Late-night-dinner is associated with poor glycemic control in people with type 2 diabetes: The KAMOGAWA-DM cohort study.

Science.gov (United States)

Sakai, Ryosuke; Hashimoto, Yoshitaka; Ushigome, Emi; Miki, Akane; Okamura, Takuro; Matsugasumi, Masako; Fukuda, Takuya; Majima, Saori; Matsumoto, Shinobu; Senmaru, Takafumi; Hamaguchi, Masahide; Tanaka, Muhei; Asano, Mai; Yamazaki, Masahiro; Oda, Yohei; Fukui, Michiaki

2018-04-26

Skipping breakfast or irregular breakfast is associated with poor glycemic control. However, a relationship between the timing of dinner and glycemic control in people with type 2 diabetes remains indefinite. Therefore, we investigated the relationship between late-night-dinner and glycemic control in people with type 2 diabetes. We performed questionnaire survey for lifestyle factors in this cross-sectional study. We defined having dinner later than eight pm as late-night-dinner. We examined the differences in clinical and metabolic parameters between those who have late-night-dinner and those who do not have. We also examined the relationship between late-night-dinner and HbA1c, using multiple regression analysis. Ninety-five people (23.2%) had a late-night-dinner, among 409 people with type 2 diabetes. Metabolic parameters (mean (SD) or median (interquartile range)) of people with late-night-dinner were worse than those of without, including body mass index (BMI) (24.4 (4.0) vs. 23.2 (3.4) kg/m 2 , p = 0.006), triglycerides (1.5 (1.1-2.1) vs. 1.2 (0.8-1.7) mmol/L, p dinner (standardized regression coefficient = 0.13, p = 0.028) was associated with hemoglobin A1c after adjusting for age, BMI, sex, duration of diabetes, smoking, exercise, alcohol, snacking after dinner, nighttime sleep duration, time from dinner to bedtime, skipping breakfast, and medication for diabetes. Late-night-dinner is independently associated with poor glycemic control in people with type 2 diabetes.

Molecular basis for increased risk for late-onset Alzheimer disease due to the naturally occurring L28P mutation in apolipoprotein E4.

Science.gov (United States)

Argyri, Letta; Dafnis, Ioannis; Theodossiou, Theodossis A; Gantz, Donald; Stratikos, Efstratios; Chroni, Angeliki

2014-05-02

The apolipoprotein (apo) E4 isoform has consistently emerged as a susceptibility factor for late-onset Alzheimer disease (AD), although the exact mechanism is not clear. A rare apoE4 mutant, apoE4[L28P] Pittsburgh, burdens carriers with an added risk for late-onset AD and may be a useful tool for gaining insights into the role of apoE4 in disease pathogenesis. Toward this end, we evaluated the effect of the L28P mutation on the structural and functional properties of apoE4. ApoE4[L28P] was found to have significantly perturbed thermodynamic properties, to have reduced helical content, and to expose a larger portion of the hydrophobic surface to the solvent. Furthermore, this mutant is thermodynamically destabilized and more prone to proteolysis. When interacting with lipids, apoE4[L28P] formed populations of lipoprotein particles with structural defects. The structural perturbations brought about by the mutation were accompanied by aberrant functions associated with the pathogenesis of AD. Specifically, apoE4[L28P] promoted the cellular uptake of extracellular amyloid β peptide 42 (Aβ42) by human neuroblastoma SK-N-SH cells as well as by primary mouse neuronal cells and led to increased formation of intracellular reactive oxygen species that persisted for at least 24 h. Furthermore, lipoprotein particles containing apoE4[L28P] induced intracellular reactive oxygen species formation and reduced SK-N-SH cell viability. Overall, our findings suggest that the L28P mutation leads to significant structural and conformational perturbations in apoE4 and can induce functional defects associated with neuronal Aβ42 accumulation and oxidative stress. We propose that these structural and functional changes underlie the observed added risk for AD development in carriers of apoE4[L28P].

Majanduse nõrgim lüli / Kristiina Ojuland

Index Scriptorium Estoniae

Ojuland, Kristiina, 1966-

2008-01-01

Töölepingu seaduse eelnõust. Ilmunud ka Meie Maa 27. mai 2008, lk. 2 ; Koit 27. mai 2008, lk. 6, pealkiri kujul: nõrgim lüli - iganenud olukord tööturul ; Vooremaa 27. mai 2008, lk. 2, pealkiri kujul: majanduse nõrgim lüli on iganenud olukord tööjõuturul ; Sõnumitooja 28. mai 2008, lk. 2 ; Pärnu Postimees 29. mai 2008, lk. 15 ; Harju Ekspress 30. mai 2008, lk. 6 ; Kuulutaja 30. mai 2008, lk. 4, pealkiri kujul: muudatused aitavad paremini kohanduda ; Põhjarannik 31. mai 2008, lk. 2

P-wave assignment of 232Th neutron resonances

International Nuclear Information System (INIS)

Corvi, F.; Pasquariello, G.; Veen, T. van der

1978-01-01

A method of p-wave assignment which exploits the parity dependence of the primary capture γ-ray spectrum was applied to the 232 Th resonance. The yield of capture γ-rays above 4.4 MeV from a 6 mm thick metallic thorium disk was measured in the neutron energy range 20-2200 eV and compared to a similar run with γ-rays in the range 3.7 - 4.4 MeV. A total of 58 resonances showing an enhancement of the high energy γ-ray yield were assigned as p-waves. Assuming that their reduced neutron widths follow a Porter-Thomas distribution, their average value and then the p-wave strength function S 1 were estimated with a maximum likelihood method. The results are: average neutron width=3.4(+0.8 or -0.6)meV; S 1 = 2.0 (+0.5 or -0.4).10 -4

Investigation of the $^{8}$Li($^{2}$H,p)$^{9}$Li Reaction at REX-ISOLDE

CERN Multimedia

2002-01-01

We propose to investigate the $^{8}$Li($^{2}$H,p )$^{9}$Li reaction at REX-ISOLDE. The main aim is to test a recently found discrepancy in extracted spectroscopic factors for this reaction. As a byproduct we will obtain improved data relevant for predictions of the $^{8}$Li(n,$\\gamma$)$^{9}$Li rate in inhomogeneous nucleosynthesis. For the full experiment including beam tuning and background measurements we ask for 13 shifts.

Study of the 6Li(p,π+)7Li reaction at 600 MeV

International Nuclear Information System (INIS)

Bauer, T.; Beurtey, R.; Boudard, A.; Bruge, G.; Chaumeaux, A.; Couvert, P.; Duhm, H.H.; Garreta, D.; Matoba, M.; Terrein, Y.; Aslanides, E.; Bertini, R.; Brochard, F.; Gorodetzky, Ph.; Hibou, F.; Bimbot, L.; Le Bornec, Y.; Tatischeff, B.; Dillig, M.

1977-01-01

The positive pion production through the 6 Li(p,π + ) reaction at 600 MeV has been studied using the high-resolution magnetic spectrometer SPES I. Differential cross sections have been measured from 5 0 to 35 0 sub(lab). The 6 Li(p,π + ) reaction feeds preferentially the 4.63 MeV 7/2 - level of 7 Li. The results of a calculation based on two- and three-nucleon diagrams with π and rho exchange between the projectile and a bound nucleon are also presented. (Auth.)

Ionic debye screening in dense liquid plasmas observed for Li+p, d reactions with liquid Li target

International Nuclear Information System (INIS)

Kasagi, J.; Yonemura, H.; Toriyabe, Y.; Nakagawa, A.; Sugawara, T.; Wang Tieshan

2009-01-01

Thick target yields of α particles emitted in the 6 Li(d,α) 4 He and 7 Li(p,α) 4 He reactions were measured for Li target in the solid and liquid phase. Observed reaction rates for the liquid Li are always larger than those for the solid. This suggests that the stopping power of hydrogen ion in the liquid Li metal might be smaller than in the solid. Using the empirically obtained stopping power for the liquid Li, we have deduced the screening potentials of the Li+p and Li+d reactions in both phases. The deduced screening potential for the liquid Li is about 500 eV larger than for the solid. This difference is attributed to the effect of liquefied Li + ions. It is concluded that the ionic screening is much stronger than the electronic screening in a low-temperature dense plasmas. (authors)

Ionic Debye Screening in Dense Liquid Plasmas Observed for Li+p,d Reactions with Liquid Li Target

Institute of Scientific and Technical Information of China (English)

J.Kasagi; H.Yonemura; Y.Toriyabe; A.Nakagawa; T.Sugawara; WANG Tie-shan

2009-01-01

Thick target yields of a particles emitted in the ~6Li(d,a)~4 He and ~7Li(p,a)~4 He reactions were measured for Li target in the solid and liquid phase.Observed reaction rates for the liquid Li are always larger than those for the solid.This suggests that the stopping power of hydrogen ion in the liquid Li metal might be smaller than in the solid.Using the empirically obtained stopping power for the liquid Li,we have deduced the screening potentials of the Li+p and Li+d reactions in both phases.The deduced screening potential for the liquid Li is about 500 eV larger than for the solid.This difference is attributed to the effect of liquefied Li~+ ions.It is concluded that the ionic screening is much stronger than the electronic screening in a low-temperature dense plasmas.

Administration of Lactobacillus salivarius LI01 or Pediococcus pentosaceus LI05 improves acute liver injury induced by D-galactosamine in rats.

Science.gov (United States)

Lv, Long-Xian; Hu, Xin-Jun; Qian, Gui-Rong; Zhang, Hua; Lu, Hai-Feng; Zheng, Bei-Wen; Jiang, Li; Li, Lan-Juan

2014-06-01

This work investigated the effect of the intragastric administration of five lactic acid bacteria from healthy people on acute liver failure in rats. Sprague-Dawley rats were given intragastric supplements of Lactobacillus salivarius LI01, Lactobacillus salivarius LI02, Lactobacillus paracasei LI03, Lactobacillus plantarum LI04, or Pediococcus pentosaceus LI05 for 8 days. Acute liver injury was induced on the eighth day by intraperitoneal injection of 1.1 g/kg body weight D-galactosamine (D-GalN). After 24 h, samples were collected to determine the level of liver enzymes, liver function, histology of the terminal ileum and liver, serum levels of inflammatory cytokines, bacterial translocation, and composition of the gut microbiome. The results indicated that pretreatment with L. salivarius LI01 or P. pentosaceus LI05 significantly reduced elevated alanine aminotransferase and aspartate aminotransferase levels, prevented the increase in total bilirubin, reduced the histological abnormalities of both the liver and the terminal ileum, decreased bacterial translocation, increased the serum level of interleukin 10 and/or interferon-γ, and resulted in a cecal microbiome that differed from that of the liver injury control. Pretreatment with L. plantarum LI04 or L. salivarius LI02 demonstrated no significant effects during this process, and pretreatment with L. paracasei LI03 aggravated liver injury. To the best of our knowledge, the effects of the three species-L. paracasei, L. salivarius, and P. pentosaceus-on D-GalN-induced liver injury have not been previously studied. The excellent characteristics of L. salivarius LI01 and P. pentosaceus LI05 enable them to serve as potential probiotics in the prevention or treatment of acute liver failure.

Demokraatia mudelid ja kodanikuõpetus üldhariduses : puuduva lüli otsinguil / Anu Toots

Index Scriptorium Estoniae

Toots, Anu, 1959-

2005-01-01

Autori hinnangul demokraatiamudeli täpsema määratlemiseta jääb puudu see tähtis lüli, mis seoks üldise demokraatia teooria oodatava praktilise kodanikukäitumisega. Tabel: Demokraatia põhimudelid ja nendele vastavad kodaniku ideaaltüübid

K2-232 b: a transiting warm Saturn on an eccentric P = 11.2 d orbit around a V = 9.9 star

Science.gov (United States)

Brahm, R.; Espinoza, N.; Jordán, A.; Rojas, F.; Sarkis, P.; Díaz, M. R.; Rabus, M.; Drass, H.; Lachaume, R.; Soto, M. G.; Jenkins, J. S.; Jones, M. I.; Henning, Th; Pantoja, B.; Vučković, M.

2018-06-01

We report the discovery of K2-232 b using photometric data of the Kepler K2 satellite coupled with ground-based spectroscopic observations. K2-232 b has a mass of MP = 0.397 ± 0.037 MJ, a radius of RP = 1.00 ± 0.020 RJ, and a moderately low equilibrium temperature of Teq = 1030 ± 15 K due to its relatively large star-planet separation of a = 0.1036 au. K2-232 b orbits its bright (V = 9.9) late F-type host star in an eccentric orbit (e = 0.258 ± 0.025) every 11.2 d, and is one of only four well-characterized warm Jupiters having host stars brighter than V = 10. We estimate a heavy element content of 20 ± 7 M⊕ for K2-232 b, which is consistent with standard models of giant planet formation. The bright host star of K2-232 b makes this system a well-suited target for detailed follow-up observations that will aid in the study of the atmospheres and orbital evolution of giant planets at moderate separations from their host stars.

Ab initio investigations of the electronic structures and chemical bonding in LiCo{sub 6}P{sub 4} and Li{sub 2}Co{sub 12}P{sub 7}

Energy Technology Data Exchange (ETDEWEB)

Matar, Samir F. [CNRS, ICMCB, UPR 9048, F‐33600 Pessac (France); Université de Bordeaux, ICMCB, UPR 9048, F‐33600 Pessac (France); Al-Alam, Adel; Ouaini, Naïm [Université Saint-Esprit de Kaslik (USEK), Groupe OCM (Optimization et Caractérisation des Matériaux), CSR-USEK, CNRS-L, Jounieh (Lebanon); Pöttgen, Rainer, E-mail: pottgen@uni-muenster.de [Institut für Anorganische und Analytische Chemie, Universität Münster, Corrensstraße 30, D-48149 Münster (Germany)

2013-06-15

The electronic structures of the metal-rich phosphides LiCo{sub 6}P{sub 4} and Li{sub 2}Co{sub 12}P{sub 7} were studied by DFT calculations. Both phosphides consist of three-dimensional [Co{sub 6}P{sub 4}] and [Co{sub 12}P{sub 7}] polyanionic networks which leave hexagonal channels for the lithium atoms. COOP data show strong Co–P and Co–Co bonding within the polyanions. The lithium atoms have trigonal prismatic phosphorus coordination. Total energy calculations indicate stability upon de-lithiation towards the Co{sub 6}P{sub 4} and Co{sub 12}P{sub 7} substructures - Graphical abstract: The cobalt–phosphorus networks in LiCo{sub 6}P{sub 4} and Li{sub 2}Co{sub 12}P{sub 7}. - Highlights: • Chemical bonding resolved in the metal-rich phosphides LiCo{sub 6}P{sub 4} and Li{sub 2}Co{sub 12}P{sub 7}. • Strong covalent Co–P bonding character in the [Co{sub 6}P{sub 4}] and [Co{sub 12}P{sub 7}] substructures. • Total energy calculations indicate stability of the de-lithiated substructures.

Depth profiling Li in electrode materials of lithium ion battery by {sup 7}Li(p,γ){sup 8}Be and {sup 7}Li(p,α){sup 4}He nuclear reactions

Energy Technology Data Exchange (ETDEWEB)

Sunitha, Y., E-mail: sunibarc@gmail.com; Kumar, Sanjiv

2017-06-01

A proton induced γ-ray emission method based on {sup 7}Li(p,γ){sup 8}Be proton capture reaction and a nuclear reaction analysis method involving {sup 7}Li(p,α){sup 4}He reaction are described for depth profiling Li in the electrode materials, graphite and lithium cobalt oxide for example, of a Li-ion battery. Depth profiling by {sup 7}Li(p,γ){sup 8}Be reaction is accomplished by the resonance at 441 keV and involves the measurement of 14.6 and 17.6 MeV γ-rays, characteristic of the reaction, by a NaI(Tl) detector. The method has a detection sensitivity of ∼0.2 at% and enables profiling up to a depth ≥20 µm with a resolution of ≥150 nm. The profiling to a fairly large depth is facilitated by the absence of any other resonance up to 1800 keV proton energy. The reaction has substantial off-resonance cross-sections. A procedure is outlined for evaluating the off-resonance yields. Interferences from fluorine and aluminium are major limitation of this depth profiling methodology. The depth profile measurement by {sup 7}Li(p,α){sup 4}He reaction, on the other hand, utilises 2–3 MeV protons and entails the detection of α-particles at 90° or 150° angles. The reaction exhibits inverse kinematics at 150°. This method, too, suffers interference from fluorine due to the simultaneous occurrence of {sup 19}F(p,α){sup 16}O reaction. Kinematical considerations show that the interference is minimal at 90° and thus is the recommended angle of detection. The method is endowed with a detection sensitivity of ∼0.1 at%, a depth resolution of ∼100 nm and a probing depth of about 30 µm in the absence and 5–8 µm in the presence of fluorine in the material. Both methods yielded comparable depth profiles of Li in the cathode (lithium cobalt oxide) and the anode (graphite) of a Li-ion battery.

Li14P2O3N6 and Li7PN4: Computational study of two nitrogen rich crystalline LiPON electrolyte materials

Science.gov (United States)

Al-Qawasmeh, Ahmad; Holzwarth, N. A. W.

2017-10-01

Two lithium oxonitridophosphate materials are computationally examined and found to be promising solid electrolytes for possible use in all solid-state batteries having metallic Li anodes - Li14P2O3N6 and Li7PN4. The first principles simulations are in good agreement with the structural analyses reported in the literature for these materials and the computed total energies indicate that both materials are stable with respect to decomposition into binary and ternary products. The computational results suggest that both materials are likely to form metastable interfaces with Li metal. The simulations also find both materials to have Li ion migration activation energies comparable or smaller than those of related Li ion electrolyte materials. Specifically, for Li7PN4, the experimentally measured activation energy can be explained by the migration of a Li ion vacancy stabilized by a small number of O2- ions substituting for N3- ions. For Li14P2O3N6, the activation energy for Li ion migration has not yet been experimentally measured, but simulations predict it to be smaller than that measured for Li7PN4.

Core TuLiP - Logic Programming for Trust Management

NARCIS (Netherlands)

Czenko, M.R.; Etalle, Sandro; Dahl, V.; Niemelä, I.

2007-01-01

We propose CoreTuLiP - the core of a trust management language based on Logic Programming. CoreTuLiP is based on a subset of moded logic programming, but enjoys the features of TM languages such as RT; in particular clauses are issued by different authorities and stored in a distributed manner. We

Concentration of thorium isotopes and the activity ratios of 230Th/232Th and 228Th/232Th in seawater in the Pacific Ocean

International Nuclear Information System (INIS)

Miyake, Yasuo; Sugimura, Yukio; Yasujima, Tadahide.

1978-01-01

The concentration of thorium isotopes and the activity ratios of 230 Th/ 232 Th and 228 Th/ 232 Th in 500 l sea water samples collected in the Pacific Ocean were determined. Thorium isotopes were analyzed by alpha-ray spectrometry after separating them from other elements with an anion exchange resin. The average content of thorium ( 232 Th) of 0.9 ng l -1 was obtained in the open Pacific water. The average contents of 230 Th and 228 Th were 2.1 x 10 -2 pgl -1 and 1.2 agl -1 respectively. It was found that the ratios of 230 Th/ 232 Th and 228 Th/ 232 Th ranged respectively from 1.0 to 29, and from 0.4 to as high as 128. (author)

Dosimetric characterization of a Tl new material of LiF: Mg, Cu, P; Caracterizacion dosimetrica de un nuevo material TL de LiF: Mg, Cu, P

Energy Technology Data Exchange (ETDEWEB)

Gonzalez, P.R.; Avila, O. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico); Quiroz, C. [UAEM, Facultad de Medicina, 50180, Toluca, Estado de Mexico (Mexico); Azorin, J. [UAM-I, 09340 Mexico D.F. (Mexico)

2004-07-01

In this work the method of preparation of a new material T L is described of LiF: Mg, Cu, P and the preliminary results of the tests corresponding to their dosimetric characterization are reported. The carried out tests were: detection threshold, sensitivity, dissipation of the sign T L, answer T L in function of the dose of radiation gamma, among others. The results showed that this material when receiving the one thermal treatment of having erased of 280 C by 10 min, followed by 100 C for two hours, he/she has a detection threshold ten times but I lower that that of the TLD-100, is 21 times but sensitive that that of reference and the dissipation of the sign T L during two months was null. This new material T L overcomes in many aspects to the commercial dosemeters of its type. (Author)

Synthesis and characterization of Li2FeP2O7/C nanocomposites as cathode materials for Li-ion batteries

International Nuclear Information System (INIS)

Du, Juan; Jiao, Lifang; Wu, Qiong; Liu, Yongchang; Zhao, Yanping; Guo, Lijing; Wang, Yijing; Yuan, Huatang

2013-01-01

Highlights: • Li 2 FeP 2 O 7 /C were prepared by a simple solid-state reaction. • Carbon coating and reducing particle size are adopted to improve the discharge capacity. • The detailed study about the electrochemical properties of Li 2 FeP 2 O 7 is scarce. • Li 2 FeP 2 O 7 /C show superior electrochemical properties. -- Abstract: The pristine Li 2 FeP 2 O 7 and Li 2 FeP 2 O 7 /C nanocomposites with different content of carbon have been successfully synthesized via a simple solid-state reaction, using cheap glucose as carbon source. XRD and EDS patterns demonstrate the high purity of the products. SEM images exhibit that the size of the particles is about 50–500 nm. Electrochemical measurements reveal that carbon coating and reducing particle size significantly enhance the electrochemical performances of Li 2 FeP 2 O 7 . Particularly, the Li 2 FeP 2 O 7 /C sample with a carbon content of 4.88 wt.% displays the best performance with a specific discharge capacity of 103.1 mAh g −1 at 0.1 C, which is 93.7% of its one-electron theoretical capacity, meaning 110 mAh g −1 . Meanwhile, it shows favorable cycling stability and excellent rate performance, indicating its potential applicability in Li-ion batteries in the long term

Isochronous Liénard-type nonlinear oscillators of arbitrary dimensions

Indian Academy of Sciences (India)

2015-10-13

Oct 13, 2015 ... Isochronous system; Liénard-type system; singular and nonsingular Hamiltonian. ... Liénard-type nonlinear oscillators exhibiting isochronous properties, including linear, quadratic and ... Pramana – Journal of Physics | News.

Mass distributions in monoenergetic-neutron-induced fission of 232Th

International Nuclear Information System (INIS)

Glendenin, L.E.; Gindler, J.E.; Ahmad, I.; Henderson, D.J.; Meadows, J.W.

1980-01-01

Fission product yields for 38 masses were determined for the fission of 232 Th with essentially monoenergetic neutrons of 2.0, 3.0, 4.0, 5.9, 6.4, 6.9, 7.6, and 8.0 MeV. Fission product activities were measured by Ge(Li) γ-ray spectrometry of irradiated 232 Th foils and by chemical separation of the fission product elements followed by β counting. The mass yield data for 232 Th(n,f ) show a sensitive increase of fission yields in the near-symmetric mass region (valley) with increasing incident neutron energy E/sub n/ and a pronounced dip in yield at the onset of second-chance fission just above the neutron binding energy (at approx. 6 MeV) where the excitation energy is lowered by competition with neutron evaporation prior to fission. The effect of second-chance fission is also seen in the yields of asymmetric peak products. A distinct third peak is observed at symmetry in the valley of the mass distribution, and enhanced yields are observed in the asymmetric peaks at masses associated with even Z (proton pairing effect). The fission yeilds of 232 Th(n,f ) are compared with those of 238 U(n,f ) and 232 Th

A novel type heterojunction photodiodes formed junctions of Au/LiZnSnO and LiZnSnO/p-Si in series

Energy Technology Data Exchange (ETDEWEB)

Aydin, H. [Department of Metallurgical and Materials Science, Faculty of Engineering, Tunceli University, Tunceli (Turkey); Tataroğlu, A. [Department of Physics, Faculty of Science, Gazi University, Ankara (Turkey); Al-Ghamdi, Ahmed A. [Department of Physics, Faculty of Science, King Abdulaziz University, Jeddah (Saudi Arabia); Yakuphanoglu, F., E-mail: fyhanoglu@firat.edu.tr [Department of Metallurgical and Materials Science, Faculty of Engineering, Tunceli University, Tunceli (Turkey); Department of Physics, Faculty of Science, King Abdulaziz University, Jeddah (Saudi Arabia); El-Tantawy, Farid [Department of Physics, Faculty of Science, Suez Canal University, Ismailia (Egypt); Farooq, W.A. [Physics and Astronomy Department, College of Science, King Saud University, Riyadh (Saudi Arabia)

2015-03-15

Highlights: • Lithium–zinc–tin–oxide thin films were prepared by sol gel method. • The Au/LiZnSnO/p-Si/Al photodiodes were fabricated using a LZTO layer grown on p-Si. • The photodiodes with Li-doped ZTO interfacial layer exhibited a better device performance. - Abstract: Lithium–zinc–tin–oxide thin films were prepared by sol gel method. The structural and optical properties of the films were investigated. The optical band gaps of the LiZnSnO films were found to be 3.78 eV for 0 at.% Li, 3.77 eV for 1 at.% Li, 3.87 eV for 3 at.% Li and 3.85 eV for 5 at.% Li, respectively. Au/LiZnSnO/p-Si/Al photodiodes were fabricated using a lithium–zinc–tin–oxide (LZTO, Li–Zn–Sn–O) layer grown on p-Si semiconductor. The electrical characteristics of the photodiodes were analyzed by current–voltage, capacitance–voltage and conductance–voltage measurements. The reverse current of the diodes increases with both the increasing illumination intensity and Li content. It was found that the Li-doped ZTO photodiodes exhibited a better device performance than those with an undoped ZTO.

LiDAR error estimation with WAsP engineering

DEFF Research Database (Denmark)

Bingöl, Ferhat; Mann, Jakob; Foussekis, D.

2008-01-01

The LiDAR measurements, vertical wind profile in any height between 10 to 150m, are based on assumption that the measured wind is a product of a homogenous wind. In reality there are many factors affecting the wind on each measurement point which the terrain plays the main role. To model Li......DAR measurements and predict possible error in different wind directions for a certain terrain we have analyzed two experiment data sets from Greece. In both sites LiDAR and met. mast data have been collected and the same conditions are simulated with Riso/DTU software, WAsP Engineering 2.0. Finally measurement...

Local television news reporting of kidney disease.

Science.gov (United States)

Jaffery, Jonathan B; Jacobson, Lynn M; Goldstein, Kenneth M; Pribble, James M

2006-12-01

Local television is the primary news source for the majority of Americans. This study aims to describe how local news reports on kidney disease. Using our searchable database of health-related late local news segments from 2002, we identified stories with the key words kidney, hypertension, blood pressure, or diabetes. This database is a representative sample of the late local news on 122 stations in the 50 largest US media markets, comprising 60% of the population. The content of each identified story was reviewed to determine whether it mentioned: (1) chronic kidney disease (CKD), (2) screening for kidney disease, or (3) kidney disease as a potential complication (for blood pressure- or diabetes-related stories). Only 2 of 1,799 database news stories (0.11%) included "kidney" as a summary key word; neither referred to CKD, screening, or complications of other diseases. Of 19 stories about hypertension or blood pressure (1.06% of all stories) and the 14 stories about diabetes (0.78% of all stories), none mentioned these criteria. Despite efforts to increase public awareness of and screening for CKD, local television news (the most important news source for a majority of Americans) did little to help achieve these goals. Further work will be needed to confirm whether this paucity of coverage varies over time and determine why so little attention is given to CKD. Educating physicians and public relations personnel who advocate for kidney disease about journalists' needs may be an important step to help advance public awareness of CKD.

Superplastic deformation of P/M and I/M Al-Li based alloys

International Nuclear Information System (INIS)

Lederich, R.J.; Sastry, S.M.L.

1984-01-01

Incremental strain-rate and constant strain-rate cone-forming tests have been carried out at 450-550 C to investigate the superplastic forming characteristics of Al-Li-Cu-Mn, Al-Li-Cu-Mg-Zr, and Al-Li-Zn-Mg alloys processed by powder-metallurgy (P/M) and ingot-metallurgy (I/M) techniques. It is found that P/M Al-Li alloys containing 0.2 pct Zr are inherently superplastically formable without the need for extensive thermomechanical processing. I/M Al-Li alloys containing Zr are also superplastically formable. The mechanical properties of the superplastically formed and solution-treated-and-aged alloys are comparable to those of solution-treated-and-aged alloys before superplastic forming. 6 references

News Media Industry

Science.gov (United States)

2007-01-01

radio news departments will operate on many technological platforms at the same time ( Papper , 2006, p.3). News radio stations will likely broadcast...Retrieved March 25, 2007, from http://firstlook.nytimes.com/index.php?cat=4 Papper , Bob. RTNDF’s 2006 Future of the News Survey, 25 Mar. 2006. 10 Mar

The "7Li(d, p)"8Li reaction in inverse kinematics at 5.44 MeV/u

International Nuclear Information System (INIS)

Pakou, A.; Aslanoglou, X.; Sgouros, O.; Soukeras, V.; Keeley, N.; Cappuzzello, F.; Acosta, L.; Agodi, C.; Calabrese, S.; Carbone, D.; Cavallaro, M.; Foti, A.; Marquinez-Duran, G.; Martel, I.; Mazzocco, M.; Strano, E.; Parascandolo, C.; Pierroutsakou, D.; Rusek, K.; Zagatto, V.A.B.

2017-01-01

New data are presented for the "7Li(d, p)"8Li stripping reaction which, together with previously reported elastic scattering data taken in the same experiment, provide a coherent set. These data, plus existing measurements of the elastic scattering and stripping at 6 MeV/u were analysed within the same coupled reaction channels scheme. Good descriptions of the stripping data to the 0.0 MeV 2"+ and 0.98 MeV 1"+ states of "8Li were obtained using a set of left angle "8Li vertical stroke "7Li + n right angle overlaps taken from the literature, provided that the elastic scattering was also well described. Multi-step reaction paths made significant contributions to the description of the larger angle data. The asymptotic normalisation coefficients are compared with previous determinations. (orig.)

48 CFR 232.070 - Responsibilities.

Science.gov (United States)

2010-10-01

... DoD contract financing, including DoD contract financing policies and important related procedures... operations. Refer specific cases involving financing policy or important procedural issues to OUSD(AT&L)DPAP... OF DEFENSE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING 232.070 Responsibilities. (a) The...

Dosimetric characterization of a Tl new material of LiF: Mg, Cu, P

International Nuclear Information System (INIS)

Gonzalez, P.R.; Avila, O.; Quiroz, C.; Azorin, J.

2004-01-01

In this work the method of preparation of a new material T L is described of LiF: Mg, Cu, P and the preliminary results of the tests corresponding to their dosimetric characterization are reported. The carried out tests were: detection threshold, sensitivity, dissipation of the sign T L, answer T L in function of the dose of radiation gamma, among others. The results showed that this material when receiving the one thermal treatment of having erased of 280 C by 10 min, followed by 100 C for two hours, he/she has a detection threshold ten times but I lower that that of the TLD-100, is 21 times but sensitive that that of reference and the dissipation of the sign T L during two months was null. This new material T L overcomes in many aspects to the commercial dosemeters of its type. (Author)

Characterization of the thermoluminescent detectors LiF:Mg,Cu,P. Environmental dosimetry applications

International Nuclear Information System (INIS)

Ciocci Brazzano, Ligia; Gregori, Beatriz N.; Papadopulos, Susana B.; Carelli, Jorge L.

2005-01-01

Studies on thermal-luminescent properties of the LiF:Mg detectors, Cu, P enrichment with Li-7 (99.93% of Li-7 and 0.07% of Li-6): optimization of the heating profile, loss of information, detection limit and doses and energy responses are presented in this work. Their performance is compared with LiF:Mg detectors, Mg, Ti enriched with Li-7 (99.93% of Li-7 and 0.07% Li-6), which are at present used for environmental dosimetry at the Physics Dosimetry Laboratory of the Nuclear Regulatory Authority [es

Thermal phonon scattering in silicon doped with Li, P and Li-O; influence of the electronic structure of the impurities

International Nuclear Information System (INIS)

Fortier, Dominique.

1976-07-01

Besides the three phonon scattering mechanisms generally considered in insulators, i.e. boundary effect, isotopic scattering and phonon-phonon interaction, the electron-phonon scattering mechanism was studied with special reference to the scattering of thermal phonons by donor impurities in silicon. In order to demonstrate clearly the effect of the electronic structure of the impurity on this scattering, three donor centres were investigated: Li, Li-O and P. On the basis of the calculated relaxation times it was possible from theoretical analysis to account for the main results and to explain why the Li centre scatters thermal phonons more efficiently than Li-O and P centres in the isolated impurity range [fr

La «loi pêche» (Code rural et l'introduction des espèces piscicoles

Directory of Open Access Journals (Sweden)

GUEVEL B.

1997-01-01

Full Text Available Les introductions d'espèces piscicoles non représentées et/ou susceptibles de créer des déséquilibres biologiques se développent, ici ou là, pour des considérations halieutiques ou accessoirement scientifiques, ou tout simplement pour se débarrasser de spécimens devenus encombrants. Face à ce phénomène, le droit de la pêche continentale n'offre qu'une réponse partielle qui n'est pas suffisante, à ce jour, pour assurer son contrôle. Ainsi, le chapitre II du titre troisième (pêche en eau douce et gestion des ressources piscicoles du livre II (nouveau du Code rural organise le contrôle des peuplements (section IV : articles L.232-10 à L.232-12, R.*232-3 à R.*232-25 du Code rural. Ce dispositif comporte un ensemble d'interdictions assorties, le cas échéant, d'autorisations : - interdiction d'introduire dans les eaux libres et les piscicultures, et de transporter sans autorisation, des poissons susceptibles de provoquer des déséquilibres biologiques ; - interdiction d'introduire sans autorisation des espèces de poissons qui ne sont pas officiellement représentées dans les eaux douces nationales ; - interdiction d'introduire, dans les eaux classées en 1ère catégorie piscicole, des poissons des espèces carnassières (brochet, perche, sandre et black-bass ; - interdiction d'introduire dans les eaux libres, pour rempoissonner ou aleviner, des poissons qui ne proviennent pas d'établissements agréés. Cette législation est perfectible en tant qu'elle suscite des difficultés d'application : la notion d'introduction n'est pas explicitée par les textes et doit être distinguée de l'emploi d'appâts vifs ou de la remise à l'eau ; le transport des espèces non représentées - autres que celles qui sont de nature à créer des déséquilibres biologiques - n'est pas soumis à autorisation et s'effectue donc librement ; le système de listes d'espèces présente une certaine rigidité et ne permet pas de pr

Preliminary study of the preparation of uranium 232 by irradiation of protactinium 231; Etude preliminaire a la preparation d'uranium 232 par irradiation de protactinium 231

Energy Technology Data Exchange (ETDEWEB)

Guillot, Ph. [Commissariat a l' Energie Atomique, Fontenay aux Roses (France). Centre d' Etudes Nucleaires

1965-07-01

A bibliography about preparation of uranium 232 is done. This even-even isotope of uranium is suitable for radioactive tracer, neutron source through {alpha},n reaction and heat source applications. The irradiation of protactinium 231, the chemical separation and the purification of uranium are studied. (author) [French] Une etude bibliographique de la preparation d'uranium 232 a ete effectuee. Cet isotope pair-pair de l'uranium peut etre utilise en tant que traceur, source d'energie et source de neutrons, lorsqu'il est melange a un element leger tel le beryllium. Une etude du taux de formation des isotopes produits, lors de l'irradiation du protactinium 231 - une des manieres d'obtenir l'uranium 232 - a ete faite a l'aide d'un programme passe sur ordinateur. Les problemes poses par la separation chimique et la purification de l'uranium ont ete egalement envisages dans ce rapport. (auteur)

L12 ordering and δ′ precipitation in Al-Cu-Li

KAUST Repository

Neibecker, Pascal

2017-06-06

The precipitation mechanism of the δ\\' (Al3Li) phase in Al-Li alloys has been controversially discussed in recent decades, specifically with respect to a conjectured congruent ordering process. However, kinetics in the Al-Li system does not allow to resolve the intermediate stages of precipitation and hence to experimentally clarify this issue. In this paper, we are revisiting the subject in ternary Al-Cu-Li alloys with pronouncedly slower kinetics, employing Transmission Electron Microscopy, High-Angle Annular Dark-Field Scanning Transmission Electron Microscopy, Differential Scanning Calorimetry and Atom Probe Tomography. The results show clear evidence for congruent ordering in a selected compositional range, revealing an already strongly L12 ordered microstructure after natural aging with a chemically homogeneous Li distribution and a decomposition of the alloy upon annealing at elevated temperatures. The presented study of the δ\\' precipitation evaluates the reaction pathway of this process and compares it to the predictions of the Bragg-Williams-Gorsky model with respect to decomposition and ordering in this alloy system.

L12 ordering and δ′ precipitation in Al-Cu-Li

KAUST Repository

Neibecker, Pascal; Leitner, Michael; Kushaim, Muna; Boll, Torben; Anjum, Dalaver H.; Al-Kassab, Tala’ at; Haider, Ferdinand

2017-01-01

The precipitation mechanism of the δ' (Al3Li) phase in Al-Li alloys has been controversially discussed in recent decades, specifically with respect to a conjectured congruent ordering process. However, kinetics in the Al-Li system does not allow to resolve the intermediate stages of precipitation and hence to experimentally clarify this issue. In this paper, we are revisiting the subject in ternary Al-Cu-Li alloys with pronouncedly slower kinetics, employing Transmission Electron Microscopy, High-Angle Annular Dark-Field Scanning Transmission Electron Microscopy, Differential Scanning Calorimetry and Atom Probe Tomography. The results show clear evidence for congruent ordering in a selected compositional range, revealing an already strongly L12 ordered microstructure after natural aging with a chemically homogeneous Li distribution and a decomposition of the alloy upon annealing at elevated temperatures. The presented study of the δ' precipitation evaluates the reaction pathway of this process and compares it to the predictions of the Bragg-Williams-Gorsky model with respect to decomposition and ordering in this alloy system.

Phototransfered thermoluminescence for dose reassessment in LiF:mg,ti , LiF: mg,Cu,p TL detectors

International Nuclear Information System (INIS)

Rodriguez Otazo, M.; Baly, L.

2001-01-01

Phototransfered Thermoluminescence (PTTL) from LiF:Mg,Ti (TLD-100) and LiF: Mg,Cu,P (GR-200) was studied at different conditions using different sources of UV light for dose reassessment purposes. The TL dosimeters were irradiated with 137Cs in the range 2 mGy to 100 mGy. The convenience of using PTTL for dose reassessment was analyzed

Comparative study of thermoluminescent properties of LiF: Mg, Cu, P, LiF: Mg, Ti and TLD-100 irradiated with X-rays

International Nuclear Information System (INIS)

Azorin, J.; Rivera, T.; Gonzalez, P.; Ortega, X.; Ginjaume, M.

2000-01-01

The thermoluminescent properties (Tl) of LiF: Mg, Cu, P, and LiF: Mg, Ti, were investigated both developed in Mexico and comparing them with the properties of TLD-100 when they are exposure to X-rays. The Tl curve of LiF: Mg, Cu, P exhibited two peaks at 200 and 300 Centigrade. Its response Tl in function of dose resulted linear in the interval of 0.5 Gy until 5 Gy and its sensitivity to X-ray was around 25 times greater that of the TLD-100. Also it was measured the Tl response of the three materials in function of photon energy. The results showed that LiF: Mg, Cu, P has potential to be used as X-ray dosemeter. (Author)

Compatibility behavior of beryllium with LiAlO2 and Li2ZrO3 ceramics, with 316L and 1.4914 steels in Sibelius

International Nuclear Information System (INIS)

Flament, T.; Roux, N.; Abassin, J.J.; Briec, M.; Cruz, D.; Schuster, I.

1991-01-01

The compatibility under irradiation of beryllium with Li 2 O, LiAlO 2 , Li 4 SiO 4 and Li 2 ZrO 3 ceramics and with 316L and 1.4914 steels was investigated in SIBELIUS. The irradiation was performed in the SILOE reactor at 550 deg C for 1690 hours in He + 0.1%H 2 purge pas. Examinations of the LiAlO 2 /Be and Li 2 ZrO 3 /Be couples show a weak oxidation of beryllium and the presence of cavities near the interface with ceramics. Examinations of the 316L/Be and 1.4914/Be couples show the formation of an oxide layer on all beryllium and steel surfaces suggesting that corrosion arises from a species (most likely T 2 O and/or H 2 O) present in the environmental atmosphere. Post-irradiation annealing tests of beryllium indicate that the major part of helium is released during irradiation whereas the major part of tritium is released above 700 deg C

Design and Preparation of Nano-Lignin Peroxidase (NanoLiP by Protein Block Copolymerization Approach

Directory of Open Access Journals (Sweden)

Turgay Tay

2016-06-01

Full Text Available This study describes the preparation of nanoprotein particles having lignin peroxidase (LiP using a photosensitive microemulsion polymerization technique. The protein-based nano block polymer was synthesized by cross-linking of ligninase enzyme with ruthenium-based aminoacid monomers. This type polymerization process brought stability in different reaction conditions, reusability and functionality to the protein-based nano block polymer system when compared the traditional methods. After characterization of the prepared LiP copolymer nanoparticles, enzymatic activity studies of the nanoenzymes were carried out using tetramethylbenzidine (TMB as the substrate. The parameters such as pH, temperature and initial enzyme concentration that affect the activity, were investigated by using prepared nanoLip particles and compared to free LiP. The reusability of the nano-LiP particles was also investigated and the obtained results showed that the nano-LiP particles exhibited admirable potential as a reusable catalyst.

Pre- and post-irradiation fading effect for LiF:Mg,Ti and LiF:Mg,Cu,P materials used in routine monitoring

International Nuclear Information System (INIS)

Carinou, E.; Askounis, P.; Dimitropoulou, F.; Kiranos, G.; Kyrgiakou, H.; Nirgianaki, E.; Papadomarkaki, E.; Kamenopoulou, V.

2011-01-01

LiF is a well-known thermoluminescent (TL) material used in individual monitoring, and its fading characteristics have been studied for years. In the present study, the fading characteristics (for a period of 150 d) of various commercial LiF materials with different dopants have been evaluated. The materials used in the study are those used in routine procedures by the Personal Dosimetry Dept. of Greek Atomic Energy Commission and in particular, LiF:Mg,Ti (MTS-N, TL Poland), LiF:Mg,Cu,P (MCP-N, TL Poland), LiF:Mg,Cu,P (MCP-Ns, thin active layer detector, TL Poland) and LiF:Mg,Cu,P (TLD100H, Harshaw). The study showed that there is a sensitivity loss in signal of up to 20 % for the MTS-N material for a 150-d period in the pre-irradiation fading phase. The MCP-N has a stable behaviour in the pre-irradiation fading phase, but this also depends on the readout system. As far as the post-irradiation fading effect is concerned, a decrease of up to 20 % for the MTS-N material is observed for the same time period. On the other hand, the LiF:Mg,Cu,P material presents a stable behaviour within ±5 %. These results show that the fading effect is different for each material and should be taken into account when estimating doses from dosemeters that are in use for >2 months. (authors)

Electrochemical Li Topotactic Reaction in Layered SnP3 for Superior Li-Ion Batteries

Science.gov (United States)

Park, Jae-Wan; Park, Cheol-Min

2016-10-01

The development of new anode materials having high electrochemical performances and interesting reaction mechanisms is highly required to satisfy the need for long-lasting mobile electronic devices and electric vehicles. Here, we report a layer crystalline structured SnP3 and its unique electrochemical behaviors with Li. The SnP3 was simply synthesized through modification of Sn crystallography by combination with P and its potential as an anode material for LIBs was investigated. During Li insertion reaction, the SnP3 anode showed an interesting two-step electrochemical reaction mechanism comprised of a topotactic transition (0.7-2.0 V) and a conversion (0.0-2.0 V) reaction. When the SnP3-based composite electrode was tested within the topotactic reaction region (0.7-2.0 V) between SnP3 and LixSnP3 (x ≤ 4), it showed excellent electrochemical properties, such as a high volumetric capacity (1st discharge/charge capacity was 840/663 mA h cm-3) with a high initial coulombic efficiency, stable cycle behavior (636 mA h cm-3 over 100 cycles), and fast rate capability (550 mA h cm-3 at 3C). This layered SnP3 anode will be applicable to a new anode material for rechargeable LIBs.

Investigation of dosimetric characteristics of the high sensitivity LiF:Mg,Cu,P thermoluminescent dosemeter and its applications in diagnostic radiology

International Nuclear Information System (INIS)

Fung, K.K.L.

2000-12-01

The recent introduction and development of the thermoluminescent (T.L.) phosphor material LiF:Mg,Cu,P (usually named TLD100H or GR200A) has aroused intense interest of scientists in the field of radiation dosimetry due to its very favourable dosimetric characteristics. Both conventional LiF:Mg,Ti (TLD100) and LiF:Mg,Cu,P T.L. phosphors are tissue-equivalent but GR200A outperforms in respect of its very much higher sensitivity, by a factor of greater than 25, and a dose detection threshold of less than 1 μGy. A reproducible readout and annealing regime was developed in the initial part of this study with the newly installed automatic TLD (Thermoluminescence Dosimetry) apparatus in the X-ray and Radiation Physics Laboratories of the Hong Kong Polytechnic University. Basic dosimetric characteristics of this T.L. dosemeter (supplied by Harshaw-Bicron Co.) were then investigated. This paved the foundation for subsequent selected novel application studies in diagnostic radiology. Dosimetric characteristics which included linearity, reproducibility, batch uniformity, energy response, and minimum detectable dose were studied using X-rays in the commonly used diagnostic radiology energy range. Favourable dosimetric characteristics were observed from this T.L. phosphor, which agrees well with published studies. The effect of the number of thermal treatment cycles in the initialisation process on dosimetric properties of this T.L. phosphor was also investigated. This study exploits the favourable dosimetric properties of these T.L. dosemeters in some selected novel dosimetric applications in diagnostic radiology with an anthropomorphic phantom using facilities both in these laboratories and also in radiology departments of various district hospitals in Hong Kong. Radiation absorbed dose from the direct or scattered beam, at critical sites inside and on the surface of the phantom, were measured in these radiological studies. The special focus in some of these studies was to

Investigation of dosimetric characteristics of the high sensitivity LiF:Mg,Cu,P thermoluminescent dosemeter and its applications in diagnostic radiology

Energy Technology Data Exchange (ETDEWEB)

Fung, K.K.L

2000-12-01

The recent introduction and development of the thermoluminescent (T.L.) phosphor material LiF:Mg,Cu,P (usually named TLD100H or GR200A) has aroused intense interest of scientists in the field of radiation dosimetry due to its very favourable dosimetric characteristics. Both conventional LiF:Mg,Ti (TLD100) and LiF:Mg,Cu,P T.L. phosphors are tissue-equivalent but GR200A outperforms in respect of its very much higher sensitivity, by a factor of greater than 25, and a dose detection threshold of less than 1 {mu}Gy. A reproducible readout and annealing regime was developed in the initial part of this study with the newly installed automatic TLD (Thermoluminescence Dosimetry) apparatus in the X-ray and Radiation Physics Laboratories of the Hong Kong Polytechnic University. Basic dosimetric characteristics of this T.L. dosemeter (supplied by Harshaw-Bicron Co.) were then investigated. This paved the foundation for subsequent selected novel application studies in diagnostic radiology. Dosimetric characteristics which included linearity, reproducibility, batch uniformity, energy response, and minimum detectable dose were studied using X-rays in the commonly used diagnostic radiology energy range. Favourable dosimetric characteristics were observed from this T.L. phosphor, which agrees well with published studies. The effect of the number of thermal treatment cycles in the initialisation process on dosimetric properties of this T.L. phosphor was also investigated. This study exploits the favourable dosimetric properties of these T.L. dosemeters in some selected novel dosimetric applications in diagnostic radiology with an anthropomorphic phantom using facilities both in these laboratories and also in radiology departments of various district hospitals in Hong Kong. Radiation absorbed dose from the direct or scattered beam, at critical sites inside and on the surface of the phantom, were measured in these radiological studies. The special focus in some of these studies was to

Comparison of characteristics of LiF:Mg,Ti e LiF:Mg,Cu,P thermoluminescent dosemeters; Comparacao das caracteristicas dos dosimetros termoluminescentes LiF:Mg,Ti e LiF:Mg,Cu,P

Energy Technology Data Exchange (ETDEWEB)

Pereira, M.S.; Filipov, D., E-mail: dfilipov@utfpr.edu.br [Universidade Tecnologica Federal do Parana (UTFPR/DAFIS), Curitiba, PR (Brazil). Departamento Academicao de Fisica; Schelin, H.R. [Instituto de Pesquisa Pele Pequeno Principe (IPPPP), Curitiba, PR (Brazil)

2014-07-01

The aim of the current study was to compare the thermoluminescent dosimeters LiF:Mg,Ti (TLD-100) and LiF:Mg,Cu,P (MCP) data, which were acquired by the Federal Technological University - Parana. Tests were realized, for this purpose, such as: sensitivity (only one MCP TLD did not present results within the limit range), linearity (whose MCP result was better than the TLD-100 one), energy dependence (TLD-100 presented lower variation than MCP TLD) and reproducibility (whose TLD-100 results were better than the MCP ones). The results from both dosimeters show that these TLDs attend radiodiagnostic dosimetry criteria, however MCP had more satisfactory results. (author)

Comprehending News Videotexts: The Influence of the Visual Content

Science.gov (United States)

Cross, Jeremy

2011-01-01

Informed by dual coding theory, this study explores the role of the visual content in L2 listeners' comprehension of news videotexts. L1 research into the visual characteristics and comprehension of news videotexts is outlined, subsequently informing the quantitative analysis of audiovisual correspondence in the news videotexts used. In each of…

Some solid state properties of LiF:Mg,Cu,P TL-materials

Energy Technology Data Exchange (ETDEWEB)

Prokert, K [Dresden Univ. of Technology (Georgia). Inst. of Radiation Protection

1996-12-31

This paper describes some investigations of solid state characteristics of a LiF:Mg,Cu,P thermoluminofor. The investigations were carried out with LiF:Mg,Cu,P-thermoluminescence (TL)-material prepared by the chemical institute of the Moscow State University in form of powder and sintered pellets. Following methods were used: (1) Studies of the chemical composition was carried out by x-ray fluorescence analysis with `SPECTRO-X-LAB`-equipment with Rh-anode, B{sub 4}C-polarizator, LN{sub 2}-cooled 30 mm{sup 2} Si(Li)-detector with Be-window (energy resolution 155 keV for Mn-k{sub {alpha}}-radiation). The software of the equipment permits a qualitative and quantitative determination of elements with atomic numbers >10; (2) investigations of the crystal structure were taken by x-ray-diffractometry with a SIEMENS-diffractometer D 500 using Cu-k{sub {alpha}}-radiation. The integrated software permits to analyze the crystalline phases using the data of the measured material by comparison with standards spectra of various pure substances. The results of determination of the chemical composition and the crystal structure show that in the thermoluminofor LiF:Mg,Cu,P, besides the basic material LiF also Li{sub 3}PO{sub 4}- and Li{sub 4}P{sub 2}O{sub 7}-crystal regions exists. The occurrence of the two lithium phosphate phases follow from the high ammonium phosphate content in the mixture for the thermoluminofor production. The formation of the various lithium phosphates depends from state of dehydration of phosphoric acids, created by thermal decomposition of NH{sub 4}H{sub 2}PO{sub 4} before their reactions with LiF start. Therefore the content of these compounds can differ if thermoluminofors are prepared under various conditions. The maintenance of the needed equilibrium of special structures in the material depends on the preparation procedure, on the reading and annealing methods. Typically for such an equilibrium is its poor thermal stability. (Abstract Truncated)

Late baryogenesis faces primordial nucleosynthesis

International Nuclear Information System (INIS)

Delbourgo-Salvador, P.; Audouze, J.; Salati, P.

1991-11-01

Since the sphalleron mechanism present in the standard theory of electro-weak interactions violates B+L, models have been suggested where baryogenesis takes place at late epochs and is concomitant with primordial nucleosynthesis. The possibility for the baryon asymmetry to be generated was numerically investigated at the same time as the light elements are cooked. The primordial yields of D, 3 He, 4 He and 7 Li were shown to exceed the upper limits inferred from observation, unless baryogenesis is anterior to the freeze-out of the weak interactions. This implies strong constraints on scenarios where the baryon asymmetry originates from the late decay of massive gravitinos. (author) 18 refs., 6 figs

The good news about giving bad news to patients.

Science.gov (United States)

Farber, Neil J; Urban, Susan Y; Collier, Virginia U; Weiner, Joan; Polite, Ronald G; Davis, Elizabeth B; Boyer, E Gil

2002-12-01

There are few data available on how physicians inform patients about bad news. We surveyed internists about how they convey this information. We surveyed internists about their activities in giving bad news to patients. One set of questions was about activities for the emotional support of the patient (11 items), and the other was about activities for creating a supportive environment for delivering bad news (9 items). The impact of demographic factors on the performance of emotionally supportive items, environmentally supportive items, and on the number of minutes reportedly spent delivering news was analyzed by analysis of variance and multiple regression analysis. More than half of the internists reported that they always or frequently performed 10 of the 11 emotionally supportive items and 6 of the 9 environmentally supportive items while giving bad news to patients. The average time reportedly spent in giving bad news was 27 minutes. Although training in giving bad news had a significant impact on the number of emotionally supportive items reported (P woman, unmarried, and having a history of major illness were also associated with reporting a greater number of emotionally supportive activities. Internists report that they inform patients of bad news appropriately. Some deficiencies exist, specifically in discussing prognosis and referral of patients to support groups. Physician educational efforts should include discussion of prognosis with patients as well as the availability of support groups.

Parent Stars of Extrasolar Planets - XIV. Strong Evidence of Li Abundance Deficit

OpenAIRE

Gonzalez, Guillermo

2014-01-01

We report the results of our analysis of new high resolution spectra of 30 late-F to early-G dwarf field stars for the purpose of deriving their Li abundances. They were selected from the subsample of stars in the Valenti and Fischer compilation that are lacking detected planets. These new data serve to expand our comparison sample used to test whether stars with Doppler-detected giant planets display Li abundance anomalies. Our results continue to show that Li is deficient among stars with p...

An insight into intrinsic interfacial properties between Li metals and Li10GeP2S12 solid electrolytes.

Science.gov (United States)

Chen, Bingbing; Ju, Jiangwei; Ma, Jun; Zhang, Jianjun; Xiao, Ruijuan; Cui, Guanglei; Chen, Liquan

2017-11-29

Density functional theory simulations and experimental studies were performed to investigate the interfacial properties, including lithium ion migration kinetics, between lithium metal anode and solid electrolyte Li 10 GeP 2 S 12 (LGPS). The LGPS[001] plane was chosen as the studied surface because the easiest Li + migration pathway is along this direction. The electronic structure of the surface states indicated that the electrochemical stability was reduced at both the PS 4 - and GeS 4 -teminated surfaces. For the interface cases, the equilibrium interfacial structures of lithium metal against the PS 4 -terminated LGPS[001] surface (Li/PS 4 -LGPS) and the GeS 4 -terminated LGPS[001] surface (Li/GeS 4 -LGPS) were revealed based on the structural relaxation and adhesion energy analysis. Solid electrolyte interphases were expected to be formed at both Li/PS 4 -LGPS and Li/GeS 4 -LGPS interfaces, resulting in an unstable state of interface and large interfacial resistance, which was verified by the EIS results of the Li/LGPS/Li cell. In addition, the simulations of the migration kinetics show that the energy barriers for Li + crossing the Li/GeS 4 -LGPS interface were relatively low compared with the Li/PS 4 -LGPS interface. This may contribute to the formation of Ge-rich phases at the Li/LGPS interface, which can tune the interfacial structures to improve the ionic conductivity for future all-solid-state batteries. This work will offer a thorough understanding of the Li/LGPS interface, including local structures, electronic states and Li + diffusion behaviors in all-solid-state batteries.

TL response of LiF: Mg, Cu, P dosemeters in function of the photon energy; Respuesta TL de dosimetros de LiF: Mg, Cu, P en funcion de la energia del foton

Energy Technology Data Exchange (ETDEWEB)

Gonzalez, P.R. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico); Azorin, J. [UAM-I, 09340 Mexico D.F. (Mexico); Furetta, C. [Universita degli Studi di Roma ' La Sapienza' , Piazzale Aldo Moro 2, 00185 Roma (Italy)

2005-07-01

In this work the obtained results of studying the response of dosemeters of LiF: Mg, Cu, P + Ptfe, developed in the ININ, commercial dosemeters GR200A (LiF: Mg, Cu, P) of chinese manufacture and TLD-100 (LiF: Mg, Ti) US are presented, when irradiating them with X rays 16, 24, 34.5, 42, 100 and 145 keV of effective energy, with gamma rays of 662 keV ({sup 137} Cs) and 1252 keV ({sup 60} Co). The results are presented in function of the sensitivity that the dosemeters showed normalized to gamma radiation of {sup 60} Co. It was appreciated that the dosemeters more equivalent to the tissue, they were those of LiF: Mg, Cu, P + Ptfe, while the less equivalent ones were the TLD-100. (Author)

There is no news like bad news: women are more remembering and stress reactive after reading real negative news than men.

Directory of Open Access Journals (Sweden)

Marie-France Marin

Full Text Available With the advent of specialized television channels offering 24-hour coverage, Internet and smart phones, the possibility to be constantly in contact with the media has increased dramatically in the last decades. Despite this higher access to knowledge, the impact media exposure has on healthy individuals remains poorly studied. Given that most information conveyed in the media is negative and that upon perception of threat, the brain activates the stress system, which leads to cortisol secretion, we decided to determine how healthy individuals react to media information. Accordingly, we investigated whether reading real negative news (1 is physiologically stressful, (2 modulates one's propensity to be stress reactive to a subsequent stressor and (3 modulates remembrance for these news. Sixty participants (30 women, 30 men were randomly assigned to either twenty-four real neutral news excerpts or to twenty-four real negative excerpts for 10 minutes. They were then all exposed to a well-validated psychosocial stressor, the Trier Social Stress Test (TSST, which consists of an anticipation phase of 10 minutes and a test phase of 10 minutes. A total of eight salivary cortisol samples were collected, at 10-minutes intervals, throughout the experimental procedure. One day later, a free recall of the news was performed. Results showed that although reading negative news did not lead to change in cortisol levels (p>0.05, it led to a significant increase in cortisol to a subsequent stressor in women only (p<0.001. Also, women in the negative news condition experienced better memory for these news excerpts compared to men (p<0.01. These results suggest a potential mechanism by which media exposure could increase stress reactivity and memory for negative news in women.

The {sup 7}Li(d, p){sup 8}Li reaction in inverse kinematics at 5.44 MeV/u

Energy Technology Data Exchange (ETDEWEB)

Pakou, A.; Aslanoglou, X.; Sgouros, O.; Soukeras, V. [The University of Ioannina, Department of Physics and HINP, Ioannina (Greece); Keeley, N. [National Centre for Nuclear Research, Otwock (Poland); Cappuzzello, F. [INFN Laboratori Nazionali del Sud, Catania (Italy); Universita di Catania, Dipartimento di Fisica e Astronomia, Catania (Italy); Acosta, L. [Universidad Nacional Autonoma de Mexico, Instituto de Fisica, Mexico City (Mexico); INFN Sezione di Catania, Catania (Italy); Agodi, C.; Calabrese, S.; Carbone, D.; Cavallaro, M. [INFN Laboratori Nazionali del Sud, Catania (Italy); Foti, A. [Universita di Catania, Dipartimento di Fisica e Astronomia, Catania (Italy); INFN Sezione di Catania, Catania (Italy); Marquinez-Duran, G.; Martel, I. [Universidad de Huelva, Departamento de Ciencias Integradas, Facultad de Ciencias Experimentales, Campus de El Carmen, Huelva (Spain); Mazzocco, M.; Strano, E. [Universita di Padova, Dipartimento di Fisica e Astronomia, Padova (Italy); INFN Sezione di Padova, Padova (Italy); Parascandolo, C.; Pierroutsakou, D. [INFN Sezione di Napoli, Napoli (Italy); Rusek, K. [University of Warsaw, Heavy Ion Laboratory, Warsaw (Poland); Zagatto, V.A.B. [Instituto de Fisica da Universidade Federal Fluminense, Niteroi, RJ (Brazil)

2017-08-15

New data are presented for the {sup 7}Li(d, p){sup 8}Li stripping reaction which, together with previously reported elastic scattering data taken in the same experiment, provide a coherent set. These data, plus existing measurements of the elastic scattering and stripping at 6 MeV/u were analysed within the same coupled reaction channels scheme. Good descriptions of the stripping data to the 0.0 MeV 2{sup +} and 0.98 MeV 1{sup +} states of {sup 8}Li were obtained using a set of left angle {sup 8}Li vertical stroke {sup 7}Li + n right angle overlaps taken from the literature, provided that the elastic scattering was also well described. Multi-step reaction paths made significant contributions to the description of the larger angle data. The asymptotic normalisation coefficients are compared with previous determinations. (orig.)

Device fabrication, characterization, and thermal neutron detection response of LiZnP and LiZnAs semiconductor devices

Energy Technology Data Exchange (ETDEWEB)

Montag, Benjamin W., E-mail: bmontag@ksu.edu; Ugorowski, Philip B.; Nelson, Kyle A.; Edwards, Nathaniel S.; McGregor, Douglas S.

2016-11-11

Nowotny-Juza compounds continue to be explored as candidates for solid-state neutron detectors. Such a device would have greater efficiency, in a compact form, than present day gas-filled {sup 3}He and {sup 10}BF{sub 3} detectors. The {sup 6}Li(n,t){sup 4}He reaction yields a total Q-value of 4.78 MeV, larger than {sup 10}B, an energy easily identified above background radiations. Hence, devices fabricated from semiconductor compounds having either natural Li (nominally 7.5% {sup 6}Li) or enriched {sup 6}Li (usually 95% {sup 6}Li) as constituent atoms may provide a material for compact high efficiency neutron detectors. Starting material was synthesized by preparing equimolar portions of Li, Zn, and As sealed under vacuum (10{sup −6} Torr) in quartz ampoules lined with boron nitride and subsequently reacted in a compounding furnace [1]. The raw synthesized material indicated the presence high impurity levels (material and electrical property characterizations). A static vacuum sublimation in quartz was performed to help purify the synthesized material [2,3]. Bulk crystalline samples were grown from the purified material [4,5]. Samples were cut using a diamond wire saw, and processed into devices. Bulk resistivity was determined from I–V curve measurements, ranging from 10{sup 6}–10{sup 11} Ω cm. Devices were characterized for sensitivity to 5.48 MeV alpha particles, 337 nm laser light, and neutron sensitivity in a thermal neutron diffracted beam at the Kansas State University TRIGA Mark II nuclear reactor. Thermal neutron reaction product charge induction was measured with a LiZnP device, and the reaction product spectral response was observed. - Highlights: • Devices were fabricated from in-house synthesized and purified LiZnAs and LiZnP. • Devices ranged in bulk resistivity from 10{sup 6}–10{sup 11} Ω cm. • Devices showed sensitivity to 5.48 MeV alpha particles. • Devices were characterized with a 337 nm laser light. • Devices were evaluated

Influence of Li10GeP2S12-type solid electrolyte on cell thermodynamics

Directory of Open Access Journals (Sweden)

Jishnu Bhattacharya

2016-06-01

Full Text Available We elucidate few critical facts about the lithium superionic conductor (Li10GeP2S12 and few other compounds of the same family as the electrolyte in Li-ion cells. The dimensionality of diffusion process and existence of ‘structural’ lithiums are not well understood in this material. From the ab-initio MD simulations, we find that the material transport Li-ions predominantly in the crystallographic c-direction. Nevertheless, the cross-channel diffusion is significant as well. We explored the mobility of individual Li-ions and do not find evidence that supports the proposition of structural Li-ions in LGPS. We find nominal effect of local Ge-P ordering and of Li-concentration change on diffusivity, which not only provides information about the invariance of diffusivity at different conditions of operation, but also ensures that identification of the ground state structure in LGPS having partially occupied Li and Ge/P sublattices should have minimal effect on the diffusion analysis. We computed the dilute Li insertion and extraction voltages for LGPS from ab-initio total energy calculation. The dilute voltages indicate that the material is prone to react by exchanging Li-ions with the electrodes at typical operating range of voltages indicating formation of some interphase at the electrode-electrolyte interface, which necessitates further experimental investigation

17 CFR 232.11 - Definition of terms used in part 232.

Science.gov (United States)

2010-04-01

... effect by a person executing or issuing it. If data are stored in a computer or similar device, any... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Definition of terms used in part 232. 232.11 Section 232.11 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION...

Převodník Ethernet na RS-232

OpenAIRE

Dreiseitel, Jiří

2012-01-01

Práce je věnována problematice konstrukce převodníku Ethernet na RS-232 za pomocí jednočipového mikrokontroléru. Cílem je seznámit čtenáře se síťovou technologií Ethernet a technologií pro sériový přenos založený na protokolu RS-232 a zároveň s technologií vestavěných systémů pro konstrukci zařízení. Součástí práce je kompletní návrh převodníku Ethernet na RS-232 včetně návrhu a implementace firmware v jazyce C za využití LwIP TCP/IP stacku. Převodník je postaven na základě vývojového kitu ST...

Lithium superionic conductor Li9.42Si1.02P2.1S9.96O2.04 with Li10GeP2S12-type structure in the Li2S–P2S5–SiO2 pseudoternary system: Synthesis, electrochemical properties, and structure–composition relationships

Directory of Open Access Journals (Sweden)

Satoshi Hori

2016-12-01

Full Text Available Lithium superionic conductors with the Li10GeP2S12 (LGPS-type structure are promising materials for use as solid electrolytes in next-generation lithium batteries. A novel member of the LGPS family, Li9.42Si1.02P2.1S9.96O2.04, and its solid solutions were synthesised by quenching from 1273 K in the Li2S–P2S5–SiO2 pseudoternary system. The material exhibited an ionic conductivity as high as 3.2×10−4 S cm−1 at 298 K, as well as the high electrochemical stability to lithium metal, which was improved by the introduction of oxygen into the LGPS-type structure. An all-solid-state cell with a lithium metal anode and Li9.42Si1.02P2.1S9.96O2.04 as the separator showed excellent performance with a high coulomb efficiency of 100%. Thus, oxygen doping is an effective way of improving the electrochemical stability of LGPS-type structure.

Growth of Li doped bismuth oxide nanorods and its electrochemical performance for the determination of L-cysteine

Energy Technology Data Exchange (ETDEWEB)

Wen, Yong, E-mail: yongwen1982@163.com [School of Civil Engineering and Architecture, Xinjiang University (China); Pei, Li-zhai; Wei, Tian [chool of Materials Science and Engineering, Anhui University of Technology (China)

2017-05-15

Li doped bismuth oxide nanorods have been prepared using sodium bismuthate and Li acetate. X-ray diffraction (XRD) pattern shows that the nanorods are composed of monoclinic Bi{sub 2}O{sub 4} and cubic LiBi{sub 12}O{sub 18.50} phases. Scanning electron microscopy (SEM) observation shows that the nanorods have the length and diameter of 1-5 μm and 50-350 nm, respectively. The formation of the Li doped bismuth oxide nanorods is closely relative to the hydrothermal conditions. The electrochemical performance for the determination of L-cysteine based on a Li doped bismuth oxide nanorods modified glassy carbon electrode (GCE) has been developed. The CV peak current increases obviously and linearly with increasing the scan rate. Under the optimal conditions, Li doped bismuth oxide nanorods modified GCE exhibits good analytical performance with good reproducibility and stability. The linear range of L-cysteine is 0.0001-2 mM and the detection limit is 0.36 μM and 0.17 μM for cvp1 and cvp2, respectively. (author)

Growth of Li doped bismuth oxide nanorods and its electrochemical performance for the determination of L-cysteine

International Nuclear Information System (INIS)

Wen, Yong; Pei, Li-zhai; Wei, Tian

2017-01-01

Li doped bismuth oxide nanorods have been prepared using sodium bismuthate and Li acetate. X-ray diffraction (XRD) pattern shows that the nanorods are composed of monoclinic Bi_2O_4 and cubic LiBi_1_2O_1_8_._5_0 phases. Scanning electron microscopy (SEM) observation shows that the nanorods have the length and diameter of 1-5 μm and 50-350 nm, respectively. The formation of the Li doped bismuth oxide nanorods is closely relative to the hydrothermal conditions. The electrochemical performance for the determination of L-cysteine based on a Li doped bismuth oxide nanorods modified glassy carbon electrode (GCE) has been developed. The CV peak current increases obviously and linearly with increasing the scan rate. Under the optimal conditions, Li doped bismuth oxide nanorods modified GCE exhibits good analytical performance with good reproducibility and stability. The linear range of L-cysteine is 0.0001-2 mM and the detection limit is 0.36 μM and 0.17 μM for cvp1 and cvp2, respectively. (author)

Mobility of radionuclides and trace elements in soil from legacy NORM and undisturbed naturally 232Th-rich sites.

Science.gov (United States)

Mrdakovic Popic, Jelena; Meland, Sondre; Salbu, Brit; Skipperud, Lindis

2014-05-01

Investigation of radionuclides (232Th and 238U) and trace elements (Cr, As and Pb) in soil from two legacy NORM (former mining sites) and one undisturbed naturally 232Th-rich site was conducted as a part of the ongoing environmental impact assessment in the Fen Complex area (Norway). The major objectives were to determine the radionuclide and trace element distribution and mobility in soils as well as to analyze possible differences between legacy NORM and surrounding undisturbed naturally 232Th-rich soils. Inhomogeneous soil distribution of radionuclides and trace elements was observed for each of the investigated sites. The concentration of 232Th was high (up to 1685 mg kg(-1), i.e., ∼7000 Bq kg(-1)) and exceeded the screening value for the radioactive waste material in Norway (1 Bq g(-1)). Based on the sequential extraction results, the majority of 232Th and trace elements were rather inert, irreversibly bound to soil. Uranium was found to be potentially more mobile, as it was associated with pH-sensitive soil phases, redox-sensitive amorphous soil phases and soil organic compounds. Comparison of the sequential extraction datasets from the three investigated sites revealed increased mobility of all analyzed elements at the legacy NORM sites in comparison with the undisturbed 232Th-rich site. Similarly, the distribution coefficients Kd (232Th) and Kd (238U) suggested elevated dissolution, mobility and transportation at the legacy NORM sites, especially at the decommissioned Nb-mining site (346 and 100 L kg(-1) for 232Th and 238U, respectively), while the higher sorption of radionuclides was demonstrated at the undisturbed 232Th-rich site (10,672 and 506 L kg(-1) for 232Th and 238U, respectively). In general, although the concentration ranges of radionuclides and trace elements were similarly wide both at the legacy NORM and at the undisturbed 232Th-rich sites, the results of soil sequential extractions together with Kd values supported the expected differences

Bare astrophysical S(E)-factor for the 6Li(d, α)4He and 7Li(p, α)4He reactions at astrophysical energies

International Nuclear Information System (INIS)

Pizzone, R.G.; Spitaleri, C.; Lattuada, M.; Musumarra, A.; Pellegriti, M.G.; Romano, S.; Tumino, A.; Cherubini, S.; Figuera, P.; Miljanic, D.; Rolfs, C.; Typel, S.; Wolter, H.H.; Castellani, V.; Degl'Innocenti, S.; Imperio, A.

2003-01-01

The Trojan Horse Method has been applied to study the 7 Li(p, α) 4 He and 6 (Li(d, α) 4 He reactions through the 7 Li(d, αα)n and 6 Li( 6 Li, αα) 4 He three body processes, respectively. The electron screening potential deduced from these experiments is much larger than the adiabatic approximation prediction for both cases; the systematic discrepancy between data and theoretical predictions is thus confirmed. Astrophysical implications of these measurements are also discussed

Photon cascade luminescence from Pr3+ ions in LiPrP4O12 polyphosphate

International Nuclear Information System (INIS)

Shalapska, T; Stryganyuk, G; Romanyshyn, Yu; Demchenko, P; Voloshinovskii, A; Trots, D; Gektin, A; Dorenbos, P

2010-01-01

The spectral-kinetic properties of luminescence from LiY 1-x Pr x P 4 O 12 (x = 1, 0.1) phosphors are studied in the 10-300 K temperature range upon excitation within the UV-VUV spectral range. The luminescence observed for LiPrP 4 O 12 at low temperatures is attributed to both intra-configurational 4f 2 → 4f 2 and inter-configurational 4f5d → 4f 2 radiative transitions of Pr 3+ . The temperature dependence of emission and the decay kinetics of Pr 3+ luminescence from LiY 1-x Pr x P 4 O 12 (x = 1, 0.1) phosphors are explained by temperature stimulated transitions from the 1 S 0 to the Pr 3+ 4f5d state. At low temperatures, the energy potential barrier between the 1 S 0 and 4f5d states is 0.014 eV for LiPrP 4 O 12 . The spectral overlap of the 1 S 0 and 4f5d states of Pr 3+ in LiY 0.9 Pr 0.1 P 4 O 12 determines the luminescence properties in the entire temperature range studied.

Dosimetric characteristics of Li2B4O7:Cu,Ag,P solid TL detectors

International Nuclear Information System (INIS)

Proki, M.

2002-01-01

The main dosimetric characteristics are presented of newly prepared tissue-equivalent, highly sensitive thermoluminescent detector, Li 2 B 4 O 7 :Cu,Ag,P in the form of sintered pellets, developed at the Institute of Nuclear Sciences, Vin a . As a result of an advancement in the preparation procedure by the sensitising of basic copper activated lithium borate TL material, significant improvement in the TL sensitivity of Li 2 B 4 O 7 :Cu,Ag,P was gained. The glow curve of Li 2 B 4 O 7 :Cu,Ag,P consists of well defined main dosimetric peak situated at about 185-190 deg. C with the TL sensitivity which is about four to five times higher than that of LiF:Mg,Ti (TLD-100). From the experimental results a very wide linear dose response range, up to 10 3 Gy is evident. Dosimetric characteristics make sintered solid Li 2 B 4 O 7 :Cu,Ag,P TL detectors very promising for different dosimetry applications particularly in medical dosimetry and also for individual monitoring. (author)

Semiconducting p-type MgNiO:Li epitaxial films fabricated by cosputtering method

Energy Technology Data Exchange (ETDEWEB)

Kwon, Yong Hun; Chun, Sung Hyun; Cho, Hyung Koun [School of Advanced Materials Science and Engineering, Sungkyunkwan University, 300 Cheoncheon-dong, Jangan-gu, Suwon, Gyeonggi-do 440-746 (Korea, Republic of)

2013-07-15

Li-doped ternary Mg{sub x}Ni{sub 1-x}O thin films were deposited on (0001) Al{sub 2}O{sub 3} substrates by a radio frequency (RF) magnetron cosputtering method with MgO and NiO:Li targets. The Mg mole fraction and Li content were relatively controlled by changing RF power for the MgO target over a range of 0-300 W, while the NiO:Li target was kept at 150 W. As a result, all films were epitaxially grown on (0001) Al{sub 2}O{sub 3} substrates with the relationship of [110]{sub NiO}||[1110]{sub Al2O3}, [112]{sub NiO}||[2110]{sub Al2O3} (in-plane), and [111]{sub NiO}||[0001]{sub Al2O3} (out-of-plane), and showed p-type semiconducting properties. Furthermore, from x-ray diffraction patterns, the authors found that MgO was effectively mixed with NiO:Li without structural deformation due to low lattice mismatch (0.8%) between NiO and MgO. However, the excess Li contents degraded the crystallinity of the MgNiO films. The band-gap of films was continuously shifted from 3.66 eV (339 nm) to 4.15 eV (299 nm) by the RF power of the MgO target. A visible transmittance of more than 80% was exhibited at RF powers higher than 200 W. Ultimately, the electrical resistivity of p-type MgNiO films was improved from 7.5 to 673.5 {Omega}cm, indicating that the Li-doped MgNiO films are good candidates for transparent p-type semiconductors.

Molecular characteristic and pathogenicity of Indonesian H5N1 clade 2.3.2 viruses

Directory of Open Access Journals (Sweden)

Dharmayanti NLPI

2013-06-01

Full Text Available The outbreak of disease in late 2012 in Indonesia caused high duck mortality. The agent of the disease was identified as H5N1 clade 2.3.2. The disease caused economic loss to the Indonesian duck farmer. The clade 2.3.2 of H5N1 virus has not previously been identified, so this study was conducted to characterize 4 of H5N1 clade 2.3.2 viruses by DNA sequencing in eight genes segment virus namely HA, NA, NS, M, PB1, PB2, PA and NP. The pathogenicity test of clade 2.3.2 viruses in ducks was compared to clade 2.1.3 viruses which predominat circulating in Indonesia. Results of phylogenetic tree analysis showed that the four of clade 2.3.2 viruses isolated in 2012 was the new introduced virus from abroad. Further analysis showed eight genes were in one group with the clade 2.3.2 viruses, especially those from VietNam and did not belong to Indonesia viruses group. The pathogenicity test in ducks showed that virus H5N1 clade 2.3.2 and clade 2.1.3 have similar clinical symptoms and pathogenicity and cause death in 75% of ducks on days 3-6 after infection.

Event-related brain potentials and second language learning: syntactic processing in late L2 learners at different L2 proficiency levels

NARCIS (Netherlands)

Hell, J.G. van; Tokowicz, N.

2010-01-01

There are several major questions in the literature on late second language (L2) learning and processing. Some of these questions include: Can late L2 learners process an L2 in a native-like way? What is the nature of the differences in L2 processing among L2 learners at different levels of L2

Late Budgets

DEFF Research Database (Denmark)

Andersen, Asger Lau; Lassen, David Dreyer; Nielsen, Lasse Holbøll Westh

are negative rather than positive; and when there is divided government. We test the hypotheses of the model using a unique data set of late budgets for US state governments, based on dates of budget approval collected from news reports and a survey of state budget o¢ cers for the period 1988...

Fake news kan leve længe i et frit marked

DEFF Research Database (Denmark)

Hendricks, Vincent Fella; Lundorff Rasmusen, Jan

2017-01-01

Der er tydelige ligheder mellem optakten til finanskrisen og "fake news"-boblen, som vi ser i dag......Der er tydelige ligheder mellem optakten til finanskrisen og "fake news"-boblen, som vi ser i dag...

Stability of the post irradiation traps in LiF: Mg, Cu, P; Estabilidad de las trampas posradiacion en LiF: Mg, Cu, P

Energy Technology Data Exchange (ETDEWEB)

Gonzalez, P.R. [ININ, A.P. 18-1027, 11801 Mexico D.F. (Mexico); Furetta, C. [Physics Department, Rome University ' ' La Sapienza' ' , Rome (Italy); Azorin, J. [UAM-I, 09340 Mexico D.F. (Mexico)

2004-07-01

In this work the results of the study of the stability of the traps are presented in dosemeters Tl of LiF: Mg,Cu,P, irradiated with gamma radiation of {sup 60} Co. The studied dosemeters were of LiF: Mg,Cu,P + Ptfe, developed in the ININ, taking like reference to the commercial dosemeter GR200A of Chinese manufacture. Before being exposed to the radiation, the dosemeters received their standard treatment from having erased, two hours after the irradiation they took the initial readings. The dosemeters faded again and they were irradiated to the same dose, soon after they stayed under normal conditions, protected of the light, later on they were taken their readings periodically during six months. The readings taken Tl the same day of the irradiation presented four peaks whose energy, determined by the deconvolution method were; 1.30 {+-} 0.01 eV, 1.50 {+-} 0.01 eV, 1.70 {+-} 0.01 eV and 2.58 {+-} 0.02 eV, for LiF: Mg,Cu,P + Ptfe, while GR200A stops the energy they were: 1.33 {+-} 0.11 eV, 1.58 {+-} 0.11 eV, 1.73 {+-} 0.11 eV and 2.60 {+-} 0.03 eV. In both cases the peak 1, with the energy but it lowers, it disappears completely after some later hours to the irradiation, while the peak 2, it disappears completely after 122 days for the local dosemeter and after 94 days for the commercial dosemeter. The energy of the peaks 3 and 4 that remained visible during the whole period of study it was: 1.38 {+-} 0.01 eV and 2.65 {+-} 0.01 eV, for LiF: Mg,Cu,P + Ptfe respectively, in the same order for GR200A, the energies were: 1.51 {+-} 0.02 eV and 2.64 {+-} 0.03 eV. In all the cases the peaks with energy below 2 eV, showed tendency to the drop, while the main peak, showed certain tendency to increase, as they show it the results. (Author)

TL response of LiF: Mg, Cu, P dosemeters in function of the photon energy

International Nuclear Information System (INIS)

Gonzalez, P.R.; Azorin, J.; Furetta, C.

2005-01-01

In this work the obtained results of studying the response of dosemeters of LiF: Mg, Cu, P + Ptfe, developed in the ININ, commercial dosemeters GR200A (LiF: Mg, Cu, P) of chinese manufacture and TLD-100 (LiF: Mg, Ti) US are presented, when irradiating them with X rays 16, 24, 34.5, 42, 100 and 145 keV of effective energy, with gamma rays of 662 keV ( 137 Cs) and 1252 keV ( 60 Co). The results are presented in function of the sensitivity that the dosemeters showed normalized to gamma radiation of 60 Co. It was appreciated that the dosemeters more equivalent to the tissue, they were those of LiF: Mg, Cu, P + Ptfe, while the less equivalent ones were the TLD-100. (Author)

Device fabrication, characterization, and thermal neutron detection response of LiZnP and LiZnAs semiconductor devices

Science.gov (United States)

Montag, Benjamin W.; Ugorowski, Philip B.; Nelson, Kyle A.; Edwards, Nathaniel S.; McGregor, Douglas S.

2016-11-01

Nowotny-Juza compounds continue to be explored as candidates for solid-state neutron detectors. Such a device would have greater efficiency, in a compact form, than present day gas-filled 3He and 10BF3 detectors. The 6Li(n,t)4He reaction yields a total Q-value of 4.78 MeV, larger than 10B, an energy easily identified above background radiations. Hence, devices fabricated from semiconductor compounds having either natural Li (nominally 7.5% 6Li) or enriched 6Li (usually 95% 6Li) as constituent atoms may provide a material for compact high efficiency neutron detectors. Starting material was synthesized by preparing equimolar portions of Li, Zn, and As sealed under vacuum (10-6 Torr) in quartz ampoules lined with boron nitride and subsequently reacted in a compounding furnace [1]. The raw synthesized material indicated the presence high impurity levels (material and electrical property characterizations). A static vacuum sublimation in quartz was performed to help purify the synthesized material [2,3]. Bulk crystalline samples were grown from the purified material [4,5]. Samples were cut using a diamond wire saw, and processed into devices. Bulk resistivity was determined from I-V curve measurements, ranging from 106-1011 Ω cm. Devices were characterized for sensitivity to 5.48 MeV alpha particles, 337 nm laser light, and neutron sensitivity in a thermal neutron diffracted beam at the Kansas State University TRIGA Mark II nuclear reactor. Thermal neutron reaction product charge induction was measured with a LiZnP device, and the reaction product spectral response was observed.

L.I. Novikova's Research School: Main Ideas and Prospects for Development

Science.gov (United States)

Selivanova, Natalia Leonidovna; Stepanov, Pavel Valentinovich; Shakurova, Marina Viktorovna

2016-01-01

This article presents the main ideas of L.I. Novikova's research school "Systems Approach to Character Education (Russian Vospitaniye-Editor) and Socialization in Children and Young Adults," which is the leading research school in the sphere of education. It also shows how these ideas were developed in the activities of five generations…

Electron transfer in keV Li+-Na*(3p) collisions: Pt.2. Molecular basis model

International Nuclear Information System (INIS)

Machholm, M.; Courbin, C.

1996-01-01

The velocity dependence of state-to-state integral cross sections for electron transfer and excitation in Li + -Na(3s, 3p) collisions is studied in the 0.05-0.3 au velocity range using the impact parameter semi-classical method and a 28-state molecular orbital basis model including a common translation factor. The initial orbital alignment dependence of electron transfer is in fair agreement with recent experiments and with atomic orbital model calculations. The main electron transfer channel from Na*(3p) is to the Li*(2p) states. The integral cross sections from an aligned or oriented Na*(3p) state to an aligned or oriented Li*(2p) state and vice versa and the corresponding alignment and orientation parameters are presented as a function of the impact velocity. (author)

Synthesis and characterization of PVA blended LiClO4 as electrolyte material for battery Li-ion

Science.gov (United States)

Gunawan, I.; Deswita; Sugeng, B.; Sudaryanto

2017-07-01

It have been synthesized the materials for Li ion battery electrolytes, namely PVA with the addition of LiClO4 salt were varied 0, 5, 10, 15 and 20% by weight respectively. The objective of this study is to control the ionic conductivity in traditional polymer electrolytes, to improve ionic conductivity with the addition of lithium perchlorat (LiClO4). These electrolyte materials prepared by PVA powder was dissolved into distilled water and added LiClO4 salt were varied. After drying the solution, PVA sheet blended LiClO4 salt as electrolyte material for Li ion battery obtained. PVA blended LiClO4 salt crystallite form was confirmed using X-Ray Difraction (XRD) equipment. Observation of the morphology done by using Scanning Electron Microscope (SEM). While the electrical conductivity of the material is measured using LCR meter. The results of XRD pattern of LiClO4 shows intense peaks at angles 2θ = 23.2, 32.99, and 36.58°, which represent the crystalline nature of the salt. Particles morphology of the sample revealed by scanning electron microscopy are irregular in shape and agglomerated, with mean size 200-300 nm. It can be concluded that polycrystalline particles are composed of large number of crystallites. The study of conductivity by using LCR meter shows that all the graphs represent the DC and AC conductivity phenomena.

Investigation of dosimetric characteristics of the high sensitivity LiF:Mg,Cu,P Thermoluminescent Dosemeter and its applications in diagnostic radiology - a review

International Nuclear Information System (INIS)

Fung, K.L.

2004-01-01

This study investigated the dosimetric properties of the high sensitivity TLD (Thermoluminescent Dosemeter) of LiF:Mg,Cu,P and its applications in diagnostic radiology. A reproducible readout and annealing regime for this high sensitivity TLD was developed in the initial part of this study with the newly installed automatic TLD Reader system. Basic dosimetric characteristics of this T.L. dosemeter were then investigated. This paved the foundation for subsequent selected novel application studies in diagnostic radiology. This study exploits the favourable dosimetric properties of these T.L. dosemeters in some selected novel dosimetric applications in diagnostic radiology with an anthropomorphic phantom. The applications studied in radiological procedures included: dose reduction in lumbar spine radiography utilizing the 'anode heel effect'; gonad dose variation with kV p in chest radiography; foetal dose comparison between computed tomography (CT) and computed radiography (CR) in X-ray pelvimetry; lens dose reduction with bismuth eye-shields in CT brain studies; foetal dose assessment of early pregnancy in common high risk radiological examinations. It is anticipated that the unique and favourable dosimetric performance of LiF:Mg,Cu,P T.L. phosphor will be exploited further in measurements of low level dose received by patients and staff in diagnostic radiological procedures such as paediatric X-ray examinations

Investigation of dosimetric characteristics of the high sensitivity LiF:Mg,Cu,P Thermoluminescent Dosemeter and its applications in diagnostic radiology - a review

Energy Technology Data Exchange (ETDEWEB)

Fung, K.L. E-mail: orkarl@polyu.edu.hk

2004-05-01

This study investigated the dosimetric properties of the high sensitivity TLD (Thermoluminescent Dosemeter) of LiF:Mg,Cu,P and its applications in diagnostic radiology. A reproducible readout and annealing regime for this high sensitivity TLD was developed in the initial part of this study with the newly installed automatic TLD Reader system. Basic dosimetric characteristics of this T.L. dosemeter were then investigated. This paved the foundation for subsequent selected novel application studies in diagnostic radiology. This study exploits the favourable dosimetric properties of these T.L. dosemeters in some selected novel dosimetric applications in diagnostic radiology with an anthropomorphic phantom. The applications studied in radiological procedures included: dose reduction in lumbar spine radiography utilizing the 'anode heel effect'; gonad dose variation with kV{sub p} in chest radiography; foetal dose comparison between computed tomography (CT) and computed radiography (CR) in X-ray pelvimetry; lens dose reduction with bismuth eye-shields in CT brain studies; foetal dose assessment of early pregnancy in common high risk radiological examinations. It is anticipated that the unique and favourable dosimetric performance of LiF:Mg,Cu,P T.L. phosphor will be exploited further in measurements of low level dose received by patients and staff in diagnostic radiological procedures such as paediatric X-ray examinations.

Onset age of L2 acquisition influences language network in early and late Cantonese-Mandarin bilinguals.

Science.gov (United States)

Liu, Xiaojin; Tu, Liu; Wang, Junjing; Jiang, Bo; Gao, Wei; Pan, Ximin; Li, Meng; Zhong, Miao; Zhu, Zhenzhen; Niu, Meiqi; Li, Yanyan; Zhao, Ling; Chen, Xiaoxi; Liu, Chang; Lu, Zhi; Huang, Ruiwang

2017-11-01

Early second language (L2) experience influences the neural organization of L2 in neuro-plastic terms. Previous studies tried to reveal these plastic effects of age of second language acquisition (AoA-L2) and proficiency-level in L2 (PL-L2) on the neural basis of language processing in bilinguals. Although different activation patterns have been observed during language processing in early and late bilinguals by task-fMRI, few studies reported the effect of AoA-L2 and high PL-L2 on language network at resting state. In this study, we acquired resting-state fMRI (R-fMRI) data from 10 Cantonese (L1)-Mandarin (L2) early bilinguals (acquired L2: 3years old) and 11 late bilinguals (acquired L2: 6years old), and analyzed their topological properties of language networks after controlling the language daily exposure and usage as well as PL in L1 and L2. We found that early bilinguals had significantly a higher clustering coefficient, global and local efficiency, but significantly lower characteristic path length compared to late bilinguals. Modular analysis indicated that compared to late bilinguals, early bilinguals showed significantly stronger intra-modular functional connectivity in the semantic and phonetic modules, stronger inter-modular functional connectivity between the semantic and phonetic modules as well as between the phonetic and syntactic modules. Differences in global and local parameters may reflect different patterns of neuro-plasticity respectively for early and late bilinguals. These results suggested that different L2 experience influences topological properties of language network, even if late bilinguals achieve high PL-L2. Our findings may provide a new perspective of neural mechanisms related to early and late bilinguals. Copyright © 2017 Elsevier Inc. All rights reserved.

Fading of the Tl signal in LiF: Mg, Cu, P during a large post irradiation period; Desvanecimiento de la senal Tl en LiF: Mg, Cu, P durante un largo periodo posradiacion

Energy Technology Data Exchange (ETDEWEB)

Gonzalez, P.R. [ININ, A.P. 18-1027, 11801 Mexico D.F. (Mexico); Azorin, J. [UAM-I, 09340 Mexico D.F. (Mexico); Furetta, C. [Universidad de Roma, Piazzale Aldo Moro 2, Roma (Italy)

2004-07-01

In this work the obtained results of the study of the fading of the Tl signal in dosemeters of LiF activated with magnesium, copper and phosphorus (LiF:Mg,Cu,P) are presented. The studied dosemeters were LiF: Mg,Cu,P + Ptfe, developed in the ININ, taking like reference to the commercial dosemeter GR200A of Chinese manufacture. In both cases the Tl curve presents four peaks; in LiF: Mg,Cu,P + Ptfe, the peaks of smaller size appear in 359 K, 389 K and 447 K, the main dosimetric peak appears in 486 K; in GR200A, the peaks of smaller size appear in 360 K, 389 K and 445 K; while the main dosimetric peak appears in 487 K. The highest fading shown by the dosemeters of LiF: Mg,Cu,P + Ptfe, it was of 3.07%, value very below the one recommended for dosimetric purposes. While the commercial dosemeters presented a fading until of 6.23%, surpassing with the recommended values. The observed fading, it corresponds to the lost of the Tl signal of the peaks 1 and 2, since the first one disappears few hours after the irradiation, while the peak 2, it disappears completely after 94 days, the peak 3 remained stable during the six months of study, while the peak 4, it showed a slight increment due to the contribution of the dose of natural environmental radiation. (Author)

[The late media emergency of smallpox vaccine, news coverage of Spanish press (1999-2004)].

Science.gov (United States)

Martínez-Martínez, Pedro Javier; Tuells, José; Colmenar-Jarillo, Gema

2015-06-01

Discussions on the need for smallpox virus preservation in 1999 focused attention on an eradicated disease 20 years ago. Smallpox was replaced as a potential candidate to be used as a bioterrorist weapon because of the international alarm scenario produced after the 11/9 events in USA. The reactivation of a vaccine which remained forgotten was the direct consequence. The initial target groups were the security forces of America. Spain was also among the countries that were interested in acquiring the smallpox vaccine. The aim of this study is to analyze the considerable media coverage of smallpox obtained in our country. Systematic review of published news in the four largest national daily newspapers (ABC, El Mundo, El País and La Vanguardia) for the period 1999-2004 of the Dow Jones Factiva document database. "Smallpox" were used as a key word. From the obtained data, a qualitative and quantitative analysis was done. 416 reviews were analyzed; the newspaper El Mundo was the most interested in these news (158 citations, 37.98%). Most of the news were published in 2003 (152, 36.5%) The year with more news about smallpox (2003) coincides with the purchase of vaccines in Spain. The type of messages in the news was highly changeable over this six-year period. Those related to "politics and diplomacy", "epidemiological risk", "bioterrorism" and "vaccine" were predominant. The alarm raised around the smallpox vaccination was a media phenomenon due to political strategy issues rather than a real public health problem.

The News Delivery Sequence: Bad News and Good News in Conversational Interaction.

Science.gov (United States)

Maynard, Douglas W.

1997-01-01

Explores the conditional nature of good and bad news while focusing on three topics: (1) the status of information as news according the participants in a conversation; (2) the valence of this information with regard to its perception as good or bad; and (3) the effect of news on individuals. Notes that good news is privileged over bad news in…

Computational studies on LiP H isolated from Ganoderma lucidum GD88

Directory of Open Access Journals (Sweden)

Parambayil Nayana

2015-01-01

Full Text Available Ganoderma lucidum is a basidiomycete fungus that produces ligninase for the modification of lignin. Lignin peroxidase (LiP is a glycoprotein that acts on the recalcitrant cell wall component lignin. In the present study, the phylogenetic analysis of Ganoderma lucidum GD88 with the partial coding sequence (cds of other LiP isoforms was performed using MEGA6. After determination of the open reading frame, the +3 frame nucleotide sequence was converted to protein using the EMBOSS Transseq and the secondary structure was predicted using the Chou and Fasman Secondary Structure Prediction server (CFSSP. Protein modeling was also performed by SWISS-MODEL. The obtained result shows that the lipH partial cds of Ganoderma lucidum GD88 is homologous to the lipD gene of Phanerochaete chrysosporium. The secondary structure prediction result revealed that the percent content of the helix (67 is higher than the percent contents of sheet (53.4 and turns (13.6. According to the generated model, LiP H protein is a homodimer with chains A and B. The heme acts as a ligand and plays a major role in structure stabilization.

Cross-section of the reaction {sup 7}Li(p,n){sup 7}Be close to the threshold

Energy Technology Data Exchange (ETDEWEB)

Shorin, V S [Institute of Physics and Power Engineering, Obninsk (Russian Federation)

1997-06-01

The status of data on the cross-section of the reaction {sup 7}Li(p,n){sup 7}Be close to the threshold is reviewed. On the basis of recent data on the cross-section of the inverse reaction {sup 7}Be(n,p){sup 7}Li and certain theoretical models, an evaluation is performed of the total cross-section of the {sup 7}Li(p,n)-reaction in the proton energy region up to 2 MeV. (author). 16 refs, 1 fig., 1 tab.

Ab initio study of isomerism of Li2AB2 molecules and Li2AB2+ ions with 16 valent electrons

International Nuclear Information System (INIS)

Charkin, O.P.; Klimenko, N.M.; MakKi, M.L.

2000-01-01

In the framework of MP2(6-31*//HF/6-31G + ZPE(HF/6-31G*) and MP4SDTQ/6-31G*//MP2/6-31G* + ZPE(MP2/6-31G*) approximations ab initio calculations of surfaces of potential energy of molecules of lithium salts of Li 2 AB 2 (Li 2 BeO 2 , L 2 MgO 2 , Li 2 BeS 2 , Li 2 MgS 2 , Li 2 CN 2 , Li 2 SiN 2 , Li 2 CP 2 ) type and ions of Li 2 AB 2 + (Li 2 BO 2 + , Li 2 AlO 2 + , Li 2 BS 2 + , Li 2 AlS 2 + , Li 2 N 3 + , Li 2 PN 2 + , Li 2 P 3 + ) type with 16 valent electrons are done. For oxide and nitride systems global minimum corresponds to symmetric linear structure D ∞h and for their sulfide and phosphorus analogues curved plane or unplane (C 2 ) structure with bond angle φ(LBA)=90-110 Deg are preferable. Equilibrium geometric parameters, relative energies and energies of isomer decomposition, frequencies and IR-intensities of normal vibrations are determined [ru

Lithium Superionic Conductor Li9.42Si1.02P2.1S9.96O2.04 with Li10GeP2S12-Type Structure in the Li2S–P2S5–SiO2 Pseudoternary System: Synthesis, Electrochemical Properties, and Structure–Composition Relationships

International Nuclear Information System (INIS)

Hori, Satoshi; Suzuki, Kota; Hirayama, Masaaki; Kato, Yuki; Kanno, Ryoji

2016-01-01

Lithium superionic conductors with the Li 10 GeP 2 S 12 (LGPS)-type structure are promising materials for use as solid electrolytes in the next-generation lithium batteries. A novel member of the LGPS family, Li 9.42 Si 1.02 P 2.1 S 9.96 O 2.04 (LSiPSO), and its solid solutions were synthesized by quenching from 1273 K in the Li 2 S–P 2 S 5 –SiO 2 pseudoternary system. The material exhibited an ionic conductivity as high as 3.2 × 10 −4 S cm −1 at 298 K, as well as the high electrochemical stability to lithium metal, which was improved by the introduction of oxygen into the LGPS-type structure. An all-solid-state cell with a lithium metal anode and LSiPSO as the separator showed excellent performance with a high reversibility of 100%. Thus, oxygen doping is an effective way of improving the electrochemical stability of LGPS-type structure.

Molecular evolution of the Li/li chemical defence polymorphism in white clover (Trifolium repens L.).

Science.gov (United States)

Olsen, K M; Sutherland, B L; Small, L L

2007-10-01

White clover (Trifolium repens) is naturally polymorphic for cyanogenesis (hydrogen cyanide release following tissue damage). The ecological factors favouring cyanogenic and acyanogenic plants have been examined in numerous studies over the last half century, making this one of the best-documented examples of an adaptive polymorphism in plants. White clover cyanogenesis is controlled by two, independently segregating Mendelian genes: Ac/ac controls the presence/absence of cyanogenic glucosides; and Li/li controls the presence/absence of their hydrolysing enzyme, linamarase. In this study, we examine the molecular evolution and population genetics of Li as it relates to the cyanogenesis polymorphism. We report here that Li exists as a single-copy gene in plants possessing linamarase activity, and that the absence of enzyme activity in li/li plants is correlated with the absence of much or all of the gene from the white clover genome. Consistent with this finding, we confirm by reverse transcription-polymerase chain reaction that Li gene expression is absent in plants lacking enzyme activity. In a molecular population genetic analysis of Li and three unlinked genes using a worldwide sample of clover plants, we find an absence of nucleotide variation and statistically significant deviations from neutrality at Li; these findings are consistent with recent positive directional selection at this cyanogenesis locus.

Trojan horse particle invariance studied with the 6Li(d,α)4He and 7Li(p,α)4He reactions

International Nuclear Information System (INIS)

Pizzone, R. G.; Spitaleri, C.; Lamia, L.; Cherubini, S.; La Cognata, M.; Puglia, S. M. R.; Rapisarda, G. G.; Romano, S.; Sergi, M. L.; Bertulani, C.; Mukhamedzhanov, A.; Blokhintsev, L.; Burjan, V.; Hons, Z.; Kroha, V.; Mrazek, J.; Piskor, S.; Kiss, G. G.; Li, C.; Tumino, A.

2011-01-01

The Trojan horse nucleus invariance for the binary reaction cross section extracted from the Trojan horse reaction was tested using the quasifree 3 He( 6 Li,αα)H and 3 He( 7 Li,αα) 2 H reactions. The cross sections for the 6 Li(d,α) 4 He and 7 Li(p,α) 4 He binary processes were extracted in the framework of the plane wave approximation. They are compared with direct behaviors as well as with cross sections extracted from previous indirect investigations of the same binary reactions using deuteron as the Trojan horse nucleus instead of 3 He. The very good agreement confirms the applicability of the plane wave approximation which suggests the independence of the binary indirect cross section on the chosen Trojan horse nucleus, at least for the investigated cases.

Fully differential cross sections for Li2+-impact ionization of Li(2s) and Li(2p)

Science.gov (United States)

Ghorbani, Omid; Ghanbari-Adivi, Ebrahim; Fabian Ciappina, Marcelo

2018-05-01

A semiclassical impact parameter version of the continuum distorted wave-Eikonal initial state theory is developed to study the differential ionization of Li atoms in collisions with Li2+ ions. Both post and prior forms of the transition amplitude are considered. The fully differential cross sections are calculated for the lithium targets in their ground and their first excited states and for the projectile ions at 16 MeV impact energy. The role of the inter-nuclear interaction as well as the significance of the post-prior discrepancy in the ejected electron spectra are investigated. The obtained results for ejection of the electron into the azimuthal plane are compared with the recent measurements and with their corresponding values obtained using a fully quantum mechanical version of the theory. In most of the cases, the consistency of the present approach with the experimental and the quantum theoretical data is reasonable. However, for 2p-state ionization, in the cases where no experimental data exist, there is a considerable difference between the two theoretical approaches. This difference is questionable and further experiments are needed to judge which theory makes a more accurate description of the collision dynamics.

Luminescence and excited state dynamics in Bi3+-doped LiLaP4O12 phosphates

International Nuclear Information System (INIS)

Babin, V.; Chernenko, K.; Demchenko, P.; Mihokova, E.; Nikl, M.; Pashuk, I.; Shalapska, T.; Voloshinovskii, A.; Zazubovich, S.

2016-01-01

Photo- and X-ray-excited luminescence characteristics of Bi-doped LiLaP 4 O 12 phosphates with different bismuth contents (from 1 to 25 at% in the melt) are investigated in the 4.2–300 K temperature range and compared with the characteristics of the undoped LiLaP 4 O 12 phosphate. The broad 2.95 eV emission band of LiLaP 4 O 12 :Bi excited around 5.4 eV is found to arise from the bismuth dopant. Relatively large FWHM and Stokes shift of the emission band and especially the data on the low-temperature decay kinetics of the 2.95 eV emission and its temperature dependence, indicating a very small spin-orbit splitting energy of the corresponding excited state, allow the conclusion that this emission arises from the radiative decay of the triplet state of an exciton localized around a Bi 3+ ion. No spectral bands are observed, arising from the electron transitions between the energy levels of Bi 3+ ions. Phenomenological model is proposed for the description of the excited state dynamics of the Bi 3+ -related localized exciton in LiLaP 4 O 12 :Bi and the parameters of the triplet localized exciton state are determined. Keywords: Photoluminescence; Time-resolved spectroscopy; Excited states; Bi 3+ centers; LiLaP 4 O 12 :Bi powders

Tl response of LiF:Mg, Cu, P + PTFE to Am-Be neutrons

International Nuclear Information System (INIS)

Gonzalez M, P.R.

2000-01-01

In different laboratories of the world it is followed the research about development of new Tl materials, whose main characteristics should be their equivalence with the tissue and their high sensibility to any type of radiation. The study consists in to measure the Tl peak intensity which TLD-100 presents at being irradiated with neutrons and that appears over 250 Centigrade, for compare it with the Tl intensity of the LiF: Mg, Cu, P + PTFE dosemeters. However, not all dosemeters of the same group show the interesting peak, by this only can be the total Tl intensity of dosemeters studied. In the ININ dosemeters development laboratory, we have developed a Tl material of lithium fluoride activated with magnesium, copper and phosphorus (LiF: Mg, Cu, P) that in polycrystalline powder form is almost 35 times more sensitive than the TLD-100 commercial dosemeter of Harshaw/Filtrol, USA. With the use of polytetrafluorethylene (PTFE) and with the above described Tl material, it has been possible to obtain dosemeters in pellet form of LiF: Mg, Cu, P + PTFE. (Author)

48 CFR 232.702 - Policy.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Policy. 232.702 Section 232.702 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Contract Funding 232.702 Policy. Fixed-price...

Etude des facteurs liés à l'observance au traitement antirétroviral chez les patients suivis à l'Unité de Prise En Charge du VIH/SIDA de l'Hôpital de District de Dschang, Cameroun

Science.gov (United States)

Mbopi-Kéou, François-Xavier; Dempouo Djomassi, Lucienne; Monebenimp, Francisca

2012-01-01

Introduction Etudier les facteurs liés à l'observance au traitement antirétroviral chez les patients adultes suivis à l'Unité de Prise en Charge du VIH/SIDA (UPEC) de l'hôpital de District de Dschang. Méthodes Dans une étude descriptive transversale conduite à l'hôpital de District de Dschang, l'observance a été évaluée sur la base des déclarations des patients et sur la régularité du renouvellement de leurs ordonnances (observance calculée). Résultats Parmi les 389 patients répondant à nos critères d'inclusion, 356 ont été interrogés. La durée moyenne du suivi était de 27 mois. La moyenne d’âge était égale à 41 ans et le sexe ratio 2,46 en faveur du sexe féminin. Le statut sérologique était découvert pour 60,56% des patients à l'occasion d'un épisode maladif. Le niveau d'observance déclarée était significativement plus élevé que le niveau global de l'observance calculée (80,2% vs 51,5%, p<10−5). Les deux principales barrières à l'observance étaient l'oubli et le travail. Les patients référés dans cette UPEC étaient moins bien observants (p<10−4). L'observance au traitement antirétroviral était d'autant meilleure quand le taux de CD4 en début de traitement était élevé (p= 0,01) et que la durée du traitement était prolongée (p=0,00). Conclusion La discordance observée entre les résultats des deux méthodes utilisées pour estimer l'observance, tout en soulévant les contraintes liées à l’évaluation de l'observance thérapeutique, souligne l'importance des méthodes biologiques. Les facteurs individuels se sont avérés être les principales raisons de non-observance. Enfin, un accent devrait être mis sur les consultations d’éducation thérapeutique et le suivi psycho-social des patients sous traitement antirétroviral dans cette UPEC. PMID:22937195

Determination of 228Th, 230Th, and 232Th in environmental samples from uranium mining and milling operations

International Nuclear Information System (INIS)

Durham, R.W.; Joshi, S.R.

1979-01-01

A method is described for the determination of 228 Th, 230 Th, and 232 Th in environmental samples from uranium mining and milling operations. The analytical procedure is based on the direct determination of 228 Th in the sample by high resolution γ-spectrometry followed by extraction and purification of the thorium fraction using high molecular weight amines and an anion-exchange technique, respectively, prior to α-spectrometry to determine isotopic ratios. The lowest level of detection for each thorium isotope is 0.01 pCi/g for solid samples and 20 pCi/l for aqueous samples. Replicate analyses of a typical mine waste stream gave a standard deviation of +-3% for 228 Th. Standard deviations of the 230 Th and 232 Th increased to +-11% apparently due to traces of 210 Po interfering in the α-spectrometry. (author)

Mn L2,3-edge X-ray absorption spectroscopic studies on charge-discharge mechanism of Li2MnO3

International Nuclear Information System (INIS)

Kubobuchi, Kei; Mogi, Masato; Imai, Hideto; Ikeno, Hidekazu; Tanaka, Isao; Mizoguchi, Teruyasu

2014-01-01

The redox reaction of Mn in Li 2 MnO 3 was studied by X-ray absorption spectroscopy and ab initio multiplet calculation. Associated with the de-intercalation of Li-ion, small but clear spectral changes were observed in Mn-L 2,3 X-ray absorption near edge structure (XANES). The systematic ab initio multiplet calculations of Mn-L 2,3 XANES revealed that the spectral changes in the experiment could not simply be ascribed to the change of the valency from Mn 4+ to Mn 5+ but can be explained well by the changes of local atomic structures around Mn 4+ due to the Li de-intercalation. Our results suggest that the electronic state of oxygen should change during charging in Li 2 MnO 3

Improving low-temperature performance of spinel LiNi0.5Mn1.5O4 electrode and LiNi0.5Mn1.5O4/Li4Ti5O12 full-cell by coating solid-state electrolyte Li-Al-Ti-P-O

Science.gov (United States)

Bi, Kun; Zhao, Shi-Xi; Huang, Chao; Nan, Ce-Wen

2018-06-01

Octahedral cathode materials LiNi0.5Mn1.5O4 (LNMO), with primary particles size of 300-600 nm are prepared through one-step co-precipitation. Then solid-state electrolyte Li2O-Al2O3-TiO2-P2O5 (LATP) was coated on LNMO to form continuous surface-modification layer. There is no obviously difference of structure, morphology between coated LATP LiNi0.5Mn1.5O4 (LATP-LNMO) and pristine LiNi0.5Mn1.5O4 (P-LNMO). Low-temperature electrochemical performance of P-LNMO and LATP-LNMO electrodes, including charge-discharge capacity, cycle performance, middle discharge voltage and electrochemical impedance spectra (EIS), were measured systematically with three electrode. The results reveal that LATP-LNMO electrode presents superior electrochemical performance at low temperature, compared to P-LNMO electrode. At -20 °C, the capacity retention of LATP-LNMO (61%) is much higher than that of P-LNMO (39%). According to EIS, the enhancement of performance of LATP-LNMO cathode at low temperature can be attribute to LATP coating, which not only promotes lithium-ion diffusion at electrode/electrolyte interface but also decreases the charge transfer resistance. Finally, the electrochemical performances of full cell of LATP-LNMO or P-LNMO cathode vs Li4Ti5O12 anode are investigated. The energy density can be achieved to 270 Wh·Kg-1 at -20 °C if using LATP-LNMO, which is much better than that of P-LNMO.

7 CFR 58.232 - Milk.

Science.gov (United States)

2010-01-01

... 7 Agriculture 3 2010-01-01 2010-01-01 false Milk. 58.232 Section 58.232 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections....232 Milk. Raw milk shall meet the requirements as outlined in §§ 58.132 through 58.138 and, unless...

28 CFR 23.2 - Background.

Science.gov (United States)

2010-07-01

... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Background. 23.2 Section 23.2 Judicial Administration DEPARTMENT OF JUSTICE CRIMINAL INTELLIGENCE SYSTEMS OPERATING POLICIES § 23.2 Background. It is... potential threats to the privacy of individuals to whom such data relates, policy guidelines for Federally...

Mechanism of Formation of Li ₇ P ₃ S ₁₁ Solid Electrolytes through Liquid Phase Synthesis

Energy Technology Data Exchange (ETDEWEB)

Wang, Yuxing [Energy; Lu, Dongping [Energy; Bowden, Mark [Environmental; El Khoury, Patrick Z. [Environmental; Han, Kee Sung [Environmental; Deng, Zhiqun Daniel [Energy; Xiao, Jie [Energy; Zhang, Ji-Guang [Energy; Liu, Jun [Energy

2018-01-22

Crystalline Li7P3S11 is a promising solid electrolyte for all solid state lithium/lithium ion batteries. A controllable liquid phase synthesis of Li7P3S11 is more desirable compared to conventional mechanochemical synthesis, but recent attempts suffer from reduced ionic conductivities. Here we elucidate the formation mechanism of crystalline Li7P3S11 synthesized in the liquid phase (acetonitrile, or ACN). We conclude that the crystalline Li7P3S11 forms through a two-step reaction: 1) formation of solid Li3PS4∙ACN and amorphous Li2S∙P2S5 phases in the liquid phase; 2) solid-state conversion of the two phases. The implication of this two-step reaction mechanism to the morphology control and the transport properties of liquid phase synthesized Li7P3S11 is identified and discussed.

TPÜ üliõpilasesinduse tegemised veebruaris ja märtsis / Katriina Vasarik

Index Scriptorium Estoniae

Vasarik, Katriina

2001-01-01

TPÜ üliõpilasesinduse sotsiaaltoimkonnas päevakorras üliõpilaste toimetuleku- ehk sotsiaaltoetused. Kultuuritoimkond tegeleb Tallinna Tudengite Kevadpäevade ettevalmistamisega. Akadeemiline toimkond viis läbi koosoleku, kus osalesid dots. L. Jõgi ja prof. J. Orn, teemaks kasvatusteaduste teaduskonna lisaerialad. Riigitellimuse küsimuses on olnud mitmeid koosolekuid. Akadeemiline nõukogu esitas TPÜ nõukogu õppekomisjonile projekti uue esmaabi õppeaine sisseviimiseks õpetajakoolituse õppekavasse. Sotsiaal-, kultuuri- ja välissuhete toimkond tegelevad soome tuutorite vastuvõtmisega, kes saabuvad Tallinna projekti "International Tutoring" raames, TPÜ-s peetakse kobar-workshop, teemaks välisüliõpilaste nõustamine

Laboratory Bioaccumulation, Depuration And Total Dose Rate Of Waterborne Th-232 In Freshwater Fish Of Anabas Testudineus

International Nuclear Information System (INIS)

Zal U'yun Wan Mahmood; Norfaizal Mohamed; Nita Salina Abu Bakar

2014-01-01

Preliminary results on the study of bioaccumulation, depuration and total dose rate of Th-232 in the whole body of Anabas testudineus are presented. The objective of this study was to evaluate the effect of Th-232 concentration activity on the laboratory bioaccumulation, depuration and total dose rate in Anabas testudineus. Anabas testudineus adults were exposed to different waterborne Th-232 levels: 0 BqL -1 (control), 50 BqL -1 and 100 BqL -1 for 30 day (uptake phase), followed by exposure to radionuclide-free water for 30 days (loss phase). Radionuclide concentration ratios between the whole body levels and water levels, percentage of Th-232 remaining in fish were calculated and total dose rates using ERICA Assessment Tool were also estimated. The results showed the increase of waterborne Th-232 concentration corresponded to a progressive increase of Th accumulation and total dose rate (internal and external) in the whole body of Anabas testudineus. Considering the ERICA dose rate screening value of 10 μGyh -1 , the findings can be concluded the estimated of total dose rate (< 5 μGyh -1 ) in Anabas testudineus is in order of small magnitude. Nevertheless, these preliminary results showed that the Anabas testudineus has a potential to accumulate thorium. (author)

P-wave Feshbach resonances of ultracold 6Li

International Nuclear Information System (INIS)

Zhang, J.; Kempen, E.G.M. van; Bourdel, T.; Cubizolles, J.; Chevy, F.; Teichmann, M.; Tarruell, L.; Salomon, C.; Khaykovich, L.; Kokkelmans, S.J.J.M.F.

2004-01-01

We report the observation of three p-wave Feshbach resonances of 6 Li atoms in the lowest hyperfine state f=1/2. The positions of the resonances are in good agreement with theory. We study the lifetime of the cloud in the vicinity of the Feshbach resonances and show that, depending on the spin states, two- or three-body mechanisms are at play. In the case of dipolar losses, we observe a nontrivial temperature dependence that is well explained by a simple model

Crystallization of P-type ATPases by the High Lipid-Detergent (HiLiDe) Method

DEFF Research Database (Denmark)

Sitsel, Oleg; Wang, Kaituo; Liu, Xiangyu

2016-01-01

Determining structures of membrane proteins remains a significant challenge. A technique utilizing high lipid-detergent concentrations ("HiLiDe") circumvents the major bottlenecks of current membrane protein crystallization methods. During HiLiDe, the protein-lipid-detergent ratio is varied in a ...... crystallization techniques. The method has been applied with particular success to P-type ATPases....

Phosphorylation of the human respiratory syncytial virus P protein mediates M2-2 regulation of viral RNA synthesis, a process that involves two P proteins.

Science.gov (United States)

Asenjo, Ana; Villanueva, Nieves

2016-01-04

The M2-2 protein regulates the balance between human respiratory syncytial virus (HRSV) transcription and replication. Here it is shown that M2-2 mediated transcriptional inhibition is managed through P protein phosphorylation. Transcription inhibition by M2-2 of the HRSV based minigenome pRSVluc, required P protein phosphorylation at serines (S) in positions 116, 117, 119 and increased inhibition is observed if S232 or S237 is also phosphorylated. Phosphorylation of these residues is required for viral particle egression from infected cells. Viral RNA synthesis complementation assays between P protein variants, suggest that two types of P proteins participate in the process as components of RNA dependent RNA polymerase (RdRp). Type I is only functional when, as a homotetramer, it is bound to N and L proteins through residues 203-241. Type II is functionally independent of these interactions and binds to N protein at a region outside residues 232-241. P protein type I phosphorylation at S116, S117 and S119, did not affect the activity of RdRp but this phosphorylation in type II avoids its interaction with N protein and impairs RdRp functionality for transcription and replication. Structural changes in the RdRp, mediated by phosphorylation turnover at the indicated residues, in the two types of P proteins, may result in a fine adjustment, late in the infectious cycle, of transcription, replication and progression in the morphogenetic process that ends in egression of the viral particles from infected cells. Copyright © 2015 Elsevier B.V. All rights reserved.

Electronic Properties of LiFePO4 and Li doped LiFePO4

International Nuclear Information System (INIS)

Zhuang, G.V.; Allen, J.L.; Ross, P.N.; Guo, J.-H.; Jow, T.R.

2005-01-01

The potential use of different iron phosphates as cathode materials in lithium-ion batteries has recently been investigated.1 One of the promising candidates is LiFePO4. This compound has several advantages in comparison to the state-of-the-art cathode material in commercial rechargeable lithium batteries. Firstly, it has a high theoretical capacity (170 mAh/g). Secondly, it occurs as mineral triphylite in nature and is inexpensive, thermally stable, non-toxic and non-hygroscopic. However, its low electronic conductivity (∼10-9 S/cm) results in low power capability. There has been intense worldwide research activity to find methods to increase the electronic conductivity of LiFePO4, including supervalent ion doping,2 introducing non-carbonaceous network conduction3 and carbon coating, and the optimization of the carbon coating on LiFePO4 particle surfaces.4 Recently, the Li doped LiFePO4 (Li1+xFe1-xPO4) synthesized at ARL has yield electronic conductivity increase up to 106.5 We studied electronic structure of LiFePO4 and Li doped LiFePO4 by synchrotron based soft X-ray emission (XES) and X-ray absorption (XAS) spectroscopies. XAS probes the unoccupied partial density of states, while XES the occupied partial density of states. By combining XAS and XES measurements, we obtained information on band gap and orbital character of both LiFePO4 and Li doped LiFePO4. The occupied and unoccupied oxygen partial density of states (DOS) of LiFePO4 and 5 percent Li doped LiFePO4 are presented in Fig. 1. Our experimental results clearly indicate that LiFePO4 has wideband gap (∼ 4 eV). This value is much larger than what is predicted by DFT calculation. For 5 percent Li doped LiFePO4, a new doping state was created closer to the Fermi level, imparting p-type conductivity, consistent with thermopower measurement. Such observation substantiates the suggestion that high electronic conductivity in Li1.05Fe0.95 PO4 is due to available number of charge carriers in the material

Determination of kinetic parameters in Tl dosemeters of LiF: Mg, Cu, P + PTFE developed in the ININ; Determinacion de parametros cineticos en dosimetros Tl de LiF: Mg, Cu, P + PTFE desarrollados en el ININ

Energy Technology Data Exchange (ETDEWEB)

Basurto G, B.S

2002-07-01

The objective of this work, is the one of determining the kinetic parameters of the dosemeter of LiF: Mg, Cu, P + Ptfe; starting from the curves Tl obtained at being irradiated with alpha radiation ({alpha}), beta ({beta}) and gamma ({gamma}). As like to compare its sensitivity with each radiation type, considering the sensitivity of the TLD-100 as the unit. In the Chapter 1, the fundamental structure of the matter is described, making emphasis in the different radiation types, and their interaction with this. In the Chapter 2, the units are described but used in the dosimetry of the radiation. In the Chapter 3, the basic concepts of the phenomenon of Tl are described and those are explained characteristic of the deconvolution method to determine the kinetics of the one phenomenon. In the Chapter 4, the methodology is detailed that was used in the elaboration of this thesis work, describing the material Tl that were considered like reference, as well as the sources of ionizing radiation, with those that the dosemeters were irradiated and the equipment in the one that the curves Tl was obtained. Reference is made to the software used to carry out the deconvolution of the curves Tl that were obtained in the one experimental development. In the Chapter 5, the obtained results of this study are presented, showing the tables of homogenization of dosemeters and the reading of the same one; they are observed the curves Tl obtained to different radiation doses (alpha, beta and gamma), the intensity Tl in function of the dose. Also they are tabulated, the obtained results in the kinetic parameters of the three different study materials (TLD-100H, USA; TLD-100, USA and LiF: Mg, Cu, P + Ptfe developed in the l.N.l.N). They are analyzed shortly for each material Tl their sensitivity to the ionizing radiation as well as their kinetic parameters. The obtained results showed that the Tl dosemeters of LiF: Mg,Cu,P + Ptfe, they presented a bigger sensitivity that the TLD-100 when

49 CFR 232.11 - Penalties.

Science.gov (United States)

2010-10-01

... hazard of death or injury to persons, or has caused death or injury, a penalty not to exceed $100,000 per... 49 Transportation 4 2010-10-01 2010-10-01 false Penalties. 232.11 Section 232.11 Transportation...-TRAIN DEVICES General § 232.11 Penalties. (a) Any person (including but not limited to a railroad; any...

There is no news like bad news: women are more remembering and stress reactive after reading real negative news than men.

Science.gov (United States)

Marin, Marie-France; Morin-Major, Julie-Katia; Schramek, Tania E; Beaupré, Annick; Perna, Andrea; Juster, Robert-Paul; Lupien, Sonia J

2012-01-01

With the advent of specialized television channels offering 24-hour coverage, Internet and smart phones, the possibility to be constantly in contact with the media has increased dramatically in the last decades. Despite this higher access to knowledge, the impact media exposure has on healthy individuals remains poorly studied. Given that most information conveyed in the media is negative and that upon perception of threat, the brain activates the stress system, which leads to cortisol secretion, we decided to determine how healthy individuals react to media information. Accordingly, we investigated whether reading real negative news (1) is physiologically stressful, (2) modulates one's propensity to be stress reactive to a subsequent stressor and (3) modulates remembrance for these news. Sixty participants (30 women, 30 men) were randomly assigned to either twenty-four real neutral news excerpts or to twenty-four real negative excerpts for 10 minutes. They were then all exposed to a well-validated psychosocial stressor, the Trier Social Stress Test (TSST), which consists of an anticipation phase of 10 minutes and a test phase of 10 minutes. A total of eight salivary cortisol samples were collected, at 10-minutes intervals, throughout the experimental procedure. One day later, a free recall of the news was performed. Results showed that although reading negative news did not lead to change in cortisol levels (p>0.05), it led to a significant increase in cortisol to a subsequent stressor in women only (pnegative news condition experienced better memory for these news excerpts compared to men (pmedia exposure could increase stress reactivity and memory for negative news in women.

Neutron scattering study on cathode LiMn2O4 and solid electrolyte 5(Li2O)(P2O5)

International Nuclear Information System (INIS)

Kartini, E.; Putra, Teguh P.; Jahya, A. K.; Insani, A.; Adams, S.

2014-01-01

Neutron scattering is very important technique in order to investigate the energy storage materials such as lithium-ion battery. The unique advantages, neutron can see the light atoms such as Hydrogen, Lithium, and Oxygen, where those elements are negligible by other corresponding X-ray method. On the other hand, the energy storage materials, such as lithium ion battery is very important for the application in the electric vehicles, electronic devices or home appliances. The battery contains electrodes (anode and cathode), and the electrolyte materials. There are many challenging to improve the existing lithium ion battery materials, in order to increase their life time, cyclic ability and also its stability. One of the most scientific challenging is to investigate the crystal structure of both electrode and electrolyte, such as cathodes LiCoO 2 , LiMn 2 O 4 and LiFePO 4 , and solid electrolyte Li 3 PO 4 . Since all those battery materials contain Lithium ions and Oxygen, the used of neutron scattering techniques to study their structure and related properties are very important and indispensable. This article will review some works of investigating electrodes and electrolytes, LiMn 2 O 4 and 5(Li 2 O)(P 2 O 5 ), by using a high resolution powder diffraction (HRPD) at the multipurpose research reactor, RSG-Sywabessy of the National Nuclear Energy Agency (BATAN), Indonesia

"I Have Good News and Bad News:" The Effects of Power Imbalances and Physical Distance on News-givers' Use of Blended News Delivery

OpenAIRE

Legg, Angela M.

2013-01-01

People dislike giving bad news, and one strategy they use to ease the process is to pair bad news with some good news, a phenomenon called blended news delivery. Often, blended news arrives from people in power positions such as physicians, managers, or teachers. But followers also find themselves needing to give bad news to those in higher power positions. Similarly, people can choose how they deliver bad news, such as in person or over email. The current study brings much needed empirical a...

Ab initio study of the structure and stability of carbonates, silicates, nitrates, phosphates, borates and aluminates L2AO3 and MAO3 (L=Li, Na; M=Be, Mg; A=C, Si, N+, P+, B-, Al-)

International Nuclear Information System (INIS)

Charkin, D.O.; Makku, M.L.; Charkin, O.P

1998-01-01

Nonempiric calculations of potential energy surfaces of molecules and ions of lithium and sodium oxosalts of the L 2 AO 3 type and beryllium and magnesium salts of the MAO 3 type with 24 valent electrons (L=Li, Na; M=Be, Mg; A=C, Si, N + , P + , B - , Al - ) are accomplished within the frames of the MP2/6-31G * +ZPE(HF/6-31G * ) and MP4SDTQ/6-31+G * //MP2/6-31G * +ZPE(MP2/6-31G * )approximations. Equilibriumgeometrical parameters and relative energy of isomers and energy of their decomposition, IR-frequencies and intensities of normal oscillations are determined; trends in their change in various series of molecules and ions are analyzed. Deformation and polarization of the AO 3 trigonal oxoanions under the effect of alkali and alkaline-earth cations, ortho-meta-isomerism in negative ions of the MBO 3 - borates and MACO 3 - aluminates, as well as effect of electron correlation on calculation results are determined. The results are compared with the data of previous calculations of isoelectron lithium and sodium salts LAO 3

Low energy 7Li(p,n)7Be neutron source (CANUTRON)

International Nuclear Information System (INIS)

Lone, M.A.; Ross, A.M.; Fraser, J.S.; Schriber, S.O.; Kushneriuk, S.A.; Selander, W.N.

1982-04-01

Characteristics of a neutron source based on the 7 Li(p,n) reaction at 2.5 MeV are investigated. It is shosn that with a 10-50 mA beam current this reaction provides a useful source for neutron radiography and other industrial applications

Neutron Energy Spectra and Yields from the 7Li(p,n) Reaction for Nuclear Astrophysics

Science.gov (United States)

Tessler, M.; Friedman, M.; Schmidt, S.; Shor, A.; Berkovits, D.; Cohen, D.; Feinberg, G.; Fiebiger, S.; Krása, A.; Paul, M.; Plag, R.; Plompen, A.; Reifarth, R.

2016-01-01

Neutrons produced by the 7Li(p, n)7Be reaction close to threshold are widely used to measure the cross section of s-process nucleosynthesis reactions. While experiments have been performed so far with Van de Graaff accelerators, the use of RF accelerators with higher intensities is planned to enable investigations on radioactive isotopes. In parallel, high-power Li targets for the production of high-intensity neutrons at stellar energies are developed at Goethe University (Frankfurt, Germany) and SARAF (Soreq NRC, Israel). However, such setups pose severe challenges for the measurement of the proton beam intensity or the neutron fluence. In order to develop appropriate methods, we studied in detail the neutron energy distribution and intensity produced by the thick-target 7Li(p,n)7Be reaction and compared them to state-of- the-art simulation codes. Measurements were performed with the bunched and chopped proton beam at the Van de Graaff facility of the Institute for Reference Materials and Measurements (IRMM) using the time-of-flight (TOF) technique with thin (1/8") and thick (1") detectors. The importance of detailed simulations of the detector structure and geometry for the conversion of TOF to a neutron energy is stressed. The measured neutron spectra are consistent with those previously reported and agree well with Monte Carlo simulations that include experimentally determined 7Li(p,n) cross sections, two-body kinematics and proton energy loss in the Li-target.

No news is good news?

CERN Multimedia

Peter Schmid

I'm retired and living back home in Austria. But I am still excited about ATLAS and I try to follow the progress of the project as closely as I can. The ATLAS e-news are an excellent source of information. Appearing now every month they provide a broad, solid view of what is going on. But I'm greedy; I'd love to be "on-line". When the first End-Cap Toroid moved from hall 180 to the pit I was frustrated. I knew that it was happening but I could only get first pictures and reports a few days later. In the meantime the ECT was lowered into the cavern; no information on this available nowhere up to the this issue of the e-news. Here is my dream: an "ATLAS news ticker", i.e. a web page with the news appearing on the day they happen; just one line of information, possibly with a reference to a picture, a person or a report. My idea isn't new. On the ATLAS web-site for the public we have a window "latest news". But I was disappointed when, until a week ago, the latest news dated from December 2006 !!! Can't we do...

news-please

OpenAIRE

Hamborg, Felix; Meuschke, Norman; Breitinger, Corinna; Gipp, Bela

2017-01-01

The amount of news published and read online has increased tremendously in recent years, making news data an interesting resource for many research disciplines, such as the social sciences and linguistics. However, large scale collection of news data is cumbersome due to a lack of generic tools for crawling and extracting such data. We present news-please, a generic, multilanguage, open-source crawler and extractor for news that works out-of-thebox for a large variety of news websites. ...

l- and n-changing collisions during interaction of a pulsed beam of Li Rydberg atoms with CO2

Science.gov (United States)

Dubreuil, B.; Harnafi, M.

1989-07-01

The pulsed Li atomic beam produced in our experiment is based on controlled transversely-excited-atmospheric CO2 laser-induced ablation of a Li metal target. The atomic beam is propagated in vacuum or in CO2 gas at low pressure. Atoms in the beam are probed by laser-induced fluorescence spectroscopy. This allows the determination of time-of-flight and velocity distributions. Li Rydberg states (n=5-13) are populated in the beam by two-step pulsed-laser excitation. The excited atoms interact with CO2 molecules. l- and n-changing cross sections are deduced from the time evolution of the resonant or collision-induced fluorescence following this selective excitation. l-changing cross sections of the order of 104 AṦ are measured; they increase with n as opposed to the plateau observed for Li* colliding with a diatomic molecule. This behavior is qualitatively well explained in the framework of the free-electron model. n-->n' changing processes with large cross sections (10-100 AṦ) are also observed even in the case of large electronic energy change (ΔEnn'>103 cm-1). These results can be interpreted in terms of resonant-electronic to vibrational energy transfers between Li Rydberg states and CO2 vibrational modes.

Luminescence properties of LiPrxCe1-xP4O12

International Nuclear Information System (INIS)

Shalapska, T.; Stryganyuka, G.; Trotsc, D.; Demkiv, T.; Gektin, A.; Voloshinovskii, A.; Dorenbos, P.

2010-01-01

LiPr 1-x Ce x P 4 O 12 (x=0, 0.002, 0.02; 0.1) powder samples were prepared using the melt solution technique. Luminescent parameters of LiPr 1-x Ce x P 4 O 12 phosphors have been investigated under ultraviolet-vacuum ultraviolet (3-12 eV) synchrotron radiation and X-rays excitation at room and near liquid He temperatures. Excitation luminescence spectra of Ce 3+ emission, luminescent spectra and decay curves from the lower excited state levels of the 4f 1 5d 1 and 5d 1 electronic configuration of the Pr 3+ and Ce 3+ , respectively, clearly indicate energy transfer from Pr 3+ to Ce 3+ . Energy migration proceeds via the Pr-sublattice followed by nonradiation transfer from Pr 3+ to Ce 3+ ions.

DISCOVERY OF A LATE L DWARF: WISEP J060738.65+242953.4

International Nuclear Information System (INIS)

Castro, Philip J.; Gizis, John E.

2012-01-01

We discover a late-type L dwarf, WISEP J060738.65+242953.4 (W0607+2429), by comparing the Wide-field Infrared Survey Explorer (WISE) preliminary data release to the Two Micron All Sky Survey (2MASS) in search of high proper motion objects (∼> 0.''3 yr –1 ). W0607+2429 was found to have a proper motion of 0.57 ± 0.''02 yr –1 . Based on colors and color-color diagrams using 2MASS and Sloan Digital Sky Survey photometry, we estimate the spectral type (optical) to be L8 within a spectral sub-type. Based on the spectral type estimated we find W0607+2429 to have a distance of 7.8 +1.4 –1.2 pc, making it one of only four very late L dwarfs within 10 pc, and the third closest L dwarf overall. This close L/T transition dwarf will play a pivotal role in resolving outstanding issues of condensate clouds of low-temperature atmospheres.

48 CFR 1553.232 - Contract financing.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contract financing. 1553.232 Section 1553.232 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION AGENCY CLAUSES AND FORMS FORMS Prescription of Forms 1553.232 Contract financing. ...

Üliõpilasteater teeb nalja armastusega / Maarja Mänd

Index Scriptorium Estoniae

Mänd, Maarja

2008-01-01

Minski lavastaja Sergei Turbani lavastusest "Naljad armastusest" Anton Tshehhovi lühinäidendite "Juubel" ja "Abieluettepanek" ainetel Tartu Üliõpilasteatri näitlejate esituses. Esietendus 7. dets. Athena pööningusaalis

P L Jain

Indian Academy of Sciences (India)

Home; Journals; Bulletin of Materials Science. P L Jain. Articles written in Bulletin of Materials Science. Volume 23 Issue 4 August 2000 pp 325-330 Electrical Properties. Electrical transport in ethyl cellulose–chloranil system · P K Khare R K Pandey P L Jain · More Details Abstract Fulltext PDF. The charge-transport ...

Sensing the News: User Experiences when Reading Locative News

Directory of Open Access Journals (Sweden)

Kjetil Vaage Øie

2012-02-01

Full Text Available This article focuses on user experiences on reading location-aware news on the mobile platform and aims to explore what experiences this kind of locative journalism generates and how such experiences change the users’ social interaction with news. We produced a specially designed mobile application and tailored news stories specific to this project called LocaNews in order to explore participants’ relation to the content in this journalistic format. The result is generated through a field study and a questionnaire of 32 people to find out how they experience the news presented in this format. The user participants’ responses are analyzed based on their news experiences, contextualizing places and their social interaction with the news within this form of journalism. Results showed that the local, semi-local and non-local user approaches the locative news in a different manner, but that the average user found this kind of news more interesting and more informative than ordinary news. The participants also have a problem identifying this as journalism, rather than an information service.

Revisiting the 7Li(p,n)7Be reaction near threshold

International Nuclear Information System (INIS)

Herrera, María S.; Moreno, Gustavo A.; Kreiner, Andrés J.

2014-01-01

In this work we review all the available experimental neutron data for the 7 Li(p,n) reaction near threshold which is necessary to obtain an accurate source model for Monte Carlo simulations in Boron Neutron Capture Therapy. Scattered published experimental results such as cross sections, differential neutron yields and total yields were collected and analyzed, exploring the sensitivity of the fitting parameters to the different possible variables and deriving a consistent working set of parameters to evaluate the neutron source near threshold. - Highlights: • We review neutron experimental data for the 7 Li(p,n) reaction near threshold. • A new computational method was used to study all the available published data. • A consistent description of the neutron source was derived fitting the available data. • We found that the neutron yield at 0° studied by Kononov is the most sensitive curve. • A consistent set of parameters to parametrize the Breit–Wigner formula is presented

Upgrading transmission lines with aerial LiDAR technology

Energy Technology Data Exchange (ETDEWEB)

Koop, J.E. [Manitoba Hydro, Winnipeg, MB (Canada)

2003-04-01

LiDAR (Light Detection and Ranging) technology is described as an example of techniques used by hydro companies to increase their capacity with existing plants, and within tight budget constraints. LiDAR was chosen by Manitoba Hydro primarily because LiDAR's data collection method offers very fast turn-around time from collection to delivery, and most importantly because of LiDAR's highly accurate ability to map terrain and wire catenary shape in every span. The article describes a case study of the 'Nip and Tuck' method of wire re-tensioning based on LiDAR data, which was used by Manitoba Hydro to create a computer model of Saskatchewan Hydro's transmission line capacity on its 138 kV transmission line between Saskatoon and North Battleford. The model was needed to analyze the existing line conditions in an effort to minimize cascading failures on the 40-year old line. Using the 'Nip and Tuck' technology in combination with LiDAR, SaskPower engineers were able to complete the required modifications to raise transmission wire operating temperatures on the 135 km long line to 66 degree C in only 36 days, and at a cost that was 80 per cent less than the cost would have been using conventional techniques ($232,000 instead of the estimated $1.25 million).

Boron isotopes in brachiopods during the end-Permian mass extinction: constraints on pH evolution and seawater chemistry

Science.gov (United States)

Jurikova, Hana; Gutjahr, Marcus; Liebetrau, Volker; Brand, Uwe; Posenato, Renato; Garbelli, Claudio; Angiolini, Lucia; Eisenhauer, Anton

2017-04-01

The global biogeochemical cycling of carbon is fundamental for life on Earth with the ocean playing a key role as the largest and dynamically evolving CO2 reservoir. The boron isotope composition (commonly expressed in δ11B) of marine calcium carbonate is considered to be one of the most reliable paleo-pH proxies, potentially enabling us to reconstruct past ocean pH changes and understand carbon cycle perturbations along Earth's geological record (e.g. Foster et al., 2008; Clarkson et al., 2015). Brachiopods present an advantageous and largely underutilised archive for Phanerozoic carbon cycle reconstructions considering their high abundance in the geological record and its origin dating back to the early Cambrian. Moreover, their shell made of low-magnesium calcite makes these marine calcifiers more resistant to post-depositional diagenetic alteration of primary chemical signals. We have investigated the δ11B using MC-ICP-MS (Neptune Plus) and B/Ca and other elemental ratios (Mg/Ca, Sr/Ca, Al/Ca, Li/Ca, Ba/Ca, Na/Ca and Fe/Ca) using ICP-MS-Quadrupole (Agilent 7500cx) from the same specimens in pristine brachiopod shells from two sections from northern Italy during the Late Permian. These sections cover the δ13C excursion in excess of ˜4 ‰ (Brand et al., 2012) and are associated with major climate and environmental perturbations that lead to the mass extinction event at the Permian-Triassic boundary. Particular emphasis will be placed on the implications of our new paleo-pH estimates on the seawater chemistry during the Late Permian. Brand, U., Posenato, R., Came, R., Affek, H., Angiolini, L., Azmy, K. and Farabegoli, E.: The end-Permian mass extinction: A rapid volcanic CO2 and CH4-climatic catastrophe, Chemical Geology 323, 121-144, doi:10.1016/j.chemgeo.2012.06.015, 2012. Clarkson, M.O., Kasemann, S.A., Wood, R.A., Lenton, T.M., Daines, S.J., Richoz, S., Ohnemueller, F., Meixner, A., Poulton, S.W. and Tipper, E.T.: Ocean acidification and the Permo

Experimental studies of collisions of excited Li(4p) atoms with C2H4, C2H6, C3H8 and theoretical interpretation of the Li-C2H4 system

International Nuclear Information System (INIS)

Semmineh, Natenael; Bililign, Solomon; Hagebaum-Reignier, Denis; Jeung, Gwang-Hi

2009-01-01

Collisions of excited Li(4p) states with C 2 H 4 , C 2 H 6 and C 3 H 8 are studied experimentally using far-wing scattering state spectroscopy techniques. High-level ab initio quantum mechanical studies of the Li-C 2 H 4 system are conducted to explain the results of the experiment for this system. The recent and present works indicate that knowledge of the internal structure of the perturber (C 2 H 4 , C 2 H 6 and C 3 H 8 ) is essential to fully understand the interaction between the metal and the hydrocarbon molecules. The ab initio calculation shows that the Li(4d) (with little probability under the experimental conditions) and the Li(4p) can be formed directly through the laser pumping. It also shows that the Li(4s) and Li(3d) states can be formed through an electronic diabatic coupling involving a radiationless process. However, the Li(3p), Li(3s) and Li(2p) states can only be formed through a secondary diabatic coupling which is a much less probable process than the primary one. The calculation limited to two C 2v sections of the potential energy surfaces (PESs) shows peculiar multi-state crossings that we have never seen in other lithium complexes we studied

2015 Puget Sound LiDAR Consortium (PSLC) LiDAR: WA DNR Lands (P1)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — In June 2014, WSI, a Quantum Spatial Inc. (QSI) company, was contracted by the Puget Sound LiDAR Consortium (PSLC) to collect Light Detection and Ranging (LiDAR)...

2015 Puget Sound LiDAR Consortium (PSLC) LiDAR: WA DNR Lands (P2)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — In June 2014, WSI, a Quantum Spatial Inc. (QSI) company, was contracted by the Puget Sound LiDAR Consortium (PSLC) to collect Light Detection and Ranging (LiDAR)...

Initial Investigations of Intra-Day News Flow of S&P500 Constituents

Directory of Open Access Journals (Sweden)

Jim Kyung-Soo Liew

2014-04-01

Full Text Available In this work, we examine Thomas Reuters News Analytics (TRNA data. We found several fascinating discoveries. First, we document the phenomenon that we label “Jam-the-Close”: The last half hour of trading (15:30 to 16:00 EST contains a substantial and statistically significant amount of news sentiment releases. This finding is robust across years and months of the year. Next, upon further investigations we found that the “novelty” score is on average 0.67 in this period vs. 2.09 prior to midday. This indicates that “new” news is flowing at a rapid pace prior to the close. Finally, we discuss the implication of such phenomena in the context of existing financial literature.

49 CFR 232.13 - Preemptive effect.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Preemptive effect. 232.13 Section 232.13 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... EQUIPMENT; END-OF-TRAIN DEVICES General § 232.13 Preemptive effect. (a) Under 49 U.S.C. 20106, issuance of...

News values on social media: News organizations’ Facebook use

Science.gov (United States)

Al-Rawi, Ahmed

2016-01-01

This study examines the news selection practices followed by news organizations through investigating the news posted on social networking sites and, in particular, the Facebook pages of four foreign Arabic language TV stations: The Iranian Al-Alam TV, Russia Today, Deutsche Welle, and BBC. A total of 15,589 news stories are analyzed in order to examine the prominence of references to countries and political actors. The study reveals that social significance and proximity as well as the news organizations’ ideological agenda are the most important elements that dictate the news selection process. PMID:29278253

News values on social media: News organizations' Facebook use.

Science.gov (United States)

Al-Rawi, Ahmed

2017-08-01

This study examines the news selection practices followed by news organizations through investigating the news posted on social networking sites and, in particular, the Facebook pages of four foreign Arabic language TV stations: The Iranian Al-Alam TV, Russia Today, Deutsche Welle, and BBC. A total of 15,589 news stories are analyzed in order to examine the prominence of references to countries and political actors. The study reveals that social significance and proximity as well as the news organizations' ideological agenda are the most important elements that dictate the news selection process.

Improved chemical stability and cyclability in Li2S–P2S5–P2O5–ZnO composite electrolytes for all-solid-state rechargeable lithium batteries

International Nuclear Information System (INIS)

Hayashi, Akitoshi; Muramatsu, Hiromasa; Ohtomo, Takamasa; Hama, Sigenori; Tatsumisago, Masahiro

2014-01-01

Highlights: • Chemical stability in air of Li 2 S–P 2 S 5 –P 2 O 5 –ZnO composite electrolytes was examined. • A partial substitution of P 2 O 5 for P 2 S 5 decreased the rate of H 2 S generation. • The addition of ZnO to the glasses reduced the amount of H 2 S. • All-solid-state lithium cells using the developed composite electrolytes exhibited good cyclability. -- Abstract: Sulfide glasses with high Li + ion conductivity are promising solid electrolytes for all-solid-state rechargeable lithium batteries. This study specifically examined the chemical stability of Li 2 S–P 2 S 5 -based glass electrolytes in air. Partial substitution of P 2 O 5 for P 2 S 5 decreased the rate of H 2 S generation from glass exposed to air. The addition of ZnO to the Li 2 S–P 2 S 5 –P 2 O 5 glasses as a H 2 S absorbent reduced the H 2 S gas release. A composite electrolyte prepared from 90 mol% of 75Li 2 S⋅21P 2 S 5 ⋅4P 2 O 5 (mol%) glass and 10 mol% ZnO was applied to all-solid-state cells. The all-solid-state In/LiCoO 2 cell with the composite electrolyte showed good cyclability as a lithium secondary battery

8 CFR 232.3 - Arriving aliens.

Science.gov (United States)

2010-01-01

... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Arriving aliens. 232.3 Section 232.3 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS DETENTION OF ALIENS FOR PHYSICAL AND MENTAL EXAMINATION § 232.3 Arriving aliens. When a district director has reasonable grounds...

Effect of AlP coating on electrochemical properties of LiMn{sub 2}O{sub 4} cathode material for lithium ion battery

Energy Technology Data Exchange (ETDEWEB)

Feng, Xiaoyu; Zhang, Jianxin, E-mail: jianxin@sdu.edu.cn; Yin, Longwei

2016-02-15

Highlights: • Modified LiMn{sub 2}O{sub 4} surface with AlP successfully. • AlP coating surface modification enhances the cycling stability of LiMn{sub 2}O{sub 4} at both room temperature and 60 °C. • AlP coating surface modification improves the rate capability of LiMn{sub 2}O{sub 4}. - Abstract: AlP-modified LiMn{sub 2}O{sub 4} has been synthesized via a simple chemical deposition method followed by high-temperature heating. The X-ray diffraction patterns, SEM images and Energy Dispersive Spectrometer show the successful surface coating of LiMn{sub 2}O{sub 4} by F-43 m crystal form AlP. AlP-modified LiMn{sub 2}O{sub 4} has a high discharge capacity of 125.7 mAh g{sup −1} with retention of 87% at a current density of 1C between 3.3 V and 4.3 V after 100 cycles at 60 °C, while bare LiMn{sub 2}O{sub 4} has more than 28% capacity loss. At 10 rates, the coated sample delivers capacity of 100 mAh g{sup −1}, which is much higher than bare LiMn{sub 2}O{sub 4}. Based on the EIS (electrochemical impedance spectroscopy) result, AlP coating can effectively inhibit the increase of the charge transfer resistance during charging and discharging cycles.

24 CFR 232.560 - Interest rate.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Interest rate. 232.560 Section 232... Equipment Eligible Security Instruments § 232.560 Interest rate. (a) The loan shall bear interest at the rate agreed upon by the lender and the borrower. (b) Interest shall be payable in monthly installments...

Stability of the post irradiation traps in LiF: Mg, Cu, P

International Nuclear Information System (INIS)

Gonzalez, P.R.; Furetta, C.; Azorin, J.

2004-01-01

In this work the results of the study of the stability of the traps are presented in dosemeters Tl of LiF: Mg,Cu,P, irradiated with gamma radiation of 60 Co. The studied dosemeters were of LiF: Mg,Cu,P + Ptfe, developed in the ININ, taking like reference to the commercial dosemeter GR200A of Chinese manufacture. Before being exposed to the radiation, the dosemeters received their standard treatment from having erased, two hours after the irradiation they took the initial readings. The dosemeters faded again and they were irradiated to the same dose, soon after they stayed under normal conditions, protected of the light, later on they were taken their readings periodically during six months. The readings taken Tl the same day of the irradiation presented four peaks whose energy, determined by the deconvolution method were; 1.30 ± 0.01 eV, 1.50 ± 0.01 eV, 1.70 ± 0.01 eV and 2.58 ± 0.02 eV, for LiF: Mg,Cu,P + Ptfe, while GR200A stops the energy they were: 1.33 ± 0.11 eV, 1.58 ± 0.11 eV, 1.73 ± 0.11 eV and 2.60 ± 0.03 eV. In both cases the peak 1, with the energy but it lowers, it disappears completely after some later hours to the irradiation, while the peak 2, it disappears completely after 122 days for the local dosemeter and after 94 days for the commercial dosemeter. The energy of the peaks 3 and 4 that remained visible during the whole period of study it was: 1.38 ± 0.01 eV and 2.65 ± 0.01 eV, for LiF: Mg,Cu,P + Ptfe respectively, in the same order for GR200A, the energies were: 1.51 ± 0.02 eV and 2.64 ± 0.03 eV. In all the cases the peaks with energy below 2 eV, showed tendency to the drop, while the main peak, showed certain tendency to increase, as they show it the results. (Author)

Fading of the Tl signal in LiF: Mg, Cu, P during a large post irradiation period

International Nuclear Information System (INIS)

Gonzalez, P.R.; Azorin, J.; Furetta, C.

2004-01-01

In this work the obtained results of the study of the fading of the Tl signal in dosemeters of LiF activated with magnesium, copper and phosphorus (LiF:Mg,Cu,P) are presented. The studied dosemeters were LiF: Mg,Cu,P + Ptfe, developed in the ININ, taking like reference to the commercial dosemeter GR200A of Chinese manufacture. In both cases the Tl curve presents four peaks; in LiF: Mg,Cu,P + Ptfe, the peaks of smaller size appear in 359 K, 389 K and 447 K, the main dosimetric peak appears in 486 K; in GR200A, the peaks of smaller size appear in 360 K, 389 K and 445 K; while the main dosimetric peak appears in 487 K. The highest fading shown by the dosemeters of LiF: Mg,Cu,P + Ptfe, it was of 3.07%, value very below the one recommended for dosimetric purposes. While the commercial dosemeters presented a fading until of 6.23%, surpassing with the recommended values. The observed fading, it corresponds to the lost of the Tl signal of the peaks 1 and 2, since the first one disappears few hours after the irradiation, while the peak 2, it disappears completely after 94 days, the peak 3 remained stable during the six months of study, while the peak 4, it showed a slight increment due to the contribution of the dose of natural environmental radiation. (Author)

Self-broadening and shifting of the Li(2s-2p) and K(4s-4p) line cores

International Nuclear Information System (INIS)

Reggami, L.; Bouledroua, M.; Allouche, A.R.; Aubert-Frecon, M.

2009-01-01

The aim of this work is to determine quantum mechanically the width Γ and the shift Δ of the lithium Li(2p→2s) and potassium K(4p→4s) resonance lines when these atoms are evolving in their parent gases. The interaction potentials along which the atoms Li(2p)+Li(2s) and K(4p)+K(4s) approach each other are constructed from reliable data. The radial wave equation is then solved numerically by using these potentials to compute the elastic phase shifts. By adopting the simplified Baranger model for the pressure broadening, which assumes the impact approximation, the cross sections effective in linewidth and lineshift are analyzed. The analysis leads in particular to the determination of the width and shift rates and the computations show that these rates have constant values and, mainly, do not depend on temperature. An approximate method is further applied to the calculations of the cross sections. The results reveal the influence of the long-range -C 3 /R 3 interactions and confirm the universality of the obtained formulas of Γ and Δ

International News Flows in the Post-Cold War World: Mapping the News and the News Producers.

Science.gov (United States)

Sreberny-Mohammadi, Annabelle

1995-01-01

Reviews the global political environment, major global news providers, and technologies of global news production. Argues for a multinational comparative mapping of international news representation in the 1990s. Outlines a major international venture to update and elaborate the 1979 UNESCO/IAMCR study of foreign news in the media of 29 countries,…

Isolation of eukaryotic ribosomal proteins. Purification and characterization of the 60 S ribosomal subunit proteins L4, L5, L7, L9, L11, L12, L13, L21, L22, L23, L26, L27, L30, L33, L35', L37, and L39.

Science.gov (United States)

Tsurugi, K; Collatz, E; Wool, E G; Lin, A

1976-12-25

The proteins of the large subunit of rat liver ribosomes were separated into seven groups by stepwise elution from carboxymethylcellulose with LiCl at pH 6.5. Seventeen proteins (L4, L5, L7, L9, L11, L12, L13, L21, L22, L23, L26, L27, L30, L33, L35', L37, and L39) were isolated from three of the groups (B60, D60, G60) by ion exchange chromatography on carboxymethylcellulose and by filtration through Sephadex. The amount of protein obtained varied from 0.5 to 15 mg. Eight of the proteins (L9, L11, L13, L21, L22, L35', L37 and L39) had no detectable contamination; the impurities in the others were no greater than 9%. The molecular weight of the proteins was estimated by polyacrylamide gel electrophoresis in sodium dodecyl sulfate; the amino acid composition was determined.

P. L. Kulwal

Indian Academy of Sciences (India)

Home; Journals; Journal of Genetics. P. L. Kulwal. Articles written in Journal of Genetics. Volume 90 Issue 1 April 2011 pp 59-66 Research Article. Mapping of shoot fly tolerance loci in sorghum using SSR markers · D. B. Apotikar D. Venkateswarlu R. B. Ghorade R. M. Wadaskar J. V. Patil P. L. Kulwal · More Details Abstract ...

Dynamics of Li+ ions in Li2O-TeO2-P2O5 glasses

Science.gov (United States)

Chatterjee, A.; Ghosh, A.

2018-04-01

In the present work we have studied transport properties of lithium ions in 0.3Li2O-0.7[xTeO2-(1-x)P2O5] glasses, where x=0.5, 0.6, 0.7. We have measured acconductivity for a wide range offrequency and temperature. The real part of the conductivity spectra has been analyzed by the power law in Almond-West formalism. The dc conductivity has been obtained from the complex impedance plots. We have found that dc conductivity increases and activation energy decreases on increase of TeO2 for a particular Li2O content. We have also found that the dc conductivity and crossover frequency obey Arrhenius relation. The time temperature superposition has been verified using the scaling formalism of the conductivity spectra. We have found that the conductivity isotherms scaled to a single master curve with suitable scaling parameters for a particular composition at different temperatures. However the scaling to a single master curve fails for different compositions at a particular temperature.

Preparation and characterization of three 7Be targets for the measurement of the 7Be(n, p)7Li and 7Be(n, α)7Li reaction cross sections

Science.gov (United States)

Maugeri, E. A.; Heinitz, S.; Dressler, R.; Barbagallo, M.; Ulrich, J.; Schumann, D.; Colonna, N.; Köster, U.; Ayranov, M.; Vontobel, P.; Mastromarco, M.; Schell, J.; Correia, J. Martins; Stora, T.; n TOF Collaboration

2018-05-01

This manuscript describes the production of three targets obtained by implantation of different activities of 7Be into thin aluminium disks. Two of the produced targets were used to measure the 7Be(n, p)7Li cross section in the energy range of interest for the Big-Bang Nucleosynthesis. A third target was used to measure the cross sections of 7Be(n, p)7Li and 7Be(n, α)7Li nuclear reactions with cold and thermal neutrons, respectively. This paper describes also the characterization of the first two targets, performed after the neutron irradiation, in terms of implanted 7Be activities and spatial distributions.

Measurement of {sup 232}Th(n, 5nγ) cross sections from 29 MeV to 42 MeV

Energy Technology Data Exchange (ETDEWEB)

Kerveno, M.; Baumann, P.; Dessagne, P.; Rudolf, G. [Universite de Strasbourg, IPHC, Strasbourg (France); CNRS, UMR7178, Strasbourg (France); Nolte, R.; Reginatto, M. [Physikalisch-Technische Bundesanstalt, Braunschweig (Germany); Jericha, E. [Technische Universitaet Wien, Atominstitut, Wien (Austria); Jokic, S.; Lukic, S. [Vinca Institute of Nuclear Sciences, Belgrade (Serbia); Koning, A.J. [Nuclear Research and Consultancy Group, Petten (Netherlands); Meulders, J.P. [Institut de Physique Nucleaire, Louvain-la-Neuve (Belgium); Nachab, A. [Universite Cadi Ayyad, Departement de physique, Faculte Poly-disciplinaire de Safi, Safi (Morocco); Pavlik, A. [Faculty of Physics, University of Vienna, Wien (Austria)

2014-10-15

The excitation function of the reaction {sup 232} Th(n, 5nγ){sup 228} Th from 29 to 42 MeV has been measured for the first time at the quasi-monoenergetic neutron beam of the UCL cyclotron CYCLONE employing the {sup 7}Li(p,n) source reaction. Taking advantage of the good energy resolution of the planar High-Purity Germanium (HPGe) detectors, prompt γ-ray spectroscopy was used to detect the γ-rays resulting from the decay of excited states of nuclei created by the (n,xn) reactions. The neutron beam was characterized by a combination of time of flight measurements carried out using a liquid scintillation detector and a {sup 238}U fission ionization chamber. Fluence measurements were performed using a proton recoil telescope. The results are compared with TALYS-1.4 code calculations. (orig.)

Dicty_cDB: SLE232 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SL (Link to library) SLE232 (Link to dictyBase) - - - Contig-U16255-1 SLE232F (Link... to Original site) SLE232F 614 - - - - - - Show SLE232 Library SL (Link to library) Clone ID SLE232 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...PSSGFTDFIPSNATCSSLNCNAQQMSCKYVQQACHETSCCPDIPQC QIPATGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSST ...CHETSCCPDIPQC QIPATGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSST TGSHTTTGGSTTGSHTTTGGSTTGSHTTTGGSA

Research News

Science.gov (United States)

... Research News Share this page Facebook Twitter Email Research News Research News Quarterly Updates Research Call Archive ... Clinical Trials in MS Learn More Become a Research Champion An MS Research Revolution Support MS Research ...

Analysing the development of TV news programmes: from information to dramatization

Directory of Open Access Journals (Sweden)

Maribel Rodríguez Fidalgo, Ph.D.

2010-01-01

Full Text Available Abstract: The TV news programme is the backbone of all television networks, be they national, regional or local. These types of programmes have been changing over the time. The essence of the information is being modified and has adopted a new format. Based on these principles, this research analyses the evolution of the language used on the Spanish TV news programmes, from their origins until today. This research has been carried out in three different phases: late 1980s, the 1990s and recent years. These stages were thoroughly examined through surveys applied to representative samples of the population. The results showed that TV news programmes have been acquiring a changing narrative style throughout time: they began using an “objective” narrative, followed by a mediated type, and finally dramatized narrative which uses shocking visual content and aims to achieve audience’s sensibilization and identification with news’ protagonists. The spectacularization of information has become the identitary feature of the current TV news programmes as a response to the need of reaching higher audience ratings.

Chrono-potentiometry in molten chlorides. Application to the study of the electrochemical properties of uranium and plutonium in the LiCl-KCl eutectic; Chronopotentiometrie dans les chlorures fondus. Application a l'etude des proprietes electrochimiques de l'uranium et du plutonium dans l'eutectique LiCl-KCl

Energy Technology Data Exchange (ETDEWEB)

Leseur, A. [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

1969-05-01

Using solutions of cadmium chloride in the eutectic LiCl-KCl, a chrono-potentiometric method has been developed with a view to its application to the study of molten solutions. Particular attention has been paid to the choice of the indicator electrodes. The method makes it possible to analyze molten solutions quantitatively and to determine diffusion coefficients and their activation energies; it yields furthermore information about the nature and the behaviour of ionic species in solution. The method has been applied to the study of solutions of uranium and plutonium chloride in the eutectic LiCl-KCl. Linear chrono-amperometry has been used for studying these solutions quantitatively, but chrono-potentiometry, of which the theory is better developed, is better suited to a quantitative study. The results obtained have made it possible to determine the diffusion coefficients of the ions Cd{sup 2+}, U{sup 3+}, U{sup 4+} and U(IV) in the presence of F{sup -} and Pu{sup 3+} ions, as well as the activation energy of the diffusion coefficients. (author) [French] La mise au point de la chronopotentiometrie comme moyen d'etude des solutions fondues a ete effectuee avec des solutions de chlorure de cadmium dans l'eutectique LiCl-KCl. Le probleme du choix des electrodes indicatrices a ete particulierement etudie. La methode permet l'analyse quantitative des solutions fondues ainsi que la determination des coefficients de diffusion et de leurs energies d'activation: elle donne en outre des renseignements sur la nature et le comportement des especes ioniques en solution. Elle a ete appliquee a l'etude des solutions des chlorures d'uranium et de plutonium dans l'eutectique LiCl-KCl. La chronoamperometrie lineaire a ete utilisee pour l'etude qualitative de ces solutions, mais la chronopotentiometrie, dont la theorie est plus complete, convient mieux pour l'etude quantitative. Les resultats obtenus ont permis de determiner les

Demystifying LiDAR technologies for temperate rainforest in the Pacific Northwest

Science.gov (United States)

Rhonda Mazza; Demetrios Gatziolis

2013-01-01

Light detection and ranging (LiDAR), also known as airborne laser scanning, is a rapidly emerging technology for remote sensing. Used to help map, monitor, and assess natural resources, LiDAR data were first embraced by forestry professionals in Scandinavia as a tool for conducting forest inventories in the mid to late 1990s. Thus early LiDAR theory and applications...

Isolation of eukaryotic ribosomal proteins. Purification and characterization of 60 S ribosomal subunit proteins L3, L6, L7', L8, L10, L15, L17, L18, L19, L23', L25, L27', L28, L29, L31, L32, L34, L35, L36, L36', and L37'.

Science.gov (United States)

Tsurugi, K; Collatz, E; Todokoro, K; Wool, I G

1977-06-10

The proteins of the large subunit of rat liver ribosomes were separated into seven groups by stepwise elution from carboxymethylcellulose with LiCl at pH 6.5. Twenty-one proteins (L3, L6, L7', L8, L10, L15, L17, L18, L19, L23', L25, L27', L28, L29, L31, L32, L34, L35, L36, L36', and L37') were isolated from three groups (C60, E60, and F60) by ion exchange chromatography on carboxymethycellulose and by filtration through Sephadex. The amount of protein obtained varied from 0.3 to 25 mg. Nine of the proteins (L6, L8, L18, L27', L28, L29, L34, L36, and L36') had no detectable contamination: the impurities in the others were no greater than 9%. The molecular weight of the proteins was estimated by polyacrylamide gel electrophoresis in sodium dodecyl sulfate; the amino acid composition was determined.

Atomic scattering in the diffraction limit: electron transfer in keV Li+-Na(3s, 3p) collisions

DEFF Research Database (Denmark)

Poel, Mike van der; Nielsen, C.V.; Rybaltover, M.

2002-01-01

We measure angle differential cross sections (DCS) in Li+ + Na --> Li + Na+ electron transfer collisions in the 2.7-24 keV energy range. We do this with a newly constructed apparatus which combines the experimental technique of cold target recoil ion momentum spectroscopy with a laser-cooled target...... of the de Broglie wavelength lambda(dB) = 150 fm at a velocity v = 0.20 au and the effective atomic diameter for electron capture 2R = 20 au. Parallel AO and MO semiclassical coupled-channel calculations of the Na(3s, 3p) --> Li(2s, 2p) state-to-state collision amplitudes have been performed, and quantum...

The enigmas of The grail. on The ConTroversy over The UniTy of Li Contes deL GraaL of ChréTien de Troyes

Directory of Open Access Journals (Sweden)

Victoria Cirlot

2014-12-01

Full Text Available This paper presents a review of the controversy about the unity of the last roman of Chrétien de Troyes, Li Contes del Graal which took place in the late fifties between Martí de Riquer, Jean Frappier and Erich Köhler. More than fifty years later, this paper will appraise the contributions that this controversy made to Romance philology, and, in particular, to the assessment of the last work of the Champenian writer.

Determination of kinetic parameters in Tl dosemeters of LiF: Mg, Cu, P + PTFE developed in the ININ

International Nuclear Information System (INIS)

Basurto G, B.S.

2002-01-01

The objective of this work, is the one of determining the kinetic parameters of the dosemeter of LiF: Mg, Cu, P + Ptfe; starting from the curves Tl obtained at being irradiated with alpha radiation (α), beta (β) and gamma (γ). As like to compare its sensitivity with each radiation type, considering the sensitivity of the TLD-100 as the unit. In the Chapter 1, the fundamental structure of the matter is described, making emphasis in the different radiation types, and their interaction with this. In the Chapter 2, the units are described but used in the dosimetry of the radiation. In the Chapter 3, the basic concepts of the phenomenon of Tl are described and those are explained characteristic of the deconvolution method to determine the kinetics of the one phenomenon. In the Chapter 4, the methodology is detailed that was used in the elaboration of this thesis work, describing the material Tl that were considered like reference, as well as the sources of ionizing radiation, with those that the dosemeters were irradiated and the equipment in the one that the curves Tl was obtained. Reference is made to the software used to carry out the deconvolution of the curves Tl that were obtained in the one experimental development. In the Chapter 5, the obtained results of this study are presented, showing the tables of homogenization of dosemeters and the reading of the same one; they are observed the curves Tl obtained to different radiation doses (alpha, beta and gamma), the intensity Tl in function of the dose. Also they are tabulated, the obtained results in the kinetic parameters of the three different study materials (TLD-100H, USA; TLD-100, USA and LiF: Mg, Cu, P + Ptfe developed in the l.N.l.N). They are analyzed shortly for each material Tl their sensitivity to the ionizing radiation as well as their kinetic parameters. The obtained results showed that the Tl dosemeters of LiF: Mg,Cu,P + Ptfe, they presented a bigger sensitivity that the TLD-100 when being

Thermoluminescent characteristics of LiF:Mg, Cu, P and CaSO_4:Dy for low dose measurement

International Nuclear Information System (INIS)

Del Sol Fernández, S.; García-Salcedo, R.; Mendoza, J. Guzmán; Sánchez-Guzmán, D.; Rodríguez, G. Ramírez; Gaona, E.; Montalvo, T. Rivera

2016-01-01

Thermoluminescence (TL) characteristics for LiF:Mg, Cu, P, and CaSO_4:Dy under the homogeneous field of X-ray beams of diagnostic irradiation and its verification using thermoluminescence dosimetry are presented. The irradiation were performed utilizing a conventional X-ray equipment installed at the Hospital Juárez Norte of México. Different thermoluminescence characteristics of two material were studied, such as batch homogeneity, glow curve, linearity, detection threshold, reproducibility, relative sensitivity and fading. Materials were calibrated in terms of absorbed dose to the standard calibration distance and they were positioned in a generic phantom. The dose analysis, verification and comparison with the measurements obtained by the TLD-100 were performed. Results indicate that the dosimetric peak appears at 202 °C and 277.5 °C for LiF:Mg, Cu, P and CaSO_4:Dy, respectively. TL response as a function of X-ray dose showed a linearity behavior in the very low dose range for all materials. However, the TLD-100 is not accurate for measurements below 4 mGy. CaSO_4:Dy is 80% more sensitive than TLD-100 and it show the lowest detection threshold, whereas LiF:Mg, Cu, P is 60% more sensitive than TLD-100. All materials showed very good repeatability. Fading for a period of one month at room temperature showed low fading LiF:Mg, Cu, P, medium and high for TLD-100 and CaSO_4:Dy. The results suggest that CaSO_4:Dy and LiF:Mg, Cu, P are suitable for measurements at low doses used in radiodiagnostic. - Highlights: • Several dosimetric characteristics were evaluated. • TL dose response to very low dose X-rays was studied. • The applications proposed for each material may be useful for diagnostic radiology dosimetry.

Partial diagenetic overprint of late jurassic belemnites from New Zealand

DEFF Research Database (Denmark)

Ullmann, Clemens Vinzenz; Campbell, Hamish J.; Frei, Robert

2013-01-01

δ7Li values become more positive with progressive alteration. The direction and magnitude of the trends in the geochemical record indicate that one main phase of alteration that occurred in the Late Cretaceous caused most of the diagenetic signature in the calcite. Despite relatively deep burial......The preservation potential and trends of alteration of many isotopic systems (e.g. Li, Mg, Ca) that are measured in fossil carbonates are little explored, yet extensive paleoenvironmental interpretations have been made on the basis of these records. Here we present a geochemical dataset for a Late...... Jurassic (~153 Ma) belemnite (Belemnopsis sp.) from New Zealand that has been partially overprinted by alteration. We report the physical pathways and settings of alteration, the resulting elemental and isotopic trends including δ7Li values and Li/Ca ratios, and assess whether remnants of the primary shell...

Good News in Bad News: How Negativity Enhances Economic Efficacy

OpenAIRE

Svensson, H.M.; Albæk, E.; van Dalen, A.; de Vreese, C.

2017-01-01

Negativity is a news ideology, and its negative effects on attitude formation are widely documented. Contrary to this view, the present study demonstrates that negative economic news can in fact be good news. Based on a two-wave national panel survey and a media content analysis, we show that individual exposure to negative economic news enhances internal economic efficacy, a sense of competence in and understanding of the economy. This is good news as internal economic efficacy may facilitat...

Identification of a rare de novo three-way complex t(5;20;8(q31;p11.2;p21 with microdeletions on 5q31.2, 5q31.3, and 8p23.2 in a patient with hearing loss and global developmental delay: case report

Directory of Open Access Journals (Sweden)

Bejjani Bassem A

2009-01-01

Full Text Available Abstract Background Complex chromosome rearrangements (CCRs, which involve more than two breakpoints on two or more chromosomes, are uncommon occurrences. Although most CCRs appear balanced at the level of the light microscope, many demonstrate cryptic, submicroscopic imbalances at the translocation breakpoints. Results We report a female with hearing loss and global developmental delay with a complex three-way unbalanced translocation (5;20;8(q31;p11.2;p21 resulting in microdeletions on 5q31.2, 5q31.3, and 8p23.2 identified by karyotyping, microarray analysis and fluorescence in situ hybridization. Discussion The microdeletion of bands 8p23.2 may be associated with the hearing impairment. Furthermore, the characterization of this patient's chromosomal abnormalities demonstrates the importance of integrated technologies within contemporary cytogenetics laboratories.

The late endosome/lysosome-anchored p18-mTORC1 pathway controls terminal maturation of lysosomes

Energy Technology Data Exchange (ETDEWEB)

Takahashi, Yusuke; Nada, Shigeyuki; Mori, Shunsuke; Soma-Nagae, Taeko; Oneyama, Chitose [Department of Oncogene Research, Research Institute for Microbial Diseases, Osaka University, 3-1 Yamadaoka, Suita, Osaka 565-0871 (Japan); Okada, Masato, E-mail: okadam@biken.osaka-u.ac.jp [Department of Oncogene Research, Research Institute for Microbial Diseases, Osaka University, 3-1 Yamadaoka, Suita, Osaka 565-0871 (Japan)

2012-01-27

Highlights: Black-Right-Pointing-Pointer p18 is a membrane adaptor that anchors mTORC1 to late endosomes/lysosomes. Black-Right-Pointing-Pointer We examine the role of the p18-mTORC1 pathway in lysosome biogenesis. Black-Right-Pointing-Pointer The loss of p18 causes accumulation of intact late endosomes by arresting lysosome maturation. Black-Right-Pointing-Pointer Inhibition of mTORC1 activity with rapamycin phenocopies the defects of p18 loss. Black-Right-Pointing-Pointer The p18-mTORC1 pathway plays crucial roles in the terminal maturation of lysosomes. -- Abstract: The late endosome/lysosome membrane adaptor p18 (or LAMTOR1) serves as an anchor for the mammalian target of rapamycin complex 1 (mTORC1) and is required for its activation on lysosomes. The loss of p18 causes severe defects in cell growth as well as endosome dynamics, including membrane protein transport and lysosome biogenesis. However, the mechanisms underlying these effects on lysosome biogenesis remain unknown. Here, we show that the p18-mTORC1 pathway is crucial for terminal maturation of lysosomes. The loss of p18 causes aberrant intracellular distribution and abnormal sizes of late endosomes/lysosomes and an accumulation of late endosome specific components, including Rab7, RagC, and LAMP1; this suggests that intact late endosomes accumulate in the absence of p18. These defects are phenocopied by inhibiting mTORC1 activity with rapamycin. Loss of p18 also suppresses the integration of late endosomes and lysosomes, resulting in the defective degradation of tracer proteins. These results suggest that the p18-mTORC1 pathway plays crucial roles in the late stages of lysosomal maturation, potentially in late endosome-lysosome fusion, which is required for processing of various macromolecules.

The late endosome/lysosome-anchored p18-mTORC1 pathway controls terminal maturation of lysosomes

International Nuclear Information System (INIS)

Takahashi, Yusuke; Nada, Shigeyuki; Mori, Shunsuke; Soma-Nagae, Taeko; Oneyama, Chitose; Okada, Masato

2012-01-01

Highlights: ► p18 is a membrane adaptor that anchors mTORC1 to late endosomes/lysosomes. ► We examine the role of the p18-mTORC1 pathway in lysosome biogenesis. ► The loss of p18 causes accumulation of intact late endosomes by arresting lysosome maturation. ► Inhibition of mTORC1 activity with rapamycin phenocopies the defects of p18 loss. ► The p18-mTORC1 pathway plays crucial roles in the terminal maturation of lysosomes. -- Abstract: The late endosome/lysosome membrane adaptor p18 (or LAMTOR1) serves as an anchor for the mammalian target of rapamycin complex 1 (mTORC1) and is required for its activation on lysosomes. The loss of p18 causes severe defects in cell growth as well as endosome dynamics, including membrane protein transport and lysosome biogenesis. However, the mechanisms underlying these effects on lysosome biogenesis remain unknown. Here, we show that the p18-mTORC1 pathway is crucial for terminal maturation of lysosomes. The loss of p18 causes aberrant intracellular distribution and abnormal sizes of late endosomes/lysosomes and an accumulation of late endosome specific components, including Rab7, RagC, and LAMP1; this suggests that intact late endosomes accumulate in the absence of p18. These defects are phenocopied by inhibiting mTORC1 activity with rapamycin. Loss of p18 also suppresses the integration of late endosomes and lysosomes, resulting in the defective degradation of tracer proteins. These results suggest that the p18-mTORC1 pathway plays crucial roles in the late stages of lysosomal maturation, potentially in late endosome–lysosome fusion, which is required for processing of various macromolecules.

Mass-yield distributions of fission products from 20, 32, and 45 MeV proton-induced fission of 232Th

Science.gov (United States)

Naik, H.; Goswami, A.; Kim, G. N.; Kim, K.; Suryanarayana, S. V.

2013-10-01

The yields of various fission products in the 19.6, 32.2, and 44.8 MeV proton-induced fission of 232Th have been determined by recoil catcher and an off-line γ-ray spectrometric technique using the BARC-TIFR Pelletron in India and MC-50 cyclotron in Korea. The mass-yield distributions were obtained from the fission product yield using the charge distribution corrections. The peak-to-valley (P/V) ratio of the present work and that of literature data for 232Th(p,f) and 238U(p,f) were obtained from the mass yield distribution. The present and the existing literature data for 232Th(p,f), 232Th(n,f), and 232Th( γ,f) at various energies were compared with those for 238U(p,f), 238U(n,f), and 238U( γ,f) to examine the probable nuclear structure effect. The role of Th-anomaly on the peak-to-valley ratio in proton-, neutron-, and photon-induced fission of 232Th was discussed with the similar data in 238U. On the other hand, the fine structure in the mass yield distributions of the fissioning systems at various excitation energies has been explained from the point of standard I and II asymmetric mode of fission besides the probable role of even-odd effect, A/ Z ratio, and fissility parameter.

L-Arginine deficiency causes airway hyperresponsiveness after the late asthmatic reaction

NARCIS (Netherlands)

Maarsingh, H.; Bossenga, B. E.; Bos, I. S. T.; Volders, H. H.; Zaagsma, J.; Meurs, H.

Peroxynitrite has been shown to be crucially involved in airway hyperresponsiveness (AHR) after the late asthmatic reaction (LAR). Peroxynitrite production may result from simultaneous synthesis of nitric oxide (NO) and superoxide by inducible NO-synthase (iNOS) at low L-arginine concentrations.

Voltammetry of uranyl chloride in the LiCl - KCl eutectic; Voltammetrie du chlorure d'uranyle dans l'eutectique LiCl - KC1

Energy Technology Data Exchange (ETDEWEB)

Fondanaiche, J C [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

1965-07-01

Spent UO{sub 2} - PuO{sub 2} fuels can be reprocessed in a molten salt media. Uranium dioxide can easily be dissolved as UO{sub 2}Cl{sub 2} in a molten salt bath using chlorine gas. A study of quantitative analysis of an uranyl chloride solution in the LiCl-KCl eutectic at 400 C has been performed here using voltammetry (a large area-graphite indicator electrode has been employed). The precision which is obtained is around 6 per cent for concentrations below 10{sup -2} M. Precision decreases slightly for more concentrated solutions. The study of polarization curves allowed to give a reduction mechanism for the UO{sub 2}{sup ++} ion. For dilute solutions, this reduction proceeds through the UO{sub 2}{sup +} ion. But interpretation of current-potential curves is made difficult by the dismutation reaction of the UO{sub 2} ion and by the fact that the surface of the indicator electrode is not renewed. (author) [French] Le traitement des combustibles a base d'oxydes (UO{sub 2} - PUO{sub 2}) peut etre effectue au moyen des sels fondus. Le bioxyde d'uranium passe aisement en solution sous forme de UO{sub 2}Cl{sub 2} dans un bain de sels fondus par action du chlore. Nous avons etudie ici l'analyse quantitative d'une solution de chlorure d'uranyle dans l'eutectique LiCl - KCl a 400 C par voltammetrie (electrode indicatrice de graphite d'assez grande surface). La precision est d'environ 6 pour cent pour les concentrations inferieures a 10{sup -2} M; elle est legerement moins bonne pour les solutions plus concentrees. L'examen des courbes de polarisation a permis de donner un mecanisme de reduction de l'ion UO{sub 2}: pour les solutions diluees, cette reduction se fait par l'intermediaire de l'ion UO{sub 2}{sup +}. Mais l'interpretation des courbes intensite-potentiel est rendue delicate par la reaction de dismutation de l'ion UO{sub 2}{sup +} et par le fait que la surface de l'electrode indicatrice n'est pas renouvelee. (auteur)

46 CFR 232.4 - Balance sheet accounts.

Science.gov (United States)

2010-10-01

... 46 Shipping 8 2010-10-01 2010-10-01 false Balance sheet accounts. 232.4 Section 232.4 Shipping... ACTIVITIES UNIFORM FINANCIAL REPORTING REQUIREMENTS Balance Sheet § 232.4 Balance sheet accounts. (a.... (b) Purpose of balance sheet accounts. The balance sheet accounts are intended to disclose the...

27 CFR 20.232 - Reconsignment in transit.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Reconsignment in transit. 20.232 Section 20.232 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... and Disposition of Specially Denatured Spirits § 20.232 Reconsignment in transit. (a) Reconsignment...

Activity in Very Cool Stars: Magnetic Dissipation in Late M and L Dwarf Atmospheres

Science.gov (United States)

Mohanty, Subhanjoy; Basri, Gibor; Shu, Frank; Allard, France; Chabrier, Gilles

2002-05-01

Recent observations show that chromospheric Hα activity in late M and L dwarfs is much lower than in the earlier M types. This is particularly surprising given that the late M and L dwarfs are comparatively very rapid rotators: in the early M dwarfs, rapid rotation is associated with high activity levels. One possibility is that the drop-off in activity in the late M and L dwarfs is a result of very high electrical resistivities in their dense, cool, and predominantly neutral atmospheres.We calculate the magnetic field diffusivity in the atmospheres of objects with Teff in the range 3000-1500 K (mid M to late L) using the atmospheric structure models of Allard and Hauschildt. We find that the combination of very low ionization fraction and high density in these atmospheres results in very large resistivities and thus efficient field diffusion. While both ambipolar diffusion and Ohmic decay of currents due to ion-electron collisions occur, the primary diffusion effects are due to current decay through collisions of charged particles with neutrals. Moreover, the latter resistivity is a strong function of both effective temperature and optical depth, increasing rapidly as either Teff or optical depth decreases. This has two implications: (1) Any magnetic field present is increasingly decoupled from atmospheric fluid motions as one moves from mid M to L. In the late M and L dwarfs, atmospheric motions cannot lead to equilibrium field configurations very different from potential ones. That is, the magnitude of magnetic stresses generated by atmospheric motions is very small in these objects. We quantify this effect by a simple Reynolds number calculation. (2) Even if magnetic stresses are easily produced by fluid motions in the hot interior (where the coupling between field and matter is good), their propagation up through the atmosphere will be increasingly hampered by the growing atmospheric resistivity as one moves from mid M to late L. Thus both the generation and

Luminescence and excited state dynamics in Bi{sup 3+}-doped LiLaP{sub 4}O{sub 12} phosphates

Energy Technology Data Exchange (ETDEWEB)

Babin, V. [Institute of Physics AS CR, Cukrovarnicka 10, 16200 Prague (Czech Republic); Chernenko, K., E-mail: nuclearphys@yandex.ru [Institute of Physics, University of Tartu, Ravila 14c, 50411 Tartu (Estonia); Peter the Great Saint-Petersburg Polytechnic University, Polytekhnicheskaya 29, 195251 St.Petersburg (Russian Federation); Demchenko, P. [Ivan Franko National University of Lviv, Kyryla i Mefodiya 8a, 79005 Lviv (Ukraine); Mihokova, E.; Nikl, M. [Institute of Physics AS CR, Cukrovarnicka 10, 16200 Prague (Czech Republic); Pashuk, I. [Ivan Franko National University of Lviv, Kyryla i Mefodiya 8a, 79005 Lviv (Ukraine); Shalapska, T. [Institute of Physics, University of Tartu, Ravila 14c, 50411 Tartu (Estonia); Voloshinovskii, A. [Ivan Franko National University of Lviv, Kyryla i Mefodiya 8a, 79005 Lviv (Ukraine); Zazubovich, S. [Institute of Physics, University of Tartu, Ravila 14c, 50411 Tartu (Estonia)

2016-08-15

Photo- and X-ray-excited luminescence characteristics of Bi-doped LiLaP{sub 4}O{sub 12} phosphates with different bismuth contents (from 1 to 25 at% in the melt) are investigated in the 4.2–300 K temperature range and compared with the characteristics of the undoped LiLaP{sub 4}O{sub 12} phosphate. The broad 2.95 eV emission band of LiLaP{sub 4}O{sub 12}:Bi excited around 5.4 eV is found to arise from the bismuth dopant. Relatively large FWHM and Stokes shift of the emission band and especially the data on the low-temperature decay kinetics of the 2.95 eV emission and its temperature dependence, indicating a very small spin-orbit splitting energy of the corresponding excited state, allow the conclusion that this emission arises from the radiative decay of the triplet state of an exciton localized around a Bi{sup 3+} ion. No spectral bands are observed, arising from the electron transitions between the energy levels of Bi{sup 3+} ions. Phenomenological model is proposed for the description of the excited state dynamics of the Bi{sup 3+}-related localized exciton in LiLaP{sub 4}O{sub 12}:Bi and the parameters of the triplet localized exciton state are determined. Keywords: Photoluminescence; Time-resolved spectroscopy; Excited states; Bi{sup 3+} centers; LiLaP{sub 4}O{sub 12}:Bi powders.

Electrochemical performances of LiMnPO4 synthesized from non-stoichiometric Li/Mn ratio.

Science.gov (United States)

Xiao, Jie; Chernova, Natasha A; Upreti, Shailesh; Chen, Xilin; Li, Zheng; Deng, Zhiqun; Choi, Daiwon; Xu, Wu; Nie, Zimin; Graff, Gordon L; Liu, Jun; Whittingham, M Stanley; Zhang, Ji-Guang

2011-10-28

In this paper, the influences of the lithium content in the starting materials on the final performances of as-prepared Li(x)MnPO(4) (x hereafter represents the starting Li content in the synthesis step which does not necessarily mean that Li(x)MnPO(4) is a single phase solid solution in this work.) are systematically investigated. It has been revealed that Mn(2)P(2)O(7) is the main impurity when Li Li(3)PO(4) begins to form once x > 1.0. The interactions between Mn(2)P(2)O(7) or Li(3)PO(4) impurities and LiMnPO(4) are studied in terms of the structural, electrochemical, and magnetic properties. At a slow rate of C/50, the reversible capacity of both Li(0.5)MnPO(4) and Li(0.8)MnPO(4) increases with cycling. This indicates a gradual activation of more sites to accommodate a reversible diffusion of Li(+) ions that may be related to the interaction between Mn(2)P(2)O(7) and LiMnPO(4) nanoparticles. Among all of the different compositions, Li(1.1)MnPO(4) exhibits the most stable cycling ability probably because of the existence of a trace amount of Li(3)PO(4) impurity that functions as a solid-state electrolyte on the surface. The magnetic properties and X-ray absorption spectroscopy (XAS) of the MnPO(4)·H(2)O precursor, pure and carbon-coated Li(x)MnPO(4) are also investigated to identify the key steps involved in preparing a high-performance LiMnPO(4). This journal is © the Owner Societies 2011

Production of 231Pa and 232U by irradiation of 230Th/232Th mixtures

International Nuclear Information System (INIS)

Kluge, E.; Lieser, K.H.

1981-01-01

The production of 231 Pa and of 232 U by irradiating a 230 Th/ 232 Th mixture (containing 12 mol per cent 230 Th) in form of ThO 2 at a thermal neutron flux of 6.9 x 10 13 cm -2 s -1 for 4 months was investigated. Pa, U and Th were separated and the chemical yields were determined. 2.6% of the 230 Th were transformed into 231 Pa and 0.13% into 232 U. These values are higher than those calculated for a thermal flux, but lower than those calculated for a flux ratio epithermal to thermal = 0.03. 231 Pa and 232 U were isolated in form of a protactinium solution and of U 3 O 8 with 94.9 and 89.1% chemical yields, respectively. Foreign activities were not detected. Thorium was recuperated and isolated as ThO 2 , with a chemical yield of 93.6%. (orig.)

Environmental 238U and 232Th concentration measurements in an area of high level natural background radiation at Palong, Johor, Malaysia.

Science.gov (United States)

Ramli, A Termizi; Hussein, A Wahab M A; Wood, A Khalik

2005-01-01

Concentrations of uranium-238 and thorium-232 in soil, water, grass, moss and oil-palm fruit samples collected from an area of high background radiation were determined using neutron activation analysis (NAA). U-238 concentration in soil ranged from 4.9 mg kg(-1) (58.8 Bq kg(-1)) to 40.4 mg kg(-1) (484.8 Bq kg(-1)), Th-232 concentration ranged from 14.9 mg kg(-1) (59.6 Bq kg(-1)) to 301.0 mg kg(-1) (1204 Bq kg(-1)). The concentration of U-238 in grass samples ranged from below the detection limit to 0.076 mg kg(-1) (912 mBq kg(-1)), and Th-232 ranged from 0.008 mg kg(-1) (32 mBq kg(-1)) to 0.343 mg kg(-1) (1.372 Bq kg(-1)). U-238 content in water samples ranged from 0.33 mg kg(-1) (4.0 Bq L(-1)) to 1.40 mg kg(-1) (16.8 Bq L(-1)), and Th-232 ranged from 0.19 mg kg(-1) (0.76 Bq L(-1)) to 0.66 mg kg(-1) (2.64 Bq L(-1)). It can be said that the concentrations of environmental U-238 and Th-232 in grass and water samples in the study area are insignificant. Mosses were found to be possible bio-radiological indicators due to their high absorption of the heavy radioelements from the environment.

Mn L{sub 2,3}-edge X-ray absorption spectroscopic studies on charge-discharge mechanism of Li{sub 2}MnO{sub 3}

Energy Technology Data Exchange (ETDEWEB)

Kubobuchi, Kei, E-mail: kubobuchi@nissan-arc.co.jp [NISSAN ARC Ltd., 1 Natsushima, Yokosuka 237-0061 (Japan); Institute of Industrial Science, The University of Tokyo, 4-6-1 Komaba, Meguro, Tokyo 153-8505, Japan. (Japan); Mogi, Masato; Imai, Hideto [NISSAN ARC Ltd., 1 Natsushima, Yokosuka 237-0061 (Japan); Ikeno, Hidekazu [Osaka Prefecture University, 1-2 Gakuen-cho, Naka-ku, Sakai, Osaka 599-8570 (Japan); Tanaka, Isao [Department of Materials Science and Engineering, Kyoto University, Yoshida-Honmachi, Sakyo-ku, Kyoto 606-8501 (Japan); Mizoguchi, Teruyasu, E-mail: teru@iis.u-tokyo.ac.jp [Institute of Industrial Science, The University of Tokyo, 4-6-1 Komaba, Meguro, Tokyo 153-8505, Japan. (Japan)

2014-02-03

The redox reaction of Mn in Li{sub 2}MnO{sub 3} was studied by X-ray absorption spectroscopy and ab initio multiplet calculation. Associated with the de-intercalation of Li-ion, small but clear spectral changes were observed in Mn-L{sub 2,3} X-ray absorption near edge structure (XANES). The systematic ab initio multiplet calculations of Mn-L{sub 2,3} XANES revealed that the spectral changes in the experiment could not simply be ascribed to the change of the valency from Mn{sup 4+} to Mn{sup 5+} but can be explained well by the changes of local atomic structures around Mn{sup 4+} due to the Li de-intercalation. Our results suggest that the electronic state of oxygen should change during charging in Li{sub 2}MnO{sub 3}.

BBC VERSUS EURO NEWS: DISCOURSE AND IDEOLOGY IN NEWS TRANSLATION

Directory of Open Access Journals (Sweden)

Hosseini, F.

2016-09-01

Full Text Available The present study aimed to compare discursive strategies employed by two international news agencies including Euro News and BBC. Van Dijk’s (2004 model of CDA was adopted. Thirty pieces of news about internal affairs of Iran together with their Persian translations were downloaded from the corresponding website, i.e. 30 pieces of English news and their corresponding Persian translations from the Euro News website and 30 pieces of English news with their corresponding translations from the BBC website. The frequency of lexical items was observed to not differ significantly. Two sets of translations were compared to their source texts based on four discursive strategies of hyperbole, polarization, vagueness and euphemism. An independent-samples t-test was conducted to compare the frequency of strategies applied by the two news agencies. Results revealed no significant difference between the two agencies except for the discursive strategy of vagueness.

Images of climate change in the news: Visual framing of a global environmental issue

Science.gov (United States)

Rebich Hespanha, S.; Rice, R. E.; Montello, D. R.; Retzloff, S.; Tien, S.

2012-12-01

News media play a powerful role in disseminating and framing information and shaping public opinion on environmental issues. Choices of text and images that are made by the creators and distributors of news media not only influence public perception about which issues are important, but also surreptitiously lead consumers of these media to perceive certain aspects or perspectives on an issue while neglecting to consider others. Our research was motivated by a desire to obtain comprehensive quantitative and qualitative understanding of the types of information - both textual and visual -- that have been provided to the U.S. public over the past several decades through news reports about climate change. As part of this project, we documented and examined 118 themes in 19 categories presented in 350 randomly-selected visual images from U.S. news coverage of global climate change between 1969 and late 2009. This study examines how the use of imagery in print news positions climate change within public and private arenas and how it emphasizes particular geographic, political, scientific, technological, sociological, and ideological aspects of the issue.

7 CFR 23.2 - Administration.

Science.gov (United States)

2010-01-01

... 7 Agriculture 1 2010-01-01 2010-01-01 false Administration. 23.2 Section 23.2 Agriculture Office... Administration. (a) Title V will be administered by the Administrators of the Extension Service and the... Act of 1914 and the Hatch Act (as amended), August 11, 1955, the administration of the programs shall...

Cost-based optimizations of power density and target-blanket modularity for 232Th/233U-based ADEP

International Nuclear Information System (INIS)

Krakowski, R.A.

1995-01-01

A cost-based parametric systems model is developed for an Accelerator-Driven Energy Production (ADEP) system based on a 232 Th/ 233 U fuel cycle and a molten-salt (LiF/BeF 2 /ThF 3 ) fluid-fuel primary system. Simplified neutron-balance, accelerator, reactor-core, chemical-processing, and balance-of-plant models are combined parametrically with a simplified costing model. The main focus of this model is to examine trade offs related to fission power density, reactor-core modularity, 233 U breeding rate, and fission product transmutation capacity

Effect of symbiotic compound Fe{sub 2}P{sub 2}O{sub 7} on electrochemical performance of LiFePO{sub 4}/C cathode materials

Energy Technology Data Exchange (ETDEWEB)

Liu, Shuxin, E-mail: liushuxin88@126.com [School of Chemistry and Chemical Engineering, Mianyang Normal University, Mianyang, Sichuan 621000 (China); Gu, Chunlei [School of Chemical and Pharmaceutical Engineering, Hebei University of Science and Technology, Shijiazhuang, Hebei 050018 (China); Wang, Haibin [School of Chemistry and Chemical Engineering, Mianyang Normal University, Mianyang, Sichuan 621000 (China); Liu, Ruijiang [School of Pharmacy, Jiangsu University, Zhenjiang, Jiangsu 212013 (China); Wang, Hong; He, Jichuan [School of Chemistry and Chemical Engineering, Mianyang Normal University, Mianyang, Sichuan 621000 (China)

2015-10-15

In order to study the effect of symbiotic compound Fe{sub 2}P{sub 2}O{sub 7} on electrochemical performance of LiFePO{sub 4}/C cathode materials, the LiFePO{sub 4}/Fe{sub 2}P{sub 2}O{sub 7}/C cathode materials were synthesized by in-situ synthesis method. The phase compositions and microstructures of the products were characterized by X-ray powder diffraction (XRD) and field emission scanning electron microscope (FESEM). Results indicate that the existence of Fe{sub 2}P{sub 2}O{sub 7} does not alter LiFePO{sub 4} crystal structure and the existence of Fe{sub 2}P{sub 2}O{sub 7} decreases the particles size of LiFePO{sub 4}. The electrochemical behavior of cathode materials was analyzed using galvanostatic measurement and cyclic voltammetry (CV). The results show that the existence of Fe{sub 2}P{sub 2}O{sub 7} improves electrochemical performance of LiFePO{sub 4} cathode materials in specific capability and lithium ion diffusion rate. The charge–discharge specific capacity and apparent lithium ion diffusion coefficient increase with Fe{sub 2}P{sub 2}O{sub 7} content and maximizes around the Fe{sub 2}P{sub 2}O{sub 7} content is 5 wt%. It has been had further proved that the Fe{sub 2}P{sub 2}O{sub 7} adding enhances the lithium ion transport to improve the electrochemical performance of LiFePO{sub 4} cathode materials. However, excessive Fe{sub 2}P{sub 2}O{sub 7} will block the electron transfer pathway and affect the electrochemical performances of LiFePO{sub 4} directly. - Graphical abstract: The LiFePO{sub 4}/Fe{sub 2}P{sub 2}O{sub 7}/C cathode materials were synthesized by in-situ synthesis method. The existence of Fe{sub 2}P{sub 2}O{sub 7} does not alter LiFePO{sub 4} crystal structure and the existence of Fe{sub 2}P{sub 2}O{sub 7} decreases the particles size of LiFePO{sub 4}. The charge–discharge specific capacity and apparent lithium ion diffusion coefficient increase with Fe{sub 2}P{sub 2}O{sub 7} content. However, excessive Fe{sub 2}P{sub 2}O{sub 7} will

Brain perfusion image using N-isopropyl-p-[123I] iodoamphetamine

International Nuclear Information System (INIS)

Matsuda, Hiroshi; Seki, Hiroyasu; Ishida, Hiroko

1984-01-01

In brain perfusion images using N-Isopropyl-p-[ 123 I] Iodoamphetamine and rotating gamma camera emission computed tomography, brain maps showing laterality indices (LI) were made for the purpose of detecting ineterhemispheric differences. Left (L) and right (R) leteral images were made by adding sagittal section images in each hemisphere, respectively. LI was calculated as follows. LI=100(1+(R-L)/(R+L)). The normal ranges (mean+-2 s.d.) of the indices determined by those obtained in five normal right-handed subjects were 103+-4 and 103+-10 for brain mean and each pixel, respectively. Out of 25 measurements in 22 righthanded patients with cerebrovascular accidents, brain mean LI beyond the normal limits and areas showing abnormal regional LI were observed in 5 (20%) and 21 (84%) measurements, respectively. On the other hand, X-ray CT showed low density areas in only 12 (48%). These brain maps were clinically useful for detecting and quantifying interhemispheric differences in brain perfusion images with N-Isopropyl-p-[ 123 I] Iodoamphetamine. (author)

The emission spectrum of the Li(2p)He{sub 2}:1{sup 2}{pi}{sub u} exciplex

Energy Technology Data Exchange (ETDEWEB)

Lehner, M; Xu, R; Jungen, M [Institut fuer Physikalische Chemie, Universitaet Basel, Klingelbergstrasse 80, CH-4056 Basel (Switzerland)

2005-04-28

In order to understand the line broadening of the 2p {yields} 2s transition of Li atoms in He gas as a function of pressure and temperature we have calculated the emission spectra of LiHe and LiHe{sub 2} based on quantum chemically computed potential energy surfaces and transition moment functions. A full quantum treatment of the red wing is compared with the results of simplified methods (e.g., the quasistatic theory) and with recent experiments.

Contribution to the radio crystallographic study of the effect of neutrons on LiF monocrystals (1962); Contribution a l'etude radiocristallographique de l'effet des neutrons sur les monocristaux de LiF (1962)

Energy Technology Data Exchange (ETDEWEB)

Dubois, M; Tournarie, M [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1962-07-01

We have studied the changes in the 200 and 400 reflections in LiF monocrystals irradiated by neutrons, for doses of between 10{sup 17} and 10{sup 18} n/cm{sup 2}. The reflections are distinctly dissymmetric and in the case of doses under 5.10{sup 17} appear to consist of a fine peak associated with a wide and diffuse base. These appear to exist organised groups of point defects which lead to perturbed zones whose number varies very little with the irradiation and which exist perhaps beforehand. (authors) [French] Nous avons etudie l'evolution des reflexions 200 et 400 de monocristaux de LiF irradie aux neutrons pour des doses variant de 10{sup 17} a 10{sup 18} n/cm{sup 2}. Les reflexions presentent une nette dissymetrie et pour des doses inferieures a 5.10{sup 17} semblent constituees d'un pic fin associe a une base large et diffuse. Il semble qu'il y ait des rassemblements organises de defauts ponctuels pour donner des zones perturbees dans le nombre varierait peu avec l'irradiation et lui serait peut-etre preexistant. (auteurs)

Selenoprotein P Inhibits Radiation-Induced Late Reactive Oxygen Species Accumulation and Normal Cell Injury

Energy Technology Data Exchange (ETDEWEB)

Eckers, Jaimee C.; Kalen, Amanda L.; Xiao, Wusheng; Sarsour, Ehab H.; Goswami, Prabhat C., E-mail: prabhat-goswami@uiowa.edu

2013-11-01

Purpose: Radiation is a common mode of cancer therapy whose outcome is often limited because of normal tissue toxicity. We have shown previously that the accumulation of radiation-induced late reactive oxygen species (ROS) precedes cell death, suggesting that metabolic oxidative stress could regulate cellular radiation response. The purpose of this study was to investigate whether selenoprotein P (SEPP1), a major supplier of selenium to tissues and an antioxidant, regulates late ROS accumulation and toxicity in irradiated normal human fibroblasts (NHFs). Methods and Materials: Flow cytometry analysis of cell viability, cell cycle phase distribution, and dihydroethidium oxidation, along with clonogenic assays, were used to measure oxidative stress and toxicity. Human antioxidant mechanisms array and quantitative real-time polymerase chain reaction assays were used to measure gene expression during late ROS accumulation in irradiated NHFs. Sodium selenite addition and SEPP1 overexpression were used to determine the causality of SEPP1 regulating late ROS accumulation and toxicity in irradiated NHFs. Results: Irradiated NHFs showed late ROS accumulation (4.5-fold increase from control; P<.05) that occurs after activation of the cell cycle checkpoint pathways and precedes cell death. The mRNA levels of CuZn- and Mn-superoxide dismutase, catalase, peroxiredoxin 3, and thioredoxin reductase 1 increased approximately 2- to 3-fold, whereas mRNA levels of cold shock domain containing E1 and SEPP1 increased more than 6-fold (P<.05). The addition of sodium selenite before the radiation treatment suppressed toxicity (45%; P<.05). SEPP1 overexpression suppressed radiation-induced late ROS accumulation (35%; P<.05) and protected NHFs from radiation-induced toxicity (58%; P<.05). Conclusion: SEPP1 mitigates radiation-induced late ROS accumulation and normal cell injury.

Lithium Superionic Conductor Li{sub 9.42}Si{sub 1.02}P{sub 2.1}S{sub 9.96}O{sub 2.04} with Li{sub 10}GeP{sub 2}S{sub 12}-Type Structure in the Li{sub 2}S–P{sub 2}S{sub 5}–SiO{sub 2} Pseudoternary System: Synthesis, Electrochemical Properties, and Structure–Composition Relationships

Energy Technology Data Exchange (ETDEWEB)

Hori, Satoshi [Department of Electronic Chemistry, Interdisciplinary Graduate School of Science and Engineering, Tokyo Institute of Technology, Yokohama (Japan); Suzuki, Kota; Hirayama, Masaaki [Department of Electronic Chemistry, Interdisciplinary Graduate School of Science and Engineering, Tokyo Institute of Technology, Yokohama (Japan); Department of Chemical Science and Engineering, School of Materials and Chemical Technology, Tokyo Institute of Technology, Yokohama (Japan); Kato, Yuki [Department of Electronic Chemistry, Interdisciplinary Graduate School of Science and Engineering, Tokyo Institute of Technology, Yokohama (Japan); Battery Research Division, Higashifuji Technical Center, Toyota Motor Corporation, Susono, Shizuoka (Japan); Battery AT, Advanced Technology 1, Toyota Motor Europe NV/SA, Zaventem (Belgium); Kanno, Ryoji, E-mail: kanno@echem.titech.ac.jp [Department of Electronic Chemistry, Interdisciplinary Graduate School of Science and Engineering, Tokyo Institute of Technology, Yokohama (Japan); Department of Chemical Science and Engineering, School of Materials and Chemical Technology, Tokyo Institute of Technology, Yokohama (Japan)

2016-12-07

Lithium superionic conductors with the Li{sub 10}GeP{sub 2}S{sub 12} (LGPS)-type structure are promising materials for use as solid electrolytes in the next-generation lithium batteries. A novel member of the LGPS family, Li{sub 9.42}Si{sub 1.02}P{sub 2.1}S{sub 9.96}O{sub 2.04} (LSiPSO), and its solid solutions were synthesized by quenching from 1273 K in the Li{sub 2}S–P{sub 2}S{sub 5}–SiO{sub 2} pseudoternary system. The material exhibited an ionic conductivity as high as 3.2 × 10{sup −4} S cm{sup −1} at 298 K, as well as the high electrochemical stability to lithium metal, which was improved by the introduction of oxygen into the LGPS-type structure. An all-solid-state cell with a lithium metal anode and LSiPSO as the separator showed excellent performance with a high reversibility of 100%. Thus, oxygen doping is an effective way of improving the electrochemical stability of LGPS-type structure.

Comparison of activity concentration of 238U, 232Th and 40K in different Layers of subsurface Structures in Dei-Dei and Kubwa, Abuja, northcentral Nigeria

International Nuclear Information System (INIS)

Maxwell, Omeje; Wagiran, Husin; Ibrahim, Noorddin; Lee, Siak Kuan; Sabri, Soheil

2013-01-01

The study of activity concentration of 232 Th, 238 U and 40 K of rock samples from site one (S1L1–S1L11, 70 m) and site two (S2L1–S2L9, 60 m) boreholes in Dei-Dei and Kubwa was presented and the first time in the region to be compared. Activity concentrations were analysed using a high resolution co-axial HPGe gamma ray spectrometer system. The activity concentration ranges in site one borehole were from 45±1 to 98±6 Bq kg −1 for 232 Th, from 18±2 to 37±4 Bq kg −1 for 238 U and from 254 ±32 Bq kg −1 to 1195 ±151 Bq kg −1 for 40 K. The activity concentration ranges in site two borehole were from 32±3 to 84±7 Bq kg −1 for 232 Th, from 15±2 to 52±5 Bq kg −1 for 238 U and from 119±15 to 705±94 for 40 K Bq kg −1 . Significantly higher concentration of 232 Th and 238 U occurs in samples collected from S1L7, S1L11 and S2L1 layers. These zones experienced granitic intrusions produced by denudation and tectonism. 40 K in rock samples of S1L4 and S2L4 activity concentrations is close; it could be that biotite granitic intrusion that is inferred as the formation in that layer reflects the same activity of potassium in rock's radioactivity measurement. The area requires further investigation of soil geochemistry and activity concentration of radionuclides in groundwater. - Highlights: • Activity concentration of 238 U, 232 Th and 40 K was noted high. • The two boreholes show significant different concentrations of 238 U, 232 Th and 40 K. • The Th/U ratio was high in both, but distinctly higher in first borehole. • 232 Th was increasing with depth in site one almost 100%. • The radiological monitoring on groundwater is recommended

Promotional role of Li4Ti5O12 as polysulfide adsorbent and fast Li+ conductor on electrochemical performances of sulfur cathode

Science.gov (United States)

Zeng, Tianbiao; Hu, Xuebu; Ji, Penghui; Shang, Biao; Peng, Qimeng; Zhang, Yaoyao; Song, Ruiqiang

2017-08-01

Lithium-sulfur (Li-S) batteries attract much attention due to its high specific capacity and energy density compared to lithium-ion batteries (LiBs). Herein, a novel composite named as (void/nano-Li4Ti5O12 pieces)@C [(v/n-L)@C] was designed and prepared as a sulfur host. Spinel Li4Ti5O12 here as a multifunctional additive played as polysulfide adsorbent agent and fast Li+ conductor, and carbon shell was designed as electronic conductor, as well as volume barrier to limit the volume expansion caused by sulfur. As-prepared (S/nano-Li4Ti5O12 pieces)@C [(S/n-L)@C] are core-shell spheres, which are about 200 nm in size. Nano-Li4Ti5O12 and sulfur were coated by the outer carbon shell with a thickness of about 20 nm. The experimental results show that electrochemical performances of (S/n-L)@C cathode were enhanced effectively compared to S@C cathode. At 0.5C and 1C, the discharge capacity of (S/n-L)@C was 33.5% and 40.1% higher than that of S@C at 500th cycle. Even at 2C, its capacity reached 600.9 mAh g-1 at 1000th cycle. Li+ conductivity of (S/n-L)@C was one order of magnitude higher than that of S@C, which was reach to 2.55 × 10-8 S cm-1. The experiment results indicate Li4Ti5O12 plays a promotional role on electrochemical performances of sulfur cathode, especially for stable cycling performance and high rate performance.

Compatibility of 316L stainless steel with the liquid alloy Pb17Li

International Nuclear Information System (INIS)

Broc, M.; Fauvet, P.; Flament, T.; Terlain, A.; Sannier, J.

1988-01-01

The behavior of 316L austenitic stainless steel in liquid eutectic lead alloy is investigated. The 316L is a possible structural material for fusion reactors. The obtained results are summarized and compared with other experimental data. The mechanisms which control the corrosion process are discussed. The investigation shows that whatever, the hydraulic flow, the corrosion of 316L stainless steel exposed to Pb17Li is characterized by the formation of a porous ferritic layer. The corrosion kinetics is mainly dependent on temperature, hydraulic flow and metallurgical state of the steel. At 400 0 C in turbulent flow, the corrosion rate at steady state of 316L solution annealed is estimated to 27 microns/year to which a depth of 25 microns has to be added to take into account the initial transient period. From overall available results, dissolution and solid state transformation in case of turbulent flow and diffusion in liquid phase for laminar flow, may be suggested

The Effects of Bad News and Good News on a Newspaper's Image.

Science.gov (United States)

Haskins, Jack B.; Miller, M. Mark

1984-01-01

Concludes that whether a newspaper carries mostly good news or mostly bad news affects the image of the paper, with bad news having negative effects and good news having positive effects on readers' perceptions of the newspaper. (FL)

Investigating people’s news diets: how online news users use offline news

NARCIS (Netherlands)

Trilling, D.; Schoenbach, K.

2015-01-01

The question how offline media use is related to online media use has been heavily debated in the last decades. If they are functionally equivalent, then advantages like low costs, rapid publication cycles, and easy access to online news could lead to them displacing offline news. Data from a

Implementation of news module for news client based on ApiCloud

OpenAIRE

Fu Xin; Liang Yu; Cao Sanxing; Gu Hongbo

2017-01-01

With the development of new media technology, news client has become the main battlefield of news browsing. Based on the ApiCloud hybrid development platform, this paper uses HTML, JavaScript and other technologies to develop the mobile client news module, and uses WAMP integrated development environment to build a news publishing system on the server side.

Characteristics of new LiF preparations and sensitised LiF

Energy Technology Data Exchange (ETDEWEB)

Driscoll, C M.H.; O' Hagan, J B; Mundy, S J; Todd, C D; McWhan, A F; Dodson, J

1986-01-01

The patent governing the preparation and production of lithium fluoride (LiF) awarded to the Harshaw Chemical Co. has expired. Other companies have become interested in developing additional preparations of this material. Two of these preparations include LiF:Mg,Ti manufactured by Vinten Instruments plc and high sensitivity LiF:Mg, Cu,P distributed by them. The properties of these materials, including sensitivity, dose threshold, photon energy response, reusability and storage characteristics, are presented in this paper and compared with those of Harshaw TLD-100 and with those of sensitised LiF.

Contamination level of natural 238U and 232Th radionuclides in offshore of coal power plant (assessment at offshore of Panjang Island and Lada Bay, Banten)

International Nuclear Information System (INIS)

Sabam Parsaoran Situmorang; Harpasis Selamet Sanusi; June Mellawati

2011-01-01

This study had been carried out by collecting sample of the surficial sediments, sea water, seaweeds, anchovies (Stolephorus and Anchoa) and mussels (Codakia) from 4 locations in waters of Pulau Panjang and coastal of Lada Bay (as control/comparison site), Banten in June - July 2010. Natural radionuclides (Th) concentration in samples was measured using neutron activation analysis (NAA) method. The results showed that the total radionuclides concentration in sediment ( 238 U: 18.6160 - 35.0013 Bq/kg; 232 Th: 11.2020 - 35.6685 Bq/kg), seawater ( 238 U: undetected; 232 Th: 0.0790 - 0.1299 Bq/l), cultivation seaweeds ( 238 U: undetected; 232 Th: 3.6735 - 4.8345 Bq/kg), natural seaweeds ( 238 U: 3.6851 - 48.0430 Bq/kg; 232 Th: 3.9941 - 9.0788 Bq/kg), Stolephorus ( 238 U: undetected; 232 Th: 3.3078 Bq/kg) and Codakia ( 238 U: 6.8903 Bq/kg; 232 Th: 3.6023 Bq/kg) in Pulau Panjang, Banten around Suralaya coal power plant higher than control site that were around the Labuan coal power plant, namely in sediments ( 238 U: 10.4253 Bq/kg; 232 Th: 16.5952 Bq/kg), seawater( 238 U: undetected; 232 Th: 0.0671 Bq/l), cultivation seaweeds ( 238 U: undetected; 232 Th: 2.3005 Bq/kg), natural seaweeds ( 238 U: 19.5367 Bq/kg; 232 Th: 2.6729 Bq/kg) and Anchoa ( 238 U: undetected; 232 Th: 2.0603 Bq/kg). (author)

Riigikokku pääseb läbi kolme sõela / Marko Suurmägi

Index Scriptorium Estoniae

Suurmägi, Marko, 1975-

2007-01-01

Kui iga erakonna üleriigilise nimekirja järjestus jääb samaks ka pärast valimisi, siis piirkondlik reastatakse pärast tulemuste selgumist saadud häälte arvu järgi ümber. Nii kerkib iga partei kõige rohkem hääli saanud liige esimeseks ja vähim toetust leidnud kandidaat viimaseks. Lisa: Võimalused. Isamaa ja Res Publica Liidu kandidaadi Helir-Valdor Seedri ja Rahvaliidu kandidaadi Jaak Alliku arvamus. Vt. samas lühiinter. valimistel osalevate erakondade esindajate Priit Toobali (Keskerakond), Meelis Atoneni (Reformierakond), Jaak Alliku (Rahvaliit), Helir-Valdor Seedri (Isamaa ja Res Publica Liit), Heiki Järveveeri (Sotsiaaldemokraatlik Erakond), Tanel Tammeti (Erakond Eestimaa Rohelised) ja Valentine Alvrega (Eesti Kristlikud Demokraadid)

The (2p, 2p) 11Δg state of 6Li2: Fourier transform spectrum of the 11Δg-B1IIu transition

International Nuclear Information System (INIS)

Linton, C.; Martin, F.; Crozet, P.; Ross, A.J.; Bacis, R.

1993-01-01

The 1 1 Δ g -B 1 II u transition of 6 Li 2 has been observed in collisionally induced fluorescence following single frequency optical-optical double resonance excitation of the F 1 Σ g + state using a ring dye laser with DCM dye. Spectra of the s and a symmetry levels were obtained separately, at high resolution, in the near-infrared region using a Fourier transform spectrometer. The molecular constants (Dunham coefficients) of the 1 1 Δ g state have been calculated. Comparison of the constants and dissociation energy with ab initio calculations has shown that the 1 1 Δ g state correlates with Li(2p) + Li(2p) and has a dissociation energy of 9,579 ± 1 cm -1 . The energy transfer process responsible for excitation of the 1 1 Δ g state is discussed

IVUS Findings in Late and Very Late Stent Thrombosis. A Comparison Between Bare-metal and Drug-eluting Stents.

Science.gov (United States)

Fuentes, Lara; Gómez-Lara, Josep; Salvatella, Neus; Gonzalo, Nieves; Hernández-Hernández, Felipe; Fernández-Nofrerias, Eduard; Sánchez-Recalde, Ángel; Alfonso, Fernando; Romaguera, Rafael; Ferreiro, José Luis; Roura, Gerard; Teruel, Luis; Gracida, Montserrat; Marcano, Ana Lucrecia; Gómez-Hospital, Joan-Antoni; Cequier, Ángel

2018-05-01

Stent thrombosis (ST) is a life-threatening complication after stent implantation. Intravascular ultrasound is able to discern most causes of ST. The aim of this study was to compare intravascular ultrasound findings between bare-metal stents (BMS) and drug-eluting stents (DES) in patients with late (31 days to 1 year) or very late ST (> 1 year). Of 250 consecutive patients with late or very late ST in 7 Spanish institutions, 114 patients (45.5% BMS and 54.5% DES) were imaged with intravascular ultrasound. Off-line intravascular ultrasound analysis was performed to assess malapposition, underexpansion, and neoatherosclerosis. The median time from stent implantation to ST was 4.0 years with BMS and 3.4 years with DES (P = .04). Isolated malapposition was similarly observed in both groups (36.5% vs 46.8%; P = .18) but was numerically lower with BMS (26.6% vs 48.0%; P = .07) in patients with very late ST. Isolated underexpansion was similarly observed in both groups (13.5% vs 11.3%; P = .47). Isolated neoatherosclerosis occurred only in patients with very late ST and was more prevalent with BMS (22.9%) than with DES (6.0%); P = .02. At 2.9 years' follow-up, there were 0% and 6.9% cardiac deaths, respectively (P = .06) and recurrent ST occurred in 4.0% and 5.2% of patients, respectively (P = .60). Malapposition was the most common finding in patients with late and very late ST and is more prevalent with DES in very late ST. In contrast, neoatherosclerosis was exclusively observed in patients with very late ST and mainly with BMS. Copyright © 2017 Sociedad Española de Cardiología. Published by Elsevier España, S.L.U. All rights reserved.

Implementation of news module for news client based on ApiCloud

Directory of Open Access Journals (Sweden)

Fu Xin

2017-01-01

Full Text Available With the development of new media technology, news client has become the main battlefield of news browsing. Based on the ApiCloud hybrid development platform, this paper uses HTML, JavaScript and other technologies to develop the mobile client news module, and uses WAMP integrated development environment to build a news publishing system on the server side.

Mass-yield distributions of fission products from 20, 32, and 45 MeV proton-induced fission of {sup 232}Th

Energy Technology Data Exchange (ETDEWEB)

Naik, H.; Goswami, A. [Bhabha Atomic Research Centre, Radiochemistry Division, Mumbai (India); Kim, G.N.; Kim, K. [Kyungpook National University, Department of Physics, Daegu (Korea, Republic of); Suryanarayana, S.V. [Bhabha Atomic Research Centre, Nuclear Physics Division, Mumbai (India)

2013-10-15

The yields of various fission products in the 19.6, 32.2, and 44.8 MeV proton-induced fission of {sup 232}Th have been determined by recoil catcher and an off-line {gamma}-ray spectrometric technique using the BARC-TIFR Pelletron in India and MC-50 cyclotron in Korea. The mass-yield distributions were obtained from the fission product yield using the charge distribution corrections. The peak-to-valley (P/V) ratio of the present work and that of literature data for {sup 232}Th(p,f) and {sup 238}U(p,f) were obtained from the mass yield distribution. The present and the existing literature data for {sup 232}Th(p,f), {sup 232}Th(n,f), and {sup 232}Th({gamma},f) at various energies were compared with those for {sup 238}U(p,f), {sup 238}U(n,f), and {sup 238}U({gamma},f) to examine the probable nuclear structure effect. The role of Th-anomaly on the peak-to-valley ratio in proton-, neutron-, and photon-induced fission of {sup 232}Th was discussed with the similar data in {sup 238}U. On the other hand, the fine structure in the mass yield distributions of the fissioning systems at various excitation energies has been explained from the point of standard I and II asymmetric mode of fission besides the probable role of even-odd effect, A/Z ratio, and fissility parameter. (orig.)

48 CFR 53.232 - Contract financing (SF 1443).

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contract financing (SF 1443). 53.232 Section 53.232 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS FORMS Prescription of Forms 53.232 Contract financing (SF 1443). SF 1443 (JUL...

46 CFR 232.6 - Financial report filing requirement.

Science.gov (United States)

2010-10-01

... RELATED ACTIVITIES UNIFORM FINANCIAL REPORTING REQUIREMENTS Income Statement § 232.6 Financial report filing requirement. (a) Reporting Frequency and Due Dates. The contractor shall file a semiannual... 46 Shipping 8 2010-10-01 2010-10-01 false Financial report filing requirement. 232.6 Section 232.6...

Science versus News: On the Cutting Edge

Science.gov (United States)

Kinney, A. L.; French, V.; Villard, R.; Maran, S. P.

1998-12-01

This session is to aid communication between scientists and journalists, to motivate astronomers to be active in communicating their science to the public via the press, and to help both astronomers and journalists to understand the constraints under which the other group is operating. The session consists of two talks of about 20 minutes, followed by a panel discussion. The first talk is "What Makes a Topic News?" This segment, by Miles O'Brien of CNN News, takes the AAS audiences behind the scenes in the world of producing science news stories. --- What drives selection of assignments? How does the science reporter convince their editor to cover a story? What factors about television producing help and also hurt getting science subjects across to the public? The second talk is "Public Knowledge on Science: The Growing Gap Between Scientists and the Taxpayer." This presentation by Jon Miller, a public opinion expert will emphasize the problems scientists and society, face in communicating to the public. --- What does the public know about science and scientific method? How much translation is required to communicate with the public to engage their interest without unacceptable compromise of scientific accuracy? The final segment is a panel of both science journalists and astronomers moderated by Steve Maran. Together they will tackle a question that gets to the heart of the Science-Vs-News controversies, "When Should Results Go Public?" Published too soon, science is called "hype"; Published too late, it is no longer "news." Should all results be peer reviewed first, and is that a satisfactory prerequisite? Do scientists take self-serving advantage of the public interest by making announcements before results appear in journals? How do we address the public desire to experience science unfolding and to see real-time data such as planetary science missions? The panelists are Dr. David Helfand, from Columbia University, Dr. Bruce Margon, from the University of

Pushed news: when the news comes to the cellphone

Directory of Open Access Journals (Sweden)

Antonio Fidalgo

2009-12-01

Full Text Available Combining two findings of recent surveys on the Internet which state that 1 “the Internet will soon surpass all other media as a main source for national and international news” and 2 “the mobile device will be the primary connection tool to the Internet in 2020” leads us to the conclusion that smartphones will soon be the primary source for news access. But if so, how will news come to the Internetconnected cellphones? In accordance with the distinction, already drawn in 1997, between push and pull technologies as two different forms of how content is delivered to the end users, cellphones are characterized as push devices (passive reception, in opposition to computers, classified as pull devices (active reception. The news items that fit cellphones are pushed news. And they will be pushed as SMS, e-mails, tweets and through news aggregators.

PUSHED NEWS: When the news comes to the cellphone

Directory of Open Access Journals (Sweden)

Antonio Fidalgo

2009-12-01

Full Text Available Combining two findings of recent surveys on the Internet whichstate that 1 “the Internet will soon surpass all other media as a main source for national and international news” and 2 “the mobile device will be the primary connection tool to the Internet in 2020” leads us to the conclusion that smartphones will soon be the primary source for news access. But if so, how will news come to the Internetconnected cellphones? In accordance with the distinction, already drawn in 1997, between push and pull technologies as two different forms of how content is delivered to the end users, cellphones are characterized as push devices (passive reception, in opposition to computers, classified as pull devices (active reception. The news items that fit cellphones are pushed news. And they will be pushed as SMS, e-mails, tweets and through news aggregators.

Synthesis and structure of Na-Li-Si-Al-P-O-N glasses prepared by melt nitridation using NH3

International Nuclear Information System (INIS)

Kidar, A.; Pomeroy, M.J.; Hampshire, S.; Mercier, C.; Leriche, A.; Revel, B.

2012-01-01

Na-Li-Si-Al-P-O-N glasses have been prepared by nitridation of a pre-synthesized Na 2 O-Li 2 O-SiO 2 -P 2 O 5 -Al 2 O 3 glass under anhydrous ammonia. Nitrogen for oxygen substitution increases the network connectivity leading to increases in microhardness and glass transition temperature. Raman and 31 P MAS-NMR spectroscopy indicate sequential nitridation reactions forming PO 3 N and PO 2 N 2 species. The data collected so far show no evidence of N/O substitutions in the silicate sub-network. (authors)

Good News in Bad News: How Negativity Enhances Economic Efficacy

NARCIS (Netherlands)

Svensson, H.M.; Albæk, E.; van Dalen, A.; de Vreese, C.

2017-01-01

Negativity is a news ideology, and its negative effects on attitude formation are widely documented. Contrary to this view, the present study demonstrates that negative economic news can in fact be good news. Based on a two-wave national panel survey and a media content analysis, we show that

Healthy depictions? Depicting adoption and adoption news events on broadcast news.

Science.gov (United States)

Kline, Susan L; Chatterjee, Karishma; Karel, Amanda I

2009-01-01

Given that the public uses the media to learn about adoption as a family form, this study analyzes U.S. television news coverage of adoption between 2001 and 2005 (N = 309 stories), to identify the types of news events covered about adoption. A majority of news stories covered fraud, crime, legal disputes, and negative international adoption cases. Adoptees as defective or unhealthy were depicted more in negative news event stories, birth parents appeared less overall, and adoptive parents were most likely to have healthy depictions in positively oriented adoption experience, big family, and reunion stories. Although three quarters of the stories used primary adoption participants as news sources, one-third of the negative event stories did not contain healthy depictions of adoption participants. The authors discuss ways journalists and researchers might improve adoption news coverage.

Analysis of the stability of the traps in LiF: Mg, Cu, P by deconvolution of it Tl curve; Analisis de la estabilidad de las trampas en LiF: Mg, Cu, P por deconvolucion de su curva TL

Energy Technology Data Exchange (ETDEWEB)

Gonzalez, P.R. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico); Azorin, J. [UAM-I, San Rafael Atlixco 186, Col Vicentina 09340 Mexico, D.F. (Mexico); Furetta, C. [Universita degli Studi di Roma ' La Sapienza' , Piazzale Aldo Moro 2, 00185, Roma, (Italy); Lopez, J. [Facultad de Matematicas, UADY, s/C.P. Merida, Yucatan (Mexico)

2004-07-01

The results of the study of the stability of the traps are presented in Tl dosemeters of LiF: Mg,Cu,P + Ptfe, developed in the ININ, taking like reference to the commercial dosemeter GR200A of Chinese factory. The readings taken Tl the same day of the irradiation they presented four peaks whose energy, determined by deconvolution were; 1.30 {+-} 0.01 eV, 1.50 {+-} 0.01 eV, 1.70 {+-} 0.01 eV and 2.58{+-} 0.02 eV, for LiF: Mg,Cu,P + Ptfe, while for GR200A the energies were: 1.33 {+-} 0.11 eV, 1.58 {+-} 0.11 eV, 1.73 {+-} 0.11 eV and 2.60 {+-} 0.03 eV. The energy of the peaks 3 and 4 that remained visible during six months of study it was: 1.38 {+-} 0.01 eV and 2.65 {+-} 0.01 eV, for LiF: Mg,Cu,P + Ptfe respectively, in the same order for GR200A, the energies were: 1.51 {+-} 0.02 eV and 2.64 {+-} 0.03 eV. (Author)

Density functional theory study of lithium diffusion at the interface between olivine-type LiFePO4 and LiMnPO4

Science.gov (United States)

Shi, Jianjian; Wang, Zhiguo; Qing Fu, Yong

2016-12-01

Coating LiMnPO4 with a thin layer of LiFePO4 shows a better electrochemical performance than the pure LiFePO4 and LiMnPO4, thus it is critical to understand Li diffusion at their interfaces to improve the performance of electrode materials. Li diffusion at the (1 0 0)\\text{LiFeP{{\\text{O}}4}} //(1 0 0)\\text{LiMnP{{\\text{O}}4}} , (0 1 0)\\text{LiFeP{{\\text{O}}4}} //(0 1 0)\\text{LiMnP{{\\text{O}}4}} , and (0 0 1)\\text{LiFeP{{\\text{O}}4}} //(0 0 1)\\text{LiMnP{{\\text{O}}4}} interfaces between LiFePO4 and LiMnPO4 was investigated using density functional theory. The calculated diffusion energy barriers are 0.55 eV for Li to diffuse along the (0 0 1) interface, 0.44 and 0.49 eV for the Li diffusion inside the LiMnPO4 and along the (1 0 0) interface, respectively. When Li diffuses from the LiFePO4 to LiMnPO4 by passing through the (0 1 0) interfaces, the diffusion barriers are 0.45 and 0.60 eV for the Li diffusions in both sides. The diffusion barriers for Li to diffuse in LiMnPO4 near the interfaces decrease compared with those in the pure LiMnPO4. The calculated diffusion coefficient of Li along the (1 0 0) interface is in the range of 3.65  ×  10-11-5.28  ×  10-12 cm2 s-1, which is larger than that in the pure LiMnPO4 with a value of 7.5  ×  10-14 cm2 s-1. Therefore, the charging/discharging rate performance of the LiMnPO4 can be improved by surface coating with the LiFePO4.

Measurement of fission yields for 232-Th (n,f) at 14,7 MeV by direct gamma spectrometric method

International Nuclear Information System (INIS)

Chouak, K.; Berrada, M.; Embarech, K.

1994-01-01

Fission yields for the reaction 232-Th (n,f) were measured at 14,7 MeV using the activation technique with direct gamma spectrometric method. Neutrons were produced via the T(d,n) sup 4 He reaction. The neutron fluences were determined relative to the well-known sup 2 sup 7 Al(n,p) sup 2 sup 7 Mg or sup 2 sup 7 Al(n,alpha) sup 2 sup 4 Na cross section, according to the irradiation time. Yields of fission products were determined by measuring the induced gamma ray activities of the irradiated Th foils, using a calibrated Ge(Li) detector. All necessary corrections were taken into account: self absorption, coincidence losses and natural gamma rays. Fifty six cumulative yields were measured and only twenty one corresponding results were found in the literature (Crouch,1977). A satisfactory agreement is observed between our results and the published data with the exception of the masses:A=134 and A=140. 1 tab., 2 refs. (author)

24 CFR 232.885 - Insurance benefits.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance benefits. 232.885 Section 232.885 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued....885 Insurance benefits. (a) Method of payment. Payment of claim shall be made in the following manner...

Major compound-dependent variations of 10B(nα)7 Li RBE for the 9L RAT gliosarcoma in vitro and in vivo

International Nuclear Information System (INIS)

Coderre, J.A.; Makar, M.S.; Micca, P.L.; Nawrocky, M.M.; Joel, D.D.; Slatkin, D.N.

1991-01-01

Relative biological effectiveness (RBE) values for the high linear-energy-transfer (LET) radiations produced during born neutron capture therapy (BNCT) were determined using the 9L rat gliosarcorna both in vitro and as an intracerebral tumor. In the absence of 10 B, the combined effect of the recoiling protons from the 14 N(n,p) 14 C and the 1 H(n,n')p reactions, compared to an iso-effect endpoint produced by 250 kVp x-rays, yielded RBEs for these high-LET protons of 4.4 in vitro and 3.8 in an in vivo/in vitro assay. RBEs for the 10 B(n,α) 7 Li reaction were calculated from cell survival data following reactor irradiation in the presence or in the absence of the either of the amino acid, p-boronophenylalanine (BPA) or the sulfhydryl dodecaborane dimer (BSSB). With BPA, RBE values ranged from 3.5 to 11.4, while under the same set of conditions with BSSB, RBE values ranged from 1.1 to 4.3. In vitro, higher RBEs for the 10 B(n,α) 7 Li reaction using BPA than with BSSB suggest a difference in distribution of 10 B relative to the nucleus

20 CFR 410.232 - Withdrawal of a claim.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Withdrawal of a claim. 410.232 Section 410.232 Employees' Benefits SOCIAL SECURITY ADMINISTRATION FEDERAL COAL MINE HEALTH AND SAFETY ACT OF 1969... Claims and Evidence § 410.232 Withdrawal of a claim. (a) Before adjudication of claim. A claimant (or an...

News, social capital and health in the context of Katrina.

Science.gov (United States)

Beaudoin, Christopher E

2007-05-01

This study assesses the public health functions played by news information and social capital in the context of Hurricane Katrina. In-depth interviews were conducted with 57 hurricane shelter residents between 4 and 6 weeks after the hurricane. Depression was more common for participants who relied more on news information than for other participants after the hurricane (adjusted odds ratio [AOR], 5.49; 95% CI, 1.29 to 23.35; p=.021). Depression was more common for participants with relatively low levels of pre-hurricane positive social interactions (AOR, .16; 95% CI, .02 to 1.83; p=.046) and post-hurricane positive social interactions (AOR, .02; 95% CI, .00 to .74; p=.033) and high levels of post-hurricane negative social interactions (AOR, 17.05; 95% CI, .92 to 315.64; p=.047). Illness and injury were more common for participants who had relied more on news information than for other participants after the hurricane (AOR, 1.13; 95% CI, 1.02 to 2.77; p=.046).

24 CFR 232.805 - Insurance premiums.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance premiums. 232.805 Section... FACILITIES Contract Rights and Obligations Premiums § 232.805 Insurance premiums. (a) First premium. The... insurance premium equal to one percent of the original face amount of the note. (b) Second premium. The...

27 CFR 31.232 - Wine bottling.

Science.gov (United States)

2010-04-01

.... The decanting of wine by caterers or other retail dealers for table or room service, banquets, and... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Wine bottling. 31.232... OF THE TREASURY LIQUORS ALCOHOL BEVERAGE DEALERS Miscellaneous § 31.232 Wine bottling. Each person...

Routinizing Breaking News

DEFF Research Database (Denmark)

Hartley, Jannie Møller

2011-01-01

This chapter revisits seminal theoretical categorizations of news proposed three decades earlier by US sociologist Gaye Tuchman. By exploring the definition of ”breaking news” in the contemporary online newsrooms of three Danish news organisations, the author offers us a long overdue re-theorizat......-theorization of journalistic practice in the online context and helpfully explores well-evidenced limitations to online news production, such as the relationship between original reporting and the use of ”shovelware.”......This chapter revisits seminal theoretical categorizations of news proposed three decades earlier by US sociologist Gaye Tuchman. By exploring the definition of ”breaking news” in the contemporary online newsrooms of three Danish news organisations, the author offers us a long overdue re...

49 CFR 232.305 - Single car air brake tests.

Science.gov (United States)

2010-10-01

... from a train or when placed on a shop or repair track, as defined in § 232.303(a); (2) A car is on a shop or repair track, as defined in § 232.303(a), for any reason and has not received a single car air... 49 Transportation 4 2010-10-01 2010-10-01 false Single car air brake tests. 232.305 Section 232...

A Reassessment of U-Th and 14C Ages for Late-Glacial High-Frequency Hydrological Events at Searles Lake, California

Science.gov (United States)

Lin, J.C.; Broecker, W.S.; Hemming, S.R.; Hajdas, I.; Anderson, Robert F.; Smith, G.I.; Kelley, M.; Bonani, G.

1998-01-01

U-Th isochron ages of tufas formed on shorelines suggest that the last pluvial event in Lake Lahontan and Searles Lake was synchronous at about 16,500 cal yr B.P. (equivalent to a radiocarbon age of between 14,000 and 13,500 yr B.P.), whereas the timing of this pluvial event determined by radiocarbon dating is on the order of 1000 yr younger. The timing of seven distinct periods of near desiccation in Searles Lake during late-glacial time has been reinvestigated for U-Th age determination by mass spectrometry. U-Th dating of evaporite layers in the interbedded mud and salt unit called the Lower Salt in Searles Lake was hampered by the uncertainty in assessing the initial 230Th/232Th of the samples. The resulting ages, corrected by a conservative range of initial 230Th/ 232Th ratios, suggest close correlation of the abrupt changes recorded in Greenland ice cores (Dansgaard-Oeschger events) and wet-dry conditions in Searles Lake between 35,000 and 24,000 Cal yr B.P. ?? 1998 University of Washington.

The Dynamic Cross-Correlations between Mass Media News, New Media News, and Stock Returns

Directory of Open Access Journals (Sweden)

Zuochao Zhang

2018-01-01

Full Text Available We investigate the dynamic cross-correlations between mass media news, new media news, and stock returns for the SSE 50 Index in Chinese stock market by employing the MF-DCCA method. The empirical results show that (1 there exist power-law cross-correlations between two types of news as well as between news and its corresponding SSE 50 Index return; (2 the cross-correlations between mass media news and SSE 50 Index returns show larger multifractality and more complicated structures; (3 mass media news and new media news have both complementary and competitive relationships; (4 with the rolling window analysis, we further find that there is a general increasing trend for the cross-correlations between the two types of news as well as the cross-correlations between news and returns and this trend becomes more persistent over time.

Neutron scattering study on cathode LiMn{sub 2}O{sub 4} and solid electrolyte 5(Li{sub 2}O)(P{sub 2}O{sub 5})

Energy Technology Data Exchange (ETDEWEB)

Kartini, E., E-mail: kartini@batan.go.id; Putra, Teguh P., E-mail: kartini@batan.go.id; Jahya, A. K., E-mail: kartini@batan.go.id; Insani, A., E-mail: kartini@batan.go.id [Technology Center for Nuclear Industry Materials, National Nuclear Energy Agency, Serpong 15314 (Indonesia); Adams, S. [Department of Materials Science and Engineering, National University of Singapore, Singapore-117576 (Singapore)

2014-09-30

Neutron scattering is very important technique in order to investigate the energy storage materials such as lithium-ion battery. The unique advantages, neutron can see the light atoms such as Hydrogen, Lithium, and Oxygen, where those elements are negligible by other corresponding X-ray method. On the other hand, the energy storage materials, such as lithium ion battery is very important for the application in the electric vehicles, electronic devices or home appliances. The battery contains electrodes (anode and cathode), and the electrolyte materials. There are many challenging to improve the existing lithium ion battery materials, in order to increase their life time, cyclic ability and also its stability. One of the most scientific challenging is to investigate the crystal structure of both electrode and electrolyte, such as cathodes LiCoO{sub 2}, LiMn{sub 2}O{sub 4} and LiFePO{sub 4}, and solid electrolyte Li{sub 3}PO{sub 4}. Since all those battery materials contain Lithium ions and Oxygen, the used of neutron scattering techniques to study their structure and related properties are very important and indispensable. This article will review some works of investigating electrodes and electrolytes, LiMn{sub 2}O{sub 4} and 5(Li{sub 2}O)(P{sub 2}O{sub 5}), by using a high resolution powder diffraction (HRPD) at the multipurpose research reactor, RSG-Sywabessy of the National Nuclear Energy Agency (BATAN), Indonesia.

History of 232-F, tritium extraction processing

International Nuclear Information System (INIS)

Blackburn, G.W.

1994-08-01

In 1950 the Atomic Energy Commission authorized the Savannah River Project principally for the production of tritium and plutonium-239 for use in thermonuclear weapons. 232-F was built as an interim facility in 1953--1954, at a cost of $3.9M. Tritium extraction operations began in October, 1955, after the reactor and separations startups. In July, 1957 a larger tritium facility began operation in 232-H. In 1958 the capacity of 232-H was doubled. Also, in 1957 a new task was assigned to Savannah River, the loading of tritium into reservoirs that would be actual components of thermonuclear weapons. This report describes the history of 232-F, the process for tritium extraction, and the lessons learned over the years that were eventually incorporated into the new Replacement Tritium Facility

Administration of Lactobacillus salivarius LI01 or Pediococcus pentosaceus LI05 prevents CCl4-induced liver cirrhosis by protecting the intestinal barrier in rats.

Science.gov (United States)

Shi, Ding; Lv, Longxian; Fang, Daiqiong; Wu, Wenrui; Hu, Chenxia; Xu, Lichen; Chen, Yanfei; Guo, Jing; Hu, Xinjun; Li, Ang; Guo, Feifei; Ye, Jianzhong; Li, Yating; Andayani, Dewi; Li, Lanjuan

2017-07-31

Alterations in the gut microbiome have been reported in liver cirrhosis, and probiotic interventions are considered a potential treatment strategy. This study aimed to evaluate the effects and mechanisms of Lactobacillus salivarius LI01, Pediococcus pentosaceus LI05, Lactobacillus rhamnosus GG, Clostridium butyricum MIYAIRI and Bacillus licheniformis Zhengchangsheng on CCl 4 -induced cirrhotic rats. Only administration of LI01 or LI05 prevented liver fibrosis and down-regulated the hepatic expression of profibrogenic genes. Serum endotoxins, bacterial translocations (BTs), and destruction of intestinal mucosal ultrastructure were reduced in rats treated with LI01 or LI05, indicating maintenance of the gut barrier as a mechanism; this was further confirmed by the reduction of not only hepatic inflammatory cytokines, such as TNF-α, IL-6, and IL-17A, but also hepatic TLR2, TLR4, TLR5 and TLR9. Metagenomic sequencing of 16S rRNA gene showed an increase in potential beneficial bacteria, such as Elusimicrobium and Prevotella, and a decrease in pathogenic bacteria, such as Escherichia. These alterations in gut microbiome were correlated with profibrogenic genes, gut barrier markers and inflammatory cytokines. In conclusion, L. salivarius LI01 and P. pentosaceus LI05 attenuated liver fibrosis by protecting the intestinal barrier and promoting microbiome health. These results suggest novel strategies for the prevention of liver cirrhosis.

Proton/gamma relative thermoluminescence efficiencies of LiF:Mg,Cu,P+PTFE prepared at ININ and TLD-100H

International Nuclear Information System (INIS)

Avila, O.; Gonzalez, P.; Murillo, G.

2009-10-01

Properties of LiF:Mg,Cu,P+PTFE dosemeters developed at ININ have been investigated in order to evaluate their performance compared to those of equivalent commercial dosemeters. In this work both LiF:Mg,Cu,P+PTFE and TLD-100H pellets were exposed to low fluence 3 MeV protons and to low dose gamma radiation to evaluate experimental proton/gamma efficiencies. Gamma irradiation was performed using the Vic krad irradiator at ININ at varying doses between 25 and 500 mGy. For proton irradiation the Tandem Van de Graaff accelerator at ININ was used. Dosemeters were placed on a holder inside a scattering chamber where protons impinge on a gold target and scatter in all directions. The holder allows for several angular positions so that dosemeters receive proton fluence between 10 6 and 10 1 0 p/cm 2 . Experimental efficiency values found for LiF:Mg,Cu,P+PTFE and TLD-100H were 0.18 +- 03 and 0.23 +- 0.03, respectively. These results allow to confirm the reliability of the dosemeters developed at ININ. (Author)

Tweeting News Articles

Directory of Open Access Journals (Sweden)

Marco Toledo Bastos

2013-09-01

Full Text Available In this article we investigate the impact of social media readership to the editorial profile of newspapers. We analyze tweets containing links to news articles from eight of the largest national newspapers in the United States, United Kingdom, Spain, Brazil, and Germany. The data collection follows the first two weeks of October 2012 and includes 2,842,699 tweets with links to news articles. Twitter-shortened links were resolved using a three-pass routine and assigned to 1 of the 21 newspaper sections. We found the concentration of links to news articles posted by top users to be lower than reported in the literature and the strategy of relaying headlines on Twitter via automatic news aggregators (feeds to be inefficient. The results of this investigation show which sections of a newspaper are the most and least read by readers in different parts of the world, with German readers placing greater emphasis on Politics and Economy; Brazilians on Sports and Arts; Spaniards on Local and National news; Britons and Americans on Opinion and World news. We also found that German and Spanish readers are more likely to read multiple national newspapers, while British readers more often resort to foreign sources of news. The results confirm that feedback to news items from a large user base is pivotal for the replication of content and that newspapers and news items can be clustered according to the editorial profile and principles of newsworthiness inherited from legacy media. The results of this investigation shed light onto the networked architecture of journalism that increasingly depends on readership agency.

Searching for “LiCrIIPO4”

International Nuclear Information System (INIS)

Mosymow, E.; Glaum, R.; Kremer, R.K.

2014-01-01

The two new phosphates LiCr II 4 (PO 4 ) 3 and Li 5 Cr II 2 Cr III (PO 4 ) 4 are discovered as equilibrium phases (ϑ=800 °C) in the quarternary system Li/Cr/P/O. Their crystal structures have been determined from single-crystal X-ray diffraction data (LiCr II 4 (PO 4 ) 3 : violet-blue, Pnma (no. 62), Z=4, a=6.175(1) Å, b=14.316(3) Å, c=10.277(2) Å, 100 parameters, R 1 =0.028, wR 2 =0.08, 2060 unique reflections with F o >4σ(F o ); Li 5 Cr II 2 Cr III (PO 4 ) 4 : greyish-green, P1 ¯ (no. 2), Z=1, a=4.9379(7) Å, b=7.917(2) Å, c=8.426(2) Å, α=109.98(2)°, β=90.71(1)°, γ=104.91(1)°, 131 parameters, R 1 =0.022, wR 2 =0.067, 1594 unique reflections with F o >4σ(F o )). Li 5 Cr II 2 Cr III (PO 4 ) 4 adopts an hitherto unknown structure type. The crystal structure of LiCr II 4 (PO 4 ) 3 is isotypic to that of NaCd II 4 (PO 4 ) 3 and related to that of the mineral silicocarnotite Ca 5 (PO 4 ) 2 (SiO 4 ). Significant disorder between Li + and Cr 2+ is observed for both crystal structures. The oxidation states assigned to chromium in these two phosphates are in agreement with UV/vis/NIR absorption spectra and magnetic susceptibility data recorded for both compounds. Instead of “LiCr II PO 4 ” mixtures of LiCr II 4 (PO 4 ) 3 , Li 5 Cr II 2 Cr III (PO 4 ) 4 , Cr 2 O 3 , and CrP are observed at equilibrium. Instead of “Li 2 Cr II P 2 O 7 ” four-phase mixtures consisting of Li 9 Cr III 3 (P 2 O 7 ) 3 (PO 4 ) 2 , Li 3 Cr III 2 (PO 4 ) 3 , LiCrP 2 O 7 , and CrP were obtained. - Graphical abstract: Investigations on the equilibrium relations in the system Li/Cr/P/O revealed the two hitherto unknown phosphates Li 5 Cr II 2 Cr III (PO 4 ) 4 and LiCr II 4 (PO 4 ) 3 . They form instead of “LiCr II PO 4 ”. The crystal structures, magnetic behavior and optical spectra of these phosphates are reported. - Highlights: • The two new phosphates Li 5 Cr II 2 Cr III (PO 4 ) 4 and LiCr II 4 (PO 4 ) 3 have been characterized. • Optical spectra and paramagnetism of

Ionic conduction studies in Li3+ ion irradiated P(VDF-HFP)-(PC + DEC)-LiCF3SO3 gel polymer electrolyte

International Nuclear Information System (INIS)

Saikia, D.; Hussain, A.M.P.; Kumar, A.; Singh, F.; Avasthi, D.K.

2006-01-01

In an attempt to increase the Li ion diffusivity in gel polymer electrolytes, the effects of Li 3+ ion irradiation in P(VDF-HFP)-(PC + DEC)-LiCF 3 SO 3 electrolyte system, with five different fluences, is studied. Irradiation with swift heavy ions shows enhancement in conductivity at low fluences and decreased in conductivity at higher fluences with respect to pristine polymer electrolyte films. Maximum room temperature ionic conductivity after irradiation is found to be 2.6 x 10 -3 S/cm. This interesting result could be attributed to the fact that, higher fluence provides critical activation energy for cross-linking and crystallization to occur, which results in decrease in ionic conductivity. XRD results show decrease in the degree of crystallinity upon ion irradiation at low fluences (≤10 11 ions/cm 2 ) and increase in crystallinity at high fluences (>10 11 ions/cm 2 ). In FTIR spectra the absorption band intensities around 3025 cm -1 and 2985 cm -1 decrease upon irradiation with a fluence of 5 x 10 1 ions/cm 2 suggesting chain scission and increase upon irradiation with a fluence of 5 x 10 12 ions/cm 2 indicating cross-linking. FTIR analyses corroborate the conductivity and XRD results

Fake news propagate differently from real news even at early stages of spreading

OpenAIRE

Zhao, Zilong; Zhao, Jichang; Sano, Yukie; Levy, Orr; Takayasu, Hideki; Takayasu, Misako; Li, Daqing; Havlin, Shlomo

2018-01-01

Social media can be a double-edged sword for modern communications, either a convenient channel exchanging ideas or an unexpected conduit circulating fake news through a large population. Existing studies of fake news focus on efforts on theoretical modelling of propagation or identification methods based on black-box machine learning, neglecting the possibility of identifying fake news using only structural features of propagation of fake news compared to those of real news and in particular...

The cosmic 6Li and 7Li problems and BBN with long-lived charged massive particles

International Nuclear Information System (INIS)

Karsten, Jedamzik

2007-01-01

Charged massive particles (CHAMPs), when present during the Big Bang nucleosynthesis (BBN) era, may significantly alter the synthesis of light elements when compared to a standard BBN scenario. This is due to the formation of bound states with nuclei. This paper presents a detailed numerical and analytical analysis of such CHAMP BBN. All reactions important for predicting light-element yields are calculated within the Born approximation. Three prior neglected effects are treated in detail: (a) photo destruction of bound states due to electromagnetic cascades induced by the CHAMP decay, (b) late-time efficient destruction/production of H 2 , Li 6 , and Li 7 due to reactions on charge Z = 1 nuclei bound to CHAMPs, and (c) CHAMP exchange between nuclei. Each of these effects may induce orders-of-magnitude changes in the final abundance yields. The study focusses on the impact of CHAMPs on a possible simultaneous solution of the Li 6 and Li 7 problems. It is shown that a prior suggested simultaneous solution of the Li 6 and Li 7 problems for a relic decaying at τ x ∼ 1000 s is only very weakly dependent on the relic being neutral or charged, unless its hadronic branching ratio is B h -4 very small. By use of a Monte-Carlo analysis it is shown that within CHAMP BBN the existence of further parameter space for a simultaneous solution of the Li 6 and Li 7 problem for long decay times τ x ≥ 10 6 s seems possible but fairly unlikely. (author)

48 CFR 232.102 - Description of contract financing methods.

Science.gov (United States)

2010-10-01

... financing methods. 232.102 Section 232.102 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 232.102 Description of contract financing methods. (e)(2) Progress payments...

Iodine Deficiency in a Study Population of Norwegian Pregnant Women-Results from the Little in Norway Study (LiN).

Science.gov (United States)

Dahl, Lisbeth; Wik Markhus, Maria; Sanchez, Perla Vanessa Roldan; Moe, Vibeke; Smith, Lars; Meltzer, Helle Margrete; Kjellevold, Marian

2018-04-20

Iodine sufficiency is particularly important in pregnancy, where median urinary iodine concentration (UIC) in the range of 150⁻250 µg/L indicates adequate iodine status. The aims of this study were to determine UIC and assess if dietary and maternal characteristics influence the iodine status in pregnant Norwegian women. The study comprises a cross-sectional population-based prospective cohort of pregnant women (Little in Norway (LiN)). Median UIC in 954 urine samples was 85 µg/L and 78.4% of the samples ( n = 748) were ≤150 µg/L. 23.2% ( n = 221) of the samples were ≤50 µg/L and 5.2% ( n = 50) were above the requirements of iodine intake (>250 µg/L). Frequent iodine-supplement users ( n = 144) had significantly higher UIC (120 µg/L) than non-frequent users (75 µg/L). Frequent milk and dairy product consumers (4⁻9 portions/day) had significantly higher UIC (99 µg/L) than women consuming 0⁻1 portion/day (57 µg/L) or 2⁻3 portions/day (83 µg/L). Women living in mid-Norway ( n = 255) had lowest UIC (72 µg/L). In conclusion, this study shows that the diet of the pregnant women did not necessarily secure a sufficient iodine intake. There is an urgent need for public health strategies to secure adequate iodine nutrition among pregnant women in Norway.

Dose Measurements in a Phantom Simulating Neonates by Using Different TL Materials: LiF:Mg,Cu,P and LiF:Mg,Ti

International Nuclear Information System (INIS)

Saez-Vergara, J.C.; Romero, A.M.; Fernandez, C.; Gomez, S.; Vazquez, J.; Olivares, M.P.

1999-01-01

A study reproducing usual exposure conditions in a special care baby unit has been performed to measure doses using TL materials in a versatile phantom specially designed for neonates having X ray examinations. The phantom offers the possibilities of reproducing different patient thicknesses and representing either a solid or hollow lung region. The results of the dose measurements using TL materials at the entrance, exit and both laterals of the phantom during different chest radiograph conditions are presented. Test conditions were reproduced in both hollow and solid chest cages simulating patient thicknesses of 5, 6 and 7 cm. The study was completed using two types of TL materials, LiF:Mg,Cu,P and LiF:Mg,Ti, in order to analyse and correct the differences on energy response between the two phosphors. (author)

Calculation of the total electron excitation cross section in the Born approximation using Slater wave functions for the Li (2s yields 2p), Li (2s yields 3p), Na (3s yields 4p), Mg (3p yields 4s), Ca (4s yields 4p) and K (4s yields 4p) excitations. M.S. Thesis

Science.gov (United States)

Simsic, P. L.

1974-01-01

Excitation of neutral atoms by inelastic scattering of incident electrons in gaseous nebulae were investigated using Slater Wave functions to describe the initial and final states of the atom. Total cross sections using the Born Approximation are calculated for: Li(2s yields 2p), Na(3s yields 4p), k(4s yields 4p). The intensity of emitted radiation from gaseous nebulae is also calculated, and Maxwell distribution is employed to average the kinetic energy of electrons.

Measurement of extremely low level dose with LiF(Mg,Cu,P) TL chips

International Nuclear Information System (INIS)

Zha Ziying; Wang Shoushan; Wu Fang; Chen Guolong; Li Yuanfang; Zhu Jianhuan

1986-01-01

This paper presents some of the dosimetric characteristics of newly developed LiF(Mg,Cu,P) TL chips with high signal-to-noise ratio for measurement at the 10 -7 to 10 -4 Gy dose level. Measuring techniques and optimum procedures for annealing and readout are also presented. (author)

Measuring News Media Literacy

Science.gov (United States)

Maksl, Adam; Ashley, Seth; Craft, Stephanie

2015-01-01

News media literacy refers to the knowledge and motivations needed to identify and engage with journalism. This study measured levels of news media literacy among 500 teenagers using a new scale measure based on Potter's model of media literacy and adapted to news media specifically. The adapted model posits that news media literate individuals…

BRAZILIAN NEWS PORTALS CHARACTERISTICS

Directory of Open Access Journals (Sweden)

Heloiza G. Herckovitz

2011-02-01

Full Text Available A content analysis of four Brazilian news media portals found that economic news dominated the top headlines with little attention paid to education, the environment and welfare. Other trends included a focus on local events and national news sources, reliance on few sources, mostly official ones, and a low percentage of news that fitted the concept of newsworthiness (a combination of both social significance and deviance concepts. Other findings of a study of 432 top news stories published by UOL, Estadão, iG and Terra during a 15-day period between February and March 2008 indicate that the top portions of the portals’ front pages carry news that lacks story depth, editorial branding, and multimedia applications. The results suggest that online news portals are in their infancy although Brazil has the largest online population of Latin America. This study hopes to shed light on the gatekeeping process in Brazilian news portals. Brazilian media portals have yet to become a significant editorial force able to provide knowledge about social issues and public affairs in a socially responsible fashione.

Determination of 232Th, 230Th and 228Th in liquid effluents from uranium mining

International Nuclear Information System (INIS)

Godoy, Jose Marcus de Oliveira

1979-10-01

A liquid scintillator αlpha spectrometer was built for the determination of Th- 228 , Th- 230 and Th- 232 in liquid effluents from Uranium mines and mills. The resolution of the αlpha spectrometer was found to be 200-300 KeV, when the scintillator was 8% T0P0, 0,77% scintimix-4 (91% PP0 and 9% Dimetil-P0P0P) and 10% of naphthalene in toluene. Aliquat-336 in xylene (30% v/v) was used to separate the thorium isotopes from other interfering radionuclides (U- 238 , U- 234 , Ra- 226 , Po- 210 ). Under the extraction experimental conditions, the detection limits were 1,2 pCi/1 for Th- 232 , 1,2 pCi/1 for Th- 230 and 0,9 pCi/1 for Th- 228 , for 1000 minutes of counting time. (author)

Coulomb excitation of {sup 8}Li

Energy Technology Data Exchange (ETDEWEB)

Assuncao, Marlete; Britos, Tatiane Nassar [Universidade Federal de Sao Paulo (UNIFESP), SP (Brazil). Dept. de Ciencias Exatas e da Terra; Descouvemont, Pierre [Universite Libre de Bruxelles (ULB), Brussels (Belgium). Physique Nucleaire Theorique et Physique Mathematique; Lepine-Szily, Alinka; Lichtenthaler Filho, Rubens; Barioni, Adriana; Silva, Diego Medeiros da; Pereira, Dirceu; Mendes Junior, Djalma Rosa; Pires, Kelly Cristina Cezaretto; Gasques, Leandro Romero; Morais, Maria Carmen; Added, Nemitala; Neto Faria, Pedro; Rec, Rafael [Universidade de Sao Paulo (IF/USP), SP (Brazil). Inst. de Fisica. Dept. de Fisica Nuclear

2012-07-01

Full text: This work shows the Coulomb Excitation of {sup 8}Li on targets that have effectively behavior of Rutherford in angles and energies of interest for determining the value of the B(E2) electromagnetic transition. Theoretical aspects involved in this type of measure, known as COULEX [1], and some results in the literature [2-3] will be presented. Some problems with the targets and measurement system while performing an experiment on Coulomb Excitation of {sup 8}Li will be discussed: the energy resolution, background, possible contributions of the primary beam and also the excited states of the target near the region of elastic and inelastic peaks. They will be illustrated by measurements of the Coulomb Excitation of {sup 8}Li on targets of {sup 197}Au and {sup 208}Pb using the system RIBRAS(Brazilian Radioactive Ion Beam). In this case, the {sup 8}Li beam(T{sub 1/2} = 838 ms)is produced by {sup 9}Be({sup 7}Li;{sup 8} Li){sup 8}Be reaction from RIBRAS system which is installed at Instituto de Fisica of the Universidade de Sao Paulo. The primary {sup 7L}i beam is provided by Pelletron Accelerator. [1] K. Alder and A. Winther, Electromagnetic Excitation, North-Holland, New York, 1975; [2] P. Descouvemont and D. Baye, Phys. Letts. B 292, 235-238, 1992; [3] J. A. Brown, F. D. Becchetti, J. W. Jaenecke, K, Ashktorab, and D. A. Roberts, J. J. Kolata, R. J. Smith, and K. Lamkin, R. E. Warner, Phys. Rev. Letts., 66, 19, 1991; [4] R. J. Smith, J. J Kolata, K. Lamkin and A. Morsard, F. D. Becchetti, J. A. Brown, W. Z. Liu, J. W. Jaenecke, and D. A. Roberts, R. E. Warner, Phys. Rev. C, 43, 5, 1991. (author)

48 CFR 232.202-4 - Security for Government financing.

Science.gov (United States)

2010-10-01

... financing. 232.202-4 Section 232.202-4 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Commercial Item Purchase Financing 232.202-4 Security for Government financing. (a)(2) When determining whether an offeror...

Preparation of thermoluminescent dosimeters of LiF: Mg, Cu, P + Ptfe for environmental radiological monitoring and radiodiagnosis; Preparacion de dosimetros termoluminiscentes de LiF: Mg, Cu, P + PTFE para monitoreo radiologico ambiental y radiodiagnostico

Energy Technology Data Exchange (ETDEWEB)

Ramirez L, A

1997-12-31

The necessity of finding a thermoluminescent material for measuring gamma and X radiation in applications like environmental monitoring, personnel dosimetry and biomedical sciences (radiotherapy and radiodiagnosis), but with special characteristics such as low umbral detection, independence of the energy of radiation and equivalency with the tissue. This made us think in lithium fluoride activated with magnesium, copper and phosphorous (LiF: Mg, Cu, P). In this thesis I developed this material chips like shape embedded in polytetrafluoroethylene (LiF: Mg, Cu, P+Ptfe). The chapter 1 and 2 talk about the atom is conformed and the interaction of the radiation with the matter. The requirements of Tl material, types of dosimetry system, biological effects and units of measurements are discussed in chapter 3 as well as the recommended limits of the International Commission on Radiological Protection ICRP. Chapter 4 shows aspects of the thermoluminescence phenomenon and describes, at the same time, the determination of the most important thermoluminescent parameters (kinetic order, energy or trap depth and the frequency factor). Chapter 5 describes the major characteristics and properties of Tl materials and its requirements for dosimetric use. Chapter 6 deals with the preparations of LiF: Mg, Cu, P+Ptfe chips and some tests for improving its sensitivity, describes the dosimetric tests and requirements proposed by American National Standard Institute ANSI-N545 Like: umbral of detection, homogeneity, fading, repeatability, linearity, effects of UV and fluorescent light etc. Finally in chapter 7 I do a report about analysis of results, conclusions and some recommendations. (Author).

Üliõpilasteatrid peavad Itaalias kongressi

Index Scriptorium Estoniae

2006-01-01

Itaalia väikelinnas Urbinos lõpeb 27. juulil sealse ülikooli teatri Teatro Aenigma ja Rahvusvahelise Üliõpilasteatrite Assotsiatsiooni koostöös kuues tudengiteatrite maailmakongress. Eestist osaleb ja peab ettekande lavastaja ja Tartu Üliõpilasteatri kunstiline juht Kalev Kudu

Rational coating of Li7P3S11 solid electrolyte on MoS2 electrode for all-solid-state lithium ion batteries

Science.gov (United States)

Xu, R. C.; Wang, X. L.; Zhang, S. Z.; Xia, Y.; Xia, X. H.; Wu, J. B.; Tu, J. P.

2018-01-01

Large interfacial resistance between electrode and electrolyte limits the development of high-performance all-solid-state batteries. Herein we report a uniform coating of Li7P3S11 solid electrolyte on MoS2 to form a MoS2/Li7P3S11 composite electrode for all-solid-state lithium ion batteries. The as-synthesized Li7P3S11 processes a high ionic of 2.0 mS cm-1 at room temperature. Due to homogeneous union and reduced interfacial resistance, the assembled all-solid-state batteries with the MoS2/Li7P3S11 composite electrode exhibit higher reversible capacity of 547.1 mAh g-1 at 0.1 C and better cycling stability than the counterpart based on untreated MoS2. Our study provides a new reference for design/fabrication of advanced electrode materials for high-performance all-solid-state batteries.

Biofantasies: genetics and medicine in the print news media.

Science.gov (United States)

Petersen, A

2001-04-01

The contemporary news media is an important site for exploring the diverse and complex cultural images of genetics and its medical possibilities, and of the mechanisms by which these images are (re) produced and sustained. This article investigates how the print news media 'frames' stories on genetics and medicine. It is based on a discourse analysis of articles appearing in three Australian newspapers in the late 1990s. Gene stories were found to be prominent in each of the newspapers, and to emphasise the medical benefits of genetic research. Stories frequently cite and quote scientists, who explain the nature and significance of the research and/or its implications for treatment or prevention. Many stories focus on new genetic discoveries, and portray genetic researchers as involved in a quest to unlock nature's secrets. Stories of hope, and depictions of geneticists as warriors or heroes, appear regularly. The positive vision of genetics is supported by the use of particular metaphors, accompanying illustrative material, 'human interest' stories, and reference to credible sources. There is rarely mention of the influence of non-genetic factors and 'multifactorial' interactions on disorders, or questioning of the goals, direction, methods, or value of genetic research. Scientists made extensive use of the media in their efforts to maintain a positive image of research in the face of public concerns about scientists 'going too far', following the announcement of the cloning of Dolly. Boundaries were drawn between 'therapeutic cloning'--implicitly defined as 'good', useful, and legitimate--and 'reproductive cloning'--seen as 'bad', dangerous, and illegitimate. By framing news stories as they do, the print news media are likely to exert a powerful influence on public responses to health problems. With new genetic technologies becoming more integrated in preventive medicine and public health, it is important to investigate how news stories help shape the agenda for

Asymmetric News Effects on Volatility: Good vs. Bad News in Good vs. Bad Times

OpenAIRE

Laakkonen, Helinä; Lanne, Markku

2008-01-01

We study the impact of positive and negative macroeconomic US and European news announcements in different phases of the business cycle on the highfrequency volatility of the EUR/USD exchange rate. The results suggest that in general bad news increases volatility more than good news. The news effects also depend on the state of the economy: bad news increases volatility more in good times than in bad times, while there is no difference between the volatility effects of good news in bad and go...

The complementary relationship between the Internet and traditional mass media: the case of online news and information

Directory of Open Access Journals (Sweden)

An Nguyen

2006-01-01

Full Text Available Background. The question whether old media are driven out of existence by new media has been a long concern in academic and industrial research but has received no definitive answer. Aim.This paper goes beyond most previous studies of Internet impact on traditional media, which have placed their relationship within a competition-based framework, to specifically investigate the complementary effect of online news and information usage on traditional sources. Method. Secondary data analysis of a national survey of 4270 Australians conducted in late 2003, employing hypothesis testing for the mean, partial correlations, and a linear regression analysis. Results. Online news and information usage at different usage levels is positively associated with the use of traditional news and information sources, especially those that are more information-intensive. Those who relied on the Internet the most for news and information still used traditional sources substantially. Conclusion. The findings suggest that even if a displacement effect takes place, there will be no replacement (absolute displacement: traditional media will still exist to complement the Internet in serving human beings' news and information needs.

Effects of "Good News" and "Bad News" on Newscast Image and Community Image.

Science.gov (United States)

Galician, Mary-Lou; Vestre, Norris D.

1987-01-01

Investigates whether the relative amount of bad, neutral, and good news on television has corresponding effects on viewers' image of the community depicted and of the carrying newscast. Concludes that bad news creates a bad image for the community but that good news does not produce a more favorable image than neutral news. (MM)

P-T-x phase diagrams of MeF-UF4(Me=Li-Cs) systems

International Nuclear Information System (INIS)

Korenev, Yu.M.; Rykov, A.N.; Varkov, M.V.; Novoselova, A.V.

1988-01-01

Vapor composition and general pressure at three-phase equilibria in the MeF-UF 4 (Me=Li-Cs) systems are calculated using the values of independent component activities obtained earlier together with the data on fusibility diagrams. P-T and T-x projections of phase diagrams of these systems are constructed

Supplementary feeding of roe deer (Capreolus capreolus L with late harvested hay. A pilot study

Directory of Open Access Journals (Sweden)

C. Rehbinder

1985-05-01

Full Text Available In order to increase the fodder available for roedeer during wintertime, late harvested hay was placed on racks early in November in three consecutive years. Freeezing kept the hay dry and fresh during all three winters. In the first winter, with much snow, the bulk of the hay was consumed whereas consumption in the two subsequent mild winters was low and selective. The crude protein content of the hay was low (3.5 - 8.4% dry matter. Metabolizable energy estimated from digestion in vitro was 3.5 — 5.6 MJ per kg dry matter. Rumen liquor from roe deer during a mild winter gave lower in vitro digestion than liquor from sheep fed with ordinary rations. The value of this poor hay for roe deer is discussed with respect to the animals requirements, seasonal adaption, the energy and protein content of the hay, water consumption and normal behavior. The results indicate that late harvested hay may be more suitable than regularly harvested hay or concentrates to help roe deer to survive spells of severe winter conditions. With late harvested hay placed out at several localized feeding sites, the risks of indigestion and dehydration, associated with a more concentrated, feed, are minimized and the ranking among the roe deer in particular will be less important and thus more animals will have improved prospects of gaining access to the fodder.Tilskottsutfodring av rådjur (Capreolus capreolus L med sent skordat ho. En pilotstudie.Abstract in Swedish / Sammanfattning: I avsikt att, for rådjur, oka mångden tillgångligt foder under vintertid, skordades och håssjades ho i borjan av november under tre på varandra foljande år. Hoet fros torn och holl sig fårskt alla vintrarna. Forstå vintern med mycket sno konsumerades huvuddelen av hoet medan de två foljande milda vintrarna konsumptionen var låg och selektiv. Mångden råprotein i hoet var lågt (3.5 — 8.4 % i torrsubstans. Innehållet av omsåttbar energi beråknad från digestion in vitro var 3

Use of mass spectral method for plotting P-T and T-x pro ection of state diagram of LiF-ZrF4 system

International Nuclear Information System (INIS)

Korenev, Yu.M.; Rykov, A.N.; Novoselova, A.V.

1979-01-01

T-x and P-T projections of the state diagram for the system LiF-ZrF 4 were constructed. The Knudsen effusion technique with the mass-spectral analysis of the evaporation products was employed to determine the vapor composition and pressure. LiF, LiF 2 , Li 3 F 3 , ZrF 4 , LiZrF 5 , Li 2 ZrF 6 , LiZrF 9 molecules were found in the saturated vapor of the system. Heats of evaporation of the molecules and their partial pressures depending on the melt composition were determined. Dissociation enthalpies of the complex molecules were calcuted

From Reader to Writer: Citizen Journalism as News Produsage

Science.gov (United States)

Bruns, Axel

Today, participatory or citizen journalism - journalism which enables readers to become writers - exists online and offline in a variety of forms and formats, operates under a number of editorial schemes, and focuses on a wide range of topics from the specialist to the generic and the micro-local to the global. Key models in this phenomenon include veteran sites Slashdot and Indymedia, as well as news-related weblogs; more recent additions into the mix have been the South Korean OhmyNews, which in 2003 was “the most influential online news site in that country, attracting an estimated 2 million readers a day” (Gillmor, 2003a, p. 7), with its new Japanese and international offshoots, as well as the Wikipedia with its highly up-to-date news and current events section and its more recent offshoot Wikinews, and even citizen-produced video news as it is found in sites such as YouTube and Current.tv.

Õpetaja professionaalse rolli internaliseerimise hindamine õpetajakoolituse esmaõppe üliõpilaste hulgas / Äli Leijen, Katrin Kullasepp, Aivar Ots

Index Scriptorium Estoniae

Leijen, Äli, 1979-

2013-01-01

Aineõpetaja magistriõppe üliõpilaste seas läbi viidud uurimusest, milles vaadeldakse, kuidas üliõpilased koordineerivad personaalset ja professionaalset mina-positsiooni erialaste ambivalentsete olukordade kontekstis

17 CFR 232.306 - Foreign language documents and symbols.

Science.gov (United States)

2010-04-01

... symbols. 232.306 Section 232.306 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... § 232.306 Foreign language documents and symbols. (a) All electronic filings and submissions must be in... words or letters in the English language rather than representative symbols, except that HTML documents...

48 CFR 2452.232-71 - Voucher submission (cost-reimbursement).

Science.gov (United States)

2010-10-01

...-reimbursement). 2452.232-71 Section 2452.232-71 Federal Acquisition Regulations System DEPARTMENT OF HOUSING AND... Clauses 2452.232-71 Voucher submission (cost-reimbursement). As prescribed in 2432.908(c)(2), insert a clause substantially the same as the following in all cost-reimbursement solicitations and contracts...

Uncovering the skewness news impact curve

Czech Academy of Sciences Publication Activity Database

Anatolyev, Stanislav; Petukhov, A.

2016-01-01

Roč. 14, č. 4 (2016), s. 746-771 ISSN 1479-8409 Institutional support: PRVOUK-P23 Keywords : conditional skewness * news impact curve * stock returns Subject RIV: AH - Economics Impact factor: 1.800, year: 2016

Synthesis and study of the triphosphate salt LiSr2P3O10·8H2O

International Nuclear Information System (INIS)

Sotnikova-Yuzhik, V.A.; Peslyak, G.V.

1995-01-01

Lithium triphosphate interaction with strontium nitrate in aqueous solution at 0.3 mole% concentration and 20 deg C is studied. Formation of crystal hydrate LiSr 2 P 3 O 10 ·8H 2 O and amorphous phase of variable composition Li 2,5-0,5x P 3 O 10 ·6H 2 O (0.20≤x≤0.55) is determined. Data on the stability of binary lithium-strontium triphosphate at storage, sequence of chemical and phase transitions under heating are obtained. 5 refs., 4 figs., 3 tabs

Measurements of low photon doses using LiF:Mg,Cu,P and CaF{sub 2}:Cu dosimeters

Energy Technology Data Exchange (ETDEWEB)

Prokert, K [Dresden Univ. of Technology (Germany). Inst. of Radiation Protection Physics; Mann, G [Dresden Univ. of Technology (Germany). Inst. of Radiation Protection Physics

1997-03-01

The new thermoluminophors LiF:Mg, Cu, P and CaF{sub 2}:Cu in form of pellets exhibit a significantly higher TL-response than the well-known dosimeters of the types TLD-100 (LiF:Mg, Ti), TLD-400 (CaF{sub 2}:Mn), TLD-900 (CaSO{sub 4}:Dy), etc. Furthermore, the thermoluminophor LiF:Mg, Cu, P shows besides its high sensitivity a good tissue equivalence and therefore, only a small variation of the dose response with the photon energy. The lower limits of detection of these new materials are about 5 {mu}Gy and 0.2 {mu}Gy resp. Therefore, short term measurements of absorbed dose can be realised in radiation fields at very low dose rates (environmental radiation, scattering radiation at medical equipment`s etc.) with an accuracy of {+-}10%. In the field of environmental monitoring the period of exposure can be limited to about 10 days. Using CaF{sub 2}:Cu detectors an exposure of 24 hours is sufficient for dose measurements with lower accuracy. The reusability of CaF{sub 2}:Cu pellets is guaranteed without loss of sensitivity independently of the application of different reading and annealing procedures. In the case of LiF:Mg, Cu, P detectors special procedures are needed in order to keep constant TL-properties. The results of dose measurements at low dose levels in different radiation fields demonstrate the advantages of these detector types. (orig.)

Terrestrial P and Reactive N and Marine Productivity in the Late Devonian Appalachian Basin

Science.gov (United States)

Tuite, M. L.; Macko, S. A.

2009-12-01

A causal link between the Late Devonian emergence of forest ecosystems and episodic black shale deposition has been proposed by several authors. Most attribute increases in epicontinental basin productivity to elevated rates of terrestrial phosphorus weathering facilitated by the co-evolution of root systems and soils. Two reasons to suspect that an increase in the P weathering flux was not the primary cause of organic-rich shale deposition are as follows. First, most Late Devonian black shales were deposited during sea level transgressions, periods when riverine fluxes of sediment and mineral nutrients such as P to marine basins were diminished. Second, Late Devonian forests were restricted to warm, moist lowlands where P was sequestered in soils as inorganic, occluded forms. However, the export flux of reactive N from these forests to adjacent epeiric seas by riverine and atmospheric deposition was enhanced by the warm, wet climate and expanding areal extent of forests. Abundant terrestrial reactive N primed the marine eutrophication pump by extending the residence time of P in the photic zone, permitting extensive growth of primary biomass. The consequent flux of organic matter to the sea floor created anoxic bottom waters that, in turn, allowed for the remobilization of P into the water column. Based on abundance and isotopic analyses of organic and inorganic C, N, P, and S from terrestrial and marine environments within and adjacent to the Late Devonian Appalachian Basin, this latter scenario is supported.

17 CFR 232.308 - Type size and font; legibility.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Type size and font; legibility. 232.308 Section 232.308 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... § 232.308 Type size and font; legibility. Provisions relating to type size, font and other legibility...

The impact of delivery style on doctors' experience of stress during simulated bad news consultations.

Science.gov (United States)

Shaw, Joanne; Brown, Rhonda; Dunn, Stewart

2015-10-01

The purpose of this study was to investigate the relationship between doctors' bad news delivery style and their experience of physiological stress during simulated bad news consultations. 31 doctors participated in two simulated breaking bad news (BBN) consultations. Delivery style was categorized as either blunt, forecasting or stalling (i.e. avoidant), based on the time to deliver the bad news and qualitative analysis of the interaction content and doctor's language style. Doctors' heart rate (HR) and skin conductance (SC) were recorded in consecutive 30s epochs. Doctors experienced a significant decrease in HR (F(1,36)=44.9, p.05) or SC (F(2,48)=.66, p>.05). Doctors experience heightened stress in the pre-news delivery phase of breaking bad news interactions. Delaying the delivery of bad news exposes doctors to a longer period of increased stress.This suggests that medical students and doctors should be taught to deliver bad news without delay, to help mitigate their response to this stressful encounter. Copyright © 2015. Published by Elsevier Ireland Ltd.

Orientation and alignment of the first excited p state in Li+He and Na+He scattering

International Nuclear Information System (INIS)

Archer, B.J.; Lane, N.F.; Kimura, M.

1990-01-01

Orientation and alignment parameters for the first excited p state of Li and Na in collisions with He through direct excitation from the ground state are studied theoretically in the energy region up to E c.m. =100 keV by using a quasi-one-electron theory. Scattering states are expanded in terms of molecular orbitals, which are calculated by using the pseudopotential method and include electron translation factors. The approach appears to work well for Li+He, giving good agreement for the 2p excitation probability and orientation. For alignment, the situation is less clear because of difficulty in experimental measurement. Two-electron effects and cascades from more highly excited states cause our description of Na+He collisions to be less satisfactory. However, agreement with the experimental 3p excitation probability and orientation parameters where all data are available is fairly good at lower energies (E c.m. 1.25 a.u.)

News of the Year.

Science.gov (United States)

St. Lifer, Evan; Olson, Renee; Margolis, Rick; Glick, Andrea; Milliot, Jim

1999-01-01

Includes the following reports: "'LJ' (Library Journal) News Report: Libraries Success at Funding Books and Bytes"; "'SLJ' (School Library Journal) News Report: We're in the Money!"; and "'PW' (Publishers Weekly) News Reports". (AEF)

Effects of microplasma arc AISI 316L welds on the corrosion behaviour of pipelines in LiBr cooling systems

International Nuclear Information System (INIS)

Sánchez-Tovar, R.; Montañés, M.T.; García-Antón, J.

2013-01-01

Highlights: •SECM tests reveal differences in electrochemical activity of base and welded alloys. •The highest electrochemical activity is obtained for the welded alloy. •Microplasma arc welding process hinders passivation in lithium bromide. •Microplasma arc welding increases corrosion rate and susceptibility to pitting. •The galvanic pair between base and welded alloys in LiBr is weak. -- Abstract: The effect of microplasma arc welding (MPAW) on the electrochemical and corrosion behaviour of AISI 316L stainless steel tubes has been studied. Scanning electrochemical measurements were performed in sodium chloride to evaluate the difference in the electrochemical activity of base (non-welded) and welded samples. Oxygen reduction rates increase in AISI 316L due to the heat treatment effect induced by welding, indicating a higher electrochemical activity in the welded samples. Additionally, the use of MPA weldments in lithium bromide (LiBr) absorption machines was also analysed at typical operating temperatures and Reynolds numbers. The welding process increases corrosion rates, hinders passivation and increases the susceptibility to pitting attack in LiBr. However, zero-resistance ammeter and localization index measurements show that the galvanic pair generated between the base and welded alloys is weak, both electrodes being in their passive state. Temperature greatly affects the corrosion process

Arousing news characteristics in Dutch television news 1990-2004: an exploration of competitive strategies

NARCIS (Netherlands)

Hendriks Vettehen, P.; Beentjes, J.; Nuijten, K.; Peeters, A.

2011-01-01

This study investigates the processes by which competition in the television news market might promote the presence of arousing characteristics in television news. A total of 3,024 news stories from six Dutch television news programs over the period 1990 to 2004 were investigated through content

Arousing news characteristics in Dutch television news 1990-2004: An exploration of competitive strategies

NARCIS (Netherlands)

Hendriks Vettehen, P.G.J.; Beentjes, J.W.J.; Nuijten, C.M.; Peeters, A.L.

2011-01-01

This study investigates the processes by which competition in the television news market might promote the presence of arousing characteristics in television news. A total of 3,024 news stories from six Dutch television news programs over the period 1990 to 2004 were investigated through content

Crystal structures and theoretical studies of polyphosphate LiZnP3O9 for nonlinear optical applications

Science.gov (United States)

Xie, Zhiqing; Su, Xin; Ding, Hanqin; Li, Hongyi

2018-06-01

Nonlinear optical materials have attracted worldwide attention owing to their wide range of applications, specially in the laser field. Phosphates with noncentrosymmetric structures are potential candidates for novel ultraviolet (UV)-NLO materials, because they usually display short UV cut-off edges. In this work, a polyphosphate, the LiZnP3O9 polyphosphate crystals were grown through spontaneous crystallization from high-temperature melts. It crystallizes in the orthorhombic space group P212121 with unit cell parameters a = 8.330(3) Å, b = 8.520(3) Å, c = 8.635(3) Å, and Z = 4. In the structure, all the P atoms are coordinated by four oxygen atoms forming the [PO4] tetrahedra and further connected to generate a zig-zag [PO3]∞ anionic framework. Thermal analysis, IR spectroscopy, UV-vis-NIR diffuse reflectance spectrum and powder second harmonic generation measurements are performed. In addition, the first-principles calculation was employed for better understanding the structure-property relationships of LiZnP3O9.

Breaking the news or fueling the epidemic? Temporal association between news media report volume and opioid-related mortality.

Directory of Open Access Journals (Sweden)

Nabarun Dasgupta

2009-11-01

Full Text Available Historical studies of news media have suggested an association between reporting and increased drug abuse. Period effects for substance use have been documented for different classes of legal and illicit substances, with the suspicion that media publicity may have played major roles in their emergence. Previous analyses have drawn primarily from qualitative evidence; the temporal relationship between media reporting volume and adverse health consequences has not been quantified nationally. We set out to explore whether we could find a quantitative relationship between media reports about prescription opioid abuse and overdose mortality associated with these drugs. We assessed whether increases in news media reports occurred before or after increases in overdose deaths.Our ecological study compared a monthly time series of unintentional poisoning deaths involving short-acting prescription opioid substances, from 1999 to 2005 using multiple cause-of-death data published by the National Center for Health Statistics, to monthly counts of English-language news articles mentioning generic and branded names of prescription opioids obtained from Google News Archives from 1999 to 2005. We estimated the association between media volume and mortality rates by time-lagged regression analyses. There were 24,272 articles and 30,916 deaths involving prescription opioids during the seven-year study period. Nationally, the number of articles mentioning prescription opioids increased dramatically starting in early 2001, following prominent coverage about the nonmedical use of OxyContin. We found a significant association between news reports and deaths, with media reporting preceding fatal opioid poisonings by two to six months and explaining 88% (p<0.0001, df 78 of the variation in mortality.While availability, structural, and individual predispositions are key factors influencing substance use, news reporting may enhance the popularity of psychoactive

The U.S. Online News Coverage of Mammography Based on a Google News Search.

Science.gov (United States)

Young Lin, Leng Leng; Rosenkrantz, Andrew B

2017-12-01

To characterize online news coverage relating to mammography, including articles' stance toward screening mammography. Google News was used to search U.S. news sites over a 9-year period (2006-2015) based on the search terms "mammography" and "mammogram." The top 100 search results were recorded. Identified articles were manually reviewed. The top 100 news articles were from the following sources: local news outlet (50%), national news outlet (24%), nonimaging medical source (13%), entertainment or culture news outlet (6%), business news outlet (4%), peer-reviewed journal (1%), and radiology news outlet (1%). Most common major themes were the screening mammography controversy (29%), description of a new breast imaging technology (23%), dense breasts (11%), and promotion of a public screening initiative (11%). For the most recent year, article stance toward screening mammography was 59%, favorable; 16%, unfavorable; and 25%, neutral. After 2010, there was an abrupt shift in articles' stances from neutral to both favorable and unfavorable. A wide range of online news sources addressed a range of issues related to mammography. National, rather than local, news sites were more likely to focus on the screening controversy and more likely to take an unfavorable view. The controversial United States Preventive Services Task Force guidelines may have influenced articles to take a stance on screening mammography. As such online news may impact public perception of the topic and thus potentially impact guideline adherence, radiologists are encouraged to maintain awareness of this online coverage and to support the online dissemination of reliable and accurate information. Copyright © 2017 The Association of University Radiologists. Published by Elsevier Inc. All rights reserved.

Discussion on some issues for near surface disposal of L/I LW sandy soil

International Nuclear Information System (INIS)

Yu Mingde

2006-01-01

It is possible that very low level waste (VLLW) is defined from among LLW and disposed of through a simple/easy engineering method. Enhancing the barrier-function of buffer/backfill material will be favorable in a long-term way for controlling long-lived α-nuclides in near field. Designing the trench cover must suit measures to local conditions and lay stress on the key points. For long-term and efficacious supervision on L/I LW disposal facilities, it is very important to change managing ideologies. (authors)

Thrilling News Revisited: The Role of Suspense for the Enjoyment of News Stories.

Science.gov (United States)

Kaspar, Kai; Zimmermann, Daniel; Wilbers, Anne-Kathrin

2016-01-01

Previous research on news perception has been dominated by a cognitively oriented perspective on reception processes, whereas emotions have been widely neglected. Consequently, it has remained open which features of a news story might elicit affective responses and hence modulate news perception, shifting the focus to the emotional potential of the narrative. According to the affective-disposition theory, the experience of suspense is the striving force of immersion in fictional dramas. Thereby, a positive affective disposition toward the protagonist of a story and a high likelihood of a bad ending should increase suspense that, in turn, should positively influence reading appreciation and lingering interest in the story. We investigated whether suspense and its determinants also play such a key role in the context of news stories. Study 1 ( n = 263) successfully replicated results of an earlier study, whereas Studies 2 ( n = 255) and 3 ( n = 599) challenged the generalizability of some effects related to manipulated characteristics of a news story. In contrast, correlational relationships between perceived news characteristics and news evaluation were relatively stable. In particular, participants' liking of the protagonist and the perceived likelihood of a good ending were positively associated with suspense, reading appreciation, and lingering interest. This result indicates a preference for happy endings and contradicts the notion that likely negative outcomes are beneficial for suspense and the enjoyment of news stories, as postulated by the affective-disposition theory in the context of fictional dramas. Moreover, experienced suspense reliably mediated the correlations between, on the one hand, participants' liking of the protagonist and the perceived likelihood of a good ending and, on the other hand, reading appreciation and lingering interest. The news story's personal relevance was less influential than expected. Further, we observed a large absence of

Study and characterization of dosimeter LiF:Mg,Cu,P for using in aeronautical dosimetry; Estudo e caracterizacao do dosimetro de LiF:Mg,Cu,P para utilizacao em dosimetria aeronautica

Energy Technology Data Exchange (ETDEWEB)

Flavia, Hanna, E-mail: hannasantana.f@gmail.com [Universidade Paulista (UNIP), Sao Jose dos Campos, SP (Brazil); Federico, Claudio; Lelis, Odair; Pereira, Heloisa; Pereira, Marlon, E-mail: claudiofederico@ieav.cta.br [Instituto de Estudos Avancados (EFA-A/IEAV), Sao Jose dos Campos, SP (Brazil). Div. de Fisica Aplicada

2014-07-01

The effects of cosmic ionizing radiation incidents in aircraft components and crews has been a source of concern and motivated increasingly studies and improvements in the area. The low dose rates involved in this radiation field in aircraft flight altitudes imply Dosimetric necessity of using materials with high efficiency of detection, to enable studies lower cumulative doses resulting in shorter routes or lower altitude. The choice of thermoluminescent dosimeters LiF: Mg, Cu, P was done by having a detection efficiency of about fifteen times higher than its predecessor (LiF: Mg, Ti), and therefore, applied in very low doses dosimetry, and environmental dosimetry . The implementation of the use of pair dosimetric TLD-600H and 700H-TLD will serve as support for testing and studies on the effects of low doses of cosmic radiation in environmental dosimetry applied in the aviation environment in the usual flight altitudes. In this paper are presented the results of development of a methodology for dosimetry low doses of gamma radiation and neutrons using the pair dosimetric TLD-600H and 700H-TLD. The results demonstrate a sensitivity of dosimeters well above the dosimeters LiF: Mg, Ti confirming its suitability for dosimetry of low doses.

Reactions of R(2)P-P(SiMe(3))Li with [(R'(3)P)(2)PtCl(2)]. A general and efficient entry to phosphanylphosphinidene complexes of platinum. Syntheses and structures of [(eta(2)-P=(i)Pr(2))Pt(p-Tol(3)P)(2)], [(eta(2)-P=(t)Bu(2))Pt(p-Tol(3)P)(2)], [{eta(2)-P=(N(i)Pr(2))(2)}Pt(p-Tol(3)P)(2)] and [{(Et(2)PhP)(2)Pt}(2)P(2)].

Science.gov (United States)

Domańska-Babul, Wioleta; Chojnacki, Jaroslaw; Matern, Eberhard; Pikies, Jerzy

2009-01-07

The reactions of lithium derivatives of diphosphanes R(2)P-P(SiMe(3))Li (R = (t)Bu, (i)Pr, Et(2)N and (i)Pr(2)N) with [(R'(3)P)(2)PtCl(2)] (R'(3)P = Et(3)P, Et(2)PhP, EtPh(2)P and p-Tol(3)P) proceed in a facile manner to afford side-on bonded phosphanylphosphinidene complexes of platinum [(eta(2)-P=R(2))Pt(PR'(3))(2)]. The related reactions of Ph(2)P-P(SiMe(3))Li with [(R'(3)P)(2)PtCl(2)] did not yield [(eta(2)-P=PPh(2))Pt(PR'(3))(2)] and resulted mainly in the formation of [{(R'(3)P)(2)Pt}(2)P(2)], Ph(2)P-PLi-PPh(2), (Me(3)Si)(2)PLi and (Me(3)Si)(3)P. Crystallographic data are reported for the compounds [(eta(2)-P=R(2))Pt(p-Tol(3)P)(2)] (R = (t)Bu, (i)Pr, ((i)Pr(2)N)(2)P) and for [{(Et(2)PhP)(2)Pt}(2)P(2)].

Networks in the news media

DEFF Research Database (Denmark)

Bro, Peter

more formal types of social networks, but also complement or even substitute social networking elsewhere, and as such this particular type of social network offers people both inside and outside the news room new potentials - and problems. This article describe the basic vision of networks in the news......When news reporters connect people in a single news story or in a series of coherent news stories they essentially construct networks in the news media. Networks through which social actors are aligned symbolically in written, visible or audible form. These socio-symbolic networks not only copy...

48 CFR 232.501-3 - Contract price.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contract price. 232.501-3... 232.501-3 Contract price. (b) The contracting officer may approve progress payments when the contract price exceeds the funds obligated under the contract, provided the contract limits the Government's...

How Television News Programs Use Video News Releases.

Science.gov (United States)

Harmon, Mark D.; White, Candace

2001-01-01

Examines actual use in television news broadcasts of video news releases (VNRs). Finds that all sizes of markets were likely to use VNRs. Finds that the most common use was as a voice-over story in an early evening newscast, and that VNRs associated with children and their safety or health got the greatest number of uses. (SR)

Quaternary system LiF-LiCl-LiVO3-Li2MoO4

International Nuclear Information System (INIS)

Anipchenko, B.V.; Garkushin, I.K.

2000-01-01

Interactions in the LiF-LiCl-LiVO 3 -Li 2 MoO 4 system are studied by differential thermal analysis. Rate of heating/cooling of the samples comprised 15 Grad/min, mass of sample composed 0.2 g. The system was investigated in the 300-650 Deg C range. X-ray diffraction method was used for determination of purity of the reagents. Composition and temperature of quaternary component eutectics are determined: 16.5 mol. % of LiF, 47.0 mol. % of LiCl, 28.8 mol. % of LiVO 3 , 7.6 mol. % of Li 2 MoO 4 ; 387 Deg C. Mean value of melting enthalpy of quaternary eutectics mixture in the LiF-LiCl-LiVO 3 -Li 2 MoO 4 system on the results of the tests was in the range of 222 kJ/kg [ru

24 CFR 232.840 - Date of default.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Date of default. 232.840 Section 232.840 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued....840 Date of default. In computing loan insurance benefits, the date of default shall be considered as...

Brain perfusion image using N-isopropyl-p-(/sup 123/I) iodoamphetamine. Detection of interhemispheric difference

Energy Technology Data Exchange (ETDEWEB)

Matsuda, Hiroshi; Seki, Hiroyasu; Ishida, Hiroko

1984-12-01

In brain perfusion images using N-isopropyl-p-(/sup 123/I)iodoamphetamine and rotating gamma camera emission computed tomography, brain maps showing laterality indices (LI) were made for the purpose of detecting intrahemispheric differences. Left (L) and right (R) leteral images were made by adding sagittal section images in each hemisphere, respectively. LI was calculated as follows. LI=100(1 + (R-L)/(R + L)). The normal ranges (mean +- 2 s.d.) of the indices determined by those obtained in five normal right-handed subjects were 103 +- 4 and 103 +- 10 for brain mean and each pixel, respectively. Out of 25 measurements in 22 right-handed patients with cerebrovascular accidents, brain mean LI beyond the normal limits and areas showing abnormal regional LI were observed in 5 (20%) and 21 (84%) measurements, respectively. On the other hand, X-ray CT showed low density areas in only 12 (48%). These brain maps were clinically useful for detecting and quantifying interhemispheric differences in brain perfusion images with N-isopropyl-p-(/sup 123/I)iodoamphetamine. (author). Contains 48 refs.

Alpha spectrometry of environmental and food samples with photon/electron-rejecting alpha liquid-scintillation (P.E.R.A.L.S.)

International Nuclear Information System (INIS)

Zehringer, M.; Stockli, M.

2006-01-01

Full text: In environmental and food monitoring radio-nuclides are normally analysed with gamma spectrometry. Routine analysis of cesium nuclides can be realised fast and without much sample preparation. Also a few nuclides of the uranium- and thorium-series can be detected with gamma spectrometry at the low Bq/kg level. 226 Ra, 224 Ra and 228 Ra can be determined via their decay products when secular equilibrium of the sample is reached (e.g. 226 Ra via its daughters 214 Pb and 214 Bi). Alpha spectrometry is the method of choice for the determination of alpha nuclides in the mBq range. The analytes have to be separated from interfering nuclides and quenching parameters prior to the spectrometry. So, the main ask in alpha spectrometry consists in an efficient sample preparation and an alpha/beta discrimination for the spectrometric measurement. Based on the work of Jack McDowell sensitive methods for the analyses of naturally occurring nuclides such as uranium, thorium, polonium and other alpha-nuclides in water, honey and spices were developed and validated [1]. Such techniques enables the tolerance and limit values for radionuclides in food to be controlled in accordance with of the Swiss Ordinance on contaminants and Ingredients (FIV) [2] he method principle is based on a selective extraction of the alpha nuclides rom water samples rsp. from an aqueous extract of mineralized samples. The extractant has also the function of a cocktail in the alpha liquid spectrometry nd therefore the extract can be analysed directly without further clean -up Photon/Electron-Rejecting Alpha-Liquid-Scintillation, P.E.R.A.L..S. [1]). Normally, one liter of water sample is extracted with 5 ml of cocktail to achieve low detection limits. The cocktail phase is separated from the aqueous phase by use of a phase separator for liquid samples. Methods were developed for the analyses of 234 U and 238 U, the thorium nuclides 228 Th, 230 Th, 232 Th and other alpha nuclides. The achieved

Structure and Ionic Conductivity of Li2S-P2S5 Glass Electrolytes Simulated with First-Principles Molecular Dynamics

Directory of Open Access Journals (Sweden)

Takeshi eBaba

2016-06-01

Full Text Available Lithium thiophosphate-based materials are attractive as solid electrolytes in all-solid-state lithium batteries because glass or glass-ceramic structures of these materials are associated with very high conductivity. In this work, we modeled lithium thiophosphates with amorphous structures and investigated Li+ mobilities by using molecular dynamics calculations based on density functional theory (DFT-MD. The structures of xLi2S-(100 - xP2S5 (x = 67, 70, 75, and 80 were created by randomly identifying appropriate compositions of Li+, PS43-, P2S74-, and S2- and then annealing them with DFT-MD calculations. Calculated relative stabilities of the amorphous structures with x = 67, 70, and 75 relative to crystals with the same compositions were 0.04, 0.12, and 0.16 kJ/g, respectively. The implication is that these amorphous structures are metastable. There was good agreement between calculated and experimental structure factors determined from X-ray scattering. The differences between the structure factors of amorphous structures were small, except for the first sharp diffraction peak, which was affected by the environment between Li and S atoms. Li+ diffusion coefficients obtained from DFT-MD calculations at various temperatures for picosecond simulation times were on the order of 10-3 - 10-5 Angstrom2/ps. Ionic conductivities evaluated by the Nernst-Einstein relationship at 298.15 K were on the order of 10-5 S/cm. The ionic conductivity of the amorphous structure with x = 75 was the highest among the amorphous structures because there was a balance between the number density and diffusibility of Li+. The simulations also suggested that isolated S atoms suppress Li+ migration.

NERSC News

Science.gov (United States)

NERSC Powering Scientific Discovery Since 1974 Login Site Map | My NERSC search... Go Home About Scheduled Outages Login Node Status My NERSC Now Computing Highlights Timeline News & Publications News Coming to NERSC Login Page May 21, 2018 NERSC rolls out a redesigned login page on June 11. Read More Â

48 CFR 1552.232-74 - Payments-simplified acquisition procedures financing.

Science.gov (United States)

2010-10-01

... acquisition procedures financing. 1552.232-74 Section 1552.232-74 Federal Acquisition Regulations System... Provisions and Clauses 1552.232-74 Payments—simplified acquisition procedures financing. As prescribed in... acquisition procedures financing. Payments—Simplified Acquisition Procedures Financing (JUN 2006) Simplified...

Trap assisted charge multiplication enhanced photoresponse of Li-P codoped p-ZnO/n-Si heterojunction ultraviolet photodetectors

Science.gov (United States)

Sharma, Pankaj; Bhardwaj, Ritesh; Kumar, Amitesh; Mukherjee, Shaibal

2018-01-01

In this work, we report a high-performance p-ZnO/n-Si heterojunction-based ultraviolet (UV) photodetector fabricated by dual ion beam sputter deposition. The lithium-phosphorus (Li-P) codoping route was used to realize low resistive and stable p-type ZnO. The current-voltage characteristics of p-ZnO/n-Si heterojunction photodiode showed good rectifying behavior with a rectification ratio of 170 at  ±3 V. The spectral response measurements of the photodiode showed excellent responsivity with a peak observed around ~325 nm and cutoff wavelength around 370 nm. The maximum responsivity achieved was 2.6 A W-1 at an applied reverse bias of  -6 V. The external quantum efficiency determined was of the order of ~1000% which is attributed to the trap assisted multiplication of charge carriers.

Thrilling news revisited: The role of suspense for the enjoyment of news stories

Directory of Open Access Journals (Sweden)

Kai Kaspar

2016-12-01

Full Text Available Previous research on news perception has been dominated by a cognitively oriented perspective on reception processes, whereas emotions have been widely neglected. Consequently, it has remained open which features of a news story might elicit affective responses and hence modulate news perception, shifting the focus to the emotional potential of the narrative. According to the affective-disposition theory, the experience of suspense is the striving force of immersion in fictional dramas. Thereby, a positive affective disposition toward the protagonist of a story and a high likelihood of a bad ending should increase suspense that, in turn, should positively influence reading appreciation and lingering interest in the story. We investigated whether suspense and its determinants also play such a key role in the context of news stories. Study 1 (n = 263 successfully replicated results of an earlier study, whereas Studies 2 (n = 255 and 3 (n = 599 challenged the generalizability of some effects related to manipulated characteristics of a news story. In contrast, correlational relationships between perceived news characteristics were relatively stable. In particular, a higher liking of the protagonist and a higher perceived likelihood of a good versus bad ending were positively associated with suspense, reading appreciation, and lingering interest. This result indicates a preference for happy endings and it contradicts the notion that likely negative outcomes are beneficial for suspense and the enjoyment of news stories, as postulated by the affective-disposition theory in the context of fictional dramas. Moreover, experienced suspense reliably mediated the correlations between, on the one hand, participants’ liking of the protagonist and the perceived likelihood of a good ending and, on the other hand, reading appreciation and lingering interest. The news story’s personal relevance was less influential than expected. Further, we observed a large

News/Press Releases

Data.gov (United States)

Office of Personnel Management — A press release, news release, media release, press statement is written communication directed at members of the news media for the purpose of announcing programs...

Elastic, dynamical, and electronic properties of LiHg and Li3Hg: First-principles study

Science.gov (United States)

Wang, Yan; Hao, Chun-Mei; Huang, Hong-Mei; Li, Yan-Ling

2018-04-01

The elastic, dynamical, and electronic properties of cubic LiHg and Li3Hg were investigated based on first-principles methods. The elastic constants and phonon spectral calculations confirmed the mechanical and dynamical stability of the materials at ambient conditions. The obtained elastic moduli of LiHg are slightly larger than those of Li3Hg. Both LiHg and Li3Hg are ductile materials with strong shear anisotropy as metals with mixed ionic, covalent, and metallic interactions. The calculated Debye temperatures are 223.5 K and 230.6 K for LiHg and Li3Hg, respectively. The calculated phonon frequency of the T2 g mode in Li3Hg is 326.8 cm-1. The p states from the Hg and Li atoms dominate the electronic structure near the Fermi level. These findings may inspire further experimental and theoretical study on the potential technical and engineering applications of similar alkali metal-based intermetallic compounds.

Who Makes The News?

DEFF Research Database (Denmark)

Jørndrup, Hanne; Bentsen, Martine

As newsroom staff around the world went about their day on 25 March 2015, hundreds of volunteers located in over 100 countries gathered to monitor their news media as part of the Fifth Global Media Monitoring Project (GMMP). The Global Media Monitoring Project (GMMP) is the world’s longest......-running and most extensive research on gender in the news media. It began in 1995 when volunteers in 71 countries around the world monitored women’s presence in their national radio, television and print news. The research revealed that only 17% of news subjects – the people who are interviewed or whom the news...... is about – were women. It found that gender parity was ‘a distant prospect in any region of the world. News [was] more often being presented by women but it [was] still rarely about women. Denmark participates in GMMP for the second time and both times we can recognize the global inequality in the Danish...

Dosimetry of beta particles using Li:Mg, Cu, P + Ptfe

International Nuclear Information System (INIS)

Olvera, L.; Azorin, J.; Rivera, T.

2003-01-01

This paper presents the experimental results of determining the thermoluminescence (Tl) response of LiF: Mg, Cu, P + Ptfe pellets excited with 90 Sr/ 90 Y beta radiation. The glow curve exhibited three peaks which appear at 121 C, 178 C and 217 C . Its relative sensitivity is 49 with respect to that of the TLD-100 dosemeter taken as a reference. The minimal dose that could be measured was 750 mGy. The Tl response as a function of dose was linear in the range of 0.7 mGy to 22.5 mGy. The study of the repeatability of the information contained in the pellets showed a standard deviation of 2 %. (Author)

Study of the reactions 9Be(p, α)6Li, 9Be(p,d)8Be from 300 keV to 900 keV

International Nuclear Information System (INIS)

Bertrand, F.; Grenier, G.; Pornet, J.

1968-10-01

The experimental results concerning the two reactions 9 Be(p,α) 6 Li and 9 Be(p,d) 8 Be from 300 to 900 keV are presented. The angular distribution, excitation and total cross-section curves are expressed in absolute values after a normalization carried out using results given by Weber, Davis and Marion. (authors) [fr

The computer-controlled GPIB-RS232 interface for data transmission

International Nuclear Information System (INIS)

Bai Xiaowei

1993-01-01

A kind of RS232-GPIB interface circuit is introduced, which provides communication between the serial system and the instrument with GPIB. Port P 1 of 8031 is used to select function mode as listener, talker or others. Under the control of a personal computer, the data communication is completed both in serial and the parallel modes

Breaking bad news of cancer diagnosis - Perception of the cancer patients in a rural community in Malaysia.

Science.gov (United States)

Bain, Mathew Gabriel; Lian, Cheah Whye; Thon, Chang Ching

2014-04-01

Breaking of bad news is an important component in the management of cancer patients. This study aimed to assess the perceptions of breaking bad news of cancer diagnosis. It was a cross-sectional study using Breaking Bad News Assessment Schedule (BAS) questionnaire on cancer patients in Serian district. Using snowballing sampling method, a total of 134 patients were interviewed face-to-face after the consent was obtained from each of the respondents. Data was entered and analyzed using SPSS version 19.0. Majority were comfortable with the current method of breaking bad news. The main aspects found to be the areas of concern were the importance of the usage of body language, management of time and identifying patients' key area of concerns. There were significant difference between sex and "information giving" (P = 0.028) and "general consideration" (P = 0.016) and also between "the age and setting the scene" (P = 0.042). Significant difference was also found between the types of cancer and "the setting of scene" (P = 0.018), "breaking bad news technique" (P = 0.010), "eliciting concerns" (P = 0.003) and "information giving" (P = 0.004). Good and effective communication skill of breaking bad news is vital in the management of cancer patients. As the incidence of new cases of cancer increase every year, breaking of bad news has become a pertinent to the medical professionals' role. Specific aspects of communication skills based on local characteristics should be more emphasized in the formulation of training for doctors.

Physical activity in persons with late effects of polio: a descriptive study.

Science.gov (United States)

Winberg, Cecilia; Flansbjer, Ulla-Britt; Carlsson, Gunilla; Rimmer, James; Lexell, Jan

2014-07-01

To promote a healthy and active lifestyle there is a need to increase our knowledge of the level of physical activity (PA) among people with late effects of polio. To examine PA in people with late effects of polio and to assess the relationship between PA, life satisfaction and various sociodemographic factors. PA was assessed in 81 persons with late effects of polio using the Physical Activity and Disability Survey (PADS) and by a pedometer. Life satisfaction was assessed with the Life Satisfaction Questionnaire (LiSat-11). The amount of PA varied considerably but on average the participants were physically active almost 3 h per day, mostly in household activities. The mean value of the pedometer counts was 6212 steps per day (SD = 3208). Sixty-nine percent of the participants rated themselves as satisfied with life as a whole. The sum of PADS was positively and significantly related to the number of steps (r = 0.39, p satisfaction with life (rho = 0.23, p satisfaction with life (rho = 0.37, p satisfaction and age further supports the general contention that an active lifestyle is an important factor for perceived well-being among older people. Copyright © 2014 Elsevier Inc. All rights reserved.

Navigating cross-media news use

DEFF Research Database (Denmark)

Swart, Joëlle; Peters, Chris; Broersma, Marcel

2017-01-01

distinctive cross-media repertoires, and what makes these compositions meaningful. This article analyzes the value of different platforms, genres and practices in everyday life by mapping patterns of cross-media news use. Combining Q methodology with think-aloud protocols and day-in-the-life-interviews, five...... distinct news media repertoires are identified: 1) regionally-oriented 2) background-oriented 3) digital 4) laid-back and 5) nationally-oriented news use. Our findings indicate that users do not always use what they prefer, nor do they prefer what they use. Moreover, the boundaries they draw between news......The current news media landscape is characterized by an abundance of digital outlets and increased opportunities for users to navigate news themselves. Yet, it is still unclear how people negotiate this fluctuating environment to decide which news media to select or ignore, how they assemble...

24 CFR 232.830 - Definition of default.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definition of default. 232.830... Insurance § 232.830 Definition of default. (a) If the borrower fails to make any payments due under or... default for the purposes of this subpart. (b) The failure to perform any other covenant under the note or...

Large-angle quasi-free scattering in the 6Li(p,pd)4He at 670 MeV

International Nuclear Information System (INIS)

Albrecht, D.; Csatlos, M.

1979-01-01

The 6 Li(p,pd) 4 He reaction was investigated at 670 MeV by a coincidence experiment at large-angle scattering geometry. Energy distributions, cross sections and angular correlations of the reaction products have been measured. Momentum distribution of the recoil nucleus has been determined for transitions leading to residual nucleus in the ground and excited states. Results were analyzed in terms of the simplified distorted wave impulse approximation using the cluster model and three-body wave functions. The observed momentum distribution of the pn pair in the p shell of 6 Li is in agreement with three-body calculations. The spectroscopic factor is larger than predicted by theory. Transitions in the ground and excited states of the α-particle also have the characteristics of quasi-free scattering on deuteron clusters

Structure and Ionic Conductivity of Li2S–P2S5 Glass Electrolytes Simulated with First-Principles Molecular Dynamics

International Nuclear Information System (INIS)

Baba, Takeshi; Kawamura, Yoshiumi

2016-01-01

Lithium thiophosphate-based materials are attractive as solid electrolytes in all-solid-state lithium batteries because glass or glass-ceramic structures of these materials are associated with very high conductivity. In this work, we modeled lithium thiophosphates with amorphous structures and investigated Li + mobilities by using molecular dynamics calculations based on density functional theory (DFT-MD). The structures of xLi 2 S–(100 − x)P 2 S 5 (x = 67, 70, 75, and 80) were created by randomly identifying appropriate compositions of Li + , PS 4 3− ,P 2 S 7 4− , and S 2− and then annealing them with DFT-MD calculations. Calculated relative stabilities of the amorphous structures with x = 67, 70, and 75 to crystals with the same compositions were 0.04, 0.12, and 0.16 kJ/g, respectively. The implication is that these amorphous structures are metastable. There was good agreement between calculated and experimental structure factors determined from X-ray scattering. The differences between the structure factors of amorphous structures were small, except for the first sharp diffraction peak, which was affected by the environment between Li and S atoms. Li + diffusion coefficients obtained from DFT-MD calculations at various temperatures for picosecond simulation times were on the order of 10 −3 –10 −5 Å 2 /ps. Ionic conductivities evaluated by the Nernst–Einstein relationship at 298.15 K were on the order of 10 −5 S/cm. The ionic conductivity of the amorphous structure with x = 75 was the highest among the amorphous structures because there was a balance between the number density and diffusibility of Li + . The simulations also suggested that isolated S atoms suppress Li + migration.

News coverage of climate change in Nature News and ScienceNOW during 2007

DEFF Research Database (Denmark)

Nielsen, Kristian Hvidtfelt; Kjærgaard, Rikke Schmidt

2011-01-01

of appreciating climate change, its severe consequences, and its anthropogenic causes. During that year the two journals’ online news services Nature News and ScienceNOW framed climate change to fit particular agendas resulting in markedly different narratives. This article demonstrates that Nature News reported...... more critically on political decisions, scientific results, and social matters of climate change compared to ScienceNOW. Operating under different institutional constraints ScienceNOW generally took a more cautious line. The evidence drawn from both textual and visual analyses shows that news sections...

The P-A-C-I-E-N-T-E Protocol: An instrument for breaking bad news adapted to the Brazilian medical reality

Directory of Open Access Journals (Sweden)

Carolina Rebello Pereira

Full Text Available Summary Objective: There are plenty of published tools for breaking bad medical news; however, none of them is culturally appropriate to our reality or published in the Brazilian literature. This study proposes a genuinely Brazilian communication tool and evaluates its acceptance among doctors and nurses. Method: This was a prospective study. The data were collected after specific training of doctors and nurses on the bad news communication techniques based on the P-A-C-I-E-N-T-E ("patient," in Portuguese Protocol. This instrument is in accordance with the Brazilian reality and was based on the SPIKES communication tool. Results: The worst task to be performed during communication is "talking about death" followed by "discussing the end of curative treatment attempts" and "diagnosis" itself. Among the respondents, 48% reported they did not receive formal training for communicating. Also, 52% of respondents do not use any systematic approach in their daily practice when communicating with patients, but 97% considered the proposed P-A-C-I-E-N-T-E Protocol as a useful and appropriate communication tool. Conclusion: The P-A-C-I-E-N-T-E Protocol proved to be suitable to the Brazilian context.

Levels of 232Th activity in the South Adriatic Sea marine environment of Montenegro

International Nuclear Information System (INIS)

Antovic, N.M.

2010-01-01

232 Th activities in the South Adriatic Sea-water, surface sediment, mud with detritus, seagrass (Posidonia oceanica) samples, and the mullet (Mugilidae) species Mugil cephalus, as well as soil and sand from the Montenegrin Coast, were measured using the six-crystal spectrometer PRIPYAT-2M, which has relatively high detection efficiency and a good sensitivity, and allows a short acquisition time, and measuring samples of any shape, without preliminary preparation and calibration measurements for different sample geometries. An average 232 Th activity concentration in surface soil layer is found to be 40.33 Bq kg -1 , while in sand-4.7 Bq kg -1 . The absorbed dose rate in air due to 232 Th gamma radiation from surface soil layer ranged from 11.76 to 63.39 nGy h -1 , with a mean of 24.06 nGy h -1 . Corresponding average annual effective dose rate has been found to be 0.03 mSv y -1 . The absorbed dose rates due to the thorium gamma radiation in air at 1 m above sand surface on the Montenegrin beaches have been found to be from 0.41 to 9.08 nGy h -1 , while annual effective dose rates ranged from 0.0005 to 0.011 mSv y -1 . 232 Th activity concentration in seawater ranged from 0.06 to 0.22 Bq L -1 , as in the mullet (Mugil cephalus) whole individuals from 0.63 to 1.67 Bq kg -1 . Annual intake of 232 Th by human consumers of this fish species has been estimated to provide an effective dose of about 0.003 mSv y -1 . (author)

The cosmic {sup 6}Li and {sup 7}Li problems and BBN with long-lived charged massive particles

Energy Technology Data Exchange (ETDEWEB)

Karsten, Jedamzik [Montpellier-2 Univ., Lab. de Physique Mathemathique et Theorique, C.N.R.S., 34 - Montpellier (France)

2007-07-01

Charged massive particles (CHAMPs), when present during the Big Bang nucleosynthesis (BBN) era, may significantly alter the synthesis of light elements when compared to a standard BBN scenario. This is due to the formation of bound states with nuclei. This paper presents a detailed numerical and analytical analysis of such CHAMP BBN. All reactions important for predicting light-element yields are calculated within the Born approximation. Three prior neglected effects are treated in detail: (a) photo destruction of bound states due to electromagnetic cascades induced by the CHAMP decay, (b) late-time efficient destruction/production of H{sup 2}, Li{sup 6}, and Li{sup 7} due to reactions on charge Z = 1 nuclei bound to CHAMPs, and (c) CHAMP exchange between nuclei. Each of these effects may induce orders-of-magnitude changes in the final abundance yields. The study focusses on the impact of CHAMPs on a possible simultaneous solution of the Li{sup 6} and Li{sup 7} problems. It is shown that a prior suggested simultaneous solution of the Li{sup 6} and Li{sup 7} problems for a relic decaying at {tau}{sub x} {approx} 1000 s is only very weakly dependent on the relic being neutral or charged, unless its hadronic branching ratio is B{sub h} << 10{sup -4} very small. By use of a Monte-Carlo analysis it is shown that within CHAMP BBN the existence of further parameter space for a simultaneous solution of the Li{sup 6} and Li{sup 7} problem for long decay times {tau}{sub x} {>=} 10{sup 6} s seems possible but fairly unlikely. (author)

Experimental investigation of highly excited states of the 5,6He and 5,6Li nuclei in the (6Li, 7Be) and (6Li, 7Li) one-nucleon-pick-up reactions

International Nuclear Information System (INIS)

Sakuta, S.B.; Novatskij, B.G.; Stepanov, D.N.; Aleksandrov, D.V.; Glukhov, Yu.A.; Nikol'skij, E.Yu.

2002-01-01

( 6 Li, 7 Be) and ( 6 Li, 7 Li) reactions on the 6 Li, 7 Li nuclei have been investigated in the angular range of 0-20 deg in laboratory system at the 93-MeV 6 Li energy. Besides low-lying states of 5,6 He and 5,6 Li nuclei, broad structures have been observed in the measured spectra close to the t( 3 He) + d and t( 3 He) + t threshold at excitation energies of 16.75 (3/2 + ) and ∼ 20 MeV ( 5 He), 16.66 (3/2 + ) and ∼ 20 MeV ( 5 Li), 14.0 and 25 MeV ( 6 He), and ∼ 20 MeV ( 6 Li). Angular distributions, which have been measured for transitions to the ground (0 + ) and exited states at E x =1.8 MeV (2 + ) and 14.0 MeV of the 6 He nucleus in the 7 Li( 6 Li, 7 Be) 6 He reaction, have been analyzed in the framework of the finite-range distorted-waves method assuming the 1p- and 1s-proton pick-up mechanism. It has been shown that ( 6 Li, 7 Be) and ( 6 Li, 7 Li) reactions predominately proceed by one-step pick-up mechanism and broad structures which are observed at high excitation energies should be considered as quasimolecular states of the t( 3 He) + d and t( 3 He) + t type [ru

Cascading Corruption News

DEFF Research Database (Denmark)

Damgaard, Mads

2018-01-01

Through a content analysis of 8,800 news items and six months of front pages in three Brazilian newspapers, all dealing with corruption and political transgression, this article documents the remarkable skew of media attention to corruption scandals. The bias is examined as an information...... phenomenon, arising from systemic and commercial factors of Brazil’s news media: An information cascade of news on corruption formed, destabilizing the governing coalition and legitimizing the impeachment process of Dilma Rousseff. As this process gained momentum, questions of accountability were disregarded...

A test of rivaling approaches to explain news effects: A multi-wave panel study of agenda setting, social and economic conditions, the tone of the news, and horse race news

NARCIS (Netherlands)

Kleinnijenhuis, J.; van Hoof, A.M.J.; Oegema, D.; de Ridder, J.A.

2007-01-01

Different "paradigmatic" approaches to explain news effects on voting may supplement each other, because their starting points are based on different news types in political campaign news: news on issue positions of parties, news on real-world developments, news on support or criticism for parties,

48 CFR 52.232-31 - Invitation To Propose Financing Terms.

Science.gov (United States)

2010-10-01

... Financing Terms. 52.232-31 Section 52.232-31 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.232-31 Invitation To Propose Financing Terms. As prescribed in 32.205(b) and 32.206, insert the following provision: Invitation To Propose Financing Terms (OCT 1995) (a) The offeror is invited to propose...

The first row anomaly and recoupled pair bonding in the halides of the late p-block elements.

Science.gov (United States)

Dunning, Thom H; Woon, David E; Leiding, Jeff; Chen, Lina

2013-02-19

The dramatic differences between the properties of molecules formed from the late p-block elements of the first row of the periodic table (N-F) and those of the corresponding elements in subsequent rows is well recognized as the first row anomaly. Certain properties of the atoms, such as the relative energies and spatial extents of the ns and np orbitals, can explain some of these differences, but not others. In this Account, we summarize the results of our recent computational studies of the halides of the late p-block elements. Our studies point to a single underlying cause for many of these differences: the ability of the late p-block elements in the second and subsequent rows of the periodic table to form recoupled pair bonds and recoupled pair bond dyads with very electronegative ligands. Recoupled pair bonds form when an electron in a singly occupied ligand orbital recouples the pair of electrons in a doubly occupied lone pair orbital on the central atom, leading to a central atom-ligand bond. Recoupled pair bond dyads occur when a second ligand forms a bond with the orbital left over from the initial recoupled pair bond. Recoupled pair bonds and recoupled pair bond dyads enable the late p-block elements to form remarkably stable hypervalent compounds such as PF(5) and SF(6) and lead to unexpected excited states in smaller halides of the late p-block elements such as SF and SF(2). Recoupled pair bonding also causes the F(n-1)X-F bond energies to oscillate dramatically once the normal valences of the central atoms have been satisfied. In addition, recoupled pair bonding provides a lower-energy pathway for inversion in heavily fluorinated compounds (PF(3) and PF(2)H, but not PH(2)F and PH(3)) and leads to unusual intermediates and products in reactions involving halogens and late p-block element compounds, such as (CH(3))(2)S + F(2). Although this Account focuses on the halides of the second row, late p-block elements, recoupled pair bonds and recoupled pair

Good Friends, Bad News

DEFF Research Database (Denmark)

Hansen, Lars Kai; Arvidsson, Adam; Nielsen, Finn Årup

. In this paper we explore the apparent paradox in a quantitative analysis of information diffusion on Twitter. Twitter is interesting in this context as it has been shown to present both the characteristics social and news media. The basic measure of virality in Twitter is the probability of retweet. Twitter...... is different from email in that retweeting does not depend on pre-existing social relations, but often occur among strangers, thus in this respect Twitter may be more similar to traditional news media. We therefore hypothesize that negative news content is more likely to be retweeted, while for non-news tweets...

Exploiting Tri-Relationship for Fake News Detection

OpenAIRE

Shu, Kai; Wang, Suhang; Liu, Huan

2017-01-01

Social media for news consumption is becoming popular nowadays. The low cost, easy access and rapid information dissemination of social media bring benefits for people to seek out news timely. However, it also causes the widespread of fake news, i.e., low-quality news pieces that are intentionally fabricated. The fake news brings about several negative effects on individual consumers, news ecosystem, and even society trust. Previous fake news detection methods mainly focus on news contents fo...

Tailor-Made News: Meeting the demands of news users on mobile and social media

NARCIS (Netherlands)

Groot Kormelink, T.; Costera Meijer, I.

2014-01-01

Despite the technological possibilities for portable, personalized, and participatory news use, the public has not turned en masse from passive receivers who consume news on the producers' terms, into active users who tailor news to fit their personal preferences and practices. Unmistakably, some

Cascading Corruption News

DEFF Research Database (Denmark)

Damgaard, Mads

2018-01-01

Through a content analysis of 8,800 news items and six months of front pages in three Brazilian newspapers, all dealing with corruption and political transgression, this article documents the remarkable skew of media attention to corruption scandals. The bias is examined as an information...... phenomenon, arising from systemic and commercial factors of Brazil’s news media: An information cascade of news on corruption formed, destabilizing the governing coalition and legitimizing the impeachment process of Dilma Rousseff. As this process gained momentum, questions of accountability were disregarded...... by the media, with harmful effects on democracy....

Ab initio study of ortho-meta-isomerism of Li4AB3+ ions of nitrite and phosphite oxo- and thiosalts (A=N, P; B=O, S)

International Nuclear Information System (INIS)

Charkin, O.D.; MakKi, M.L.; Charkin, O.P.

2000-01-01

In the framework of MP2(6-31*//HF/6-31G + ZPE(HF/6-31G*) and MP4SDTQ/6-31G*//MP2/6-31G* + ZPE(MP2/6-31G*) approximations ab initio calculations of surfaces of potential energy of Li 4 NO 3 + , Li 4 PO 3 + , Li 4 NS 3 + , LiPS 3 + ions and Li 3 NO 3 , Li 3 PO 3 , Li 3 NS 3 , Li 3 PS 3 molecules of lithium oxo-and thiosalts with 26 valent electrons. Several low-level energy local minimums are determined for each of these ions including (Li + ) 4 ·AB 3 3- ortho-structure of C 3V symmetry with pyramidal three-charge AB 3 3- anion and totality of meta-structures of L + ·AB 2 - ·BL 3 + ion type and AB 2 - ·BL 4 2+ ion pair of C 2V and C s symmetry with onium OLi 3 + , OLi 4 2+ cations or their thio-analogues. Equilibrium geometric parameters and relative energy of isomers, energy of different channels of decomposition, frequencies and IR-intensities of normal vibrations, characteristics of electron density distribution are determined [ru

AN UPDATED 6Li(p, α)3He REACTION RATE AT ASTROPHYSICAL ENERGIES WITH THE TROJAN HORSE METHOD

International Nuclear Information System (INIS)

Lamia, L.; Spitaleri, C.; Sergi, M. L.; Pizzone, R. G.; Tumino, A.; La Cognata, M.; Tognelli, E.; Degl'Innocenti, S.; Prada Moroni, P. G.; Pappalardo, L.

2013-01-01

The lithium problem influencing primordial and stellar nucleosynthesis is one of the most interesting unsolved issues in astrophysics. 6 Li is the most fragile of lithium's stable isotopes and is largely destroyed in most stars during the pre-main-sequence (PMS) phase. For these stars, the convective envelope easily reaches, at least at its bottom, the relatively low 6 Li ignition temperature. Thus, gaining an understanding of 6 Li depletion also gives hints about the extent of convective regions. For this reason, charged-particle-induced reactions in lithium have been the subject of several studies. Low-energy extrapolations of these studies provide information about both the zero-energy astrophysical S(E) factor and the electron screening potential, U e . Thanks to recent direct measurements, new estimates of the 6 Li(p, α) 3 He bare-nucleus S(E) factor and the corresponding U e value have been obtained by applying the Trojan Horse method to the 2 H( 6 Li, α 3 He)n reaction in quasi-free kinematics. The calculated reaction rate covers the temperature window 0.01 to 2T 9 and its impact on the surface lithium depletion in PMS models with different masses and metallicities has been evaluated in detail by adopting an updated version of the FRANEC evolutionary code.

Probabilities of symmetric and asymmetric fission in the proton bombardment of Th{sup 232}

Energy Technology Data Exchange (ETDEWEB)

Bowles, B J [Atomic Energy Research Establishment, Chemistry Div., Harwell (United Kingdom); Brown, F; Butler, J P

1957-08-01

The ratio of symmetric to asymmetric fission in the proton bombardment of Th{sup 232} does not rise steadily with increasing proton energy; a periodic decrease in superposed upon the over-all increase. This is attributed to the changing pattern of various fission reactions, (p,f), (p,nf), etc. (author)

News Authorship and News Sources: Impacts on Environmental Coverage in The Nigerian Press

Directory of Open Access Journals (Sweden)

Ogadimma C. Emenyeonu

2017-07-01

Full Text Available This study examines the impacts of news authorship and news sources on environmental coverage in the Nigerian press to shed light on the roles they play in news construction. The study finds that journalists in conjunction with policy makers are the catalyst for environmental information, whereas citizens who are pivotal in creating relevant public opinion on environmental issues are left behind. The study reveals that investigative reporting lacks in environmental coverage because most coverage are events driven which explains why environmental news is reported as straight news and as such journalists rely heavily on official sources rather than subsidiary sources. The study opines that for proper environmental coverage, journalists must choose sources from both main and subsidiary actors and revert to proactive, investigative and interpretive reporting so as to make environmental stories relatable to the intended audiences.

48 CFR 232.072-3 - Cash flow forecasts.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Cash flow forecasts. 232..., DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING 232.072-3 Cash flow forecasts. (a... contractor to submit a cash flow forecast covering the duration of the contract. (b) A contractor's inability...

Young people’s news orientations and uses of traditional and new media for news

NARCIS (Netherlands)

van Cauwenberge, A.; d'Haenens, L.; Beentjes, H.

2013-01-01

This article reports on Flemish college students’ news orientations and their uses of traditional and new media for news within a public service media environment. We used five homogeneous focus groups that covered variation in news media use. The analysis of the focus groups revealed major

Iraq’s Shia Warlords and Their Militias: Political and Security Challenges and Options

Science.gov (United States)

2015-06-01

military to seize the con- tested oil- rich Kirkuk area and other parts of Diyala. They fear further Kurdish expansion as additional ISIS-held...Al-Gharbiya News (Bagh- dad ), September 29, 2014, available from www.algharbiyanews. com/?p=37068; and Abd Al-Aziz Al-Ta’i, “Mutaqal sirri li-mil...Al-Wikala Al-Ikhbariya li’l-Anba’ (Bagh- dad ), October 15, 2014, available from www.ikhnews.com/index. php?page=article&id=130925. 102. “Khubara’ wa

Atomic scattering in the diffraction limit: electron transfer in keV Li+-Na(3s, 3p) collisions

International Nuclear Information System (INIS)

Poel, M van der; Nielsen, C V; Rybaltover, M; Nielsen, S E; Machholm, M; Andersen, N

2002-01-01

We measure angle differential cross sections (DCS) in Li + + Na → Li + Na + electron transfer collisions in the 2.7-24 keV energy range. We do this with a newly constructed apparatus which combines the experimental technique of cold target recoil ion momentum spectroscopy with a laser-cooled target. This setup yields a momentum resolution of 0.12 au, an order of magnitude better angular resolution than previous measurements on this system. This enables us to clearly resolve Fraunhofer-type diffraction patterns in the angle DCS. In particular, the angular width of the ring structure is given by the ratio of the de Broglie wavelength λ dB = 150 fm at a velocity v = 0.20 au and the effective atomic diameter for electron capture 2R = 20 au. Parallel AO and MO semiclassical coupled-channel calculations of the Na(3s, 3p) → Li(2s, 2p) state-to-state collision amplitudes have been performed, and quantum scattering amplitudes are derived by the eikonal method. The resulting angle-differential electron transfer cross sections and their diffraction patterns agree with the experimental level-to-level results over most scattering angles in the energy range

The news Engine

DEFF Research Database (Denmark)

Andersson, Ralf

for ideas etc. Reporters have limitedpossibilities for making own stories and less time for research - each live reportercovers 5-7 stories during a day. People : In a survey, most reporters replied that the new workflow was afundamental change of their work and had major impact on their identity......The News Engine How a new experiment in newsrooms can change process, product and people.   By Ralf Andersson   In fall 2012, the news department of the Danish Broadcasting Corporation,decided to implement a new workflow called ”The News Engine” - in order to workfaster, more freely, flexible...... and with fewer resources. This was done to raisethe productivity. The fundamental principle was that all stories should fit all platforms(content sharing) - and that no one did their own story anymore. DR News introduced 8-10 mobile live teams who are responsible for doinginterviews, record pictures and sound...

Composited reduced graphene oxide into LiFePO4/Li2SiO3 and its electrochemical impedance spectroscopy properties

Science.gov (United States)

Arifin, M.; Rus, Y. B.; Aimon, A. H.; Iskandar, F.; Winata, T.; Abdullah, M.; Khairurrijal, K.

2017-03-01

LiFePO4 is commonly used as cathode material for Li-ion batteries due to its stable operational voltage and high specific capacity. However, it suffers from certain disadvantages such as low intrinsic electronic conductivity and low ionic diffusion. This study was conducted to analyse the effect of reduced graphene oxide (rGO) on the electrochemical properties of LiFePO4/Li2SiO3 composite. This composite was synthesized by a hydrothermal method. Fourier transform infrared spectroscopy measurement identified the O-P-O, Fe-O, P-O, and O-Si-O- bands in the LiFePO4/Li2SiO3 composite. X-ray diffraction measurement confirmed the formation of LiFePO4. Meanwhile, Raman spectroscopy confirmed the number of rGO layers. Further, scanning electron microscopy images showed that rGO was distributed around the LiFePO4/Li2SiO3 particles. Finally, the electrochemical impedance spectroscopy results showed that the addition of 1 wt% of rGO to the LiFePO4/Li2SiO3 composite reduced charge transfer resistance. It may be concluded that the addition of 1 wt% rGO to LiFePO4/Li2SiO3 composite can enhance its electrochemical performance as a cathode material.

Angular distribution measurements of {sup 6}Li(p,{alpha}){sup 3}He reaction at 140 keV proton energy using nuclear track detectors

Energy Technology Data Exchange (ETDEWEB)

Al-Jarallah, M.I. E-mail: mibrahim@kfupm.edu.sa; Naqvi, A.A.; Abu-Jarad, F.A.; Fazal-ur-Rehman; Durrani, S.M.A.; Kidwai, S

2001-06-01

Angular distributions of a {sup 6}Li(p,{alpha}) {sup 3}He reaction were measured at six angles for 140 keV proton energy using nuclear track detectors (NTDs). The measurements were carried out over 60 deg. -160 deg. lab. angles in 20 deg. increments using a scattering chamber of 80 deg. beam line of the 350 kV accelerator. A semiconductor silicon surface barrier (SSB) detector was placed at +160 deg. and was used as a monitor. The results have shown that the CR-39 detector has excellent capabilities to distinguish 1.4-2.7 MeV {alpha}+ {sup 3}He particles from the {sup 6}Li(p,{alpha}) {sup 3}He reaction and 8-9.4 MeV {alpha}-particles from the {sup 7}Li(p,{alpha}) {sup 4}He reaction through their track diameters. However, it was not possible to distinguish between the 2.3 MeV {sup 3}He ions and the 1.7 MeV {sup 4}He ions from the {sup 6}Li(p,{alpha}) {sup 3}He reaction from their track diameter measurements, but it was possible to differentiate between the two, from the darker contrast of the {sup 3}He particles caused by its deeper tracks as compared to those of {sup 4}He.

Estimation of radionuclide concentration of 238U, 226Ra, 232Th in air in Wuhan city

International Nuclear Information System (INIS)

Shi Jinhua; Chen Changhua

1989-01-01

The concentrations of 238 U, 226 Ra and 232 Th in air in Wuhan area were estimated by assuming that they originate from resuspended particles of soil and investigating the dust content in air and the concentrations of these radionuclides in soil. 60 soil samples were collected from April to October, 1984, and 7346 air dust samples during 1981-1985. The estimated mean air concentrations of 238 U, 226 Ra and 232 Th were 24.0 x 10 -9 , 18.9 x 10 -9 and 28.7 x 10 -9 , Bq/L, respectively. Their highest values were observed of 30.4 x 10 -9 , 23.9 x 10 -9 and 36.2 x 10 -9 Bq/L in 1983. Seasonal change of the concentrations was clear as shown in the data of 1984 and 1985, which was related to the meterological conditions. Among the 6 districts of Wuhan city, the highest concentration was in Qingshan and the lowest in Wuchang

Magnetic field selective enhancement of Li I lines comparing Li II line in laser ablated lithium plasma at 10- 2 mbar air ambient gas

Science.gov (United States)

Liu, Ping; Wu, Ding; Sun, Liying; Hai, Ran; Liu, Jiamin; Ding, Hongbin

2017-11-01

In this paper, the effect of magnetic field (1.1 T) on the atomic and ionic spectral emission of a laser produced lithium plasma at low pressure has been investigated. The experimental results indicate that magnetic field enhances the intensities of Li I spectral lines but reduces the Li II spectral lines intensities. In this study, two narrowband filters were placed before the ICCD camera to observe the evolution feature of Li II spectral line (548.39 nm, 2p3P2,1,0 → 2s3S1) and Li I spectral line (610.30 nm, 3d2P3/2, 5/2 → 2p2P1/2, 3/2), respectively. The plasma dynamic images show that with the magnetic field, the number density of luminous Li atoms is higher, while the number density of luminous Li ions is lower in comparison to the field-free case. The reduced Li II spectral intensities indicate that the quenching rate of Li ions in the excited state is greater than that without the magnetic field. The enhanced impact frequency of recombination indicates that magnetic field increases the recombination process of electron and Li ions. All of these observations strongly suggest that magnetic confinement increases the recombination process of the electrons with Li ions in the plasma, which results in the decrease in the intensity of Li II line. The results are useful for applying laser-induced breakdown spectroscopy (LIBS) to in-situ diagnose the processes of lithium wall conditioning in EAST tokamak.

News media old and new

DEFF Research Database (Denmark)

Schrøder, Kim Christian

2014-01-01

This article presents and discusses three different approaches to the exploration of the cross-media challenges facing news audiences, as they seek access to, navigate in and make sense of the multitude of news sources across print, broadcasting, online and mobile media platforms. From a modernized...... uses and gratifications perspective, based on the notion of “worthwhileness” as the determinant of people's everyday selections from the “supermarket of news”, the article first reports from a longitudinal survey study in Denmark in which the author's foundational mapping of cross-media news...... consumption in pre-mobile 2008 is compared with replicating mappings carried out in 2011 and 2012, in a collaborative project between academics and news publishers. The analytical interest here focuses on the fluctuations between traditional news media and the surging digital news outlets of the internet...

Haber Etiği ve Bir Siyasi Haber İncelemesi / News Ethics and An Analysis of a Political News

Directory of Open Access Journals (Sweden)

Buğra KARDAN

2015-07-01

Full Text Available Medyada haber etiği ve habercilik ahlakı tartışmaları, medya tarihi kadar eski bir olgudur. İletişim teknolojisinin sağladığı imkânlarla faaliyet çeşitliliği, etki gücü ve etki alanı hızla artan basın-yayın sektörü, siyasi ve/veya mali hedefler gözeten birer araç olarak artık daha sık kullanılmakta ve ortaya çıkan etik (ve adli sorunlar, medyada haber etiği tartışmalarının güncel kalması sonucunu doğurmaktadır. Bu çalışmada medyada haber etiği konusu, siyasi bir haber (bir siyasi parti genel başkanına dönük şiddet eylemi haberi çerçevesinde ele alınmış; olayın farklı siyasi duruşlardaki bazı medya organları (gazeteler tarafından haberleştirilme biçimi, belirli kıstaslar altında toplanan veriler eşliğinde, haber etiği perspektifiyle ve karşılaştırmalı olarak incelenmiştir. Yapılan inceleme sonuçlarına göre, özellikle bazı gazetelerde söz konusu haberin sunuş biçimi üzerinde medya organlarının siyasi pozisyonlarının etkili olabildiği gözlemlenmiştir. / Debates on ethics in media and journalism has a long-standing history, just as the history of media. Due to the opportunities provided by communication technologies, power, influence and functions of the press and media increase and so that play an instrumental role in maximization of the political and/or financial ambitions of political or economic actors. Hence, debates on news ethics continue forever to be a major issue. This study focuses on ethical issues in the news and more specifically political news; elaborates on a news about the violence that a political party leader faced in Turkey, and analyzes how media (newspapers from different political views reflected the case. As a result of the study, it has been observed that newspapers presented the event largely according to their political positions and worldviews.

Early hematologic changes during prostate cancer radiotherapy predictive for late urinary and bowel toxicity

Energy Technology Data Exchange (ETDEWEB)

Pinkawa, Michael; Djukic, Victoria; Klotz, Jens; Holy, Richard; Eble, Michael J. [RWTH Aachen University, Department of Radiation Oncology, Aachen (Germany); Ribbing, Carolina [RWTH Aachen University, Department of Diagnostic and Interventional Radiology, Aachen (Germany)

2015-10-15

The primary objective of the study was to identify early hematologic changes predictive for radiotherapy (RT)-associated genitourinary and gastrointestinal toxicity. In a group of 91 prostate cancer patients presenting for primary (n = 51) or postoperative (n = 40) curative RT, blood samples (blood count, acute phase proteins, and cytokines) were analyzed before (T1), three times during (T2-T4), and 6-8 weeks after (T5) radiotherapy. Before RT (baseline), on the last day (acute toxicity), a median of 2 months and 16 months (late toxicity) after RT, patients responded to a validated questionnaire (Expanded Prostate Cancer Index Composite). Acute score changes > 20 points and late changes > 10 points were considered clinically relevant. Radiotherapy resulted in significant changes of hematologic parameters, with the largest effect on lymphocytes (mean decrease of 31-45 %) and significant dependence on target volume. C-reactive protein (CRP) elevation > 5 mg/l and hemoglobin level decrease ≥ 5 G/1 at T2 were found to be independently predictive for acute urinary toxicity (p < 0.01, respectively). CRP elevation was predominantly detected in primary prostate RT (p = 0.02). Early lymphocyte level elevation ≥ 0.3G/l at T2 was protective against late urinary and bowel toxicity (p = 0.02, respectively). Other significant predictive factors for late bowel toxicity were decreasing hemoglobin levels (cut-off ≥ 5 G/l) at T2 (p = 0.04); changes of TNF-α (tumor necrosis factor; p = 0.03) and ferritin levels (p = 0.02) at T5. All patients with late bowel toxicity had interleukin (IL)-6 levels < 1.5 ng/l at T2 (63 % without; p = 0.01). Early hematologic changes during prostate cancer radiotherapy are predictive for late urinary and bowel toxicity. (orig.) [German] Das primaere Ziel der Studie war die Identifikation von fruehen haematologischen Veraenderungen mit praediktiver Bedeutung fuer radiotherapieassoziierte genitourinale und gastrointestinale Toxizitaet. In einer

Relance du Gemini News Service | IDRC - International ...

International Development Research Centre (IDRC) Digital Library (Canada)

Agence de presse basée à Londres, le Gemini News Service achetait des reportages de correspondants dans des pays en développement et les distribuait aux médias d'information partout dans le monde. La fermeture de l'agence en 2002 après trente ans d'activité s'explique en partie par les frais d'exploitation élevés ...

Analysis of the stability of the traps in LiF: Mg, Cu, P by deconvolution of it Tl curve

International Nuclear Information System (INIS)

Gonzalez, P.R.; Azorin, J.; Furetta, C.; Lopez, J.

2004-01-01

The results of the study of the stability of the traps are presented in Tl dosemeters of LiF: Mg,Cu,P + Ptfe, developed in the ININ, taking like reference to the commercial dosemeter GR200A of Chinese factory. The readings taken Tl the same day of the irradiation they presented four peaks whose energy, determined by deconvolution were; 1.30 ± 0.01 eV, 1.50 ± 0.01 eV, 1.70 ± 0.01 eV and 2.58± 0.02 eV, for LiF: Mg,Cu,P + Ptfe, while for GR200A the energies were: 1.33 ± 0.11 eV, 1.58 ± 0.11 eV, 1.73 ± 0.11 eV and 2.60 ± 0.03 eV. The energy of the peaks 3 and 4 that remained visible during six months of study it was: 1.38 ± 0.01 eV and 2.65 ± 0.01 eV, for LiF: Mg,Cu,P + Ptfe respectively, in the same order for GR200A, the energies were: 1.51 ± 0.02 eV and 2.64 ± 0.03 eV. (Author)

Googling the news

DEFF Research Database (Denmark)

Ørmen, Jacob

2016-01-01

Search engines provide a window into the changing association between websites and keywords across cultures and countries and over time. As such, they offer journalism and news researchers an opportunity to study how search engines, in this case Google, mediate news events and stories online...

Lactose intolerance: lack of evidence for short stature or vitamin D deficiency in prepubertal children.

Directory of Open Access Journals (Sweden)

Nithya Setty-Shah

Full Text Available The health consequences of lactose intolerance (LI are unclear.To investigate the effects of LI on stature and vitamin D status.LI subjects will have similar heights and vitamin D status as controls.Prepubertal children of ages 3-12 years with LI (n=38, age 8.61 ± 3.08y, male/female 19/19 were compared to healthy, age- and gender-matched controls (n=49, age 7.95±2.64, male/female 28/21.prepubertal status (boys: testicular volume <3cc; girls: Tanner 1 breasts, diagnosis of LI by hydrogen breath test, and no history of calcium or vitamin D supplementation. Vitamin D deficiency was defined as 25-hydroxyvitamin D [25(OHD] <50 nmol/L. Gender-adjusted midparental target height (MPTH z-score was calculated using NCHS data for 18 year-old adults. Data were expressed as mean ± SD.There was no significant difference in 25(OHD between the LI and non-LI subjects (60.1±21.1, vs. 65.4 ± 26.1 nmol/L, p = 0.29. Upon stratification into normal weight (BMI <85(th percentile vs. overweight/obese (BMI ≥85(th percentile, the normal weight controls had significantly higher 25(OHD level than both the normal weight LI children (78.3 ± 32.6 vs. 62.9 ± 23.2, p = 0.025, and the overweight/obese LI children (78.3±32.6 vs. 55.3±16.5, p = 0.004. Secondly, there was no overall difference in height z-score between the LI children and controls. The normal weight LI patients had similar height as normal controls (-0.46 ± 0.89 vs. -0.71 ± 1.67, p = 0.53, while the overweight/obese LI group was taller than the normal weight controls (0.36 ± 1.41 vs. -0.71 ± 1.67, p = 0.049, and of similar height as the overweight/obese controls (0.36 ± 1.41 vs. 0.87 ± 1.45, p = 0.28. MPTH z-score was similar between the groups.Short stature and vitamin D deficiency are not features of LI in prepubertal children.

Breaking bad news of cancer diagnosis – Perception of the cancer patients in a rural community in Malaysia

Science.gov (United States)

Bain, Mathew Gabriel; Lian, Cheah Whye; Thon, Chang Ching

2014-01-01

Context: Breaking of bad news is an important component in the management of cancer patients. Aims: This study aimed to assess the perceptions of breaking bad news of cancer diagnosis. Settings and Design: It was a cross-sectional study using Breaking Bad News Assessment Schedule (BAS) questionnaire on cancer patients in Serian district. Materials and Methods: Using snowballing sampling method, a total of 134 patients were interviewed face-to-face after the consent was obtained from each of the respondents. Statistical Analysis Used: Data was entered and analyzed using SPSS version 19.0. Results: Majority were comfortable with the current method of breaking bad news. The main aspects found to be the areas of concern were the importance of the usage of body language, management of time and identifying patients’ key area of concerns. There were significant difference between sex and “information giving” (P = 0.028) and “general consideration” (P = 0.016) and also between “the age and setting the scene” (P = 0.042). Significant difference was also found between the types of cancer and “the setting of scene” (P = 0.018), “breaking bad news technique” (P = 0.010), “eliciting concerns” (P = 0.003) and “information giving” (P = 0.004). Conclusion: Good and effective communication skill of breaking bad news is vital in the management of cancer patients. As the incidence of new cases of cancer increase every year, breaking of bad news has become a pertinent to the medical professionals’ role. Specific aspects of communication skills based on local characteristics should be more emphasized in the formulation of training for doctors. PMID:24818107

High ion conductive Sb2O5-doped β-Li3PS4 with excellent stability against Li for all-solid-state lithium batteries

Science.gov (United States)

Xie, Dongjiu; Chen, Shaojie; Zhang, Zhihua; Ren, Jie; Yao, Lili; Wu, Linbin; Yao, Xiayin; Xu, Xiaoxiong

2018-06-01

The combination of high conductivity and good stability against Li is not easy to achieve for solid electrolytes, hindering the development of high energy solid-state batteries. In this study, doped electrolytes of Li3P1-xSbxS4-2.5xO2.5x are successfully prepared via the high energy ball milling and subsequent heat treatment. Plenty of techniques like XRD, Raman, SEM, EDS and TEM are utilized to characterize the crystal structures, particle sizes, and morphologies of the glass-ceramic electrolytes. Among them, the Li3P0.98Sb0.02S3.95O0.05 (x = 0.02) exhibits the highest ionic conductivity (∼1.08 mS cm-1) at room temperature with an excellent stability against lithium. In addition, all-solid-state lithium batteries are assembled with LiCoO2 as cathode, Li10GeP2S12/Li3P0.98Sb0.02S3.95O0.05 as the bi-layer electrolyte, and lithium as anode. The constructed solid-state batteries delivers a high initial discharge capacity of 133 mAh g-1 at 0.1C in the range of 3.0-4.3 V vs. Li/Li+ at room temperature, and shows a capacity retention of 78.6% after 50 cycles. Most importantly, the all-solid-state lithium batteries with the Li10GeP2S12/Li3P0.98Sb0.02S3.95O0.05 electrolyte can be workable even at -10 °C. This study provides a promising electrolyte with the improved conductivity and stability against Li for the application of all-solid-state lithium batteries.

X particle effect for 6Li reaction rates calculations

International Nuclear Information System (INIS)

Kocak, G.; Balantekin, A. B.

2009-01-01

The inferred primordial 6 L i-7 L i abundances are different from standard big bang nucleosynthesis results, 6 L i is 1000 times larger and 7 L i is 3 times smaller than the big bang prediction. In big bang nucleosynthesis, negatively charged massive X particles a possible solution to explain this primordial Li abundances problem [1]. In this study, we consider only X particle effect for nuclear reactions to obtain S-factor and reaction rates for Li. All S-factors calculated within the Optical Model framework for d(α,γ)6 L i system. We showed that the enhancement effect of massive negatively charged X particle for 6 L i system reaction rate.(author)

Investigation of pUC19 DNA damage induced by direct and indirect effect of 7Li ions radiation

International Nuclear Information System (INIS)

Sui Li; Zhao Kui; Guo Jiyu; Ni Meinan; Kong Fuquan; Cai Minghui; Yang Mingjian

2006-01-01

The effect of direct and indirect action on DNA damage in 7 Li ions radiation is investigated. Using 7 Li ions generated by HI-13 tandem accelerator, three conditions of pUC19 plasmid DNA samples including dry, with or without mannitol are irradiated at different doses in air. These irradiated DNA samples are analyzed with atomic force microscopy (AFM) in nanometer-scale. The changes of DNA forms as the dose increases are observed. The results show that free radical is the main factor in DNA strand breaks induced by 7 Li ions radiation under condition of aqueous solution. The mannitol can effectively scavenge free radical and reduce the yields of DNA strand breaks. The experimental results of this report can offered valuable basal data for cancer therapy by boron neutron capture therapy (BNCT) or heavy ion radiation method, etc. (author)

Electrochemical Behavior of LiBr, LiI, and Li2Se in LiCl Molten Salt

International Nuclear Information System (INIS)

Choi, In Kyu; Do, Jae Bum; Hong, Sun Seok; Seo, Chung Seok

2006-03-01

The effect of fission products on the electrolytic reduction of uranium oxide has been studied. It has been reported that volatile fission products, such as Br, I, and Se, react with Li metal which is a reductant in the process to give LiBr, LiI, and Li 2 Se. These compounds are dissociated as corresponding anions and cations in the LiCl molten salt at 650 .deg. C. In this experiment, oxidation and reduction reaction of 3wt% of each compound in LiCl molten salt were investigated by cyclic voltammetry. For LiBr, redox reactions of cation and anion were reversible, while redox reactions of Li + and I - were irreversible. For Li 2 Se, about half of the produced Li metal was disappeared at the cathode and two anodic current curves were appeared. After the cyclic voltammetric measurements for each compound, chronopotentiometric experiment was carried out for one hour with 100 - 400 mA. After the electrolysis, no compounds gave Li metal in the porous MgO filter in which Li metal was produced at the cathode. However, LiCl salt was covered with Br 2 for LiBr electrolysis. Dark red color of Br 2 was easily removed by water. For LiI electrolysis, salt gave black color and I 2 was deposited on the Pt anode. For Li 2 Se electrolysis, black fine powders were precipitated in the salt. After the separation and dryness of the precipitates, it was analyzed with XRD and it turned out PtSe 2 . From the electrochemical experimental results, it was concluded that these compounds may affect the electrolytic reduction process of uranium oxide in the spent fuel

Outsourcing the news? An empirical assessment of the role of sources and news agencies in the contemporary news landscape

NARCIS (Netherlands)

Boumans, J.W.

2016-01-01

Journalists are increasingly accused of uncritically recycling subsidized material in the form of press releases and news agency copy. This practice has been labeled churnalism and is believed to compromise journalism’s autonomy and threaten news quality. While the context - rampant competition,

Estimation of diameter and height of individual trees for Pinus sylvestris L. based on the individualising of crowns using airborne LiDAR and the National Forestry Inventory data

Energy Technology Data Exchange (ETDEWEB)

Valbuena-Rabadán, M.A.; Santamaría-Peña, J.; Sanz-Adán, F.

2016-07-01

Aim of the study: The objective of this study is to test the validity of the DBH and total height allometric models fitted to the crown polygon data obtained by the application of a crown delineation and individualisation algorithm which uses the geometrical relationships between the points in the original LiDAR point clouds in the Pinus sylvestris L. stands. Area of study: The study area is located in the province of Álava in the Autonomous Community of the Basque Country. Material and Methods: The crowns are delineated using data from airborne LiDAR point clouds obtained in the 2008 overflight of the Basque Autonomous Community. The DBH and total height data for field trees are obtained from the plots in the 4th National forest inventory. Main Results: For the adjusted total height and DBH models coefficients of determination of 0.87 and 0.74 respectively were obtained. The root mean squared errors were 10.67% and 18.97% respectively. The distributions of obtained DBH and total height fitted values and the distributions of the DBH and total height of the field trees are very similar except for the DBH below 15 cm. Research highlights: For stands of Pinus sylvestris L. in Álava, the geometrical relationships between the points that correspond to laser signal echoes obtained with airborne LiDAR sensors can be used directly to delineate approximations of the horizontal projections of the crowns of the trees. Although the procedure set out here was developed for stands of P. sylvestris L. in Álava, it can be applied to other conifers in regular stands by adjusting the working parameters of the function which delineates the crowns on the basis of the point cloud. (Author)

Automatic Detection of Fake News

OpenAIRE

Pérez-Rosas, Verónica; Kleinberg, Bennett; Lefevre, Alexandra; Mihalcea, Rada

2017-01-01

The proliferation of misleading information in everyday access media outlets such as social media feeds, news blogs, and online newspapers have made it challenging to identify trustworthy news sources, thus increasing the need for computational tools able to provide insights into the reliability of online content. In this paper, we focus on the automatic identification of fake content in online news. Our contribution is twofold. First, we introduce two novel datasets for the task of fake news...

The Stock Market's Reaction to Unemployment News: Why Bad News is Usually Good for Stocks

OpenAIRE

John H. Boyd; Ravi Jagannathan; Jian Hu

2001-01-01

We find that on average an announcement of rising unemployment is 'good news' for stocks during economic expansions and 'bad news' during economic contractions. Thus stock prices usually increase on news of rising unemployment, since the economy is usually in an expansion phase. We provide an explanation for this phenomenon. Unemployment news bundles two primitive types of information relevant for valuing stocks: information about future interest rates and future corporate earnings and divide...

Dynamic polarizabilities and Van der Waals coefficients for alkali atoms Li, Na and alkali dimer molecules Li2, Na2 and NaLi

Science.gov (United States)

Mérawa, M.; Dargelos, A.

1998-07-01

The present paper gives an account of investigations of the polarizability of the alkali atoms Li, Na, diatomics homonuclear and heteronuclear Li2, Na2 and NaLi at SCF (Self Consistent Field) level of approximation and at correlated level, using a time Time-Dependent Gauge Invariant method (TDGI). Our static polarizability values agree with the best experimental and theoretical determinations. The Van der Waals C6 coefficients for the atom-atom, atom-dimer and dimer-dimer interactions have been evaluated. Les polarisabilités des atomes alcalins Li, Na, et des molécules diatomiques homonucléaires et hétéronucléaire Li2, Na2 et NaLi, ont été calculées au niveau SCF (Self Consistent Field) et au niveau corrélé à partir d'une méthode invariante de jauge dépendante du temps(TDGI). Nos valeurs des polarisabilités statiques sont en accord avec les meilleurs déterminations expérimentales et théoriques. Les coefficients C6 de Van de Waals pour les interactions atome-atome, atome-dimère et dimère-dimère ont également été évalués.

40 CFR 170.232 - Knowledge of labeling and site-specific information.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Knowledge of labeling and site-specific information. 170.232 Section 170.232 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS WORKER PROTECTION STANDARD Standard for Pesticide Handlers § 170.232 Knowledge...

When Sound Bites Become the News: a Case Study on Manufacturing News in Croatia

Directory of Open Access Journals (Sweden)

Tena Perišin

2017-06-01

Full Text Available Media environment is rapidly changing and facing a widespread crisis in journalism. It is followed by the decline of audience trust and increasing market pressures. The main goal is to win the audience’s attention, very often by creating drama and producing ‘conflict’. The news is not based on something that really happened and that is relevant, but it is more often manufactured or artificially produced. In this case study we explore the curious life cycle of a sound bite from a passing remark by the then Croatian Prime Minister Zoran Milanović’s to the headlines, discussions and extensive reports which developed over the course of several days. This example shows how news could be manufactured and content blurred when it is built around a fragment without providing the context, in this case a political quote. For several days, politicians, experts, war veterans, but also ordinary citizens were involved in the manufactured news story without making a reference to the context. Consequently, the democratic debate was avoided. Drawing on a discussion of news fragmentation as isolation from context, we show that in this case, news values (what news is are increasingly blurred, preventing the news from becoming the source of information and discussion of the country’s key issues.

78 FR 338 - Buckeye Hammond Railroad, L.L.C.; Acquisition and Operation Exemption; Buckeye Partners, L.P.

Science.gov (United States)

2013-01-03

... Railroad, L.L.C.; Acquisition and Operation Exemption; Buckeye Partners, L.P. Buckeye Hammond Railroad, L.L... acquire from Buckeye Partners, L.P., a noncarrier, and to operate approximately 6,797 feet (1.29 miles) of...: December 26, 2012. By the Board, Rachel D. Campbell, Director, Office of Proceedings. Jeffrey Herzig...

Exploring Digital News Publishing Business Models

DEFF Research Database (Denmark)

Lindskow, Kasper

News publishers in the industrialized world are experiencing a fundamental challenge to their business models because of the changing modes of consumption, competition, and production of their offerings that are associated with the emergence of the networked information society. The erosion...... of the traditional business models poses an existential threat to news publishing and has given rise to a continuing struggle among news publishers to design digital business models that will be sustainable in the future. This dissertation argues that a central and underresearched aspect of digital news publishing...... business models concerns the production networks that support the co-production of digital news offerings. To fill this knowledge gap, this dissertation explores the strategic design of the digital news publishing production networks that are associated with HTML-based news offerings on the open Web...

7 CFR 28.904 - Market news.

Science.gov (United States)

2010-01-01

... 7 Agriculture 2 2010-01-01 2010-01-01 false Market news. 28.904 Section 28.904 Agriculture..., TESTING, AND STANDARDS Cotton Classification and Market News Service for Producers Classification and Market News Services § 28.904 Market news. The Director shall cause to be distributed to producers of...

Diverse artikelen in Gay Amsterdam News

NARCIS (Netherlands)

Hekma, G.

2002-01-01

Vernedering, in: Gay Amsterdam News 125 (jan 2002), pp. 20-21; Webseks, zaad, zweetseks, in: Gay Amsterdam News 126 (feb 2002), pp. 30-31; Wurgseks, in: Gay Amsterdam News 127 (mrt 2002), pp. 30-31; Wijnandus Johannes Sengers (1927-2002), in: Gay Amsterdam News 133 (sept 2002), pp. 49.

Hadronic decay of late-decaying particles and big-bang nucleosynthesis

Energy Technology Data Exchange (ETDEWEB)

Kawasaki, Masahiro [Research Center for the Early Universe, Graduate School of Science, University of Tokyo, Tokyo 113-0033 (Japan)]. E-mail: masahiro_kawasaki@mac.com; Kohri, Kazunori [Department of Earth and Space Science, Osaka University, Osaka 560-0043 (Japan); Moroi, Takeo [Department of Physics, Tohoku University, Sendai 980-8578 (Japan)

2005-10-06

We study the big-bang nucleosynthesis (BBN) scenario with late-decaying exotic particles with lifetime longer than {approx}1 s. With a late-decaying particle in the early universe, predictions of the standard BBN scenario can be significantly altered. Therefore, we derive constraints on its primordial abundance. We pay particular attention to hadronic decay modes of such particles. We see that the non-thermal production process of D, {sup 3}He and {sup 6}Li provides a stringent upper bound on the primordial abundance of late-decaying particles with hadronic branching ratio.

Fake News

OpenAIRE

Grunewald, Andreas; Kräkel, Matthias

2017-01-01

In the last decade, social media and the Internet have amplified the possibility to spread false information, a.k.a. fake news, which has become a serious threat to the credibility of politicians, organizations, and other decision makers. This paper proposes a framework for investigating the incentives to strategically spread fake news under different institutional configurations and payoff structures. In particular, we show under what conditions institutions that foster transparency in the m...

The New News Media: Democratic implications of undergraduate education and news consumption over social and traditional media

OpenAIRE

Miller, Jennifer

2013-01-01

Communication students at Simon Fraser University were surveyed and interviewed to deduce perceptions and behaviour of news consumption over social and traditional media. Both social media and traditional media are used to consume news with traditional media acting as the primary news source and as more accessible and reliable than social media. News stories considered important or having various perspectives were verified the most, especially world news. Extent of accessibility of sources an...

Preparation of thermoluminescent dosimeters of LiF: Mg, Cu, P + Ptfe for environmental radiological monitoring and radiodiagnosis

International Nuclear Information System (INIS)

Ramirez L, A.

1996-01-01

The necessity of finding a thermoluminescent material for measuring gamma and X radiation in applications like environmental monitoring, personnel dosimetry and biomedical sciences (radiotherapy and radiodiagnosis), but with special characteristics such as low umbral detection, independence of the energy of radiation and equivalency with the tissue. This made us think in lithium fluoride activated with magnesium, copper and phosphorous (LiF: Mg, Cu, P). In this thesis I developed this material chips like shape embedded in polytetrafluoroethylene (LiF: Mg, Cu, P+Ptfe). The chapter 1 and 2 talk about the atom is conformed and the interaction of the radiation with the matter. The requirements of Tl material, types of dosimetry system, biological effects and units of measurements are discussed in chapter 3 as well as the recommended limits of the International Commission on Radiological Protection ICRP. Chapter 4 shows aspects of the thermoluminescence phenomenon and describes, at the same time, the determination of the most important thermoluminescent parameters (kinetic order, energy or trap depth and the frequency factor). Chapter 5 describes the major characteristics and properties of Tl materials and its requirements for dosimetric use. Chapter 6 deals with the preparations of LiF: Mg, Cu, P+Ptfe chips and some tests for improving its sensitivity, describes the dosimetric tests and requirements proposed by American National Standard Institute ANSI-N545 Like: umbral of detection, homogeneity, fading, repeatability, linearity, effects of UV and fluorescent light etc. Finally in chapter 7 I do a report about analysis of results, conclusions and some recommendations. (Author)

29 CFR 500.232 - Consent findings and order.

Science.gov (United States)

2010-07-01

... Administrative Law Judge; and (4) A waiver of any right to challenge or contest the validity of the findings and... 29 Labor 3 2010-07-01 2010-07-01 false Consent findings and order. 500.232 Section 500.232 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS MIGRANT AND...

Tallinna Ülikooli venekeelsete üliõpilaste eesti keele õppe motivatsioonilised orientatsioonid / Triin Kibar

Index Scriptorium Estoniae

Kibar, Triin

2009-01-01

Artiklis analüüsitakse erinevaid lähenemisi keeleõppemotivatsioonile ning antakse ülevaade Tallinna Ülikooli venekeelsete üliõpilaste eesti keele õppe motivatsioonilisest orientatsioonist. Artikkel põhineb autori magistritöö raames tehtud uurimusel, milles osales 80 TLÜ venekeelset tudengit, kes õppisid 2008. a. kevadsemestril erialast eesti keelt

Indonesian News Harvester and Recommender System

Directory of Open Access Journals (Sweden)

Adi Wibowo

2017-09-01

Full Text Available To provide convenience for the user that frequently read the news, a system to gather, classify, and provide news from several news websites in one place was needed. This system utilized a recommender system to provide only relevant news to the user. This research proposed a system architecture that used vector space model, and Rocchio relevance feedback to provide specific news recommendation to user’s feedback. The results are that the proposed system architecture can achieve the goal by using five levels of feedback from the user. However, the time needed to gather news is increasing exponentially in line with the number of terms gathered from articles.

Tl response of LiF: Mg, Cu, P+Ptfe at X rays of 24, 42 and 100 KeV; Respuesta TL de LiF: Mg, Cu, P+Ptfe a rayos X de 24, 42 y 100 KeV

Energy Technology Data Exchange (ETDEWEB)

Gonzalez M, P.R.; Tovar M, V.M. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico); Azorin N, J. [UAM-I, 09340 Mexico D.F. (Mexico); Furetta, C. [Universita degli Studi di Roma ' La Sapienza' , Piazzale Aldo Moro 2, 00185 Roma (Italy); Quiroz C, M.C. [Facultad de Medicina, UAEM, 50180 Toluca, Estado de Mexico (Mexico)

2005-07-01

In this work the obtained results of the irradiation of thermoluminescent dosemeters (Tl) of LiF: Mg,Cu,P + Ptfe with X rays for the effective radiation energy of 24, 42 and 100 keV, in an interval of Kerma in air in the sinus of the air between 0.05 and 1.0 Gy are presented. The rate of Kerma in air was determined with an ionization chamber PTW-1152, gauged by the Laboratoire Central des Industries Electriques (LCIE). As reference commercial TLD-100 dosemeters was used. The results showed that the studied Tl dosemeters presented a lineal response in the interval of mentioned Kerma. On the other hand the estimated Kerma with the Tl dosemeter in the calibration curves for X rays, were similar to the one measured with the previously gauged ionization chamber. The Tl of LiF: Mg, Cu, P + Ptfe, developed in the ININ, are highly reliable for X-ray dosimetry. (Author)

Various aspects of LiNiO2 chemistry: A review

Directory of Open Access Journals (Sweden)

P. Kalyani and N. Kalaiselvi

2005-01-01

Full Text Available Despite the appearance of ever first report on the synthesis of LiNiO2 in 1954, active research to identify and evaluate its suitability as an electrode material in rechargeable lithium batteries started only in late 80's. Following this, numerous articles discussed the synthesis, electrochemical behavior and the problems associated with the compound. In this connection, the present communication reviews certain important experimental results obtained by different research groups on various aspects of LiNiO2, in order to understand the significance of LiNiO2 as a potential cathode material for rechargeable lithium batteries. Also selected type of methodologies adopted to synthesize the title compound have also been discussed to substantiate the dependence of electrochemical behavior of LiNiO2 on the method of synthesis and reaction conditions. The subject has been discussed at length and may provide useful information on the properties of LiNiO2 and may enable the fabrication of tailor made nickel-based electrode materials for 'next generation' lithium or lithium-ion batteries along with the highlights of doped and coated derivatives of LiNiO2.

Localization and expression of substance P in transgenic mice overexpressing human APP751 with the London (V717I) and Swedish (K670M/N671L) mutations.

Science.gov (United States)

Willis, Michael; Hutter-Paier, Birgit; Wietzorrek, Georg; Windisch, Manfred; Humpel, Christian; Knaus, Hans Günther; Marksteiner, Josef

2007-04-27

Substance P-like immunoreactivity (-LI) is found in neuritic plaques, and is reduced in patients suffering from Alzheimer disease (AD). In this study, we examined the distribution and expression of substance P in transgenic mice overexpressing human amyloid precursor protein (hAPP) APP751 with the London (V717I) and Swedish (K670M/N671L) mutations. Immunohistochemistry was performed to localize substance P- and glial fibrillary acidic protein-LI by confocal microscopy. In hAPP transgenic mice, the number of beta-amyloid plaques significantly increased from 6 to 12 months. About 5% of beta-amyloid plaques were substance P-immunoreactive. In transgenic mice, the morphology of substance P-immunoreactive structures changed by consisting of swollen and dystrophic neurites mostly associated with beta-amyloid plaques. The overall localization and the relative substance P densities were not different between wild type and transgenic mice at 6 and 12 months. At month 12, a dramatic change in the distribution pattern of substance P-LI was observed as it was now expressed in a high number of reactive astrocytes. This expression of substance P in astrocytes was mainly found in the hippocampal formation and thalamic nuclei with a preferential association with beta-amyloid plaques, whereas in cortical regions only faintly substance P-immunoreactive astrocytes were observed. This study indicates that substance P undergoes complex changes in this animal Alzheimer disease model. Future experiments including substance P antagonists are necessary to further explore the interaction between beta-amyloid deposits and substance P.

Structures in 20O from the 14C(7Li, p) reaction at 44 MeV

International Nuclear Information System (INIS)

Bohlen, H.G.; Oertzen, W. von; Kokalova, T.; Wheldon, C.; Milin, M.; Dorsch, T.; Kruecken, R.; Faestermann, T.; Mahgoub, M.; Hertenberger, R.; Wirth, H.F.

2011-01-01

We have studied the multi-nucleon transfer reaction 14 C( 7 Li, p) at E Lab ( 7 Li) = 44 MeV populating states of the neutron-rich oxygen isotope 20 O. The experiments have been performed at the Munich Tandem accelerator using the high-resolution Q3D magnetic spectrometer, with an overall energy resolution of 45keV. States were populated up to 20MeV excitation energy -65 states have been identified in the analysis, among which 42 are new. Rotational bands are proposed in terms of underlying intrinsic reflection-asymmetric cluster and prolate molecular structures (namely 14 C x 2n x α) as parity doublet bands. A rectangular oblate structure is suggested for some very narrow states at high excitation energies. (orig.)

The Usefulness of a News Media Literacy Measure in Evaluating a News Literacy Curriculum

Science.gov (United States)

Maksl, Adam; Craft, Stephanie; Ashley, Seth; Miller, Dean

2017-01-01

A survey of college students showed those who had taken a news literacy course had significantly higher levels of news media literacy, greater knowledge of current events, and higher motivation to consume news, compared with students who had not taken the course. The effect of taking the course did not diminish over time. Results validate the News…

The shifting cross-media news landscape

DEFF Research Database (Denmark)

Schrøder, Kim Christian; Steeg Larsen, Bent

2010-01-01

and lifestyles. Theoretically the study is anchored in Habermas’s notion of the public sphere, and its recent reconceptualizations in theories of ‘cultural citizenship’, 'civic agency' and 'public connection'. The project operationalizes these theories through the concept of users' perceived “worthwhileness......The article offers new insights for democracy and for news producers by mapping the use and users of today’s cross-media news landscape, as the everyday consumption of news across the range of available news media and formats is shifting as a result of transformations of technology, culture......” of news media, a user-anchored concept which incorporates the different functionalities of the situational cross-media use of news by citizen/consumers in everyday life. Empirically the article presents the findings of a large-scale survey that traces the imminent challenges facing players in the news...

High-resolution photofission measurements in 238U and 232Th. Progress report, June 1, 1980-February 10, 1981

International Nuclear Information System (INIS)

Lancman, H.

1981-02-01

Intense proton beam currents from the Dynamitron at Brooklyn College have been used to generate gamma rays of variable energy from a number of (p,γ) resonances in various nuclei. Spectra of photofission fragments of 238 U and 232 Th have been measured with an average gamma ray energy resolution of approx. 300 eV. Structure in the photofission cross section of 232 Th was observed at approx. 6176 keV

Navigating Cross-Media News Use : Media repertoires and the value of news in everyday life.

NARCIS (Netherlands)

Swart, Joelle; Peters, Chris; Broersma, Marcel

2017-01-01

The current news media landscape is characterized by an abundance of digital outlets and increased opportunities for users to navigate news themselves. Yet, it is still unclear how people negotiate this fluctuating environment to decide which news media to select or ignore, how they assemble

78 FR 21491 - DeltaPoint Capital IV, L.P., DeltaPoint Capital IV (New York), L.P.; Notice Seeking Exemption...

Science.gov (United States)

2013-04-10

... SMALL BUSINESS ADMINISTRATION [License No. 02/02-0662, 02/02-0661] DeltaPoint Capital IV, L.P., DeltaPoint Capital IV (New York), L.P.; Notice Seeking Exemption Under Section 312 of the Small Business Investment Act, Conflicts of Interest Notice is hereby given that DeltaPoint Capital IV, L.P. and DeltaPoint...

News Sources, Gender and Majority-Minority in Danish TV News Programs

DEFF Research Database (Denmark)

Fiig, Christina

In this paper, I am going to identify some central methodological challenges in relation to a project on TV-news and news sources in a perspective of intersectionality and to sketch a research design. In what follows, I will present some methodological issues and research designs of previous...

Power structure in Chilean news media.

Science.gov (United States)

Bahamonde, Jorge; Bollen, Johan; Elejalde, Erick; Ferres, Leo; Poblete, Barbara

2018-01-01

Even democracies endowed with the most active free press struggle to maintain diversity of news coverage. Consolidation and market forces may cause only a few dominant players to control the news cycle. Editorial policies may be biased by corporate ownership relations, narrowing news coverage and focus. To an increasing degree this problem also applies to social media news distribution, since it is subject to the same socio-economic drivers. To study the effects of consolidation and ownership on news diversity, we model the diversity of Chilean coverage on the basis of ownership records and social media data. We create similarity networks of news outlets on the basis of their ownership and the topics they cover. We then examine the relationships between the topology of ownership networks and content similarity to characterize how ownership affects news coverage. A network analysis reveals that Chilean media is highly concentrated both in terms of ownership as well as in terms of topics covered. Our method can be used to determine which groups of outlets and ownership exert the greatest influence on news coverage.

Calibration of 232U solution; Calibracion de una disolucion de 232U

Energy Technology Data Exchange (ETDEWEB)

Galan Valera, M P; Acena Berrenechea, M L

1988-07-01

A method for as certain the activity by alpha spectroscopy with semiconductor detectors, of a solution of 232U is presented. It consists of the comparison with a 233U solution activity previously measured in a gridded ionization chamber of 2{pi} geometry. The total measurement uncertainty is about + - 0,02. (Author) 9 refs.

Political News and Political Consciousness

Science.gov (United States)

Schertges, Claudia

2007-01-01

This article deals with mass media in modern democratic societies, using the example of Israeli news reports in German television (TV) news. Central to this interest are processes of mediating politics: political socialisation and education; that is to say, empowering citizens via TV news to participate in democratic processes. The article…

Study and characterization of dosimeter LiF:Mg,Cu,P for using in aeronautical dosimetry

International Nuclear Information System (INIS)

Flavia, Hanna; Federico, Claudio; Lelis, Odair; Pereira, Heloisa; Pereira, Marlon

2014-01-01

The effects of cosmic ionizing radiation incidents in aircraft components and crews has been a source of concern and motivated increasingly studies and improvements in the area. The low dose rates involved in this radiation field in aircraft flight altitudes imply Dosimetric necessity of using materials with high efficiency of detection, to enable studies lower cumulative doses resulting in shorter routes or lower altitude. The choice of thermoluminescent dosimeters LiF: Mg, Cu, P was done by having a detection efficiency of about fifteen times higher than its predecessor (LiF: Mg, Ti), and therefore, applied in very low doses dosimetry, and environmental dosimetry . The implementation of the use of pair dosimetric TLD-600H and 700H-TLD will serve as support for testing and studies on the effects of low doses of cosmic radiation in environmental dosimetry applied in the aviation environment in the usual flight altitudes. In this paper are presented the results of development of a methodology for dosimetry low doses of gamma radiation and neutrons using the pair dosimetric TLD-600H and 700H-TLD. The results demonstrate a sensitivity of dosimeters well above the dosimeters LiF: Mg, Ti confirming its suitability for dosimetry of low doses

75 FR 41877 - Insured Healthcare Facilities 232 Loan Application

Science.gov (United States)

2010-07-19

... DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT [Docket No. FR-5376-N-65] Insured Healthcare Facilities 232 Loan Application AGENCY: Office of the Chief Information Officer, HUD. ACTION: Notice. SUMMARY... Proposal: Insured Healthcare Facilities 232 Loan Application. OMB Approval Number: 2502-New. Form Numbers...

75 FR 16821 - Insured Healthcare Facilities 232 Loan Application

Science.gov (United States)

2010-04-02

... DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT [Docket No. FR-5376-N-23] Insured Healthcare Facilities 232 Loan Application AGENCY: Office of the Chief Information Officer, HUD. ACTION: Notice. SUMMARY...: Title of Proposal: Insured Healthcare Facilities 232 Loan Application. OMB Approval Number: 2502-New...

Impedance spectroscopy study and phase transition in phospho-vanadium mixed oxide LiZnV{sub 0.5}P{sub 0.5}O{sub 4}

Energy Technology Data Exchange (ETDEWEB)

Rahal, A.; Guidara, Kamel; Megdiche, Makram [Sfax Universite, Laboratoire de Caracterisations Spectroscopiques et Optique des Materiaux (LaSCOM), Faculte des Sciences de Sfax, BP 1171, Sfax (Tunisia); Megdiche Borchani, S. [Sfax Universite, Laboratoire de Caracterisations Spectroscopiques et Optique des Materiaux (LaSCOM), Faculte des Sciences de Sfax, BP 1171, Sfax (Tunisia); Institut Superieur D' Informatique et de Multimedia de Sfax (ISIMS), Pole Technologique de Sfax, Sakiet Ezzit, BP 242, Sfax (Tunisia)

2017-08-15

An X-ray crystallographic study has allowed us to identify a powder of the type LiZnV{sub 0.5}P{sub 0.5}O{sub 4}, which contains 50% of vanadium and 50% of phosphor, inside the binary system LiZnVO{sub 4}-LiZnPO{sub 4}. The structure is isotypic with the phenacite like LiZnP0{sub 4}. X-ray diffraction patterns are indexed according to the lattice parameters of the rhombohedral system and the R3 space group. IR spectra show the presence of VO{sub 4} and PO{sub 4} groups in the network of this material. The experimental results indicate that σ{sub AC}(ω) is proportional to (ω{sup n}). The activation energy found from the Arrhenius plot confirms that the conduction processing of the material is not due to simple hopping mechanism. The temperature dependence of frequency exponent n was investigated to understanding the conduction mechanism in LiZnV{sub 0.5}P{sub 0.5}O{sub 4}. The non-overlapping small Polaron tunneling (NSPT) model can explain the temperature dependence of the frequency exponent. A phase transition at T = 623 K has been evidenced by Differential scanning calorimetry (DSC) and subsequently confirmed by the analysis of dielectric and electric properties. (orig.)

Efficacy of an herbal formulation LI10903F containing Dolichos biflorus and Piper betle extracts on weight management

Directory of Open Access Journals (Sweden)

Sengupta Krishanu

2012-12-01

Full Text Available Abstract Background A novel herbal formulation LI10903F, alternatively known as LOWAT was developed based on its ability to inhibit adipogenesis and lipogenesis in 3T3-L1 adipocytes model. The clinical efficacy and tolerability of LI10903F were evaluated in an eight-week, randomized, double-blind, placebo-controlled, clinical trial in 50 human subjects with body mass index (BMI between 30 and 40 kg/m2 (clinical trial registration number: ISRCTN37381706. Participants were randomly assigned to either a placebo or LI10903F group. Subjects in the LI10903F group received 300 mg of herbal formulation thrice daily, while subjects in the placebo group received 300 mg of placebo capsules thrice daily. All subjects were provided a standard diet (2,000 kcal daily and participated in a moderate exercise of 30 min walk for five days a week. Additionally, the safety of this herbal formulation was evaluated by a series of acute, sub-acute toxicity and genotoxicity studies in animals and cellular models. Results After eight weeks of supplementation, statistically significant net reductions in body weight (2.49 kg; p=0.00005 and BMI (0.96 kg/m2; p=0.00004 were observed in the LI10903F group versus placebo group. Additionally, significant increase in serum adiponectin concentration (p=0.0076 and significant decrease in serum ghrelin concentration (p=0.0066 were found in LI10903F group compared to placebo group. Adverse events were mild and were equally distributed between the two groups. Interestingly, LI10903F showed broad spectrum safety in a series of acute, sub-acute toxicity and genotoxicity studies. Conclusions Results from the current research suggest that LI10903F or LOWAT is well-tolerated, safe and effective for weight management.

Efficacy of an herbal formulation LI10903F containing Dolichos biflorus and Piper betle extracts on weight management.

Science.gov (United States)

Sengupta, Krishanu; Mishra, Atmatrana T; Rao, Manikeshwar K; Sarma, Kadainti Vs; Krishnaraju, Alluri V; Trimurtulu, Golakoti

2012-12-27

A novel herbal formulation LI10903F, alternatively known as LOWAT was developed based on its ability to inhibit adipogenesis and lipogenesis in 3T3-L1 adipocytes model. The clinical efficacy and tolerability of LI10903F were evaluated in an eight-week, randomized, double-blind, placebo-controlled, clinical trial in 50 human subjects with body mass index (BMI) between 30 and 40 kg/m² (clinical trial registration number: ISRCTN37381706). Participants were randomly assigned to either a placebo or LI10903F group. Subjects in the LI10903F group received 300 mg of herbal formulation thrice daily, while subjects in the placebo group received 300 mg of placebo capsules thrice daily. All subjects were provided a standard diet (2,000 kcal daily) and participated in a moderate exercise of 30 min walk for five days a week. Additionally, the safety of this herbal formulation was evaluated by a series of acute, sub-acute toxicity and genotoxicity studies in animals and cellular models. After eight weeks of supplementation, statistically significant net reductions in body weight (2.49 kg; p=0.00005) and BMI (0.96 kg/m²; p=0.00004) were observed in the LI10903F group versus placebo group. Additionally, significant increase in serum adiponectin concentration (p=0.0076) and significant decrease in serum ghrelin concentration (p=0.0066) were found in LI10903F group compared to placebo group. Adverse events were mild and were equally distributed between the two groups. Interestingly, LI10903F showed broad spectrum safety in a series of acute, sub-acute toxicity and genotoxicity studies. Results from the current research suggest that LI10903F or LOWAT is well-tolerated, safe and effective for weight management.

232 Les Défis de L'utilisation des Tic dans L'enseignement ...

African Journals Online (AJOL)

Tracie1

communication; et qu'ils n'ont pas à leur disposition l'infrastructure de base requise. ..... L'Analyse des questionnaires des professeurs de français. Tableau 3 ..... équipé et le plus fonctionnel de tous les autres établissements universitaires ...

Cross-validation of the factorial structure of the Neighborhood Environment Walkability Scale (NEWS and its abbreviated form (NEWS-A

Directory of Open Access Journals (Sweden)

Cerin Ester

2009-06-01

Full Text Available Abstract Background The Neighborhood Environment Walkability Scale (NEWS and its abbreviated form (NEWS-A assess perceived environmental attributes believed to influence physical activity. A multilevel confirmatory factor analysis (MCFA conducted on a sample from Seattle, WA showed that, at the respondent level, the factor-analyzable items of the NEWS and NEWS-A measured 11 and 10 constructs of perceived neighborhood environment, respectively. At the census blockgroup (used by the US Census Bureau as a subunit of census tracts level, the MCFA yielded five factors for both NEWS and NEWS-A. The aim of this study was to cross-validate the individual- and blockgroup-level measurement models of the NEWS and NEWS-A in a geographical location and population different from those used in the original validation study. Methods A sample of 912 adults was recruited from 16 selected neighborhoods (116 census blockgroups in the Baltimore, MD region. Neighborhoods were stratified according to their socio-economic status and transport-related walkability level measured using Geographic Information Systems. Participants self-completed the NEWS. MCFA was used to cross-validate the individual- and blockgroup-level measurement models of the NEWS and NEWS-A. Results The data provided sufficient support for the factorial validity of the original individual-level measurement models, which consisted of 11 (NEWS and 10 (NEWS-A correlated factors. The original blockgroup-level measurement model of the NEWS and NEWS-A showed poor fit to the data and required substantial modifications. These included the combining of aspects of building aesthetics with safety from crime into one factor; the separation of natural aesthetics and building aesthetics into two factors; and for the NEWS-A, the separation of presence of sidewalks/walking routes from other infrastructure for walking. Conclusion This study provided support for the generalizability of the individual

Clinical use of LiF:Mg,Cu,P: Critical evaluation of an ultrasensitive material for thermoluminescence dosimetry

International Nuclear Information System (INIS)

Duggan, Lisa

2002-01-01

Radiation dosimetry is an essential part of optimization in medical exposures. However there are medical procedures that are particularly challenging for existing dosimetric techniques: neonatal radiography (low dose), mammography (low energy), cardiac catheterization (moving radiation fields), and brachytherapy using implanted radionuclides (steep dose gradients). Hence, the objectives of this thesis were to study the dosimetric characteristics of ultrasensitive LiF:Mg,Cu,P thermoluminescence dosimeters (TLDs) in radiation beams typical for both diagnostics and therapy, and develop procedures to implement this dosimeter into clinical practice for those selected scenarios. GR-200 (SDDML, China) and MCP-N (TLD Poland) TLDs were compared to other TLD materials (LiF:Mg,Ti, Al 2 O 3 :C) and tested for reproducibility, dose response (1 μGy to 500 Gy), photon energy response (10 keV to 18 MVp), light sensitivity (240-800 nm), long-term stability (6 months) using different annealing cycles and glow curve deconvolution. A miniaturized TLD form (MCP-Np) was developed by TLD Poland for the present investigations. Detection limit of GR-200 and MCP-Np was found to be less than 1 and 8 μGy, respectively, with dose response linear up to 18 Gy. To obtain adequate detection limits and precision, accurate temperature calibration of heating cycles and a dual-anneal technique with dose history monitoring was performed. Energy response was similar for both materials within 5% and essentially uniform except for a minimum of 0.82 at 185 keV. LiF:Mg,Cu,P proved to be more suitable than LiF:Mg,Ti for dosimetry in low dose medical applications particularly when kilovoltage photons are to be used. The high sensitivity and resulting scope for miniaturization provided the opportunity to perform unique in vivo measurements within brachytherapy implants and for mammography

Specific interaction between hnRNP H and HPV16 L1 proteins: Implications for late gene auto-regulation enabling rapid viral capsid protein production

Energy Technology Data Exchange (ETDEWEB)

Zheng, Zi-Zheng; Sun, Yuan-Yuan; Zhao, Min; Huang, Hui [National Institute of Diagnostics and Vaccine Development in Infectious Diseases, Xiamen University, Xiamen, Fujian 361005 (China); School of Life Sciences, Xiamen University, Xiamen, Fujian 361005 (China); Zhang, Jun; Xia, Ning-Shao [National Institute of Diagnostics and Vaccine Development in Infectious Diseases, Xiamen University, Xiamen, Fujian 361005 (China); School of Life Sciences, Xiamen University, Xiamen, Fujian 361005 (China); School of Public Health, Xiamen University, Xiamen, Fujian 361005 (China); Miao, Ji, E-mail: jmiao@xmu.edu.cn [National Institute of Diagnostics and Vaccine Development in Infectious Diseases, Xiamen University, Xiamen, Fujian 361005 (China); School of Life Sciences, Xiamen University, Xiamen, Fujian 361005 (China); Zhao, Qinjian, E-mail: qinjian_zhao@xmu.edu.cn [National Institute of Diagnostics and Vaccine Development in Infectious Diseases, Xiamen University, Xiamen, Fujian 361005 (China); School of Public Health, Xiamen University, Xiamen, Fujian 361005 (China)

2013-01-18

Highlights: ► The RNA-binding hnRNP H regulates late viral gene expression. ► hnRNP H activity was inhibited by a late viral protein. ► Specific interaction between HPV L1 and hnRNP H was demonstrated. ► Co-localization of HPV L1 and hnRNP H inside cells was observed. ► Viral capsid protein production, enabling rapid capsid assembly, was implicated. -- Abstract: Heterogeneous nuclear ribonucleoproteins (hnRNPs), including hnRNP H, are RNA-binding proteins that function as splicing factors and are involved in downstream gene regulation. hnRNP H, which binds to G triplet regions in RNA, has been shown to play an important role in regulating the staged expression of late proteins in viral systems. Here, we report that the specific association between hnRNP H and a late viral capsid protein, human papillomavirus (HPV) L1 protein, leads to the suppressed function of hnRNP H in the presence of the L1 protein. The direct interaction between the L1 protein and hnRNP H was demonstrated by complex formation in solution and intracellularly using a variety of biochemical and immunochemical methods, including peptide mapping, specific co-immunoprecipitation and confocal fluorescence microscopy. These results support a working hypothesis that a late viral protein HPV16 L1, which is down regulated by hnRNP H early in the viral life cycle may provide an auto-regulatory positive feedback loop that allows the rapid production of HPV capsid proteins through suppression of the function of hnRNP H at the late stage of the viral life cycle. In this positive feedback loop, the late viral gene products that were down regulated earlier themselves disable their suppressors, and this feedback mechanism could facilitate the rapid production of capsid proteins, allowing staged and efficient viral capsid assembly.

Structure of the unbound systems: 10,12Li and 13Be

International Nuclear Information System (INIS)

Randisi, G.

2011-12-01

The unbound systems 10;12 Li and 13 Be have been studied via nucleon removal from a 14 B beam of 35 MeV/nucleon. The invariant mass (decay energy) spectra were reconstructed from the measured 9;11 Li-n and 12 Be-n coincidences. Simulations, taking into account the effects of the experimental setup and the reaction, were developed. The reconstructed decay energy spectra were interpreted using theoretical lineshapes folded with the experimental response, as well as uncorrelated distributions obtained from the data by event mixing. In the case of 10 Li, the data were reproduced with an s-wave virtual state of scattering length a s = [-10 -3 +1 (stat) ±3 (syst)] fm and l = 1 resonance with energy E r = [0.55 ± 0.02 (stat) ± 0.05 (syst)] MeV and with Γ 0 = [0.35 ± 0.05 (stat) ± 0.15 (syst)] MeV confirming the ν1p 1/2 - ν2s 1/2 inversion. For 12 Li, evidence was found for excited states between 0.2 and 0.8 MeV above the threshold. In the case of 13 Be, the decay energy, as well as the other observables, were reproduced assuming an l = 0 resonance with E r = [0.70 ± 0.05 (stat) ± 0.07 (syst)] MeV and Γ 0 = [1.7 ± 0.1 (stat) ± 0.1 (syst)] MeV and l = 2 resonance with E r = [2.4 ± 0.1(stat) ± 0.1 (syst)] MeV and Γ 0 = [0.6 ± 0.2 (stat) ± 0.1 (syst)] MeV. This hypothesis is supported by the selectivity of proton knockout, whereby the neutron configuration of the states populated in 13 Be should directly reflect that of 14 B. (author)

Climate News Across Media Platforms

DEFF Research Database (Denmark)

Eskjær, Mikkel Fugl

2015-01-01

In a changing media landscape marked by technological, institutional and cultural convergence, comparative and cross-media content analysis represents a valuable analytical tool in mapping the diverse channels of climate change communication. This paper presents a comparative study of climate...... quantitative and qualitative content analysis the paper documents and explores the extent and character of climate change news across different media platforms. The study aims at contributing to the on-going assessment of how news media are addressing climate change at a time when old and new media...... change news on five different media platforms: newspapers, television, radio, web-news and mobile news. It investigates the themes and actors represented in public climate change communication as well as the diverse possibilities of participating in public debates and information sharing. By combining...

CERN television news

CERN Multimedia

2002-01-01

CERN events brought right to your desktop by the new video bulletin.   CERN now has its very own news broadcast , or rather 'webcast', with a host of special reports and even a star presenter. From today onwards, just go to the Bulletin's web page, click on the 'video news' link and sit back and enjoy the latest news about CERN, presented in images by Wendy Korda. The ten-minute newscast in both French and English, the Organization's two official languages, presents interviews, pictures of experiments and computer-generated graphics, bringing you right up to date with some of the Laboratory's latest stories. The show concludes with a selection of the best snapshots taken by the CERN Photo Lab. So every one or two months CERN's Audio-Video Service (ETT/DH) will be putting together a video news report that you can watch on your own desktop computer. Daniel Boileau, Patrick Gilbert de Vautibault and Jacques Fichet, the Service's three technicians, came up with the idea of producing this regular feat...

Calculation of the πsup(+)sup(7)Li → pesup(+)esup(-)sup(6)Li

International Nuclear Information System (INIS)

Avakov, G.V.; Blokhintsev, L.D.; Blokhintseva, T.D.

1985-01-01

The π +7 Li → p e + e -6 Li reaction have been considered in the framework of the nucleon cluster model and of the shell model. The cross section of this reaction have been calculated at the pion kinetic energy 380 MeV. The comparison with the available experimental data has been carried out

The interaction of financial news between mass media and new media: Evidence from news on Chinese stock market

Science.gov (United States)

Zhang, Yongjie; Zhang, Zuochao; Liu, Lanbiao; Shen, Dehua

2017-11-01

In this paper, we investigate both the contemporaneous and the lead-lag relationships between the mass media news and the new media news of the financial news on the constitute stocks of the CSI 300. The empirical results show that: (1) there exists a strong correlation between these two types of news; (2) the granger causality direction from new media news to mass media news is increasingly obvious, while the reverse direction has a downward trend; (3) new media is playing a increasingly important role in the stock market and exhibits a trend to substitutes the mass media.

Local news media framing of obesity in the context of a sugar-sweetened beverage reduction media campaign.

Science.gov (United States)

Jeong, Michelle; Gilmore, Joelle Sano; Bleakley, Amy; Jordan, Amy

2014-01-01

This study examined local news media's framing of obesity preceding and surrounding the Philadelphia sugar-sweetened beverage reduction media campaign. Using key search terms pertaining to obesity and sugary beverages, the authors searched the LexisNexis database and gathered local news stories (n = 167) that were aired or published between October, 2010 and March, 2011. They conducted a content analysis, coding for framing-related outcome measures (underlying factors, action steps, and contextual agents). Overall, the news media employed individual-level framing in the majority of stories when discussing obesity, both before and after the campaign launch. After the campaign launched, however, stories were significantly more likely to mention systemic-level contextual agents such as food companies (P = .008), beverage companies (P = .03), and champions or advocates (P = .001). The researchers observed a shift in the local news media discourse toward more thematic framing of obesity, and suggest that public health officials consider the potential impact of news media frames on garnering public support for future policy implementations. Copyright © 2014 Society for Nutrition Education and Behavior. Published by Elsevier Inc. All rights reserved.

The sup 8 Li(n,. gamma. ) sup 9 Li reaction and primordial nucleosynthesis

Energy Technology Data Exchange (ETDEWEB)

Mao, Z Q; Champagne, A E [Princeton Univ., NJ (USA). Dept. of Physics

1991-01-01

Shell-model calculations, using both p-shell and spd-shell interactions, have been used to predict the spectroscopic properties of low-lying states in {sup 9}Li. From this information, we have obtained new estimates for the rate of the {sup 8}Li(n,{gamma}){sup 9}Li reaction, which may act to limit the production of heavy elements during an inhomogeneous big bang. The two calculations produce reaction rates which differ by about a factor of 2 at the temperatures of interest, demonstrating the uncertainties in this approach. However, the spd calculation appears to be the more reliable of the two. (orig.).

Characterization of {sup 6}LiF:Mg,Cu,P (TLD-600 H) estimate of E, b and s parameters

Energy Technology Data Exchange (ETDEWEB)

Andres, P. A., E-mail: andresp@cab.cnea.gov.ar [Centro Atomico Bariloche, Division Proteccion Radiologica / CNEA, Av. E. Bustillo Km 9.5, R8402AGP San Carlos de Bariloche (Argentina)

2015-10-15

LiF:Mg,Cu,P dosemeters are useful for low-dose measurements because of its high sensitivity compared to the LiF:Mg,Ti dosemeters. {sup 7}LiF:Mg,Cu,P have been used for environmental dosimetry in Bariloche Atomic Centre for almost a decade. Since {sup 6}LiF:Mg,Cu,P dosemeters were intended to be used for X ray diagnosis dosimetry in neonatology, they had to be characterized first. The main goal of measuring and analyzing Tl glow curves is the extraction of some parameters that can be used to describe the Tl process in the material. This job focused on the estimation of the activation energy E for the Tl traps, the frequency factor s and the order of kinetics b of the Tl process. Furthermore, the most appropriate time-temperature profile (Ttp) was determined as well as the annealing temperature and time, which resulted being 240 degrees C for 10 minutes. The Ttp used was 140 degrees C for 10 seconds, a heating rate of 20/s until 240 degrees C, remaining at this temperature for 20 seconds, and then an exponential cooling until 50 degrees C. After applying the whole glow-peak method for different orders of kinetic, and the Kitis equation assuming a first order kinetics, the values obtained were: E = (1.066 ± 0.025) eV, as a weighted average of both methods, and a frequency factor s = (3.57 ± 1.56) E-10 s{sup -1} again as a weighted average of both methods. In both cases a first order kinetics (b = 1) was assumed. The dosemeters were irradiated with a calibrated {sup 137}Cs source and read with a Harshaw TLD{sup TM} Model 3500 reader resulting in a minimum detectable dose of about 20 μGy. (Author)

Hydrogen dynamics in the low temperature phase of LiBH{sub 4} probed by quasielastic neutron scattering

Energy Technology Data Exchange (ETDEWEB)

Remhof, Arndt, E-mail: arndt.remhof@empa.ch [Empa, Swiss Federal Institute for Materials Science and Technology, Hydrogen and Energy, CH-8600 Dübendorf (Switzerland); Züttel, Andreas [Empa, Swiss Federal Institute for Materials Science and Technology, Hydrogen and Energy, CH-8600 Dübendorf (Switzerland); Ramirez-Cuesta, Timmy; García-Sakai, Victoria [ISIS Facility, Rutherford Appleton Laboratory, Chilton, Didcot, Oxon OX11 0QX (United Kingdom); Frick, Bernhard [Institut Laue-Langevin, F-38002 Grenoble (France)

2013-12-12

Highlights: • Inelastic fixed window sans offer new possibilities in neutron backscattering spectrometers. • Two different kind of reorientational motion were identified in the low temperature phase of LiBH{sub 4}. • Thermally activated jump rotation. - Abstract: LiBH{sub 4} contains 18.5 wt% hydrogen and undergoes a structural phase transition (orthorhombic → hexagonal) at 381 K which is associated with a large increase in hydrogen and lithium solid-state mobility. We investigated the hydrogen dynamics in the low temperature phase of LiBH{sub 4} by quasielastic neutron scattering, including a new kind of inelastic fixed window scan (IFWS). In the temperature range from 175 to 380 K the H-dynamics is dominated by thermally activated rotational jumps of the [BH{sub 4}]{sup −} anion around the c3 axis with an activation energy of about 162 meV. In agreement with earlier NMR data, a second type of thermally activated motion with an activation energy of about 232 meV could be identified using the IFWS. The present study of hydrogen dynamics in LiBH{sub 4} illustrates the feasibility of using IFWS on neutron backscattering spectrometers as a probe of localised motion.

Návrh zařízení pro Power HIL simulaci Li-pol článku

OpenAIRE

Pribulla, Daniel

2015-01-01

Táto práca sa zaoberá návrhom a realizáciou Power-HIL simulátora Li-po článku, slúžiaceho na testovanie napájania malých bezdrôtových modulov. Základom simulátora je model akumulátora, ktorý zahŕňa vplyv teploty a degradácie na parametre článku. Na vývoj zariadenia a simulácie bolo použité prostredie Matlab Simulink. Parametre modelu batérie boli určené na základe sérií meraní reálneho článku s kapacitou 250mAh pri rôznych teplotách. Za účelom merania bola zostrojená tepelná komora. Výkonová ...

Identification of a novel PSEN1 mutation (Leu232Pro) in a Korean patient with early-onset Alzheimer's disease and a family history of dementia.

Science.gov (United States)

Park, Jiyun; An, Seong Soo A; Giau, Vo Van; Shim, Kyuhwan; Youn, Young Chul; Bagyinszky, Eva; Kim, SangYun

2017-08-01

In the present study, a novel mutation in exon 7 of presenilin 1 (Leu232Pro) was discovered in a Korean patient with early-onset Alzheimer's disease, who represented memory decline at 37 years of age, followed by impairment in spatial activity and concentrations and personality changes. Imaging analyses with magnetic resonance scan showed diffuse atrophy in the frontoparietal regions. Targeted next generation sequencing and Sanger sequencing identified a heterozygous T to C transition at position 695 (c.695T>C) of in presenilin 1 gene (PSEN1), resulting in a novel missense mutation at codon 232 from leucine to proline (L232P). Several family members of the patient developed dementia, suggesting an autosomal dominant inheritance; however, we were unable to perform a segregation analysis to confirm this. Since the proline may play a role as a helix breaker, this mutation could significantly disturb the transmembrane helix domain-V of PSEN1 and perturb its protein functions. This hypothesis was supported by the results from the in silico analyses, predicted a major kink on this helix. Several leucine>proline substitutions in other PSEN1 transmembrane helices revealed aggressive AD phenotypes. Future functional studies would be needed to evaluate the pathogenicity of this mutation in AD. Copyright © 2017 Elsevier Inc. All rights reserved.

48 CFR 652.232-71 - Voucher Submission (Cost-Reimbursement).

Science.gov (United States)

2010-10-01

...-Reimbursement). 652.232-71 Section 652.232-71 Federal Acquisition Regulations System DEPARTMENT OF STATE CLAUSES... Voucher Submission (Cost-Reimbursement). As prescribed in 632.908(b), the contracting officer may insert a clause substantially the same as follows: Voucher Submission (Cost-Reimbursement) (AUG 1999) (a) General...

Refined study of the interaction between HIV-1 p6 late domain and ALIX

Directory of Open Access Journals (Sweden)

Gerlier Denis

2008-05-01

Full Text Available Abstract The interaction between the HIV-1 p6 late budding domain and ALIX, a class E vacuolar protein sorting factor, was explored by using the yeast two-hybrid approach. We refined the ALIX binding site of p6 as being the leucine triplet repeat sequence (Lxx4 (LYPLTSLRSLFG. Intriguingly, the deletion of the C-terminal proline-rich region of ALIX prevented detectable binding to p6. In contrast, a four-amino acid deletion in the central hinge region of p6 increased its association with ALIX as shown by its ability to bind to ALIX lacking the proline rich domain. Finally, by using a random screening approach, the minimal ALIX391–510 fragment was found to specifically interact with this p6 deletion mutant. A parallel analysis of ALIX binding to the late domain p9 from EIAV revealed that p6 and p9, which exhibit distinct ALIX binding motives, likely bind differently to ALIX. Altogether, our data support a model where the C-terminal proline-rich domain of ALIX allows the access of its binding site to p6 by alleviating a conformational constraint resulting from the presence of the central p6 hinge.

Lithium abundance patterns of late-F stars: an in-depth analysis of the lithium desert

Science.gov (United States)

Aguilera-Gómez, Claudia; Ramírez, Iván; Chanamé, Julio

2018-06-01

Aims: We address the existence and origin of the lithium (Li) desert, a region in the Li-Teff plane sparsely populated by stars. Here we analyze some of the explanations that have been suggested for this region, including mixing in the late main sequence, a Li dip origin for stars with low Li abundances in the region, and a possible relation with the presence of planets. Methods: To study the Li desert, we measured the atmospheric parameters and Li abundance of 227 late-F dwarfs and subgiants, chosen to be in the Teff range of the desert and without previous Li abundance measurements. Subsequently, we complemented those with literature data to obtain a homogeneous catalog of 2318 stars, for which we compute masses and ages. We characterize stars surrounding the region of the Li desert. Results: We conclude that stars with low Li abundances below the desert are more massive and more evolved than stars above the desert. Given the unexpected presence of low Li abundance stars in this effective temperature range, we concentrate on finding their origin. We conclude that these stars with low Li abundance do not evolve from stars above the desert: at a given mass, stars with low Li (i.e., below the desert) are more metal-poor. Conclusions: Instead, we suggest that stars below the Li desert are consistent with having evolved from the Li dip, discarding the need to invoke additional mixing to explain this feature. Thus, stars below the Li desert are not peculiar and are only distinguished from other subgiants evolved from the Li dip in that their combination of atmospheric parameters locates them in a range of effective temperatures where otherwise only high Li abundance stars would be found (i.e., stars above the desert). Full Tables 1 and 3 are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/614/A55This paper includes observations collected at The McDonald Observatory and

Market News Price Dataset

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Real-time price data collected by the Boston Market News Reporter. The NOAA Fisheries' "Fishery Market News" began operations in New York City on February 14, 1938....

Ideophones in Japanese modulate the P2 and late positive complex responses.

Directory of Open Access Journals (Sweden)

Gwilym eLockwood

2015-07-01

Full Text Available Sound-symbolism, or the direct link between sound and meaning, is typologically and behaviorally attested across languages. However, neuroimaging research has mostly focused on artificial non-words or individual segments, which do not represent sound-symbolism in natural language. We used EEG to compare Japanese ideophones, which are phonologically distinctive sound-symbolic lexical words, and arbitrary adverbs during a sentence reading task. Ideophones elicit a larger visual P2 response and a sustained late positive complex in comparison to arbitrary adverbs. These results and previous literature suggest that the larger P2 may indicate the integration of sound and sensory information by association in response to the distinctive phonology of ideophones. The late positive complex may reflect the facilitated lexical retrieval of ideophones in comparison to arbitrary words. This account provides new evidence that ideophones exhibit similar cross-modal correspondences to those which have been proposed for non-words and individual sounds, and that these effects are detectable in natural language.

Theoretical investigation of elementary reaction of complexing LiH+BeH2 → LiBeH3

International Nuclear Information System (INIS)

Charkin, O.P.; Boldyrev, A.I.; Sukhanov, L.P.

1979-01-01

In the framework of non-empiric Hartree-Fock-Roothaan method on the basis of gauss functions of Roos and Siegbahn made are calculations of different sections of potential surface elementary reaction of complexing LiH+BeH 2 → LiBeH 3 . Charts of potential surface are presented. Questions of the elementary mechanism of elementary processes of complexing and effect of mutual orientation of the reagents upon the reaction mechanism are considered. Stability of LiBeH 3 molecule to different dissociation channels and different aspects of structural non-rigidity of the L[MXsub(k+1)] complexes at super barrier excitation are discussed

D-Wave Electron-H, -He+, and -Li2+ Elastic Scattering and Photoabsorption in P States of Two-Electron Systems

Science.gov (United States)

Bhatia, A. K.

2014-01-01

In previous papers [A. K. Bhatia, Phys. Rev. A 85, 052708 (2012); 86, 032709 (2012); 87, 042705 (2013)] electron-H, -He+, and -Li2+ P-wave scattering phase shifts were calculated using the variational polarized orbital theory. This method is now extended to the singlet and triplet D-wave scattering in the elastic region. The long-range correlations are included in the Schrodinger equation by using the method of polarized orbitals variationally. Phase shifts are compared to those obtained by other methods. The present calculation provides results which are rigorous lower bonds to the exact phase shifts. Using the presently calculated D-wave and previously calculated S-wave continuum functions, photoionization of singlet and triplet P states of He and Li+ are also calculated, along with the radiative recombination rate coefficients at various electron temperatures.

The Changing Landscape of Science News