it is recommended the use of an independent procedure of checking dose calculations, in order to verify the main treatment planning system and double check every patient dosimetry. In this work we present and automatic spreadsheet that import data from planning system using IMPAC/RTP format and verify monitor unit calculation using an independent calculus algorithm. Additionally, it perform a personalized analysis of dose volume histograms and several radiobiological parameters like TCP and NTCP. Finally, the application automatically generate a clinical dosimetry report for every patient, including treatment fields, fractionation, independent check results, dose volume analysis, and first day forms. (Author)
Ultraviolet light and heat source selection in captive spiny-tailed iguanas (Oplurus cuvieri)
International Nuclear Information System (INIS)
Dickinson, H.C.; Fa, J.E.
1997-01-01
Three experimental manipulations were conducted to assess the influence of heat source selection and active thermoregulation on ultraviolet (UV) light exposure in captive spiny-tailed iguanas (Oplurus cuvieri) at the Jersey Wildlife Preservation Trust. Four replicates per manipulation were conducted on six individual lizards. All animals were tested in a separate enclosure to which they were acclimated before observations. Data on choice of thermal sources were collected during the first 2 hr of light, when lizards were actively thermoregulating. Animals were allowed to choose between incandescent light, UV light and a non-light heat source (thermotube) in different combinations. Recorded temperatures close to the incandescent light (37°C) were always significantly higher than at the thermotube (33°C) and at the UV light (29°C). Manipulation 1 offered the animals a choice of an UV light and an incandescent light as thermal sources. Manipulation 2 presented animals with the thermal choices in Manipulation 1, but substrates under each source in Manipulation 1 were switched. In Manipulation 3, animals could choose between an incandescent light and the thermotube. All studied lizards were significantly more attracted to the incandescent light than to the UV light or thermotube. Incandescent light elicited a significantly higher proportion of basking behaviors in all individuals than the other sources. A high proportion of time basking was also spent in front of the thermotube but fewer individuals and less time were spent basking under the UV light. Heat source selection was generally found to be independent of substrate. Management applications of this preference are suggested for juvenile diurnal heliothermic iguanids. (author)
International Nuclear Information System (INIS)
Khruschev, V.V.; Savrin, V.I.; Semenov, S.V.
1999-01-01
Parameters of the QCD-motivated static potential and the quark masses are calculated on the basis of the 1 -- meson mass spectra in the framework of the relativistic independent-quark model based on the Dirac equation. The value of the confining potential parameter is found to be (0.20 ± 0.01) GeV 2 for interactions between quarks and antiquarks independently on their flavors. The flavor independence of the confining potential is justified on the 5 x 10 -2 accuracy level both for the heavy quarks and for the light ones. The values of parameter α s , which is a strength of the quasi-Coulombic potential are consistent with the QCD-motivated decrease of α s at small interaction range [ru
Organic light emitting diode with light extracting electrode
Energy Technology Data Exchange (ETDEWEB)
Bhandari, Abhinav; Buhay, Harry
2017-04-18
An organic light emitting diode (10) includes a substrate (20), a first electrode (12), an emissive active stack (14), and a second electrode (18). At least one of the first and second electrodes (12, 18) is a light extracting electrode (26) having a metallic layer (28). The metallic layer (28) includes light scattering features (29) on and/or in the metallic layer (28). The light extracting features (29) increase light extraction from the organic light emitting diode (10).
A novel FRET pair for detection of parallel DNA triplexes by the LightCycler
DEFF Research Database (Denmark)
Schneider, Uffe V; Severinsen, Jette K; Géci, Imrich
2010-01-01
BACKGROUND: Melting temperature of DNA structures can be determined on the LightCycler using quenching of FAM. This method is very suitable for pH independent melting point (Tm) determination performed at basic or neutral pH, as a high throughput alternative to UV absorbance measurements. At acid...
White light emission from fluorescent SiC with porous surface
DEFF Research Database (Denmark)
Lu, Weifang; Ou, Yiyu; Fiordaliso, Elisabetta Maria
2017-01-01
We report for the frst time a NUV light to white light conversion in a N-B co-doped 6H-SiC (fuorescent SiC) layer containing a hybrid structure. The surface of fuorescent SiC sample contains porous structures fabricated by anodic oxidation method. After passivation by 20nm thick Al2O3, the photol......We report for the frst time a NUV light to white light conversion in a N-B co-doped 6H-SiC (fuorescent SiC) layer containing a hybrid structure. The surface of fuorescent SiC sample contains porous structures fabricated by anodic oxidation method. After passivation by 20nm thick Al2O3...... the bulk fuorescent SiC layer. A high color rendering index of 81.1 has been achieved. Photoluminescence spectra in porous layers fabricated in both commercial n-type and lab grown N-B co-doped 6H-SiC show two emission peaks centered approximately at 460nm and 530nm. Such bluegreen emission phenomenon can......, the photoluminescence intensity from the porous layer was signifcant enhanced by a factor of more than 12. Using a porous layer of moderate thickness (~10µm), high-quality white light emission was realized by combining the independent emissions of blue-green emission from the porous layer and yellow emission from...
Photoresponse of poly(para-phenylenevinylene) light-emitting diodes
International Nuclear Information System (INIS)
Wei, X.; Raikh, M.; Vardeny, Z.V.; Yang, Y.; Moses, D.
1994-01-01
We have studied the photoresponses of poly(para-phenylene vinylene) (PPV) light-emitting diodes (LED's) with PPV derivatives sandwiched between tin oxide (ITO) and metals including calcium, aluminum, and copper. Under illumination all diodes exhibit relatively large photoconductive I(V) responses which cross the dark I(V) curve at a forward-bias voltage V 0 that scales with the difference in work functions between the ITO and metal electrodes, the open-circuit voltage saturates at V 0 and is temperature independent, and the enhanced electroluminescence intensity of the illuminated LED's correlates with the photocurrent
Independent safety organization
International Nuclear Information System (INIS)
Kato, W.Y.; Weinstock, E.V.; Carew, J.F.; Cerbone, R.J.; Guppy, J.G.; Hall, R.E.; Taylor, J.H.
1985-01-01
Brookhaven National Laboratory has conducted a study on the need and feasibility of an independent organization to investigate significant safety events for the Office for Analysis and Evaluation of Operational Data, USNRC. The study consists of three parts: the need for an independent organization to investigate significant safety events, alternative organizations to conduct investigations, and legislative requirements. The determination of need was investigated by reviewing current NRC investigation practices, comparing aviation and nuclear industry practices, and interviewing a spectrum of representatives from the nuclear industry, the regulatory agency, and the public sector. The advantages and disadvantages of alternative independent organizations were studied, namely, an Office of Nuclear Safety headed by a director reporting to the Executive Director for Operations (EDO) of NRC; an Office of Nuclear Safety headed by a director reporting to the NRC Commissioners; a multi-member NTSB-type Nuclear Safety Board independent of the NRC. The costs associated with operating a Nuclear Safety Board were also included in the study. The legislative requirements, both new authority and changes to the existing NRC legislative authority, were studied. 134 references
Directory of Open Access Journals (Sweden)
Safaa Hassan
2017-12-01
Full Text Available Light-trapping enhancement in newly discovered graded photonic super-crystals (GPSCs with dual periodicity and dual basis is herein explored for the first time. Broadband, wide-incident-angle, and polarization-independent light-trapping enhancement was achieved in silicon solar cells patterned with these GPSCs. These super-crystals were designed by multi-beam interference, rendering them flexible and efficient. The optical response of the patterned silicon solar cell retained Bloch-mode resonance; however, light absorption was greatly enhanced in broadband wavelengths due to the graded, complex unit super-cell nanostructures, leading to the overlap of Bloch-mode resonances. The broadband, wide-angle light coupling and trapping enhancement mechanism are understood to be due to the spatial variance of the index of refraction, and this spatial variance is due to the varying filling fraction, the dual basis, and the varying lattice constants in different directions.
Directory of Open Access Journals (Sweden)
Uesaka Miki
2008-12-01
Full Text Available Abstract Background P450 oxidoreductase (POR catalyzes electron transfer to microsomal P450 enzymes. Its deficiency causes Antley-Bixler syndrome (ABS, and about half the patients with ABS have ambiguous genitalia and/or impaired steroidogenesis. POR mRNA expression is up-regulated when mesenchymal stem cells (MSCs differentiate into steroidogenic cells, suggesting that the regulation of POR gene expression is important for steroidogenesis. In this context we examined the regulation of POR expression in ovarian granulosa cells by gonadotropins, and its possible role in steroidogenesis. Methods Changes in gene expression in MSCs during differentiation into steroidogenic cells were examined by DNA microarray analysis. Changes in mRNA and protein expression of POR in the rat ovary or in granulosa cells induced by gonadotropin treatment were examined by reverse transcription-polymerase chain reaction and western blotting. Effects of transient expression of wild-type or mutant (R457H or V492E POR proteins on the production of estrone in COS-7 cells were examined in vitro. Effects of POR knockdown were also examined in estrogen producing cell-line, KGN cells. Results POR mRNA was induced in MSCs following transduction with the SF-1 retrovirus, and was further increased by cAMP treatment. Expression of POR mRNA, as well as Cyp19 mRNA, in the rat ovary were induced by equine chorionic gonadotropin and human chorionic gonadotropin. POR mRNA and protein were also induced by follicle stimulating hormone in primary cultured rat granulosa cells, and the induction pattern was similar to that for aromatase. Transient expression of POR in COS-7 cells, which expressed a constant amount of aromatase protein, greatly increased the rate of conversion of androstenedione to estrone, in a dose-dependent manner. The expression of mutant POR proteins (R457H or V492E, such as those found in ABS patients, had much less effect on aromatase activity than expression of wild
An Analysis of the Heroine of North and South---Margaret Hale as an Independent Woman
Directory of Open Access Journals (Sweden)
Ping Wang
2017-11-01
Full Text Available Mrs. Gaskell is a very important woman writer in the 19th century in Britain, and she is famous for her social novels, in which she highlights complicated social conflicts. North and South is usually considered as the turning point of Mrs. Gaskell’s literary creation, in which she suggests for the first time that there should be a hope of a reconciliation between the working class and the bourgeoisie. Also, the author vividly depicted an independent woman with a sharp mind and a deliberate manner in the book, that is, Margaret Hale. She seems to be very special when compared with the women around her and very attractive to men for her peculiar thoughts as well as her beautiful looks. This thesis mainly analyzes the attractive heroine of the novel in three aspects: her independent character, her independent action and her independent thoughts. What’s more, the thesis aims to shed light on the characteristics a “New Woman” should be endowed with. The heroine, to some extent, is the author Mrs. Gaskell herself, rejecting inferiority to men and defending the rights to express themselves freely. All in all, this thesis tries to enlighten people on woman’s position in today’s society by deriving some inspirations from the literary work.
Robertson, William C
2003-01-01
Why is left right and right left in the mirror? Baffled by the basics of reflection and refraction? Wondering just how the eye works? If you have trouble teaching concepts about light that you don t fully grasp yourself, get help from a book that s both scientifically accurate and entertaining with Light. By combining clear explanations, clever drawings, and activities that use easy-to-find materials, this book covers what science teachers and parents need to know to teach about light with confidence. It uses ray, wave, and particle models of light to explain the basics of reflection and refraction, optical instruments, polarization of light, and interference and diffraction. There s also an entire chapter on how the eye works. Each chapter ends with a Summary and Applications section that reinforces concepts with everyday examples. Whether you need a deeper understanding of how light bends or a good explanation of why the sky is blue, you ll find Light more illuminating and accessible than a college textbook...
Ultraviolet light and ultraviolet light-activated composite resins
International Nuclear Information System (INIS)
Murray, G.A.; Yates, J.L.; Newman, S.M.
1981-01-01
In a comparison of the UV light--activated composite resins, Estilux was polymerized to a significantly greater depth than the other composite resins. In general, Lee-fill polymerized the least. When comparing the UV light sources, the Lee light and the Duralux light did not significantly differ from each other, but both polymerized the materials tested to a significantly greater depth than the other light sources. Of the two time exposures, 60-second exposure provided a significantly greater depth of polymerization than 20 seconds for each light with each material
Independent tube verification and dynamic tracking in et inspection of nuclear steam generator
International Nuclear Information System (INIS)
Xiongzi, Li; Zhongxue, Gan; Lance, Fitzgibbons
2001-01-01
The full text follows. In the examination of pressure boundary tubes in steam generators of commercial pressurized water nuclear power plants (PWR's), it is critical to know exactly which particular tube is being accessed. There are no definitive landmarks or markings on the individual tubes. Today this is done manually, it is tedious, and interrupts the normal inspection work, and is difficult due to the presence of water on the tube surface, plug ends instead of tube openings in the field of view, and varying lighting quality. In order to eliminate the human error and increase the efficiency of operation, there is a need to identify tube position during the inspection process, independent of robot encoder position and motion. A process based on a Cognex MVS-8200 system and its application function package has been developed to independently identify tube locations. ABB Combustion Engineering Nuclear Power's Outage Services group, USPPL in collaboration with ABB Power Plant Laboratories' Advanced Computers and Controls department has developed a new vision-based Independent Tube Verification system (GENESIS-ITVS-TM ). The system employ's a model-based tube-shape detection algorithm and dynamic tracking methodology to detect the true tool position and its offsets from identified tube location. GENESIS-ITVS-TM is an automatic Independent Tube Verification System (ITVS). Independent tube verification is a tube validation technique using computer vision, and not using any robot position parameters. This process independently counts the tubes in the horizontal and vertical axes of the plane of the steam generator tube sheet as the work tool is moved. Thus it knows the true position in the steam generator, given a known starting point. This is analogous to the operator's method of counting tubes for verification, but it is automated. GENESIS-ITVS-TM works independent of the robot position, velocity, or acceleration. The tube position information is solely obtained from
Light Converting Inorganic Phosphors for White Light-Emitting Diodes
Chen, Lei; Lin, Chun-Che; Yeh, Chiao-Wen; Liu, Ru-Shi
2010-01-01
White light-emitting diodes (WLEDs) have matched the emission efficiency of florescent lights and will rapidly spread as light source for homes and offices in the next 5 to 10 years. WLEDs provide a light element having a semiconductor light emitting layer (blue or near-ultraviolet (nUV) LEDs) and photoluminescence phosphors. These solid-state LED lamps, rather than organic light emitting diode (OLED) or polymer light-emitting diode (PLED), have a number of advantages over conventional incand...
Alosco, Michael L; Spitznagel, Mary Beth; Raz, Naftali; Cohen, Ronald; Sweet, Lawrence H; Colbert, Lisa H; Josephson, Richard; van Dulmen, Manfred; Hughes, Joel; Rosneck, Jim; Gunstad, John
2014-03-01
To examine the independent association between executive function with instrumental activities of daily living and health behaviours in older adults with heart failure. Executive function is an important contributor to functional independence as it consists of cognitive processes needed for decision-making, planning, organising and behavioural monitoring. Impairment in this domain is common in heart failure patients and associated with reduced performance of instrumental activities of daily living in many medical and neurological populations. However, the contribution of executive functions to functional independence and healthy lifestyle choices in heart failure patients has not been fully examined. Cross-sectional analyses. One hundred and seventy-five heart failure patients completed a neuropsychological battery and echocardiogram. Participants also completed the Lawton-Brody Instrumental Activities of Daily Living Scale and reported current cigarette use. Hierarchical regressions revealed that reduced executive function was independently associated with worse instrumental activity of daily living performance with a specific association for decreased ability to manage medications. Partial correlations showed that executive dysfunction was associated with current cigarette use. Our findings suggest that executive dysfunction is associated with poorer functional independence and contributes to unhealthy behaviours in heart failure. Future studies should examine whether heart failure patients benefit from formal organisation schema (i.e. pill organisers) to maintain independence. Screening of executive function in heart failure patients may provide key insight into their ability to perform daily tasks, including the management of treatment recommendations. © 2013 John Wiley & Sons Ltd.
Reed, Phil
2011-03-01
Binge eating is often associated with stress-induced disruption of typical eating patterns. Three experiments were performed with the aim of developing a potential model for this effect by investigating the effect of presenting response-independent stimuli on rats' lever-pressing for food reinforcement during both fixed-interval (FI) and fixed-ratio (FR) schedules of reinforcement. In Experiment 1, a response-independent brief tone (500-ms, 105-dB, broadband, noisy signal, ranging up to 16 kHz, with spectral peaks at 3 and 500 Hz) disrupted the performance on an FI 60-s schedule. Responding with the response-independent tone was more vigorous than in the absence of the tone. This effect was replicated in Experiment 2 using a within-subject design, but no such effect was noted when a light was employed as a disrupter. In Experiment 3, a 500-ms tone, but not a light, had a similar effect on rats' performance on FR schedules. This tone-induced effect may represent a release from response-inhibition produced by an aversive event. The implications of these results for modeling binge eating are discussed.
CALDER: Cryogenic light detectors for background-free searches
Energy Technology Data Exchange (ETDEWEB)
Cardani, L. [Dipartimento di Fisica - Sapienza Università di Roma, Roma - Italy and Physics Department, Princeton University, Princeton, NJ (United States); Bellini, F.; Casali, N.; Coppolecchia, A.; Cosmelli, C.; Cruciani, A.; Vignati, M. [Dipartimento di Fisica - Sapienza Università di Roma and INFN - Sezione di Roma, Roma - Italy (Italy); Castellano, M. G. [Istituto di Fotonica e Nanotecnologie - CNR, Roma - Italy (Italy); Colantoni, I. [Dipartimento di Fisica - Sapienza Università di Roma (Italy); Di Domizio, S. [Dipartimento di Fisica, Università di Genova, Genova - Italy and INFN Sezione di Genova, Genova - Italy (Italy); Tomei, C. [INFN - Sezione di Roma, Roma - Italy (Italy)
2015-08-17
The development of background-free detectors is essential for experiments searching for rare events. Bolometers, that are among the most competitive devices for the study of neutrino-less double beta decay (0νDBD) and Dark Matter interactions, suffer from the absence of techniques that allow to identify the nature of the interacting particles. This limit can be overcome by coupling the bolometer to an independent device for the measurement of the light emitted by interactions, as the combined read-out of the bolometric and light signals allows to identify and reject particles different from those of interest. CUORE, the most advanced bolometric experiment for 0νDBD searches, could disentangle the electrons produced by 0νDBD from the dangerous background due to α particles, by measuring the (tiny) Cherenkov light emitted by electrons and not by α’s. LUCIFER, a project based on ZnSe scintillating bolometers for the study of {sup 82}Se 0νDBD, would be competitive also in the search of Dark Matter interactions if equipped with light detectors that allow to distinguish and reject the background due to electrons and γ’s. These advances require cryogenic detectors characterized by noise lower than 20 eV, large active area, wide temperature range of operation, high radio-purity and ease in fabricating hundreds of channels. The CALDER collaboration aims to develop such detectors by exploiting the superb energy resolution and natural multiplexed read-out provided by Kinetic Inductance Detectors.
Melanopsin mediates light-dependent relaxation in blood vessels.
Sikka, Gautam; Hussmann, G Patrick; Pandey, Deepesh; Cao, Suyi; Hori, Daijiro; Park, Jong Taek; Steppan, Jochen; Kim, Jae Hyung; Barodka, Viachaslau; Myers, Allen C; Santhanam, Lakshmi; Nyhan, Daniel; Halushka, Marc K; Koehler, Raymond C; Snyder, Solomon H; Shimoda, Larissa A; Berkowitz, Dan E
2014-12-16
Melanopsin (opsin4; Opn4), a non-image-forming opsin, has been linked to a number of behavioral responses to light, including circadian photo-entrainment, light suppression of activity in nocturnal animals, and alertness in diurnal animals. We report a physiological role for Opn4 in regulating blood vessel function, particularly in the context of photorelaxation. Using PCR, we demonstrate that Opn4 (a classic G protein-coupled receptor) is expressed in blood vessels. Force-tension myography demonstrates that vessels from Opn4(-/-) mice fail to display photorelaxation, which is also inhibited by an Opn4-specific small-molecule inhibitor. The vasorelaxation is wavelength-specific, with a maximal response at ∼430-460 nm. Photorelaxation does not involve endothelial-, nitric oxide-, carbon monoxide-, or cytochrome p450-derived vasoactive prostanoid signaling but is associated with vascular hyperpolarization, as shown by intracellular membrane potential measurements. Signaling is both soluble guanylyl cyclase- and phosphodiesterase 6-dependent but protein kinase G-independent. β-Adrenergic receptor kinase 1 (βARK 1 or GRK2) mediates desensitization of photorelaxation, which is greatly reduced by GRK2 inhibitors. Blue light (455 nM) regulates tail artery vasoreactivity ex vivo and tail blood blood flow in vivo, supporting a potential physiological role for this signaling system. This endogenous opsin-mediated, light-activated molecular switch for vasorelaxation might be harnessed for therapy in diseases in which altered vasoreactivity is a significant pathophysiologic contributor.
Electromagnetic structure of spin-zero light nuclei from point of view of analyticity
International Nuclear Information System (INIS)
Dubnicka, S.; Dumbrajs, O.
1975-01-01
The analysis of spin-zero light nuclei electromagnetic form factors from the point of view of analyticity is carried out. The interpretation of diffraction minima in elastic electron-nucleus scattering as real zeros of form factors is advocated. The model-independent charge radii and charge distributions are calculated on the base of present-day experimental data
Two-gluon correlations in heavy–light ion collisions
International Nuclear Information System (INIS)
Wertepny, Douglas E.
2014-01-01
We derive the cross-section for two-gluon production in heavy–light ion collisions in the saturation/Color Glass Condensate framework. This calculation includes saturation effects to all orders in one of the nuclei (heavy ion) along with a single saturation correction in the projectile (light ion). The calculation of the correlation function predicts (qualitatively) two identical ridge-like correlations, near- and away-side. This prediction was later supported by experimental findings in p + A collisions at the LHC. Concentrating on the energy and geometry dependence of the correlation functions we find that the correlation function is nearly center-of-mass energy independent. The geometry dependence of the correlation function leads to an enhancement of near- and away-side correlations for the tip-on-tip U + U collisions when compared with side-on-side U + U collisions, an exactly opposite behavior from the correlations generated by the elliptic flow of the quark–gluon plasma
Muller, A; Gal, N; Betlehem, J; Fuller, N; Acs, P; Kovacs, G L; Fusz, K; Jozsa, R; Olah, A
2015-09-01
We examined the effects of different shift work schedules and chronic mild stress (CMS) on mood using animal model. The most common international shift work schedules in nursing were applied by three groups of Wistar-rats and a control group with normal light-dark cycle. One subgroup from each group was subjected to CMS. Levels of anxiety and emotional life were evaluated in light-dark box. Differences between the groups according to independent and dependent variables were examined with one- and two-way analysis of variance, with a significance level defined at p animals.
Directory of Open Access Journals (Sweden)
Hui LI
2017-08-01
Full Text Available This study proposes a holographic grating made of polymer dispersed liquid crystal (PDLC, with a small amount of chiral molecules doped into PDLC material. The major advantage of this grating is that it is independent of light polarization. This characteristic was verified by applying the interference beam intensity of a He-Cd laser at 150 mW/cm2, with an incidence angle between the two interference beams of 24°, for an irradiation curing duration of 120 s. The observed periodic structure of the grating is consistent with the theoretical value. As chiral molecules are doped, nematic-LC experiences a phase-change in the grating. However, the electro-optical features are only slightly affected. This proposed grating has greatly potential in 3D imaging because of its polarization-independent feature.DOI: http://dx.doi.org/10.5755/j01.ms.23.2.16312
Heavy-to-light correlators beyond the light cone
International Nuclear Information System (INIS)
Lucha, W.; Melikhov, D. I.; Simula, S.
2008-01-01
We present the first systematic analysis of the off-light-cone effects in correlators relevant for the extraction of the heavy-to-light form factors within the method of light-cone sum rules. In a model with scalar constituents, the correlator is calculated in two different ways: (i) by performing the expansion of the Bethe-Salpeter amplitude of the light meson near the light cone x 2 = 0 and (ii) by adopting the known solution for the Bethe-Salpeter amplitude which allows one to calculate the correlator without invoking any expansion. We demonstrate that the contributions to the correlator from the off-light-cone terms x 2 ≠ 0 are not suppressed by any large parameter compared to the contribution of the light-cone term x 2 0. For decays of heavy particles of mass in the range 1.5-5 GeV, the light-cone correlator is shown to systematically overestimate the full correlator, numerically the difference being 10-20%
Heavy-to-light correlators beyond the light cone
International Nuclear Information System (INIS)
Lucha, W.; Melikhov, D. I.; Simula, S.
2008-01-01
We present the first systematic analysis of the off-light-cone effects in correlators relevant for the extraction of the heavy-to-light form factors within the method of light-cone sum rules. In a model with scalar constituents, the correlator is calculated in two different ways: (i) by performing the expansion of the Bethe-Salpeter amplitude of the light meson near the light cone x 2 = 0 and (ii) by adopting the known solution for the Bethe-Salpeter amplitude which allows one to calculate the correlator without invoking any expansion. We demonstrate that the contributions to the correlator from the off-light-cone terms x 2 ≠ 0 are not suppressed by any large parameter compared to the contribution of the light-cone term x 2 = 0. For decays of heavy particles of mass in the range 1.5–5 GeV, the light-cone correlator is shown to systematically overestimate the full correlator, numerically the difference being 10–20%.
A phenomenological and approximately flavour independent potential for quark-antiquark system
International Nuclear Information System (INIS)
Song Xiaotong.
1988-08-01
We proposed a phenomenological and flavour independent potential for quark-antiquark systems with equal or unequal masses. The potential has a Lorentz vector term motivated by empirical formula of leptonic width of vector meson at short distances and a Lorentz scalar part inspired by the result from lattice QCD responsible for quark confinement at large distances. Using this potential we calculated the energy levels, leptonic widths, radiative transition rates and hadronic decay rates of the (uu-bar), (dd-bar), (ss-bar), (cc-bar), (bb-bar) and (tt-bar) systems. The fine and hyperfine splittings of light and heavy quark-antiquark systems are also calculated. Most results agree fairly well with the experiment. (author). 46 refs, 5 figs, 13 tabs
Light regulation of the insulin receptor in the retina.
Rajala, Raju V S; Anderson, Robert E
2003-10-01
The peptide hormone insulin binds its cognate cell-surface receptors to activate a coordinated biochemical-signaling network and to induce intracellular events. The retina is an integral part of the central nervous system and is known to contain insulin receptors, although their function is unknown. This article, describes recent studies that link the photobleaching of rhodopsin to tyrosine phosphorylation of the insulin receptor and subsequent activation of phosphoinositide 3- kinase (PI3K). We recently found a light-dependent increase in tyrosine phosphorylation of the insulin receptor-beta-subunit (IR beta) and an increase in PI3K enzyme activity in isolated rod outer segments (ROS) and in anti-phosphotyrosine (PY) and anti-IR beta immunoprecipitates of retinal homogenates. The light effect, which was localized to photoreceptor neurons, is independent of insulin secretion. Our results suggest that light induces tyrosine phosphorylation of IR beta in outer-segment membranes, which leads to the binding of p85 through its N-terminal SH2 domain and the generation of PI-3,4,5-P3. We suggest that the physiological role of this process may be to provide neuroprotection of the retina against light damage by activating proteins that protect against stress-induced apoptosis. The studies linking PI3K activation through tyrosine phosphorylation of IR beta now provide physiological relevance for the presence of these receptors in the retina.
Adaptive Lighting Design – Staged Experiences of Light
DEFF Research Database (Denmark)
Søndergaard, Karin; Petersen, Kjell Yngve
2015-01-01
involved in the negotiations of how the lighting design unfolds. Each installation stages a specified place, where participants perform their own experiences of being and moving in dynamically changing lighting settings. Through investigative actions participants test the ways that the lighting...... compositions influence their ability to orient themselves within the geography of the space and how the balances in light colours and luminous intensities affect their experience of directionality, distances, and scales. In short, the experience of being present in the space as well as one’s experience......Adaptive Lighting Design – Staged Experiences of Light The two installations, White Cube and White Box, enable experience-based studies as a form of perceptual activity, wherein lighting conditions are examined in a dialectical exchange between the system and the people participating. Adaptive...
Light storage via slow-light four-wave mixing
International Nuclear Information System (INIS)
Fan, Yun-Fei; Wang, Hai-Hua; Wei, Xiao-Gang; Li, Ai-Jun; Kang, Zhi-Hui; Wu, Jin-Hui; Zhang, Han-Zhuang; Xu, Huai-Liang; Gao, Jin-Yue
2012-01-01
We experimentally demonstrate a light storage via slow-light four-wave mixing in a solid-state medium with a four-level double lambda scheme. Using slow light based on electromagnetically induced transparency, we obtain a slowed four-wave mixing signal pulse together with the slowed probe pulse. During the propagation of light pulses, the storage and retrieval of both the slowed four-wave mixing pulse and the slowed probe pulse are studied by manipulating the intensities of the control fields. -- Highlights: ► A light storage via slow-light four-wave mixing is observed in a solid. ► The probe pulse is slowed under electromagnetically induced transparency. ► A slowed four-wave mixing pulse is obtained by slow light. ► The storage of slowed double pulses is studied.
Directory of Open Access Journals (Sweden)
Shenghong Li
2013-01-01
Full Text Available As part of our continuing efforts in the search for potential biologically active compounds from medicinal plants, we have isolated 18 compounds including two novel nitrogen containing diterpenes from extracts of the fruits of Vitex agnus-castus. These isolates, along with our previously obtained novel compound vitexlactam A (1, were evaluated for potential biological effects, including cancer chemoprevention. Chemically, the nitrogenous isolates were found to be two labdane diterpene alkaloids, each containing an α, β-unsaturated γ-lactam moiety. Structurally, they were elucidated to be 9α-hydroxy-13(14-labden-16,15-amide (2 and 6β-acetoxy-9α-hydroxy-13(14-labden-15,16-amide (3, which were named vitexlactams B and C, respectively. The 15 known isolates were identified as vitexilactone (4, rotundifuran (5, 8-epi-manoyl oxide (6, vitetrifolin D (7, spathulenol (8, cis-dihydro-dehydro-diconiferylalcohol-9-O-β-D-glucoside (9, luteolin-7-O-glucoside (10, 5-hydroxy-3,6,7,4′-tetramethoxyflavone (11, casticin (12, artemetin (13, aucubin (14, agnuside (15, β-sitosterol (16, p-hydroxybenzoic acid (17, and p-hydroxybenzoic acid glucose ester (18. All compound structures were determined/identified on the basis of 1D and/or 2D NMR and mass spectrometry techniques. Compounds 6, 8, 9, and 18 were reported from a Vitex spieces for the first time. The cancer chemopreventive potentials of these isolates were evaluated for NADP(H:quinone oxidoreductase type 1 (QR1 induction activity. Compound 7 demonstrated promising QR1 induction effect, while the new compound vitexlactam (3 was only slightly active.
Li, Shenghong; Qiu, Shengxiang; Yao, Ping; Sun, Handong; Fong, Harry H S; Zhang, Hongjie
2013-01-01
As part of our continuing efforts in the search for potential biologically active compounds from medicinal plants, we have isolated 18 compounds including two novel nitrogen containing diterpenes from extracts of the fruits of Vitex agnus-castus. These isolates, along with our previously obtained novel compound vitexlactam A (1), were evaluated for potential biological effects, including cancer chemoprevention. Chemically, the nitrogenous isolates were found to be two labdane diterpene alkaloids, each containing an α , β -unsaturated γ -lactam moiety. Structurally, they were elucidated to be 9 α -hydroxy-13(14)-labden-16,15-amide (2) and 6 β -acetoxy-9 α -hydroxy-13(14)-labden-15,16-amide (3), which were named vitexlactams B and C, respectively. The 15 known isolates were identified as vitexilactone (4), rotundifuran (5), 8-epi-manoyl oxide (6), vitetrifolin D (7), spathulenol (8), cis-dihydro-dehydro-diconiferylalcohol-9-O- β -D-glucoside (9), luteolin-7-O-glucoside (10), 5-hydroxy-3,6,7,4'-tetramethoxyflavone (11), casticin (12), artemetin (13), aucubin (14), agnuside (15), β -sitosterol (16), p-hydroxybenzoic acid (17), and p-hydroxybenzoic acid glucose ester (18). All compound structures were determined/identified on the basis of 1D and/or 2D NMR and mass spectrometry techniques. Compounds 6, 8, 9, and 18 were reported from a Vitex spieces for the first time. The cancer chemopreventive potentials of these isolates were evaluated for NADP(H):quinone oxidoreductase type 1 (QR1) induction activity. Compound 7 demonstrated promising QR1 induction effect, while the new compound vitexlactam (3) was only slightly active.
Blank, David L.; Feliz, Dax; Collins, Karen A.; White, Graeme L.; Stassun, Keivan G.; Curtis, Ivan A.; Hart, Rhodes; Kielkopf, John F.; Nelson, Peter; Relles, Howard; Stockdale, Christopher; Jayawardene, Bandupriya; Pennypacker, Carlton R.; Shankland, Paul; Reichart, Daniel E.; Haislip, Joshua B.; Kouprianov, Vladimir V.
2018-06-01
Proxima Centauri has become the subject of intense study since the radial-velocity (RV) discovery by Anglada-Escudé et al. of a planet orbiting this nearby M dwarf every ∼11.2 days. If Proxima Centauri b transits its host star, independent confirmation of its existence is possible, and its mass and radius can be measured in units of the stellar host mass and radius. To date, there have been three independent claims of possible transit-like event detections in light curve observations obtained by the MOST satellite (in 2014–15), the Bright Star Survey Telescope telescope in Antarctica (in 2016), and the Las Campanas Observatory (in 2016). The claimed possible detections are tentative, due in part to the variability intrinsic to the host star, and in the case of the ground-based observations, also due to the limited duration of the light curve observations. Here, we present preliminary results from an extensive photometric monitoring campaign of Proxima Centauri, using telescopes around the globe and spanning from 2006 to 2017, comprising a total of 329 observations. Considering our data that coincide directly and/or phased with the previously published tentative transit detections, we are unable to independently verify those claims. We do, however, verify the previously reported ubiquitous and complex variability of the host star. We discuss possible interpretations of the data in light of the previous claims, and we discuss future analyses of these data that could more definitively verify or refute the presence of transits associated with the RV-discovered planet.
Energy Technology Data Exchange (ETDEWEB)
1989-01-01
Increasing energy costs have led to a review of the high costs of lighting. The use of new energy-efficient lighting equipment, coupled with the use of the proper quantity and quality of lighting only where it is needed, creates a potential for cost reduction. A manual is provided to aid the process of adapting Canadian industrial, commercial, and institutional enterprises to these higher costs. An introductory review of lighting fundamentals is presented, providing a basic understanding of concepts such as illumination, light output measurements, power requirements, lighting quality, and energy audit methods. The currently available lighting equipment used to achieve cost savings is then reviewed, including energy saving lamps and ballasts, controls, and automatic energy control systems. A number of energy management opportunities are identified, such as modification of lighting usage patterns, calculation of the optimum number of lighting fixtures, replacement of existing lamps, and the application of task lighting. Examples are included to show the cost savings possible when applying some of the techniques suggested. 27 figs., 11 tabs.
On independence in risk communication
International Nuclear Information System (INIS)
Lacronique, J. F.
2006-01-01
The term 'independence' is a common key word used by almost all stake holders in the field of nuclear safety regulation. The intention is to persuade the public that it can have more confidence and trust in the persons in charge, if their competence and judgment cannot be altered by any kind of political issue or personal interest. However, it is possible to discuss the reality of this claimed quality: how is it possible to verify that the organization that claim 'independence' really respect it? National expertise Institutions can show that they are independent from the industry, but can they claim total independence from the government? NGO have build a large part of their constituency on 'independence' from industry and governments, but are they independent from the ideological forces -sometimes very powerful - that support them? How can we achieve to make this noble word really meaningful? We will show through different examples, that 'independence' is by definition a fragile and versatile challenge, rather than a durable label. It has to be refreshed regularly and thoroughly. Risk communication, in that context, must respect principles which will build independence as a solid asset, and keep a certain distance with mere marketing purposes or candid wishful thinking
User-independent accelerometer-based gesture recognition for mobile devices
Directory of Open Access Journals (Sweden)
Eduardo METOLA
2013-07-01
Full Text Available Many mobile devices embed nowadays inertial sensors. This enables new forms of human-computer interaction through the use of gestures (movements performed with the mobile device as a way of communication. This paper presents an accelerometer-based gesture recognition system for mobile devices which is able to recognize a collection of 10 different hand gestures. The system was conceived to be light and to operate in a user-independent manner in real time. The recognition system was implemented in a smart phone and evaluated through a collection of user tests, which showed a recognition accuracy similar to other state-of-the art techniques and a lower computational complexity. The system was also used to build a human-robot interface that enables controlling a wheeled robot with the gestures made with the mobile phone
A Search for Beyond Standard Model Light Bosons Decaying into Muon Pairs
CMS Collaboration
2016-01-01
A dataset corresponding to $2.8~\\mathrm{fb}^{-1}$ of proton-proton collisions at $\\sqrt{s} = 13~\\mathrm{TeV}$ was recorded by the CMS experiment at the CERN LHC. These data are used to search for new light bosons with a mass in the range $0.25-8.5~\\mathrm{GeV}/c^2$ decaying into muon pairs. No excess is observed in the data, and a model-independent upper limit on the product of the cross section, branching fraction and acceptance is derived. The results are interpreted in the context of two benchmark models, namely, the next-to-minimal supersymmetric standard model, and dark SUSY models including those predicting a non-negligible light boson lifetime.
Light pollution alters the phenology of dawn and dusk singing in common European songbirds.
Da Silva, Arnaud; Valcu, Mihai; Kempenaers, Bart
2015-05-05
Artificial night lighting is expanding globally, but its ecological consequences remain little understood. Animals often use changes in day length as a cue to time seasonal behaviour. Artificial night lighting may influence the perception of day length, and may thus affect both circadian and circannual rhythms. Over a 3.5 month period, from winter to breeding, we recorded daily singing activity of six common songbird species in 12 woodland sites, half of which were affected by street lighting. We previously reported on analyses suggesting that artificial night lighting affects the daily timing of singing in five species. The main aim of this study was to investigate whether the presence of artificial night lighting is also associated with the seasonal occurrence of dawn and dusk singing. We found that in four species dawn and dusk singing developed earlier in the year at sites exposed to light pollution. We also examined the effects of weather conditions and found that rain and low temperatures negatively affected the occurrence of dawn and dusk singing. Our results support the hypothesis that artificial night lighting alters natural seasonal rhythms, independently of other effects of urbanization. The fitness consequences of the observed changes in seasonal timing of behaviour remain unknown.
Memory operation devices based on light-illumination ambipolar carbon-nanotube thin-film-transistors
International Nuclear Information System (INIS)
Aïssa, B.; Nedil, M.; Kroeger, J.; Haddad, T.; Rosei, F.
2015-01-01
We report the memory operation behavior of a light illumination ambipolar single-walled carbon nanotube thin film field-effect transistors devices. In addition to the high electronic-performance, such an on/off transistor-switching ratio of 10 4 and an on-conductance of 18 μS, these memory devices have shown a high retention time of both hole and electron-trapping modes, reaching 2.8 × 10 4 s at room temperature. The memory characteristics confirm that light illumination and electrical field can act as an independent programming/erasing operation method. This could be a fundamental step toward achieving high performance and stable operating nanoelectronic memory devices
Directory of Open Access Journals (Sweden)
Akinori Kuzuya
2011-12-01
Full Text Available A new simple scheme for constructing recombinant vectors that does not require any restriction enzyme, ligase, or any other special enzyme treatment has been developed. By using caged primers in PCR, unnatural sticky-ends of any sequence, which are sufficiently long for ligation-independent cloning (LIC, are directly prepared on the product after a brief UVA irradiation. Target genes and vectors amplified by this light-assisted cohesive-ending (LACE PCR join together in the desired arrangement in a simple mixture of them, tightly enough to be repaired and ligated in competent cells.
360-degrees profilometry using strip-light projection coupled to Fourier phase-demodulation.
Servin, Manuel; Padilla, Moises; Garnica, Guillermo
2016-01-11
360 degrees (360°) digitalization of three dimensional (3D) solids using a projected light-strip is a well-established technique in academic and commercial profilometers. These profilometers project a light-strip over the digitizing solid while the solid is rotated a full revolution or 360-degrees. Then, a computer program typically extracts the centroid of this light-strip, and by triangulation one obtains the shape of the solid. Here instead of using intensity-based light-strip centroid estimation, we propose to use Fourier phase-demodulation for 360° solid digitalization. The advantage of Fourier demodulation over strip-centroid estimation is that the accuracy of phase-demodulation linearly-increases with the fringe density, while in strip-light the centroid-estimation errors are independent. Here we proposed first to construct a carrier-frequency fringe-pattern by closely adding the individual light-strip images recorded while the solid is being rotated. Next, this high-density fringe-pattern is phase-demodulated using the standard Fourier technique. To test the feasibility of this Fourier demodulation approach, we have digitized two solids with increasing topographic complexity: a Rubik's cube and a plastic model of a human-skull. According to our results, phase demodulation based on the Fourier technique is less noisy than triangulation based on centroid light-strip estimation. Moreover, Fourier demodulation also provides the amplitude of the analytic signal which is a valuable information for the visualization of surface details.
Context-aware tunable office lighting application and user response
Chen, Nancy H.; Nawyn, Jason; Thompson, Maria; Gibbs, Julie; Larson, Kent
2013-09-01
LED light sources having multiple independently controllable color channels allow tuning of both the intensity and color output. Consequently, highly tailored lighting can be applied according to instantaneous user needs and preferences. Besides improving lighting performance, energy use can also be reduced since the brightest illumination is applied only when necessary. In an example application, low activity or vacant areas of a multi-zone office are lit by low power illumination, including colored light options, which can reduce energy consumption to 20-45% of typical full-time, fullbrightness, office-wide illumination. The availability of color also allows communication functions and additional aesthetic design possibilities. To reduce user burden in frequent switching between various illumination settings, an activity recognition sensor network is used to identify selected office activities. The illumination is then adjusted automatically to satisfy the needs of the occupants. A handheld mobile device provides an interactive interface for gathering user feedback regarding impressions and illumination preferences. The activity-triggered queries collect contemporaneous feedback that reduces reliance on memory; immediate previews of illumination options are also provided. Through mobile queries and post-experience interviews, user feedback was gathered regarding automation, colored lighting, and illumination preferences. Overall reaction was indicated by a range of response words such as fun, stimulating, very cool, very pleasant, enjoyed, good, comfortable, satisfactory, fine, energy saving, interesting, curious, dim, cave, isolated, distracting, and unfamiliar. Positive reaction from a meaningful, though not universal, fraction of users indicates reasonable application potential, particularly as personal preferences and control are accommodated.
Directory of Open Access Journals (Sweden)
Valentin Borshchevskiy
Full Text Available Na+-translocating NADH:quinone oxidoreductase (NQR is a redox-driven sodium pump operating in the respiratory chain of various bacteria, including pathogenic species. The enzyme has a unique set of redox active prosthetic groups, which includes two covalently bound flavin mononucleotide (FMN residues attached to threonine residues in subunits NqrB and NqrC. The reason of FMN covalent bonding in the subunits has not been established yet. In the current work, binding of free FMN to the apo-form of NqrC from Vibrio harveyi was studied showing very low affinity of NqrC to FMN in the absence of its covalent bonding. To study structural aspects of flavin binding in NqrC, its holo-form was crystallized and its 3D structure was solved at 1.56 Å resolution. It was found that the isoalloxazine moiety of the FMN residue is buried in a hydrophobic cavity and that its pyrimidine ring is squeezed between hydrophobic amino acid residues while its benzene ring is extended from the protein surroundings. This structure of the flavin-binding pocket appears to provide flexibility of the benzene ring, which can help the FMN residue to take the bended conformation and thus to stabilize the one-electron reduced form of the prosthetic group. These properties may also lead to relatively weak noncovalent binding of the flavin. This fact along with periplasmic location of the FMN-binding domains in the vast majority of NqrC-like proteins may explain the necessity of the covalent bonding of this prosthetic group to prevent its loss to the external medium.
Adaptive Lighting Design – Staged Experiences of Light
DEFF Research Database (Denmark)
Petersen, Kjell Yngve; Søndergaard, Karin
in ways that meaningfully adapt. In the two installations, two different aspects are at play. In White Cube, the light colours are balanced. In White Box, the light follows the movements of the people in the space. In situations with several people occupying the same space, social relations become......Adaptive Lighting Design – Staged Experiences of Light The two installations, White Cube and White Box, enable experience-based studies as a form of perceptual activity, wherein lighting conditions are examined in a dialectical exchange between the system and the people participating. Adaptive...... lighting is based on a partial automation of the possibilities to adjust the colour tone and brightness levels of light in order to adapt to people’s needs and desires. Software can be seen to bear a communicative aesthetic, where the relation of user situations and the design intentions are controlled...
Mass spectrum of vector mesons in the relativistic model of quasi-independent quarks
International Nuclear Information System (INIS)
Savrin, V.I.; Khrushchev, V.V.; Semenov, S.V.
1988-01-01
Mass values of mesons with J PC =1 -- built of u-, d-, s-, c-, b-quarks in S-states have been found with the help of numerical solutions of Dirac equation. The potential entering the equation consists of the scalar linear potential and the Coulomb vector one. The main contribution into spectra dependence on the radial quantum number for light quarks is shown to give the cnfinement scalar flavour independent potential: V c (r)=κ 2 r, at parameter value κ∼ 0.42 GeV. The calculated mass values are in agreement with ∼ 5% accuracy with the data for well established mesons
Directory of Open Access Journals (Sweden)
Santamaria Anna
2010-04-01
Full Text Available Abstract Background Camptotheca acuminata is a major natural source of the terpenoid indole alkaloid camptothecin (CPT. At present, little is known about the cellular distribution of the biosynthesis of CPT, which would be useful knowledge for developing new strategies and technologies for improving alkaloid production. Results The pattern of CPT accumulation was compared with the expression pattern of some genes involved in CPT biosynthesis in C. acuminata [i.e., Ca-TDC1 and Ca-TDC2 (encoding for tryptophan decarboxylase and Ca-HGO (encoding for 10-hydroxygeraniol oxidoreductase]. Both CPT accumulation and gene expression were investigated in plants at different degrees of development and in plantlets subjected to drought-stress. In all organs, CPT accumulation was detected in epidermal idioblasts, in some glandular trichomes, and in groups of idioblast cells localized in parenchyma tissues. Drought-stress caused an increase in CPT accumulation and in the number of glandular trichomes containing CPT, whereas no increase in epidermal or parenchymatous idioblasts was observed. In the leaf, Ca-TDC1 expression was detected in some epidermal cells and in groups of mesophyll cells but not in glandular trichomes; in the stem, it was observed in parenchyma cells of the vascular tissue; in the root, no expression was detected. Ca-TDC2 expression was observed exclusively in leaves of plantlets subjected to drought-stress, in the same sites described for Ca-TDC1. In the leaf, Ca-HGO was detected in all chlorenchyma cells; in the stem, it was observed in the same sites described for Ca-TDC1; in the root, no expression was detected. Conclusions The finding that the sites of CPT accumulation are not consistently the same as those in which the studied genes are expressed demonstrates an organ-to-organ and cell-to-cell translocation of CPT or its precursors.
DEFF Research Database (Denmark)
Sørensen, Tor; Merritt, Timothy; Andersen, Oskar
2015-01-01
While there has been much focus on tangible lighting interfaces embedded in physical objects and smartphones as remote control, there has not been sufficient attention on how the expressivity of bodily movement can be used when designing interactions with light. Therefore, we investigate...... interaction with lighting technology beyond the smartphone and physical controllers. We examine the usefulness of the in-air gestural interaction style for lighting control. We bring forward "Tangible Lights", which serves as a novel interface for in-air interaction with lighting, drawing on existing...
Directory of Open Access Journals (Sweden)
Pablo de Andrés
2017-04-01
Full Text Available Our study reveals how two separate dimensions of board composition—the proportion of independent directors and of non-independent directors—influence CEO compensation in Western European firms. Controlling for the simultaneous determination of CEO pay structure and board design, we find that firms with a higher proportion of non-independent outsiders on their boards pay less direct compensation (salary + bonus and less equity-linked compensation to their CEOs. By contrast, CEOs working for firms with more independent boards receive more equity based-pay. When we control for the fact that equity linked is not granted systematically in Europe we find that firms with more independent directors on the board tend to grant equity-linked compensation more often than firms with more non independent outside directors. Our results challenge the commonly accepted view of independent directors as safeguards of shareholder value, uncovering the relevance of non-independent outsiders for pay moderation and incentives.
Light Trapping with Silicon Light Funnel Arrays
Directory of Open Access Journals (Sweden)
Ashish Prajapati
2018-03-01
Full Text Available Silicon light funnels are three-dimensional subwavelength structures in the shape of inverted cones with respect to the incoming illumination. Light funnel (LF arrays can serve as efficient absorbing layers on account of their light trapping capabilities, which are associated with the presence of high-density complex Mie modes. Specifically, light funnel arrays exhibit broadband absorption enhancement of the solar spectrum. In the current study, we numerically explore the optical coupling between surface light funnel arrays and the underlying substrates. We show that the absorption in the LF array-substrate complex is higher than the absorption in LF arrays of the same height (~10% increase. This, we suggest, implies that a LF array serves as an efficient surface element that imparts additional momentum components to the impinging illumination, and hence optically excites the substrate by near-field light concentration, excitation of traveling guided modes in the substrate, and mode hybridization.
Light's labour's lost - policies for energy-efficient lighting
Energy Technology Data Exchange (ETDEWEB)
NONE
2006-06-29
When William Shakepeare wrote Love's Labour's Lost he would have used light from tallow candles at a cost (today) of 12,000 British pounds per million-lumen hours. The same amount of light from electric lamps now costs only 2 pounds! But today's low-cost illumination still has a dark side. Globally, lighting consumes more electricity than is produced by either hydro or nuclear power and results in CO2 emissions equivalent to two thirds of the world's cars. A standard incandescent lamp may be much more efficient than a tallow candle, but it is far less efficient than a high-pressure sodium lamp. Were inefficient light sources to be replaced by the equivalent efficient ones, global lighting energy demand would be up to 40% less at a lower overall cost. Larger savings still could be realised through the intelligent use of controls, lighting levels and daylight. But achieving efficient lighting is not just a question of technology; it requires policies to transform current practice. This book documents the broad range of policy measures to stimulate efficient lighting that have already been implemented around the world and suggests new ways these could be strengthened to prevent light's labour's from being lost.
Light's labour's lost - policies for energy-efficient lighting
International Nuclear Information System (INIS)
2006-01-01
When William Shakepeare wrote Love's Labour's Lost he would have used light from tallow candles at a cost (today) of 12,000 British pounds per million-lumen hours. The same amount of light from electric lamps now costs only 2 pounds. But today's low-cost illumination still has a dark side. Globally, lighting consumes more electricity than is produced by either hydro or nuclear power and results in CO2 emissions equivalent to two thirds of the world's cars. A standard incandescent lamp may be much more efficient than a tallow candle, but it is far less efficient than a high-pressure sodium lamp. Were inefficient light sources to be replaced by the equivalent efficient ones, global lighting energy demand would be up to 40% less at a lower overall cost. Larger savings still could be realised through the intelligent use of controls, lighting levels and daylight. But achieving efficient lighting is not just a question of technology; it requires policies to transform current practice. This book documents the broad range of policy measures to stimulate efficient lighting that have already been implemented around the world and suggests new ways these could be strengthened to prevent light's labour's from being lost
The International Year of Light and Light-based Technologies
Pendrill, Ann-Marie
2015-05-01
I report on the opening ceremony of the International Year of Light and Light-based Technologies 2015 (IYL2015), which took place at the UNESCO headquarters in Paris, France, on 19-20 January 2015. Over the two days, more than 1000 participants from all over the world learned more about the fundamental properties of light and advanced photonics applications, the history of optics and its applications through the centuries, light poverty and light pollution, and light for everyday life, health and research.
Bedaf, Sandra; Gelderblom, Gert Jan; Syrdal, Dag Sverre; Lehmann, Hagen; Michel, Hervé; Hewson, David; Amirabdollahian, Farshid; Dautenhahn, Kerstin; de Witte, Luc
2014-11-01
In light of the increasing elderly population and the growing demand for home care, the potential of robot support is given increasing attention. In this paper, an inventory of activities was made that threaten independent living of elderly when becoming problematic. Results will guide the further development of an existing service robot, the Care-O-bot®. A systematic literature search of PubMed was performed, focused on the risk factors for institutionalization. Additionally, focus group sessions were conducted in the Netherlands, United Kingdom and France. In these focus group sessions, problematic activities threatening the independence of elderly people were discussed. Three separate target groups were included in the focus group sessions: (1) elderly persons (n = 41), (2) formal caregivers (n = 40) and (3) informal caregivers (n = 32). Activities within the International Classification of Functioning domains mobility, self-care, and interpersonal interaction and relationships were found to be the most problematic. A distinct set of daily activities was identified that may threaten independent living, but no single activity could be selected as the main activity causing a loss of independence as it is often a combination of problematic activities that is person-specific. Supporting the problematic activities need not involve a robotic solution.
Tongtaksin, A; Leevailoj, C
This study investigated the influence of battery charge levels on the stability of light-emitting diode (LED) curing-light intensity by measuring the intensity from fully charged through fully discharged batteries. The microhardness of resin composites polymerized by the light-curing units at various battery charge levels was measured. The light intensities of seven fully charged battery LED light-curing units-1) LY-A180, 2) Bluephase, 3) Woodpecker, 4) Demi Plus, 5) Saab II, 6) Elipar S10, and 7) MiniLED-were measured with a radiometer (Kerr) after every 10 uses (20 seconds per use) until the battery was discharged. Ten 2-mm-thick cylindrical specimens of A3 shade nanofilled resin composite (PREMISE, Kerr) were prepared per LED light-curing unit group. Each specimen was irradiated by the fully charged light-curing unit for 20 seconds. The LED light-curing units were then used until the battery charge fell to 50%. Specimens were prepared again as described above. This was repeated again when the light-curing units' battery charge fell to 25% and when the light intensity had decreased to 400 mW/cm 2 . The top/bottom surface Knoop hardness ratios of the specimens were determined. The microhardness data were analyzed by one-way analysis of variance with Tukey test at a significance level of 0.05. The Pearson correlation coefficient was used to determine significant correlations between surface hardness and light intensity. We found that the light intensities of the Bluephase, Demi Plus, and Elipar S10 units were stable. The intensity of the MiniLED unit decreased slightly; however, it remained above 400 mW/cm 2 . In contrast, the intensities of the LY-A180, Woodpecker, and Saab II units decreased below 400 mW/cm 2 . There was also a significant decrease in the surface microhardnesses of the resin composite specimens treated with MiniLED, LY-A180, Woodpecker, and Saab II. In conclusion, the light intensity of several LED light-curing units decreased as the battery was
Statistical analysis of the W Cyg light curve
International Nuclear Information System (INIS)
Klyus, I.A.
1983-01-01
A statistical analysis of the light curve of W Cygni has been carried out. The process of brightness variations brightness of the star is shown to be a stationary stochastic one. The hypothesis of stationarity of the process was checked at the significance level of α=0.05. Oscillations of the brightness with average durations of 131 and 250 days have been found. It is proved that oscillations are narrow-band noise, i.e. cycles. Peaks on the power spectrum corresponding to these cycles exceed 99% confidence interval. It has been stated that the oscillations are independent
Energy Technology Data Exchange (ETDEWEB)
Seiss, U; Borns, E; Boehm, H
1985-01-01
A description is given of the possibility of a comparison of the production between different suspension cultures of microalgae at equal and defined light conditions. For this, a variant of the turbidostat technique is used by which with the acid of a phototransistor and the filter combination of red filter/opal glass filter a chlorophyll-equivalent signal is applied for control. The equal light conditions are compared and set by the preparation of the respective absorption profiles. From this one can derive the mean level of irradiation within the suspension cultures and use it as the reference value for the light conditions. By this technique it is possible to set equal light conditions in suspension cultures independent of the given cell sizes, cell shapes and dry matter contents.
AdS/QCD, Light-Front Holography, and Sublimated Gluons
Energy Technology Data Exchange (ETDEWEB)
Brodsky, Stanley J.; /SLAC; de Teramond, Guy F.; /Costa Rica U.
2012-02-16
The gauge/gravity duality leads to a simple analytical and phenomenologically compelling nonperturbative approximation to the full light-front QCD Hamiltonian - 'Light-Front Holography', which provides a Lorentz-invariant first-approximation to QCD, and successfully describes the spectroscopy of light-quark meson and baryons, their elastic and transition form factors, and other hadronic properties. The bound-state Schroedinger and Dirac equations of the soft-wall AdS/QCD model predict linear Regge trajectories which have the same slope in orbital angular momentum L and radial quantum number n for both mesons and baryons. Light-front holography connects the fifth-dimensional coordinate of AdS space z to an invariant impact separation variable {zeta} in 3+1 space at fixed light-front time. A key feature is the determination of the frame-independent light-front wavefunctions of hadrons - the relativistic analogs of the Schroedinger wavefunctions of atomic physics which allow one to compute form factors, transversity distributions, spin properties of the valence quarks, jet hadronization, and other hadronic observables. One thus obtains a one-parameter color-confining model for hadron physics at the amplitude level. AdS/QCD also predicts the form of the non-perturbative effective coupling {alpha}{sub s}{sup AdS} (Q) and its {beta}-function with an infrared fixed point which agrees with the effective coupling a{sub g1} (Q{sup 2}) extracted from measurements of the Bjorken sum rule below Q{sup 2} < 1 GeV{sup 2}. This is consistent with a flux-tube interpretation of QCD where soft gluons with virtualities Q{sup 2} < 1 GeV{sup 2} are sublimated into a color-confining potential for quarks. We discuss a number of phenomenological hadronic properties which support this picture.
Directory of Open Access Journals (Sweden)
Eliane Dalva Godoy Danesi
2011-03-01
Full Text Available The effects of light intensity and temperature in S. platensis cultivation with potassium nitrate or urea as nitrogen source were investigated, as well as the biomass chlorophyll contents of this cyanobacteria, through the Response Surface Methodology. Experiments were performed at temperatures from 25 to 34.5ºC and light intensities from 15 to 69 µmol photons m-2 s-1, in mineral medium. In cultivations with both sources of nitrogen, KNO3 and urea, statistic evaluation through multiple regression, no interactions of such independent variables were detected in the results of the dependent variables maximum cell concentration, chlorophyll biomass contents, cell and chlorophyll productivities, as well as in the nitrogen-cell conversion factor. In cultivation performed with both sources of nitrogen, it was possible to obtain satisfactory adjustments to relate the dependent variables to the independent variables. The best results were achieved at temperature of 30ºC, at light intensity of 60 µmol photons m-2s-1, for cell growth, with cell productivity of approximately 95 mg L-1 d-1 in cultivations with urea. For the chlorophyll biomass content, the most adequate light intensity was 24 µmol photons m-2 s-1.
Practical Investigation for Road Lighting using Renewable Energy Sources
Directory of Open Access Journals (Sweden)
Maged A. Abu Adma
2017-12-01
Full Text Available Abstract - Hybrid renewable energy systems are recently used to counteract the limitations of solar and wind as solo renewable energy sources due to adverse weather conditions. This study explains a design of a fully independent -off grid- hybrid solar and wind road lighting system according to geography and weather conditions recorded from the National Research Institute of Astronomy and Geophysics. The computerized model is designed step by step by the aid of Simulink-Matlab and the simulation was successfully run to show the performance of each module.
Detection of internal structure by scattered light intensity: Application to kidney cell sorting
Goolsby, C. L.; Kunze, M. E.
1985-01-01
Scattered light measurements in flow cytometry were sucessfully used to distinguish cells on the basis of differing morphology and internal structure. Differences in scattered light patterns due to changes in internal structure would be expected to occur at large scattering angles. Practically, the results of these calculations suggest that in experimental situations an array of detectors would be useful. Although in general the detection of the scattered light intensity at several intervals within the 10 to 60 region would be sufficient, there are many examples where increased sensitivity could be acheived at other angles. The ability to measure at many different angular intervals would allow the experimenter to empirically select the optimum intervals for the varying conditions of cell size, N/C ratio, granule size and internal structure from sample to sample. The feasibility of making scattered light measurements at many different intervals in flow cytometry was demonstrated. The implementation of simplified versions of these techniques in conjunction with independant measurements of cell size could potentially improve the usefulness of flow cytometry in the study of the internal structure of cells.
The effect of lunarlike satellites on the orbital infrared light curves of Earth-analog planets.
Moskovitz, Nicholas A; Gaidos, Eric; Williams, Darren M
2009-04-01
We have investigated the influence of lunarlike satellites on the infrared orbital light curves of Earth-analog extrasolar planets. Such light curves will be obtained by NASA's Terrestrial Planet Finder (TPF) and ESA's Darwin missions as a consequence of repeat observations to confirm the companion status of a putative planet and determine its orbit. We used an energy balance model to calculate disk-averaged infrared (bolometric) fluxes from planet-satellite systems over a full orbital period (one year). The satellites are assumed to lack an atmosphere, have a low thermal inertia like that of the Moon, and span a range of plausible radii. The planets are assumed to have thermal and orbital properties that mimic those of Earth, while their obliquities and orbital longitudes of inferior conjunction remain free parameters. Even if the gross thermal properties of the planet can be independently constrained (e.g., via spectroscopy or visible-wavelength detection of specular glint from a surface ocean), only the largest (approximately Mars-sized) lunarlike satellites can be detected by light curve data from a TPF-like instrument (i.e., one that achieves a photometric signal-to-noise ratio of 10 to 20 at infrared wavelengths). Nondetection of a lunarlike satellite can obfuscate the interpretation of a given system's infrared light curve so that it may resemble a single planet with high obliquity, different orbital longitude of vernal equinox relative to inferior conjunction, and in some cases drastically different thermal characteristics. If the thermal properties of the planet are not independently established, then the presence of a lunarlike satellite cannot be inferred from infrared data, which would thus demonstrate that photometric light curves alone can only be used for preliminary study, and the addition of spectroscopic data will be necessary.
Advanced methods for light trapping in optically thin silicon solar cells
Nagel, James Richard
2011-12-01
The field of light trapping is the study of how best to absorb light in a thin film of material when most light either reflects away at the surface or transmits straight through to the other side. This has tremendous application to the field of photovoltaics where thin silicon films can be manufactured cheaply, but also fail to capture all of the available photons in the solar spectrum. Advancements in light trapping therefore bring us closer to the day when photovoltaic devices may reach grid parity with traditional fossil fuels on the electrical energy market. This dissertation advances our understanding of light trapping by first modeling the effects of loss in planar dielectric waveguides. The mathematical framework developed here can be used to model any arbitrary three-layer structure with mixed gain or loss and then extract the total field solution for the guided modes. It is found that lossy waveguides possess a greater number of eigenmodes than their lossless counterparts, and that these "loss guided" modes attenuate much more rapidly than conventional modes. Another contribution from this dissertation is the exploration of light trapping through the use of dielectric nanospheres embedded directly within the active layer of a thin silicon film. The primary benefit to this approach is that the device can utilize a surface nitride layer serving as an antireflective coating while still retaining the benefits of light trapping within the film. The end result is that light trapping and light injection are effectively decoupled from each other and may be independently optimized within a single photovoltaic device. The final contribution from this work is a direct numerical comparison between multiple light trapping schemes. This allows us to quantify the relative performances of various design techniques against one another and objectively determine which ideas tend to capture the most light. Using numerical simulation, this work directly compares the absorption
Light output from six battery operated dental curing lights
Energy Technology Data Exchange (ETDEWEB)
Shimokawa, Carlos Alberto Kenji, E-mail: carlos.shimokawa@usp.br [University of São Paulo, School of Dentistry, Restorative Dentistry, Avenida Professor Lineu Prestes, 2227, 05508-000, São Paulo, São Paulo (Brazil); Dalhousie University, Faculty of Dentistry, Dental Clinical Sciences, 5981 University Avenue, B3H 4R2, Halifax, Nova Scotia (Canada); Turbino, Míriam Lacalle, E-mail: miturbin@usp.br [University of São Paulo, School of Dentistry, Restorative Dentistry, Avenida Professor Lineu Prestes, 2227, 05508-000, São Paulo, São Paulo (Brazil); Harlow, Jessie Eudora, E-mail: jessie.harlow@dal.ca [Dalhousie University, Faculty of Dentistry, Dental Clinical Sciences, 5981 University Avenue, B3H 4R2, Halifax, Nova Scotia (Canada); Price, Hannah Louise, E-mail: hannlprice@gmail.com [Dalhousie University, Faculty of Dentistry, Dental Clinical Sciences, 5981 University Avenue, B3H 4R2, Halifax, Nova Scotia (Canada); Price, Richard Bengt, E-mail: richard.price@dal.ca [Dalhousie University, School of Biomedical Engineering and Faculty of Dentistry, 5981 University Avenue, B3H 4R2, Halifax, Nova Scotia (Canada)
2016-12-01
Light Curing Units (LCUs) are used daily in almost every dental office to photocure resins, but because the light is so bright, the user is unable to tell visually if there are any differences between different LCUs. This study evaluated the light output from six dental LCUs: Elipar Deep Cure-S (3M ESPE), Bluephase G2 (Ivoclar Vivadent), Translux 2Wave (Heraeus Kulzer), Optilight Prime (Gnatus), Slim Blast (First Medica) and Led.B (Guilin Woodpecker) with a fully charged battery, after 50, and again after 100, 20 second light exposures. For each situation, the radiant power was measured 10 times with a laboratory-grade power meter. Then, the emission spectrum was measured using a fiber-optic spectrometer followed by an analysis of the light beam profile. It was found there were significant differences in the LCU power and the irradiance values between the LCUs (p < 0.01). The Optilight Prime and Slim Blast LCUs showed a significant reduction in light output after a 50 and 100 exposures, while Bluephase G2 exhibited a significant reduction only after 100 exposures (p < 0.01). The Bluephase G2 and Translux 2 Wave delivered an emission spectrum that had two distinct wavelength emission peaks. Only the Elipar Deep Cure-S and Bluephase G2 LCUs displayed homogeneous light beam profiles, the other LCUs exhibited highly non-homogeneous light beam profiles. It was concluded that contemporary LCUs could have very different light output characteristics. Both manufacturers and researchers should provide more information about the light output from LCUs. - Highlights: • The six LCUs delivered significantly different light output characteristics. • The use of a single irradiance value does not adequately describe the light output from a curing light. • Small differences in the tip area, or how it is defined, will have a large effect on the calculated irradiance. • In some cases there were large portions of the light tip that emitted less than 400 mW/cm². • The radiant
Light output from six battery operated dental curing lights
International Nuclear Information System (INIS)
Shimokawa, Carlos Alberto Kenji; Turbino, Míriam Lacalle; Harlow, Jessie Eudora; Price, Hannah Louise; Price, Richard Bengt
2016-01-01
Light Curing Units (LCUs) are used daily in almost every dental office to photocure resins, but because the light is so bright, the user is unable to tell visually if there are any differences between different LCUs. This study evaluated the light output from six dental LCUs: Elipar Deep Cure-S (3M ESPE), Bluephase G2 (Ivoclar Vivadent), Translux 2Wave (Heraeus Kulzer), Optilight Prime (Gnatus), Slim Blast (First Medica) and Led.B (Guilin Woodpecker) with a fully charged battery, after 50, and again after 100, 20 second light exposures. For each situation, the radiant power was measured 10 times with a laboratory-grade power meter. Then, the emission spectrum was measured using a fiber-optic spectrometer followed by an analysis of the light beam profile. It was found there were significant differences in the LCU power and the irradiance values between the LCUs (p < 0.01). The Optilight Prime and Slim Blast LCUs showed a significant reduction in light output after a 50 and 100 exposures, while Bluephase G2 exhibited a significant reduction only after 100 exposures (p < 0.01). The Bluephase G2 and Translux 2 Wave delivered an emission spectrum that had two distinct wavelength emission peaks. Only the Elipar Deep Cure-S and Bluephase G2 LCUs displayed homogeneous light beam profiles, the other LCUs exhibited highly non-homogeneous light beam profiles. It was concluded that contemporary LCUs could have very different light output characteristics. Both manufacturers and researchers should provide more information about the light output from LCUs. - Highlights: • The six LCUs delivered significantly different light output characteristics. • The use of a single irradiance value does not adequately describe the light output from a curing light. • Small differences in the tip area, or how it is defined, will have a large effect on the calculated irradiance. • In some cases there were large portions of the light tip that emitted less than 400 mW/cm². • The radiant
International Nuclear Information System (INIS)
Jursinic, P.; Govindjee; Wraight, C.A.
1978-01-01
The effect of light-induced and salt-jump induced membrane potential on microsecond and millisecond delayed light emission from chloroplasts, following a single 10 ns flash, have been studied. Microsecond delayed light emission is shown to be independent of the membrane potential contrary to proposals that the activation energy for delayed light emission can be modulated by transmembrane electric fields. This result is discussed in terms of the possible origin of this short-lived emission. Millisecond delayed light after a single excitation flash is enhanced by membrane potential only if a proton gradient is present. By measuring changes in ms delayed light caused by simultaneous injection of KCl and Na-benzoate (which creates a proton gradient) in the presence of valinomycin, the light-induced potential generated across the thylakoid membrane by a single excitation flash was calibrated and found to be 128 +- 10 mV in agreement with the recent measurements of Zickler and Witt, (FEBS Lett. 66, 142-148 (1976)), based on voltage-dependent ionophores. It is concluded that the secondary charges that give rise to ms delayed light, after a single flash, do not fully span the membrane. (author)
International Nuclear Information System (INIS)
Okuno, T.; Kawamura, G.; Muto, H.; Matsuda, A.
2016-01-01
Mesoporous SiO_2 templates deposited TiO_2 nanocrystals are synthesized via a sol–gel route, and Au nanoparticles (NPs) are deposited in the tubular mesopores of the templates by a photodeposition method (Au/SiO_2–TiO_2). The photocatalytic characteristics of Au/SiO_2–TiO_2 are discussed with the action spectra of photoreactions of 2-propanol and methylene blue. Photocatalytic activities of SiO_2–TiO_2 under individual ultraviolet (UV) and visible (Vis) light illumination are enhanced by deposition of Au NPs. Furthermore, Au/SiO_2–TiO_2 shows higher photocatalytic activities under simultaneous irradiation of UV and Vis light compared to the activity under individual UV and Vis light irradiation. Since the photocatalytic activity under simultaneous irradiation is almost the same as the total activities under individual UV and Vis light irradiation, it is concluded that the electrons and the holes generated by lights of different wavelengths are efficiently used for photocatalysis without carrier recombination. - Graphical abstract: This graphic shows the possible charge behavior in Au/SiO_2–TiO_2 under independent light irradiation of ultraviolet and visible light irradiation. Both reactions under independent UV and Vis light irradiation occurred in parallel when Au/SiO_2–TiO_2 photocatalyst was illuminated UV and Vis light simultaneously, and then photocatalytic activity is improved by simultaneous irradiation. - Highlights: • Au nanoparticles were deposited in mesoporous SiO_2–TiO_2 by a photodeposition method. • Photocatalytic activity under UV and Vis light was enhanced by deposition of Au. • Photocatalytic activity of Au/SiO_2–TiO_2 was improved by simultaneous irradiation.
Evaluation of light-emitting diode beacon light fixtures.
2009-12-01
Rotating beacons containing filament light sources have long been used on highway maintenance trucks : to indicate the presence of the truck to other drivers. Because of advances in light-emitting diode (LED) : technologies, flashing lights containin...
International Nuclear Information System (INIS)
Cepeda Pena, William Enrique
1998-01-01
The article tries on the wrong use of the artificial light, of the main problems of the light contamination, dispersion of the light, noxious effects of the light contamination, ecological effects, effects on the man's biological rhythm, economic effects and effects about the civic and vial security, among other topics
Optimization of light quality from color mixing light-emitting diode systems for general lighting
Thorseth, Anders
2012-03-01
Given the problem of metamerisms inherent in color mixing in light-emitting diode (LED) systems with more than three distinct colors, a method for optimizing the spectral output of multicolor LED system with regards to standardized light quality parameters has been developed. The composite spectral power distribution from the LEDs are simulated using spectral radiometric measurements of single commercially available LEDs for varying input power, to account for the efficiency droop and other non-linear effects in electrical power vs. light output. The method uses electrical input powers as input parameters in a randomized steepest decent optimization. The resulting spectral power distributions are evaluated with regard to the light quality using the standard characteristics: CIE color rendering index, correlated color temperature and chromaticity distance. The results indicate Pareto optimal boundaries for each system, mapping the capabilities of the simulated lighting systems with regard to the light quality characteristics.
On Judicial and Quasi-Judicial Independence
Comtois, Suzanne; de Graaf, K.J.
2013-01-01
'Principles of judicial and quasi-judicial independence are fundamental to all democracies and yet, the notion of independence is still elusive. What is judicial and quasi-judicial independence and why is it important? From whom and what are the judiciary and other adjudicators to be independent? Is
Quantum efficiency harmonic analysis of exciton annihilation in organic light emitting diodes
Energy Technology Data Exchange (ETDEWEB)
Price, J. S.; Giebink, N. C., E-mail: ncg2@psu.edu [Department of Electrical Engineering, The Pennsylvania State University, University Park, Pennsylvania 16802 (United States)
2015-06-29
Various exciton annihilation processes are known to impact the efficiency roll-off of organic light emitting diodes (OLEDs); however, isolating and quantifying their contribution in the presence of other factors such as changing charge balance continue to be a challenge for routine device characterization. Here, we analyze OLED electroluminescence resulting from a sinusoidal dither superimposed on the device bias and show that nonlinearity between recombination current and light output arising from annihilation mixes the quantum efficiency measured at different dither harmonics in a manner that depends uniquely on the type and magnitude of the annihilation process. We derive a series of analytical relations involving the DC and first harmonic external quantum efficiency that enable annihilation rates to be quantified through linear regression independent of changing charge balance and evaluate them for prototypical fluorescent and phosphorescent OLEDs based on the emitters 4-(dicyanomethylene)-2-methyl-6-(4-dimethylaminostyryl)-4H-pyran and platinum octaethylporphyrin, respectively. We go on to show that, in most cases, it is sufficient to calculate the needed quantum efficiency harmonics directly from derivatives of the DC light versus current curve, thus enabling this analysis to be conducted solely from standard light-current-voltage measurement data.
International Nuclear Information System (INIS)
Leonardo, J.M.; Reynolds, P.R.; Tuveson, R.W.
1984-01-01
The his-4 locus derived from Escherichia coli strain AB1157 has been transduced into 4 E. coli strains that exhibit all 4 possible combinations of genes controlling sensitivity to near-ultraviolet light (nur versus nur + ) and far-ultraviolet light (uvrA6 versus uvrA + ). The 4 strains exhibited the predicted sensitivity to 254-nm radiation based on the sensitivity of the parent strains from which they were derived and the frequency of his + mutations predicted from experiments with AB1157 from which the his-4 locus was derived. When the 4 strains were treated with 365-nm radiation, they exhibited the predicted sensitivity based on the near-ultraviolet light sensitivity of the strains from which they were derived while his + mutations were undetectable with the 4 strains as well as with strain AB1157. When treated with 365-nm radiation, cells of a WP2sub(s) strain (a derivative of B/r transduced to his-4) plated on semi-enriched medium prepared with casamino acids did not yield induced mutations, whereas plating on semi-enriched medium prepared with nutrient broth did yield mutants at both the his-4 and trp loci at frequencies at least an order of magnitude lower than that observed with far-ultraviolet light. The induction of nutritionally independent mutants by 365-nm radiation is strongly dependent on the supplement used for semi-enrichment. When compared at equivalent survival levels, mutant frequencies are significantly less following 365-nm radiation when compared with far-ultraviolet radiation. (Auth.)
DEFF Research Database (Denmark)
Petersen, Kjell Yngve; Søndergaard, Karin; Kongshaug, Jesper
2015-01-01
the investigations of lighting scenarios carried out in two test installations: White Cube and White Box. The test installations are discussed as large-scale experiential instruments. In these test installations we examine what could potentially occur when light using LED technology is integrated and distributed......Adaptive Lighting Adaptive lighting is based on a partial automation of the possibilities to adjust the colour tone and brightness levels of light in order to adapt to people’s needs and desires. IT support is key to the technical developments that afford adaptive control systems. The possibilities...... differently into an architectural body. We also examine what might occur when light is dynamic and able to change colour, intensity and direction, and when it is adaptive and can be brought into interaction with its surroundings. In short, what happens to an architectural space when artificial lighting ceases...
... I : NADH-Coenzyme Q oxidoreductase (part of the Electron Transport Chain). COMPLEX II : Succinate dehydrogenase (part of the Electron Transport Chain). COMPLEX III : Coenzyme Q-cytochrome c oxidoreductase (part ...
Light Converting Inorganic Phosphors for White Light-Emitting Diodes
Directory of Open Access Journals (Sweden)
Chiao-Wen Yeh
2010-03-01
Full Text Available White light-emitting diodes (WLEDs have matched the emission efficiency of florescent lights and will rapidly spread as light source for homes and offices in the next 5 to 10 years. WLEDs provide a light element having a semiconductor light emitting layer (blue or near-ultraviolet (nUV LEDs and photoluminescence phosphors. These solid-state LED lamps, rather than organic light emitting diode (OLED or polymer light-emitting diode (PLED, have a number of advantages over conventional incandescent bulbs and halogen lamps, such as high efficiency to convert electrical energy into light, reliability and long operating lifetime. To meet with the further requirement of high color rendering index, warm light with low color temperature, high thermal stability and higher energy efficiency for WLEDs, new phosphors that can absorb excitation energy from blue or nUV LEDs and generate visible emissions efficiently are desired. The criteria of choosing the best phosphors, for blue (450-480 nm and nUV (380-400 nm LEDs, strongly depends on the absorption and emission of the phosphors. Moreover, the balance of light between the emission from blue-nUV LEDs and the emissions from phosphors (such as yellow from Y3Al5O12:Ce3+ is important to obtain white light with proper color rendering index and color temperature. Here, we will review the status of phosphors for LEDs and prospect the future development.
Light Converting Inorganic Phosphors for White Light-Emitting Diodes
Chen, Lei; Lin, Chun-Che; Yeh, Chiao-Wen; Liu, Ru-Shi
2010-01-01
White light-emitting diodes (WLEDs) have matched the emission efficiency of florescent lights and will rapidly spread as light source for homes and offices in the next 5 to 10 years. WLEDs provide a light element having a semiconductor light emitting layer (blue or near-ultraviolet (nUV) LEDs) and photoluminescence phosphors. These solid-state LED lamps, rather than organic light emitting diode (OLED) or polymer light-emitting diode (PLED), have a number of advantages over conventional incandescent bulbs and halogen lamps, such as high efficiency to convert electrical energy into light, reliability and long operating lifetime. To meet with the further requirement of high color rendering index, warm light with low color temperature, high thermal stability and higher energy efficiency for WLEDs, new phosphors that can absorb excitation energy from blue or nUV LEDs and generate visible emissions efficiently are desired. The criteria of choosing the best phosphors, for blue (450−480 nm) and nUV (380−400 nm) LEDs, strongly depends on the absorption and emission of the phosphors. Moreover, the balance of light between the emission from blue-nUV LEDs and the emissions from phosphors (such as yellow from Y3Al5O12:Ce3+) is important to obtain white light with proper color rendering index and color temperature. Here, we will review the status of phosphors for LEDs and prospect the future development.
de Haan, Laura H J; Pot, Gerda K; Aarts, Jac M M J G; Rietjens, Ivonne M C M; Alink, Gerrit M
2006-08-01
NAD(P)H:quinone oxidoreductase (NQO1)-mediated detoxification of quinones is suggested to be involved in cancer prevention. In the present study, using transfected CHO cells, it was demonstrated that the relation between NQO1 activity and the resulting protection against the cytotoxicity of menadione shows a steep dose-response curve revealing a 'lower protection threshold' of 0.5mumol DCPIP/min/mg protein and an 'upper protection threshold' at 1mumol DCPIP/min/mg protein. In an additional in vivo experiment it was investigated how both in vitro critical activity levels of NQO1, relate to NQO1 activities in mice and man, either without or upon induction of the enzyme by butylated hydroxyanisol (BHA) or indole-3-carbinol (I(3)C). Data from an experiment with CD1 mice revealed that base-line NQO1 levels in liver, kidney, small intestine, colon and lung are generally below the observed 'lower protection threshold' in vitro, this also holds for most human tissue S-9 samples. To achieve NQO1 levels above this 'lower protection threshold' will require 5-20 fold NQO1 induction. Discussion focuses on the relevance of the in vitro NQO1 activity thresholds for the in vivo situation. We conclude that increased protection against menadione toxicity can probably not be achieved by NQO1 induction but should be achieved by other mechanisms. Whether this conclusion also holds for other electrophiles and the in vivo situation awaits further definition of their NQO1 protection thresholds.
Coherent storage of temporally multimode light using a spin-wave atomic frequency comb memory
International Nuclear Information System (INIS)
Gündoğan, M; Mazzera, M; Ledingham, P M; Cristiani, M; De Riedmatten, H
2013-01-01
We report on the coherent and multi-temporal mode storage of light using the full atomic frequency comb memory scheme. The scheme involves the transfer of optical atomic excitations in Pr 3+ :Y 2 SiO 5 to spin waves in hyperfine levels using strong single-frequency transfer pulses. Using this scheme, a total of five temporal modes are stored and recalled on-demand from the memory. The coherence of the storage and retrieval is characterized using a time-bin interference measurement resulting in visibilities higher than 80%, independent of the storage time. This coherent and multimode spin-wave memory is promising as a quantum memory for light. (paper)
International Nuclear Information System (INIS)
Gundorin, N.A.; Kopach, Y.N.; Telezhnikov, S.A.
1994-01-01
The independent yields of 239 Pu fission fragments by means of gamma-spectroscopy method were measured for light and heavy groups on the IBR-30 reactor in Dubna. Comparative analysis of experimental data for fission induced by thermal and resonance neutrons was performed. The possibilities to increase the measurement's precision consist of the employment of a HPGe detector with high efficiency and its open-quotes activeclose quotes shielding in the gamma spectrometer, as well as a high speed electronics system. In this way the number of identified fragments will be increased and independent yields will be measured to a precision of 1-3%. Measurements at the source with shorter neutron pulse duration to increase neutron energy resolution will be possible after the reconstruction of a modern neutron source in Dubna in accordance with the IREN project
Memory operation devices based on light-illumination ambipolar carbon-nanotube thin-film-transistors
Energy Technology Data Exchange (ETDEWEB)
Aïssa, B., E-mail: aissab@emt.inrs.ca [Qatar Environment and Energy Research Institute (QEERI), Qatar Foundation, P.O. Box 5825, Doha (Qatar); Centre Energie, Matériaux et Télécommunications, INRS, 1650, Boulevard Lionel-Boulet Varennes, Quebec J3X 1S2 (Canada); Nedil, M. [Telebec Wireless Underground Communication Laboratory, UQAT, 675, 1ère Avenue, Val d' Or, Quebec J9P 1Y3 (Canada); Kroeger, J. [NanoIntegris & Raymor Nanotech, Raymor Industries Inc., 3765 La Vérendrye, Boisbriand, Quebec J7H 1R8 (Canada); Haddad, T. [Department of Mechanical Engineering, McGill University, Montreal, Quebec H3A 0B8 (Canada); Rosei, F. [Centre Energie, Matériaux et Télécommunications, INRS, 1650, Boulevard Lionel-Boulet Varennes, Quebec J3X 1S2 (Canada)
2015-09-28
We report the memory operation behavior of a light illumination ambipolar single-walled carbon nanotube thin film field-effect transistors devices. In addition to the high electronic-performance, such an on/off transistor-switching ratio of 10{sup 4} and an on-conductance of 18 μS, these memory devices have shown a high retention time of both hole and electron-trapping modes, reaching 2.8 × 10{sup 4} s at room temperature. The memory characteristics confirm that light illumination and electrical field can act as an independent programming/erasing operation method. This could be a fundamental step toward achieving high performance and stable operating nanoelectronic memory devices.
Timescale stretch parameterization of Type Ia supernova B-band light curves
International Nuclear Information System (INIS)
Goldhaber, G.; Groom, D.E.; Kim, A.; Aldering, G.; Astier, P.; Conley, A.; Deustua, S.E.; Ellis, R.; Fabbro, S.; Fruchter, A.S.; Goobar, A.; Hook, I.; Irwin, M.; Kim, M.; Knop, R.A.; Lidman, C.; McMahon, R.; Nugent, P.E.; Pain, R.; Panagia, N.; Pennypacker, C.R.; Perlmutter, S.; Ruiz-Lapuente, P.; Schaefer, B.; Walton, N.A.; York, T.
2001-01-01
R-band intensity measurements along the light curve of Type Ia supernovae discovered by the Cosmology Project (SCP) are fitted in brightness to templates allowing a free parameter the time-axis width factor w identically equal to s times (1+z). The data points are then individually aligned in the time-axis, normalized and K-corrected back to the rest frame, after which the nearly 1300 normalized intensity measurements are found to lie on a well-determined common rest-frame B-band curve which we call the ''composite curve.'' The same procedure is applied to 18 low-redshift Calan/Tololo SNe with Z < 0.11; these nearly 300 B-band photometry points are found to lie on the composite curve equally well. The SCP search technique produces several measurements before maximum light for each supernova. We demonstrate that the linear stretch factor, s, which parameterizes the light-curve timescale appears independent of z, and applies equally well to the declining and rising parts of the light curve. In fact, the B band template that best fits this composite curve fits the individual supernova photometry data when stretched by a factor s with chi 2/DoF ∼ 1, thus as well as any parameterization can, given the current data sets. The measurement of the data of explosion, however, is model dependent and not tightly constrained by the current data. We also demonstrate the 1 + z light-cure time-axis broadening expected from cosmological expansion. This argues strongly against alternative explanations, such as tired light, for the redshift of distant objects
Bimodal nature in low-energy fission of light actinides
International Nuclear Information System (INIS)
Nagame, Yuichiro; Nishinaka, Ichiro; Tsukada, Kazuaki; Ikezoe, Hiroshi; Otsuki, Tsutomu; Sueki, Keisuke; Nakahara, Hiromichi; Kudo, Hisaaki.
1995-01-01
To solve various problems in the mass division process of light actinoids, some experiments on the basis of bimodal fission were carried. Mass and kinetic energy distribution of Th-232 and U-238 were determined. Pa-225 (N= 134) and Pa-227 (N=136), fission nuclei, were produced by Bi-209 + 0-16 and Bi-209 + 0-18 heavy ion nucleus reactions, and the mass yield distribution were determined by the time-of-flight method and the radiochemical procedure. From the results, two independent deforming processes were proved in the fission process of light actinoid nuclei. On the deforming process through the low fission barrier, nucleus fissioned after small deformation under the influence of stabilization of the shell structure of fission product. In the case of process through the high barrier, however, the nucleus fissioned after large deformation. The unsymmetrical mass division was derived from the former and the symmetrical one from the latter. (S.Y.)
The Effects of Light and Temperature on Germination of Stevia (Stevia rebaudiana BERT. Seeds
Directory of Open Access Journals (Sweden)
Esra UÇAR
2016-03-01
Full Text Available The Stevia rebaudiana (Bert. Bertoni is a perennial herbaceous plant and belongs to family of Asteraceae (Compositae. The contents of S. rebaudiana (Bert. Bertoni consist mainly non-caloric stevioside and rebaudioside A sweeteners. Low seed germination is an important problem in stevia cultivation. Therefore in this study, the effects of light and temperature on germination performance of stevia seeds were studied. Stevia rebaudiana seeds were treated with two lights (light/darkness and four different temperatures (15 ºC, 20 ºC, 25 ºC, 30 ºC. For each treatment, 50 seeds were counted and placed into petri dishes. Experiments were conducted as a randomized complete design method with three replicates. Germination was started within 6 to 10 days depending on the treatments. The highest seed germination rate (71% was observed in darkness/25 ºC temperature and followed by darkness/20 ºC (68% and light/25 ºC (67%. On the other hand, the lowest seed germination rate (31% was obtained from 15 ºC in both light and dark conditions and followed by darkness/30 ºC (43% and light/30 ºC (49%. The results showed that lower (15 ºC and higher (30 ºC temperatures significantly decreased the germination rates of stevia independently from the light treatments.
Light scattering reviews 8 radiative transfer and light scattering
Kokhanovsky, Alexander A
2013-01-01
Light scattering review (vol 8) is aimed at the presentation of recent advances in radiative transfer and light scattering optics. The topics to be covered include: scattering of light by irregularly shaped particles suspended in atmosphere (dust, ice crystals), light scattering by particles much larger as compared the wavelength of incident radiation, atmospheric radiative forcing, astrophysical radiative transfer, radiative transfer and optical imaging in biological media, radiative transfer of polarized light, numerical aspects of radiative transfer.
Polarized light modulates light-dependent magnetic compass orientation in birds
Muheim, Rachel; Sjöberg, Sissel; Pinzon-Rodriguez, Atticus
2016-01-01
Magnetoreception of the light-dependent magnetic compass in birds is suggested to be mediated by a radical-pair mechanism taking place in the avian retina. Biophysical models on magnetic field effects on radical pairs generally assume that the light activating the magnetoreceptor molecules is nondirectional and unpolarized, and that light absorption is isotropic. However, natural skylight enters the avian retina unidirectionally, through the cornea and the lens, and is often partially polarized. In addition, cryptochromes, the putative magnetoreceptor molecules, absorb light anisotropically, i.e., they preferentially absorb light of a specific direction and polarization, implying that the light-dependent magnetic compass is intrinsically polarization sensitive. To test putative interactions between the avian magnetic compass and polarized light, we developed a spatial orientation assay and trained zebra finches to magnetic and/or overhead polarized light cues in a four-arm “plus” maze. The birds did not use overhead polarized light near the zenith for sky compass orientation. Instead, overhead polarized light modulated light-dependent magnetic compass orientation, i.e., how the birds perceive the magnetic field. Birds were well oriented when tested with the polarized light axis aligned parallel to the magnetic field. When the polarized light axis was aligned perpendicular to the magnetic field, the birds became disoriented. These findings are the first behavioral evidence to our knowledge for a direct interaction between polarized light and the light-dependent magnetic compass in an animal. They reveal a fundamentally new property of the radical pair-based magnetoreceptor with key implications for how birds and other animals perceive the Earth’s magnetic field. PMID:26811473
Directory of Open Access Journals (Sweden)
Estefanía Suárez-Vidal
2017-08-01
Full Text Available Light is a major environmental factor that may determine the interaction between plants and herbivores in several ways, including top-down effects through changes in herbivore behavior and bottom-up effects mediated by alterations of plant physiology. Here we explored the relative contribution of these two regulation processes to the outcome of the interaction of pine trees with a major forest pest, the pine weevil (Hylobius abietis. We studied to what extent light availability influence insect feeding behavior and/or the ability of pines to produce induced defenses in response to herbivory. For this purpose, 3-year old Pinus pinaster plants from three contrasting populations were subjected to 6 days of experimental herbivory by the pine weevil under two levels of light availability (complete darkness or natural sunlight independently applied to the plant and to the insect in a fully factorial design. Light availability strongly affected the pine weevil feeding behavior. The pine weevil fed more and caused larger feeding scars in darkness than under natural sunlight. Besides, under the more intense levels of weevil damage (i.e., those registered with insects in darkness, light availability also affected the pine’s ability to respond to insect feeding by producing induced resin defenses. These results were consistent across the three studied populations despite they differed in weevil susceptibility and inducibility of defenses. Morocco was the most damaged population and the one that induced more defensive compounds. Overall, results indicate that light availability modulates the outcome of the pine–weevil interactions through both bottom-up and top-down regulation mechanisms.
Chen, Chun-Chieh; Liu, Chin-San; Li, Chien-Chun; Tsai, Chia-Wen; Yao, Hsien-Tsung; Liu, Te-Chung; Chen, Haw-Wen; Chen, Pei-Yin; Wu, Yu-Ling; Lii, Chong-Kuei; Liu, Kai-Li
2013-09-01
Because induction of phase II detoxification enzyme is important for chemoprevention, we study the effects of Indigofera suffruticosa Mill, a medicinal herb, on the expression of π class of glutathione S-transferase (GSTP) and NAD(P)H: quinone oxidoreductase 1 (NQO1) in rat Clone 9 liver cells. Both water and ethanolic extracts of I. suffruticosa significantly increased the expression and enzyme activities of GSTP and NQO1. I. suffruticosa extracts up-regulated GSTP promoter activity and the binding affinity of nuclear factor erythroid 2-related factor 2 (Nrf2) with the GSTP enhancer I oligonucleotide. Moreover, I. suffruticosa extracts increased nuclear Nrf2 accumulation as well as ARE transcriptional activity. The level of phospho-ERK was augmented by I. suffruticosa extracts, and the ERK inhibitor PD98059 abolished the I. suffruticosa extract-induced ERK activation and GSTP and NQO-1 expression. Moreover, I. suffruticosa extracts, especially the ethanolic extract increased the glutathione level in mouse liver and red blood cells as well as Clone 9 liver cells. The efficacy of I. suffruticosa extracts in induction of phase II detoxification enzymes and glutathione content implies that I. suffruticosa could be considered as a potential chemopreventive agent. Copyright © 2013 Elsevier Ltd. All rights reserved.
How to distinguish elastically scattered light from Stokes shifted light for solid-state lighting?
Meretska, Maryna; Lagendijk, Aart; Thyrrestrup Nielsen, Henri; Mosk, Allard; IJzerman, W.L.; Vos, Willem L.
2016-01-01
We have studied the transport of light through phosphor diffuser plates that are used in commercial solid-state lighting modules (Fortimo). These polymer plates contain YAG:Ce+3phosphor particles that both elastically scatter and Stokes shift light in the visible wavelength range (400–700 nm). We
Federal Laboratory Consortium — Lighting Systems Test Facilities aid research that improves the energy efficiency of lighting systems. • Gonio-Photometer: Measures illuminance from each portion of...
Swanson, Michael A.; Usselman, Robert J.; Frerman, Frank E.; Eaton, Gareth R.; Eaton, Sandra S.
2011-01-01
Electron-transfer flavoprotein-ubiquinone oxidoreductase (ETF-QO) accepts electrons from electron-transfer flavoprotein (ETF) and reduces ubiquinone from the ubiquinone-pool. It contains one [4Fe-4S]2+,1+ and one FAD, which are diamagnetic in the isolated oxidized enzyme and can be reduced to paramagnetic forms by enzymatic donors or dithionite. In the porcine protein, threonine 367 is hydrogen bonded to N1 and O2 of the flavin ring of the FAD. The analogous site in Rhodobacter sphaeroides ETF-QO is asparagine 338. Mutations N338T and N338A were introduced into the R. sphaeroides protein by site-directed mutagenesis to determine the impact of hydrogen bonding at this site on redox potentials and activity. The mutations did not alter the optical spectra, EPR g-values, spin-lattice relaxation rates, or the [4Fe-4S]2+,1+ to FAD point-dipole interspin distances. The mutations had no impact on the reduction potential for the iron-sulfur cluster, which was monitored by changes in the continuous wave EPR signals of the [4Fe-4S]+ at 15 K. For the FAD semiquinone, significantly different potentials were obtained by monitoring the titration at 100 or 293 K. Based on spectra at 293 K the N338T mutation shifted the first and second midpoint potentials for the FAD from +47 mV and −30 mV for wild type to −11 mV and −19 mV, respectively. The N338A mutation decreased the potentials to −37 mV and −49 mV. Lowering the midpoint potentials resulted in a decrease in the quinone reductase activity and negligible impact on disproportionation of ETF1e− catalyzed by ETF-QO. These observations indicate that the FAD is involved in electron transfer to ubiquinone, but not in electron transfer from ETF to ETF-QO. Therefore the iron-sulfur cluster is the immediate acceptor from ETF. PMID:18672901
Accounting for Independent Schools.
Sonenstein, Burton
The diversity of independent schools in size, function, and mode of operation has resulted in a considerable variety of accounting principles and practices. This lack of uniformity has tended to make understanding, evaluation, and comparison of independent schools' financial statements a difficult and sometimes impossible task. This manual has…
Riegel, Kurt W.
1973-01-01
Outdoor lighting is light pollution which handicaps certain astronomical programs. Protective measures must be adopted by the government to aid observational astronomy without sacrificing legitimate outdoor lighting needs. (PS)
Light guide technology: using light to enhance safety
Lerner, William S.
2009-05-01
When used to detect extreme temperatures in harsh environments, warning devices have been placed at a distance from the "danger zone" for several reasons. The inability to mix electricity with flammable, caustic, liquid or volatile substances, the limited heat tolerances exhibited by most light sources, and the susceptibility of light sources to damage from vibration, have made the placement of a warning light directly within these harsh environments impossible. This paper describes a system that utilizes a beam of light to provide just such a warning. This system can be used with hard-wired or wireless sensors, side-light illumination, image projection and image transfer. The entire system may be self-contained and portable.
Biniek, Catherine; Heyno, Eiri; Kruk, Jerzy; Sparla, Francesca; Trost, Paolo; Krieger-Liszkay, Anja
2017-04-01
The quinone reductase NQR and the b-type cytochrome AIR12 of the plasma membrane are important for the control of reactive oxygen species in the apoplast. AIR12 and NQR are two proteins attached to the plant plasma membrane which may be important for generating and controlling levels of reactive oxygen species in the apoplast. AIR12 (Auxin Induced in Root culture) is a single gene of Arabidopsis that codes for a mono-heme cytochrome b. The NADPH quinone oxidoreductase NQR is a two-electron-transferring flavoenzyme that contributes to the generation of O 2 •- in isolated plasma membranes. A. thaliana double knockout plants of both NQR and AIR12 generated more O 2 •- and germinated faster than the single mutant affected in AIR12. To test whether NQR and AIR12 are able to interact functionally, recombinant purified proteins were added to plasma membranes isolated from soybean hypocotyls. In vitro NADH-dependent O 2 •- production at the plasma membrane in the presence of NQR was reduced upon addition of AIR12. Electron donation from semi-reduced menadione to AIR12 was shown to take place. Biochemical analysis showed that purified plasma membrane from soybean hypocotyls or roots contained phylloquinone and menaquinone-4 as redox carriers. This is the first report on the occurrence of menaquinone-4 in eukaryotic photosynthetic organisms. We propose that NQR and AIR12 interact via the quinone, allowing an electron transfer from cytosolic NAD(P)H to apoplastic monodehydroascorbate and control thereby the level of reactive oxygen production and the redox state of the apoplast.
Directory of Open Access Journals (Sweden)
Annika K. Jägerbrand
2015-01-01
Full Text Available Light emitting diodes (LEDs and SSL (solid state lighting are relatively new light sources, but are already widely applied for outdoor lighting. Despite this, there is little available information allowing planners and designers to evaluate and weigh different sustainability aspects of LED/SSL lighting when making decisions. Based on a literature review, this paper proposes a framework of sustainability indicators and/or measures that can be used for a general evaluation or to highlight certain objectives or aspects of special interest when choosing LED/SSL lighting. LED/SSL lighting is reviewed from a conventional sustainable development perspective, i.e., covering the three dimensions, including ecological, economic and social sustainability. The new framework of sustainable indicators allow prioritization when choosing LED/SSL products and can thereby help ensure that short-term decisions on LED/SSL lighting systems are in line with long-term sustainability goals established in society. The new framework can also be a beneficial tool for planners, decision-makers, developers and lighting designers, or for consumers wishing to use LED/SSL lighting in a sustainable manner. Moreover, since some aspects of LED/SSL lighting have not yet been thoroughly studied or developed, some possible future indicators are suggested.
Organic light emitting diode with light extracting layer
Lu, Songwei
2016-06-14
A light extraction substrate includes a glass substrate having a first surface and a second surface. A light extraction layer is formed on at least one of the surfaces. The light extraction layer is a coating, such as a silicon-containing coating, incorporating nanoparticles.
On the mass spectra of the pseudoscalar mesons in the relativistic independent quark model
International Nuclear Information System (INIS)
Khrushchev, V.V.; Semenov, S.V.
2002-01-01
In the framework of the relativistic independent quark model with the QCD-motivated static potential, the masses of the ground states of pseudoscalar mesons and their radial excitations are calculated for both observed mesons and unobserved ones. The strength of the spin-spin interaction and the magnitude of the mean field contribution are estimated for both the light and heavy 0 -+ mesons. The calculated masses are in agreement with experimental values within an accuracy of 30 - 40 MeV, and the predictions are obtained for the mass values of a number of unobserved yet radial excitations of pseudoscalar mesons
Peyer, Suzanne M; Pankey, M Sabrina; Oakley, Todd H; McFall-Ngai, Margaret J
2014-02-01
The squid Euprymna scolopes has evolved independent sets of tissues capable of light detection, including a complex eye and a photophore or 'light organ', which houses the luminous bacterial symbiont Vibrio fischeri. As the eye and light organ originate from different embryonic tissues, we examined whether the eye-specification genes, pax6, eya, six, and dac, are shared by these two organs, and if so, whether they are regulated in the light organ by symbiosis. We obtained sequences of the four genes with PCR, confirmed orthology with phylogenetic analysis, and determined that each was expressed in the eye and light organ. With in situ hybridization (ISH), we localized the gene transcripts in developing embryos, comparing the patterns of expression in the two organs. The four transcripts localized to similar tissues, including those associated with the visual system ∼1/4 into embryogenesis (Naef stage 18) and the light organ ∼3/4 into embryogenesis (Naef stage 26). We used ISH and quantitative real-time PCR to examine transcript expression and differential regulation in postembryonic light organs in response to the following colonization conditions: wild-type, luminescent V. fischeri; a mutant strain defective in light production; and as a control, no symbiont. In ISH experiments light organs showed down regulation of the pax6, eya, and six transcripts in response to wild-type V. fischeri. Mutant strains also induced down regulation of the pax6 and eya transcripts, but not of the six transcript. Thus, luminescence was required for down regulation of the six transcript. We discuss these results in the context of symbiont-induced light-organ development. Our study indicates that the eye-specification genes are expressed in light-interacting tissues independent of their embryonic origin and are capable of responding to bacterial cues. These results offer evidence for evolutionary tinkering or the recruitment of eye development genes for use in a light
Li, Lei; Sahi, Sunil K.; Peng, Mingying; Lee, Eric B.; Ma, Lun; Wojtowicz, Jennifer L.; Malin, John H.; Chen, Wei
2016-01-01
We developed new optic devices ? singly-doped luminescence glasses and nanoparticle-coated lenses that convert UV light to visible light ? for improvement of visual system functions. Tb3+ or Eu3+ singly-doped borate glasses or CdS-quantum dot (CdS-QD) coated lenses efficiently convert UV light to 542?nm or 613?nm wavelength narrow-band green or red light, or wide-spectrum white light, and thereby provide extra visible light to the eye. In zebrafish (wild-type larvae and adult control animals,...
Hybrid daylight/light-emitting diode illumination system for indoor lighting.
Ge, Aiming; Qiu, Peng; Cai, Jinlin; Wang, Wei; Wang, Junwei
2014-03-20
A hybrid illumination method using both daylight and light-emitting diodes (LEDs) for indoor lighting is presented in this study. The daylight can be introduced into the indoor space by a panel-integration system. The daylight part and LEDs are combined within a specific luminaire that can provide uniform illumination. The LEDs can be turned on and dimmed through closed-loop control when the daylight illuminance is inadequate. We simulated the illumination and calculated the indoor lighting efficiency of our hybrid daylight and LED lighting system, and compared this with that of LED and fluorescent lighting systems. Simulation results show that the efficiency of the hybrid daylight/LED illumination method is better than that of LED and traditional lighting systems, under the same lighting conditions and lighting time; the method has hybrid lighting average energy savings of T5 66.28%, and that of the LEDs is 41.62%.
Perfect Lighting for Facial Photography in Aesthetic Surgery: Ring Light.
Dölen, Utku Can; Çınar, Selçuk
2016-04-01
Photography is indispensable for plastic surgery. On-camera flashes can result in bleached out detail and colour. This is why most of the plastic surgery clinics prefer studio lighting similar to professional photographers'. In this article, we want to share a simple alternative to studio lighting that does not need extra space: Ring light. We took five different photographs of the same person with five different camera and lighting settings: Smartphone and ring light; point and shoot camera and on-camera flash; point and shoot camera and studio lighting; digital single-lens reflex (DLSR) camera and studio lighting; DSLR and ring light. Then, those photographs were assessed objectively with an online survey of five questions answered by three distinct populations: plastic surgeons (n: 28), professional portrait photographers (n: 24) and patients (n: 22) who had facial aesthetic procedures. Compared to the on-camera flash, studio lighting better showed the wrinkles of the subject. The ring light facilitated the perception of the wrinkles by providing homogenous soft light in a circular shape rather than bursting flashes. The combination of a DSLR camera and ring light gave the oldest looking subject according to 64 % of responders. The DSLR camera and the studio lighting demonstrated the youngest looking subject according to 70 % of the responders. The majority of the responders (78 %) chose the combination of DSLR camera and ring light that exhibited the wrinkles the most. We suggest using a ring light to obtain well-lit photographs without loss of detail, with any type of cameras. However, smartphones must be avoided if standard pictures are desired. This journal requires that authors assign a level of evidence to each article. For a full description of these Evidence-Based Medicine ratings, please refer to the Table of Contents or the online Instructions to Authors www.springer.com/00266.
Probabilistic conditional independence structures
Studeny, Milan
2005-01-01
Probabilistic Conditional Independence Structures provides the mathematical description of probabilistic conditional independence structures; the author uses non-graphical methods of their description, and takes an algebraic approach.The monograph presents the methods of structural imsets and supermodular functions, and deals with independence implication and equivalence of structural imsets.Motivation, mathematical foundations and areas of application are included, and a rough overview of graphical methods is also given.In particular, the author has been careful to use suitable terminology, and presents the work so that it will be understood by both statisticians, and by researchers in artificial intelligence.The necessary elementary mathematical notions are recalled in an appendix.
Transverse and longitudinal angular momenta of light
Energy Technology Data Exchange (ETDEWEB)
Bliokh, Konstantin Y., E-mail: k.bliokh@gmail.com [Center for Emergent Matter Science, RIKEN, Wako-shi, Saitama 351-0198 (Japan); Nonlinear Physics Centre, RSPhysE, The Australian National University, Canberra, ACT 0200 (Australia); Nori, Franco [Center for Emergent Matter Science, RIKEN, Wako-shi, Saitama 351-0198 (Japan); Physics Department, University of Michigan, Ann Arbor, MI 48109-1040 (United States)
2015-08-26
We review basic physics and novel types of optical angular momentum. We start with a theoretical overview of momentum and angular momentum properties of generic optical fields, and discuss methods for their experimental measurements. In particular, we describe the well-known longitudinal (i.e., aligned with the mean momentum) spin and orbital angular momenta in polarized vortex beams. Then, we focus on the transverse (i.e., orthogonal to the mean momentum) spin and orbital angular momenta, which were recently actively discussed in theory and observed in experiments. First, the recently-discovered transverse spin angular momenta appear in various structured fields: evanescent waves, interference fields, and focused beams. We show that there are several kinds of transverse spin angular momentum, which differ strongly in their origins and physical properties. We describe extraordinary features of the transverse optical spins and overview recent experiments. In particular, the helicity-independent transverse spin inherent in edge evanescent waves offers robust spin–direction coupling at optical interfaces (the quantum spin Hall effect of light). Second, we overview the transverse orbital angular momenta of light, which can be both extrinsic and intrinsic. These two types of the transverse orbital angular momentum are produced by spatial shifts of the optical beams (e.g., in the spin Hall effect of light) and their Lorentz boosts, respectively. Our review is underpinned by a unified theory of the angular momentum of light based on the canonical momentum and spin densities, which avoids complications associated with the separation of spin and orbital angular momenta in the Poynting picture. It allows us to construct a comprehensive classification of all known optical angular momenta based on their key parameters and main physical properties.
Finel, M; Skehel, J M; Albracht, S P; Fearnley, I M; Walker, J E
1992-11-24
NADH:ubiquinone oxidoreductase (complex I) was purified from bovine heart mitochondria by solubilization with n-dodecyl beta-D-maltoside (lauryl maltoside), ammonium sulfate fractionation, and chromatography on Mono Q in the presence of the detergent. Its subunit composition was very similar to complex I purified by conventional means. Complex I was dissociated in the presence of N,N-dimethyldodecylamine N-oxide and beta-mercaptoethanol, and two subcomplexes, I alpha and I beta, were isolated by chromatography. Subcomplex I alpha catalyzes electron transfer from NADH to ubiquinone-1. It is composed of about 22 different and mostly hydrophilic subunits and contains 2.0 nmol of FMN/mg of protein. Among its subunits is the 51-kDa subunit, which binds FMN and NADH and probably contains a [4Fe-4S] cluster also. Three other potential Fe-S proteins, the 75- and 24-kDa subunits and a 23-kDa subunit (N-terminal sequence TYKY), are also present. All of the Fe-S clusters detectable by EPR in complex I, including cluster 2, are found in subcomplex I alpha. The line shapes of the EPR spectra of the Fe-S clusters are slightly broadened relative to spectra measured on complex I purified by conventional means, and the quinone reductase activity is insensitive to rotenone. Similar changes were found in samples of the intact chromatographically purified complex I, or in complex I prepared by the conventional method and then subjected to chromatography in the presence of lauryl maltoside. Subcomplex I beta contains about 15 different subunits. The sequences of many of them contain hydrophobic segments that could be membrane spanning, including at least two mitochondrial gene products, ND4 and ND5. The role of subcomplex I beta in the intact complex remains to be elucidated.
Directory of Open Access Journals (Sweden)
Anamika Basu
Full Text Available Prostate cancer (PCa mortality is driven by highly aggressive tumors characterized by metastasis and resistance to therapy, and this aggressiveness is mediated by numerous factors, including activation of stress survival pathways in the pro-inflammatory tumor microenvironment. LEDGF/p75, also known as the DFS70 autoantigen, is a stress transcription co-activator implicated in cancer, HIV-AIDS, and autoimmunity. This protein is targeted by autoantibodies in certain subsets of patients with PCa and inflammatory conditions, as well as in some apparently healthy individuals. LEDGF/p75 is overexpressed in PCa and other cancers, and promotes resistance to chemotherapy-induced cell death via the transactivation of survival proteins. We report in this study that overexpression of LEDGF/p75 in PCa cells attenuates oxidative stress-induced necrosis but not staurosporine-induced apoptosis. This finding was consistent with the observation that while LEDGF/p75 was robustly cleaved in apoptotic cells into a p65 fragment that lacks stress survival activity, it remained relatively intact in necrotic cells. Overexpression of LEDGF/p75 in PCa cells led to the upregulation of transcript and protein levels of the thiol-oxidoreductase ERp57 (also known as GRP58 and PDIA3, whereas its depletion led to ERp57 transcript downregulation. Chromatin immunoprecipitation and transcription reporter assays showed LEDGF/p75 binding to and transactivating the ERp57 promoter, respectively. Immunohistochemical analysis revealed significantly elevated co-expression of these two proteins in clinical prostate tumor tissues. Our results suggest that LEDGF/p75 is not an inhibitor of apoptosis but rather an antagonist of oxidative stress-induced necrosis, and that its overexpression in PCa leads to ERp57 upregulation. These findings are of significance in clarifying the role of the LEDGF/p75 stress survival pathway in PCa.
Synchrony of plant cellular circadian clocks with heterogeneous properties under light/dark cycles.
Okada, Masaaki; Muranaka, Tomoaki; Ito, Shogo; Oyama, Tokitaka
2017-03-22
Individual cells in a plant can work independently as circadian clocks, and their properties are the basis of various circadian phenomena. The behaviour of individual cellular clocks in Lemna gibba was orderly under 24-h light/dark cycles despite their heterogeneous free-running periods (FRPs). Here, we reveal the entrainment habits of heterogeneous cellular clocks using non-24-h light/dark cycles (T-cycles). The cellular rhythms of AtCCA1::LUC under T = 16 h cycles showed heterogeneous entrainment that was associated with their heterogeneous FRPs. Under T = 12 h cycles, most cells showed rhythms having ~24-h periods. This suggested that the lower limit of entrainment to the light/dark cycles of heterogeneous cellular circadian clocks is set to a period longer than 12 h, which enables them to be synchronous under ~24-h daily cycles without being perturbed by short light/dark cycles. The entrainment habits of individual cellular clocks are likely to be the basis of the circadian behaviour of plant under the natural day-night cycle with noisy environmental fluctuations. We further suggest that modifications of EARLY FLOWERING3 (ELF3) in individual cells deviate the entrainability to shorter T-cycles possibly by altering both the FRPs and light responsiveness.
Studying Light Color using White LED Lighting
Yamagishi, Misako; Yamaba, Kazuo; Nagata, Manori; Kubo, Chiho; Nokura, Kunihiro
Recently, white Light Emitting Diodes (LEDs) are receiving attention worldwide as new lighting devices. This study examined effects of a lighting application on performance using white LEDs. The light color—the correlated color temperature (CCT) —was assessed. It affected to psychological states and physiological conditions. Three CCT conditions were respectively set for the experiment: 2500 K, 5000 K, and 8200 K. In all, 20 younger subjects (20-30 years old), 15 middle-aged to elderly subjects (45-60 years old) and 12 elderly subjects (over 65 years-old) participated. They were presented a Numerical Verification (NV) task for performance measurement. The psychological states on performance were evaluated using the lighting assessment questionnaire. The physiological conditions were recorded using an electrocardiograph. Results show that the effects of CCT differ among age groups. Especially, the performance of younger subjects might differ from CCT conditions; elderly subjects are affected by CCT condition because of their visual acuity or response to contrast of objects.