Typing of two Middle Eastern populations with the Precision ID Ancestry Panel

DEFF Research Database (Denmark)

Truelsen, Ditte Mikkelsen; Farzad, Maryam Sharafi; Mogensen, Helle Smidt

2017-01-01

, Turkish and Iranian individuals were SNP typed with Massively Parallel Sequencing with the Precision ID Ancestry Panel (Thermo Fisher Scientific) to assess whether it was possible to differentiate geographically proximate populations in the Middle East using this kit. Analyses showed that it were...

A novel Y-xylosidase, nucleotide sequence encoding it and use thereof.

NARCIS (Netherlands)

Graaff, de L.H.; Peij, van N.N.M.E.; Broeck, van den H.C.; Visser, J.

1996-01-01

A nucleotide sequence is provided which encodes a peptide having beta-xylosidase activity and exhibits at least 30mino acid identity with the amino acid sequence shown in SEQ ID NO. 1 or hybridises under stringent conditions with a nucleotide sequence shown in SEQ ID NO. 1, or a part thereof having

Overexpression of inhibitor of DNA-binding (ID)-1 protein related to angiogenesis in tumor advancement of ovarian cancers

International Nuclear Information System (INIS)

Maw, Min Khine; Fujimoto, Jiro; Tamaya, Teruhiko

2009-01-01

The inhibitor of DNA-binding (ID) has been involved in cell cycle regulation, apoptosis and angiogenesis. This prompted us to study ID functions in tumor advancement of ovarian cancers. Sixty patients underwent surgery for ovarian cancers. In ovarian cancers, the levels of ID-1, ID-2 and ID-3 mRNAs were determined by real-time reverse transcription-polymerase chain reaction. The histoscore with the localization of ID-1 was determined by immunohistochemistry. Patient prognosis was analyzed with a 36-month survival rate. Microvessel counts were determined by immunohistochemistry for CD34 and factor VIII-related antigen. ID-1 histoscores and mRNA levels both significantly (p < 0.001) increased in ovarian cancers according to clinical stage, regardless of histopathological type. Furthermore, 30 patients with high ID-1 expression had a lower survival rate (53%) compared to patients with low ID-1 expression (80%). ID-1 histoscores and mRNA levels significantly (p < 0.0001) correlated with microvessel counts in ovarian cancers. ID-1 increased in ovarian cancer cells during tumor progression. Moreover, ID-1 expression levels correlated with microvessel counts. Therefore, ID-1 might work on tumor advancement via angiogenesis and is considered to be a candidate for a prognostic indicator in ovarian cancers

ID3 contributes to cerebrospinal fluid seeding and poor prognosis in medulloblastoma

International Nuclear Information System (INIS)

Phi, Ji Hoon; Choi, Seung Ah; Lim, Sang-Hee; Lee, Joongyub; Wang, Kyu-Chang; Park, Sung-Hye; Kim, Seung-Ki

2013-01-01

The inhibitor of differentiation (ID) genes have been implicated as promoters of tumor progression and metastasis in many human cancers. The current study investigated the expression and functional roles of ID genes in seeding and prognosis of medulloblastoma. ID gene expression was screened in human medulloblastoma tissues. Knockdown of ID3 gene was performed in medulloblastoma cells in vitro. The expression of metastasis-related genes after ID3 knockdown was assessed. The effect of ID3 knockdown on tumor seeding was observed in an animal model in vivo. The survival of medulloblastoma patients was plotted according to the ID3 expression levels. Significantly higher ID3 expression was observed in medulloblastoma with cerebrospinal fluid seeding than tumors without seeding. Knockdown of ID3 decreased proliferation, increased apoptosis, and suppressed the migration of D283 medulloblastoma cells in vitro. In a seeding model of medulloblastoma, ID3 knockdown in vivo with shRNA inhibited the growth of primary tumors, prevented the development of leptomeningeal seeding, and prolonged animal survival. High ID3 expression was associated with shorter survival of medulloblastoma patients, especially in Group 4 medulloblastomas. High ID3 expression is associated with medullolbastoma seeding and is a poor prognostic factor, especially in patients with Group 4 tumors. ID3 may represent the metastatic/ aggressive phenotype of a subgroup of medulloblastoma

Inhibitor of differentiation 4 (Id4) is a potential tumor suppressor in prostate cancer

International Nuclear Information System (INIS)

Carey, Jason PW; Asirvatham, Ananthi J; Galm, Oliver; Ghogomu, Tandeih A; Chaudhary, Jaideep

2009-01-01

Inhibitor of differentiation 4 (Id4), a member of the Id gene family is also a dominant negative regulator of basic helix loop helix (bHLH) transcription factors. Some of the functions of Id4 appear to be unique as compared to its other family members Id1, Id2 and Id3. Loss of Id4 gene expression in many cancers in association with promoter hypermethylation has led to the proposal that Id4 may act as a tumor suppressor. In this study we provide functional evidence that Id4 indeed acts as a tumor suppressor and is part of a cancer associated epigenetic re-programming. Data mining was used to demonstrate Id4 expression in prostate cancer. Methylation specific polymerase chain reaction (MSP) analysis was performed to understand molecular mechanisms associated with Id4 expression in prostate cancer cell lines. The effect of ectopic Id4 expression in DU145 cells was determined by cell cycle analysis (3H thymidine incorporation and FACS), expression of androgen receptor, p53 and cyclin dependent kinase inhibitors p27 and p21 by a combination of RT-PCR, real time-PCR, western blot and immuno-cytochemical analysis. Id4 expression was down-regulated in prostate cancer. Id4 expression was also down-regulated in prostate cancer line DU145 due to promoter hyper-methylation. Ectopic Id4 expression in DU145 prostate cancer cell line led to increased apoptosis and decreased cell proliferation due in part by an S-phase arrest. In addition to S-phase arrest, ectopic Id4 expression in PC3 cells also resulted in prolonged G2/M phase. At the molecular level these changes were associated with increased androgen receptor (AR), p21, p27 and p53 expression in DU145 cells. The results suggest that Id4 acts directly as a tumor suppressor by influencing a hierarchy of cellular processes at multiple levels that leads to a decreased cell proliferation and change in morphology that is possibly mediated through induction of previously silenced tumor suppressors

ID4 promotes AR expression and blocks tumorigenicity of PC3 prostate cancer cells

International Nuclear Information System (INIS)

Komaragiri, Shravan Kumar; Bostanthirige, Dhanushka H.; Morton, Derrick J.; Patel, Divya; Joshi, Jugal; Upadhyay, Sunil; Chaudhary, Jaideep

2016-01-01

Deregulation of tumor suppressor genes is associated with tumorigenesis and the development of cancer. In prostate cancer, ID4 is epigenetically silenced and acts as a tumor suppressor. In normal prostate epithelial cells, ID4 collaborates with androgen receptor (AR) and p53 to exert its tumor suppressor activity. Previous studies have shown that ID4 promotes tumor suppressive function of AR whereas loss of ID4 results in tumor promoter activity of AR. Previous study from our lab showed that ectopic ID4 expression in DU145 attenuates proliferation and promotes AR expression suggesting that ID4 dependent AR activity is tumor suppressive. In this study, we examined the effect of ectopic expression of ID4 on highly malignant prostate cancer cell, PC3. Here we show that stable overexpression of ID4 in PC3 cells leads to increased apoptosis and decreased cell proliferation and migration. In addition, in vivo studies showed a decrease in tumor size and volume of ID4 overexpressing PC3 cells, in nude mice. At the molecular level, these changes were associated with increased androgen receptor (AR), p21, and AR dependent FKBP51 expression. At the mechanistic level, ID4 may regulate the expression or function of AR through specific but yet unknown AR co-regulators that may determine the final outcome of AR function. - Highlights: • ID4 expression induces AR expression in PC3 cells, which generally lack AR. • ID4 expression increased apoptosis and decreased cell proliferation and invasion. • Overexpression of ID4 reduces tumor growth of subcutaneous xenografts in vivo. • ID4 induces p21 and FKBP51 expression- co-factors of AR tumor suppressor activity.

ID4 promotes AR expression and blocks tumorigenicity of PC3 prostate cancer cells

Energy Technology Data Exchange (ETDEWEB)

Komaragiri, Shravan Kumar; Bostanthirige, Dhanushka H.; Morton, Derrick J.; Patel, Divya; Joshi, Jugal; Upadhyay, Sunil; Chaudhary, Jaideep, E-mail: jchaudhary@cau.edu

2016-09-09

Deregulation of tumor suppressor genes is associated with tumorigenesis and the development of cancer. In prostate cancer, ID4 is epigenetically silenced and acts as a tumor suppressor. In normal prostate epithelial cells, ID4 collaborates with androgen receptor (AR) and p53 to exert its tumor suppressor activity. Previous studies have shown that ID4 promotes tumor suppressive function of AR whereas loss of ID4 results in tumor promoter activity of AR. Previous study from our lab showed that ectopic ID4 expression in DU145 attenuates proliferation and promotes AR expression suggesting that ID4 dependent AR activity is tumor suppressive. In this study, we examined the effect of ectopic expression of ID4 on highly malignant prostate cancer cell, PC3. Here we show that stable overexpression of ID4 in PC3 cells leads to increased apoptosis and decreased cell proliferation and migration. In addition, in vivo studies showed a decrease in tumor size and volume of ID4 overexpressing PC3 cells, in nude mice. At the molecular level, these changes were associated with increased androgen receptor (AR), p21, and AR dependent FKBP51 expression. At the mechanistic level, ID4 may regulate the expression or function of AR through specific but yet unknown AR co-regulators that may determine the final outcome of AR function. - Highlights: • ID4 expression induces AR expression in PC3 cells, which generally lack AR. • ID4 expression increased apoptosis and decreased cell proliferation and invasion. • Overexpression of ID4 reduces tumor growth of subcutaneous xenografts in vivo. • ID4 induces p21 and FKBP51 expression- co-factors of AR tumor suppressor activity.

ACE insertion/deletion (I/D) polymorphism and diabetic nephropathy.

Science.gov (United States)

Rahimi, Zohreh

2012-10-01

Angiotensin converting enzyme (ACE) gene encodes ACE, a key component of renin angiotensin system (RAS), plays an important role in blood pressure homeostasis by generating the vasoconstrictor peptide angiotensin II. Directory of Open Access Journals (DOAJ), Google Scholar, Pubmed (NLM), LISTA (EBSCO) and Web of Science have been searched. The presence of ACE insertion/deletion (I/D) polymorphism affects the plasma level of ACE. ACE DD genotype is associated with the highest systemic and renal ACE levels compared with the lowest ACE activity in carriers of II genotype. In this review focus has been performed on the study of ACE I/D polymorphism in various populations and its influence on the risk of onset and progression of diabetic nephropathy. Also, association between ACE I/D polymorphism and response to ACE inhibitor and angiotensin II receptor antagonists will be reviewed. Further, synergistic effect of this polymorphism and variants of some genes on the risk of development of diabetic nephropathy will be discussed.

The metalloid arsenite induces nuclear export of Id3 possibly via binding to the N-terminal cysteine residues

International Nuclear Information System (INIS)

Kurooka, Hisanori; Sugai, Manabu; Mori, Kentaro; Yokota, Yoshifumi

2013-01-01

Highlights: •Sodium arsenite induces cytoplasmic accumulation of Id3. •Arsenite binds to closely spaced N-terminal cysteine residues of Id3. •N-terminal cysteines are essential for arsenite-induced nuclear export of Id3. •Nuclear export of Id3 counteracts its transcriptional repression activity. -- Abstract: Ids are versatile transcriptional repressors that regulate cell proliferation and differentiation, and appropriate subcellular localization of the Id proteins is important for their functions. We previously identified distinct functional nuclear export signals (NESs) in Id1 and Id2, but no active NES has been reported in Id3. In this study, we found that treatment with the stress-inducing metalloid arsenite led to the accumulation of GFP-tagged Id3 in the cytoplasm. Cytoplasmic accumulation was impaired by a mutation in the Id3 NES-like sequence resembling the Id1 NES, located at the end of the HLH domain. It was also blocked by co-treatment with the CRM1-specific nuclear export inhibitor leptomycin B (LMB), but not with the inhibitors for mitogen-activated protein kinases (MAPKs). Importantly, we showed that the closely spaced N-terminal cysteine residues of Id3 interacted with the arsenic derivative phenylarsine oxide (PAO) and were essential for the arsenite-induced cytoplasmic accumulation, suggesting that arsenite induces the CRM1-dependent nuclear export of Id3 via binding to the N-terminal cysteines. Finally, we demonstrated that Id3 significantly repressed arsenite-stimulated transcription of the immediate-early gene Egr-1 and that this repression activity was inversely correlated with the arsenite-induced nuclear export. Our results imply that Id3 may be involved in the biological action of arsenite

Beam transport radiation shielding for branch lines 2-ID-B and 2-ID-C

International Nuclear Information System (INIS)

Feng, Y.P.; Lai, B.; McNulty, I.; Dejus, R.J.; Randall, K.J.; Yun, W.

1995-01-01

The x-ray radiation shielding requirements beyond the first optics enclosure have been considered for the beam transport of the 2-ID-B and 2-ID-C branch lines of Sector 2 (SRI-CAT) of the APS. The first three optical components (mirrors) of the 2-ID-B branch are contained within the shielded first optics enclosure. Calculations indicate that scattering of the primary synchrotron beam by beamline components outside the enclosure, such as apertures and monochromators, or by gas particles in case of vacuum failure is within safe limits for this branch. A standard 2.5-inch-diameter stainless steel pipe with 1/16-inch-thick walls provides adequate shielding to reduce the radiation dose equivalent rate to human tissue to below the maximum permissible limit of 0.25 mrem/hr. The 2-ID-C branch requires, between the first optics enclosure where only two mirrors are used and the housing for the third mirror, additional lead shielding (0.75 mm) and a minimum approach distance of 2.6 cm. A direct beam stop consisting of at least 4.5 mm of lead is also required immediately downstream of the third mirror for 2-ID-C. Finally, to stop the direct beam from escaping the experimental station, a beam stop consisting of at least 4-mm or 2.5-mm steel is required for the 2-ID-B or 2-ID-C branches, respectively. This final requirement can be met by the vacuum chambers used to house the experiments for both branch lines

Inhibitor of differentiation 4 (Id4 is a potential tumor suppressor in prostate cancer

Directory of Open Access Journals (Sweden)

Carey Jason PW

2009-06-01

Full Text Available Abstract Background Inhibitor of differentiation 4 (Id4, a member of the Id gene family is also a dominant negative regulator of basic helix loop helix (bHLH transcription factors. Some of the functions of Id4 appear to be unique as compared to its other family members Id1, Id2 and Id3. Loss of Id4 gene expression in many cancers in association with promoter hypermethylation has led to the proposal that Id4 may act as a tumor suppressor. In this study we provide functional evidence that Id4 indeed acts as a tumor suppressor and is part of a cancer associated epigenetic re-programming. Methods Data mining was used to demonstrate Id4 expression in prostate cancer. Methylation specific polymerase chain reaction (MSP analysis was performed to understand molecular mechanisms associated with Id4 expression in prostate cancer cell lines. The effect of ectopic Id4 expression in DU145 cells was determined by cell cycle analysis (3H thymidine incorporation and FACS, expression of androgen receptor, p53 and cyclin dependent kinase inhibitors p27 and p21 by a combination of RT-PCR, real time-PCR, western blot and immuno-cytochemical analysis. Results Id4 expression was down-regulated in prostate cancer. Id4 expression was also down-regulated in prostate cancer line DU145 due to promoter hyper-methylation. Ectopic Id4 expression in DU145 prostate cancer cell line led to increased apoptosis and decreased cell proliferation due in part by an S-phase arrest. In addition to S-phase arrest, ectopic Id4 expression in PC3 cells also resulted in prolonged G2/M phase. At the molecular level these changes were associated with increased androgen receptor (AR, p21, p27 and p53 expression in DU145 cells. Conclusion The results suggest that Id4 acts directly as a tumor suppressor by influencing a hierarchy of cellular processes at multiple levels that leads to a decreased cell proliferation and change in morphology that is possibly mediated through induction of previously

A proposed HTTP service based IDS

Directory of Open Access Journals (Sweden)

Mohamed M. Abd-Eldayem

2014-03-01

Full Text Available The tremendous growth of the web-based applications has increased information security vulnerabilities over the Internet. Security administrators use Intrusion-Detection System (IDS to monitor network traffic and host activities to detect attacks against hosts and network resources. In this paper IDS based on Naïve Bayes classifier is analyzed. The main objective is to enhance IDS performance through preparing the training data set allowing to detect malicious connections that exploit the http service. Results of application are demonstrated and discussed. In the training phase of the proposed IDS, at first a feature selection technique based on Naïve Bayes classifier is used, this technique identifies the most important HTTP traffic features that can be used to detect HTTP attacks. In the testing and running phases proposed IDS classifies the network traffic based on the requested service, then based on the selected features Naïve Bayes classifier is used to analyze the HTTP service based traffic and identifies the HTTP normal connections and attacks. The performance of the IDS is measured through experiments using NSL-KDD data set. The results show that the detection rate of the IDS is about 99%, the false-positive rate is about 1%, and the false-negative rate is about 0.25%; therefore, proposed IDS holds the highest detection rate and the lowest false alarm compared with other leading IDS. In addition, the proposed IDS based on Naïve Bayes is used to classify network connections as a normal or attack. And it holds a high detection rate and a low false alarm.

Overestimation of the 25(OH)D serum concentration with the automated IDS EIA kit.

Science.gov (United States)

Cavalier, Etienne; Huberty, Véronique; Cormier, Catherine; Souberbielle, Jean-Claude

2011-02-01

We have recently observed an increasing number of patients presenting very high serum levels of 25-hydroxyvitamin D [25(OH)D] (> 150 ng/mL), which, in all cases, had been measured with the IDS EIA kit adapted on different "open" automated platforms. We performed a comparison between the IDS EIA kit adapted on two different "open"automated platforms and the DiaSorin RIA. We found a systematic bias (higher levels with the IDS EIA kit) for concentrations more than 50-60 ng/mL that was less obvious when the IDS EIA was used in its manual procedure. We thus suggest to use the IDS EIA kit in its manual procedure rather than to adapt it on an automated platform, and to interpret cautiously a 25(OH)D greater than 100 ng/mL with this kit. Copyright © 2011 American Society for Bone and Mineral Research.

Cytological Evaluation and REBA HPV-ID HPV Testing of Newly Developed Liquid-Based Cytology, EASYPREP: Comparison with SurePath.

Science.gov (United States)

Lee, Youn Soo; Gong, Gyungyub; Sohn, Jin Hee; Ryu, Ki Sung; Lee, Jung Hun; Khang, Shin Kwang; Cho, Kyung-Ja; Kim, Yong-Man; Kang, Chang Suk

2013-06-01

The objective of this study was to evaluate a newly-developed EASYPREP liquid-based cytology method in cervicovaginal specimens and compare it with SurePath. Cervicovaginal specimens were prospectively collected from 1,000 patients with EASYPREP and SurePath. The specimens were first collected by brushing for SurePath and second for EASYPREP. The specimens of both methods were diagnosed according to the Bethesda System. Additionally, we performed to REBA HPV-ID genotyping and sequencing analysis for human papillomavirus (HPV) on 249 specimens. EASYPREP and SurePath showed even distribution of cells and were equal in cellularity and staining quality. The diagnostic agreement between the two methods was 96.5%. Based on the standard of SurePath, the sensitivity, specificity, positive predictive value, and negative predictive value of EASYPREP were 90.7%, 99.2%, 94.8%, and 98.5%, respectively. The positivity of REBA HPV-ID was 49.4% and 95.1% in normal and abnormal cytological samples, respectively. The result of REBA HPV-ID had high concordance with sequencing analysis. EASYPREP provided comparable results to SurePath in the diagnosis and staining quality of cytology examinations and in HPV testing with REBA HPV-ID. EASYPREP could be another LBC method choice for the cervicovaginal specimens. Additionally, REBA HPV-ID may be a useful method for HPV genotyping.

[Clinical Significance of ID4 Gene Mehtylation in Demethylation-Treated MDS Cell Line and 2 MDS Patients].

Science.gov (United States)

Kang, Hui-Yuan; Wang, Xin-Rong; Gao, Li; Wang, Wei; Li, Mian-Yang; Wang, Li-Li; Wang, Cheng-Bin; Yu, Li

2015-04-01

To evaluate significance of ID4 gene mehtylation in demethylating myelodysplastic syndrome(MDS) cell Line MUTZ1 and 2 patients with MDS. The methylation-specific PCR (MS-PCR) and reverse transcription-PCR (RT-PCR) were applied to identify the methylation status and gene expression of ID4 gene in MDS cell line MUTZ1, a patient with aplastic anemia(AA) and a donor with normal bone marrow (NBM). RT-PCR was applied to detect the ID4 gene expression status in MUTZ1 cell line treated with decitabine at 3 different concentrations. Then bisulfite sequencing PCR (BSP) was applied to detect ID4 gene methylation status in 2 MDS parients treated with decitabine. The MDS cell line MUTZ-1 displayed a complete methylation of ID4 gene promoter with little mRNA expression. Inversely, bone marrow of an AA patient and NBM showed complete unmethylation of this gene with intensity mRNA expression. With the increase of decitabine concentration, ID4 gene mRNA expression was more and more increased. After decitabine treatment, ID4 gene methylation-positive frequencies of both the 2 MDS patients were much more decreased than that of the first treatment. So, ID4 gene mRNA expression inhibited by promoter hypemethylation could be recovered by using demethylation medicine. ID4 as a new potential anti-oncogene suggests that its methylation may become a marker for selection and assessment of therapeutic schedules in patients with MDS.

Large-scale analysis of intrinsic disorder flavors and associated functions in the protein sequence universe.

Science.gov (United States)

Necci, Marco; Piovesan, Damiano; Tosatto, Silvio C E

2016-12-01

Intrinsic disorder (ID) in proteins has been extensively described for the last decade; a large-scale classification of ID in proteins is mostly missing. Here, we provide an extensive analysis of ID in the protein universe on the UniProt database derived from sequence-based predictions in MobiDB. Almost half the sequences contain an ID region of at least five residues. About 9% of proteins have a long ID region of over 20 residues which are more abundant in Eukaryotic organisms and most frequently cover less than 20% of the sequence. A small subset of about 67,000 (out of over 80 million) proteins is fully disordered and mostly found in Viruses. Most proteins have only one ID, with short ID evenly distributed along the sequence and long ID overrepresented in the center. The charged residue composition of Das and Pappu was used to classify ID proteins by structural propensities and corresponding functional enrichment. Swollen Coils seem to be used mainly as structural components and in biosynthesis in both Prokaryotes and Eukaryotes. In Bacteria, they are confined in the nucleoid and in Viruses provide DNA binding function. Coils & Hairpins seem to be specialized in ribosome binding and methylation activities. Globules & Tadpoles bind antigens in Eukaryotes but are involved in killing other organisms and cytolysis in Bacteria. The Undefined class is used by Bacteria to bind toxic substances and mediate transport and movement between and within organisms in Viruses. Fully disordered proteins behave similarly, but are enriched for glycine residues and extracellular structures. © 2016 The Protein Society.

Evaluation of the Precision ID Ancestry Panel for crime case work

DEFF Research Database (Denmark)

Pereira, Vania; Mogensen, Helle S; Børsting, Claus

2017-01-01

The application of massive parallel sequencing (MPS) methodologies in forensic genetics is promising and it is gradually being implemented in forensic genetic case work. One of the major advantages of these technologies is that several traditional electrophoresis assays can be combined into one...... single MPS assay. This reduces both the amount of sample used and the time of the investigations. This study assessed the utility of the Precision ID Ancestry Panel (Thermo Fisher Scientific, Waltham, USA) in forensic genetics. This assay was developed for the Ion Torrent PGM™ System and genotypes 165...... ancestry informative SNPs. The performance of the assay and the accompanying software solution for ancestry inference was assessed by typing 142 Danes and 98 Somalis. Locus balance, heterozygote balance, and noise levels were calculated and future analysis criteria for crime case work were estimated...

Exome sequencing identifies three novel candidate genes implicated in intellectual disability.

Directory of Open Access Journals (Sweden)

Zehra Agha

Full Text Available Intellectual disability (ID is a major health problem mostly with an unknown etiology. Recently exome sequencing of individuals with ID identified novel genes implicated in the disease. Therefore the purpose of the present study was to identify the genetic cause of ID in one syndromic and two non-syndromic Pakistani families. Whole exome of three ID probands was sequenced. Missense variations in two plausible novel genes implicated in autosomal recessive ID were identified: lysine (K-specific methyltransferase 2B (KMT2B, zinc finger protein 589 (ZNF589, as well as hedgehog acyltransferase (HHAT with a de novo mutation with autosomal dominant mode of inheritance. The KMT2B recessive variant is the first report of recessive Kleefstra syndrome-like phenotype. Identification of plausible causative mutations for two recessive and a dominant type of ID, in genes not previously implicated in disease, underscores the large genetic heterogeneity of ID. These results also support the viewpoint that large number of ID genes converge on limited number of common networks i.e. ZNF589 belongs to KRAB-domain zinc-finger proteins previously implicated in ID, HHAT is predicted to affect sonic hedgehog, which is involved in several disorders with ID, KMT2B associated with syndromic ID fits the epigenetic module underlying the Kleefstra syndromic spectrum. The association of these novel genes in three different Pakistani ID families highlights the importance of screening these genes in more families with similar phenotypes from different populations to confirm the involvement of these genes in pathogenesis of ID.

Tinjauan Desain Website Kemlu.Go.Id

OpenAIRE

Danu Widhyatmoko

2013-01-01

Review of kemlu.go.id website design is a research report on Kemlu.go.id website design. Kemlu.go.id website aims to be the information gateway of Ministry of Foreign Affairs, and also as guidelines of foreign politic policies of Republic of Indonesia. The review had been accomplished by using analytical method based on the "Nine Essential Principles for Good Web Design" developed by Collis Ta'eed (2007). At the end of the article, several recommendations in developing kemlu.go.id website are...

Electron ID in ATLAS Run 2

CERN Document Server

Thais, Savannah Jennifer; The ATLAS collaboration

2018-01-01

Efficient and accurate electron identification is of critical importance to measuring many physics processes with leptons in the final state, including H->4l, dark vector boson searches, and various SUSY searches. This poster will describe the current status of the Likelihood driven Electron ID, highlighting the recent move from a MC driven ID to a data-driven ID. It will include the most recent identification efficiency and scale-factor measurements. Additionally, it will describe continued improvements for Run 2 electron ID, highlighting improvements in the low pt region and potential Machine Learning improvements.

Tinjauan Desain Website Kemlu.Go.Id

Directory of Open Access Journals (Sweden)

Danu Widhyatmoko

2013-04-01

Full Text Available Review of kemlu.go.id website design is a research report on Kemlu.go.id website design. Kemlu.go.id website aims to be the information gateway of Ministry of Foreign Affairs, and also as guidelines of foreign politic policies of Republic of Indonesia. The review had been accomplished by using analytical method based on the "Nine Essential Principles for Good Web Design" developed by Collis Ta'eed (2007. At the end of the article, several recommendations in developing kemlu.go.id website are presented to create better appearance.  

Idékatalog Appetit på maden

DEFF Research Database (Denmark)

Jensen, Tenna; Jespersen, Astrid Pernille; Grønnow, Liv Cæcilie

2015-01-01

Idékataloget er en selvstændig publikation hørende til projekt Appetit på maden. Idékataloget er udviklet til brug i Københavns Kommune.......Idékataloget er en selvstændig publikation hørende til projekt Appetit på maden. Idékataloget er udviklet til brug i Københavns Kommune....

Id1 suppresses anti-tumour immune responses and promotes tumour progression by impairing myeloid cell maturation.

Science.gov (United States)

Papaspyridonos, Marianna; Matei, Irina; Huang, Yujie; do Rosario Andre, Maria; Brazier-Mitouart, Helene; Waite, Janelle C; Chan, April S; Kalter, Julie; Ramos, Ilyssa; Wu, Qi; Williams, Caitlin; Wolchok, Jedd D; Chapman, Paul B; Peinado, Hector; Anandasabapathy, Niroshana; Ocean, Allyson J; Kaplan, Rosandra N; Greenfield, Jeffrey P; Bromberg, Jacqueline; Skokos, Dimitris; Lyden, David

2015-04-29

A central mechanism of tumour progression and metastasis involves the generation of an immunosuppressive 'macroenvironment' mediated in part through tumour-secreted factors. Here we demonstrate that upregulation of the Inhibitor of Differentiation 1 (Id1), in response to tumour-derived factors, such as TGFβ, is responsible for the switch from dendritic cell (DC) differentiation to myeloid-derived suppressor cell expansion during tumour progression. Genetic inactivation of Id1 largely corrects the myeloid imbalance, whereas Id1 overexpression in the absence of tumour-derived factors re-creates it. Id1 overexpression leads to systemic immunosuppression by downregulation of key molecules involved in DC differentiation and suppression of CD8 T-cell proliferation, thus promoting primary tumour growth and metastatic progression. Furthermore, advanced melanoma patients have increased plasma TGFβ levels and express higher levels of ID1 in myeloid peripheral blood cells. This study reveals a critical role for Id1 in suppressing the anti-tumour immune response during tumour progression and metastasis.

Parental social support, coping strategies, resilience factors, stress, anxiety and depression levels in parents of children with MPS III (Sanfilippo syndrome) or children with intellectual disabilities (ID).

Science.gov (United States)

Grant, Sheena; Cross, Elaine; Wraith, James Edmond; Jones, Simon; Mahon, Louise; Lomax, Michelle; Bigger, Brian; Hare, Dougal

2013-03-01

Mucopolysaccharidosis type III (MPS III, Sanfilippo syndrome) is a lysosomal storage disorder, caused by a deficiency in one of four enzymes involved in the catabolism of the glycosaminoglycan heparan sulphate. It is a degenerative disorder, with a progressive decline in children's intellectual and physical functioning. There is currently no cure for the disorder. To date there is a paucity of research on how this disorder impacts parents psychological functioning. Specifically, research in the area has failed to employ adequate control groups to assess if the impact of this disorder on parents psychological functioning differs from parenting a child with intellectual disability (ID). The current study examined child behaviour and parental psychological functioning in 23 parents of children with MPS III and 23 parents of children with ID. Parents completed postal questionnaires about their child's behaviour and abilities and their own psychological functioning. Parents of children with MPS III reported fewer behavioural difficulties as their child aged, more severe level of intellectual disability, and similar levels of perceived social support, coping techniques, stress, anxiety and depression levels as parents of children with ID. Both groups of parents scored above the clinical cut off for anxiety and depression. Parents of children with MPS III rated themselves as significantly less future-orientated and goal directed than parents of children with ID. Services should develop support packages for parents of children with MPS III that incorporate an understanding of the unique stressors and current-difficulty approach of this population. Future research should examine gender differences between parental psychological functioning, using mixed qualitative and quantitative approaches, and utilise matched developmental level and typically developing control groups.

Rethinking Social Network Assessment for Students with Intellectual Disabilities (ID) in Postsecondary Education

Science.gov (United States)

Eisenman, Laura T.; Farley-Ripple, Elizabeth; Culnane, Mary; Freedman, Brian

2013-01-01

Social networks of persons with intellectual disabilities (ID) have been characterized as smaller and less diverse than those of typical peers. Advocates have focused on strengthening those social networks by expanding circles of social support, protection, and friendship. As young adults with ID experience increasing levels of community…

Facts about Infectious Diseases (ID)

Science.gov (United States)

... an ID Specialist? Facts about ID Pocketcard Infectious diseases are caused by microscopic organisms that penetrate the body’s natural ... from diseases such as AIDS or treatment of diseases such as cancer, may allow ... of contaminated food or water, bites from vectors such as ticks or mosquitoes ...

One ID Card for the Entire Campus.

Science.gov (United States)

Ridenour, David P.; Ferguson, Linda M.

1986-01-01

The implementation by Indiana State University of a machine-readable photo ID system for their food services prompted an investigation into the available alternatives and requirements for a more efficient all-University ID card system. The new ID system is described. (AUTHOR/MLW)

Elevated endogenous expression of the dominant negative basic helix-loop-helix protein ID1 correlates with significant centrosome abnormalities in human tumor cells

Directory of Open Access Journals (Sweden)

Gutmann Anja

2010-01-01

Full Text Available Abstract Background ID proteins are dominant negative inhibitors of basic helix-loop-helix transcription factors that have multiple functions during development and cellular differentiation. Ectopic (over-expression of ID1 extends the lifespan of primary human epithelial cells. High expression levels of ID1 have been detected in multiple human malignancies, and in some have been correlated with unfavorable clinical prognosis. ID1 protein is localized at the centrosomes and forced (over-expression of ID1 results in errors during centrosome duplication. Results Here we analyzed the steady state expression levels of the four ID-proteins in 18 tumor cell lines and assessed the number of centrosome abnormalities. While expression of ID1, ID2, and ID3 was detected, we failed to detect protein expression of ID4. Expression of ID1 correlated with increased supernumerary centrosomes in most cell lines analyzed. Conclusions This is the first report that shows that not only ectopic expression in tissue culture but endogenous levels of ID1 modulate centrosome numbers. Thus, our findings support the hypothesis that ID1 interferes with centrosome homeostasis, most likely contributing to genomic instability and associated tumor aggressiveness.

Id-1 and Id-2 genes and products as therapeutic targets for treatment of breast cancer and other types of carcinoma

Science.gov (United States)

Desprez, Pierre-Yves; Campisi, Judith

2014-09-30

A method for treatment and amelioration of breast, cervical, ovarian, endometrial, squamous cells, prostate cancer and melanoma in a patient comprising targeting Id-1 or Id-2 gene expression with a delivery vehicle comprising a product which modulates Id-1 or Id-2 expression.

miR-342 regulates BRCA1 expression through modulation of ID4 in breast cancer.

Directory of Open Access Journals (Sweden)

Elisabetta Crippa

Full Text Available A miRNAs profiling on a group of familial and sporadic breast cancers showed that miRNA-342 was significantly associated with estrogen receptor (ER levels. To investigate at functional level the role of miR-342 in the pathogenesis of breast cancer, we focused our attention on its "in silico" predicted putative target gene ID4, a transcription factor of the helix-loop-helix protein family whose expression is inversely correlated with that of ER. ID4 is expressed in breast cancer and can negatively regulate BRCA1 expression. Our results showed an inverse correlation between ID4 and miR-342 as well as between ID4 and BRCA1 expression. We functionally validated the interaction between ID4 and miR-342 in a reporter Luciferase system. Based on these findings, we hypothesized that regulation of ID4 mediated by miR-342 could be involved in the pathogenesis of breast cancer by downregulating BRCA1 expression. We functionally demonstrated the interactions between miR-342, ID4 and BRCA1 in a model provided by ER-negative MDA-MB-231 breast cancer cell line that presented high levels of ID4. Overexpression of miR-342 in these cells reduced ID4 and increased BRCA1 expression, supporting a possible role of this mechanism in breast cancer. In the ER-positive MCF7 and in the BRCA1-mutant HCC1937 cell lines miR-342 over-expression only reduced ID4. In the cohort of patients we studied, a correlation between miR-342 and BRCA1 expression was found in the ER-negative cases. As ER-negative cases were mainly BRCA1-mutant, we speculate that the mechanism we demonstrated could be involved in the decreased expression of BRCA1 frequently observed in non BRCA1-mutant breast cancers and could be implicated as a causal factor in part of the familial cases grouped in the heterogeneous class of non BRCA1 or BRCA2-mutant cases (BRCAx. To validate this hypothesis, the study should be extended to a larger cohort of ER-negative cases, including those belonging to the BRCAx class.

Evaluation of ID-PaGIA syphilis antibody test.

Science.gov (United States)

Naaber, Paul; Makoid, Ene; Aus, Anneli; Loivukene, Krista; Poder, Airi

2009-01-01

Laboratory diagnosis of syphilis is usually accomplished by serology. There are currently a large number of different commercial treponemal tests available that vary in format, sensitivity and specificity. To evaluate the ID-PaGIA Syphilis Antibody Test as an alternative to other specific treponemal tests for primary screening or confirmation of diagnosis. Serum samples from healthy adults (n = 100) were used for detection of specificity of ID-PaGIA. To evaluate sensitivity of ID-PaGIA serum samples (n = 101) from patients with confirmed or suspected syphilis were tested for syphilis antibodies with FTA-Abs IgM, ID-PaGIA, ELISA IgM and TPHA tests. No false-positive results were found with ID-PaGIA. Sensitivity of various treponemal tests was the following: FTA-Abs IgM: 95.5%, ID-PaGIA and ELISA IgM: 94%, and TPHA 75%. The positive and negative predictive values of ID-PaGIA were 100 and 89.5%, respectively. Compared with other treponemal tests ID-PaGIA has excellent sensitivity and specificity.

A Cross-Layer, Anomaly-Based IDS for WSN and MANET.

Science.gov (United States)

Amouri, Amar; Morgera, Salvatore D; Bencherif, Mohamed A; Manthena, Raju

2018-02-22

Intrusion detection system (IDS) design for mobile adhoc networks (MANET) is a crucial component for maintaining the integrity of the network. The need for rapid deployment of IDS capability with minimal data availability for training and testing is an important requirement of such systems, especially for MANETs deployed in highly dynamic scenarios, such as battlefields. This work proposes a two-level detection scheme for detecting malicious nodes in MANETs. The first level deploys dedicated sniffers working in promiscuous mode. Each sniffer utilizes a decision-tree-based classifier that generates quantities which we refer to as correctly classified instances (CCIs) every reporting time. In the second level, the CCIs are sent to an algorithmically run supernode that calculates quantities, which we refer to as the accumulated measure of fluctuation (AMoF) of the received CCIs for each node under test (NUT). A key concept that is used in this work is that the variability of the smaller size population which represents the number of malicious nodes in the network is greater than the variance of the larger size population which represents the number of normal nodes in the network. A linear regression process is then performed in parallel with the calculation of the AMoF for fitting purposes and to set a proper threshold based on the slope of the fitted lines. As a result, the malicious nodes are efficiently and effectively separated from the normal nodes. The proposed scheme is tested for various node velocities and power levels and shows promising detection performance even at low-power levels. The results presented also apply to wireless sensor networks (WSN) and represent a novel IDS scheme for such networks.

Clinical accuracy of a PLEX-ID flu device for simultaneous detection and identification of influenza viruses A and B.

Science.gov (United States)

Tang, Yi-Wei; Lowery, Kristin S; Valsamakis, Alexandra; Schaefer, Virginia C; Chappell, James D; White-Abell, Jill; Quinn, Criziel D; Li, Haijing; Washington, Cicely A; Cromwell, Jenna; Giamanco, Chantel M; Forman, Michael; Holden, Jeffery; Rothman, Richard E; Parker, Michelle L; Ortenberg, Elaine V; Zhang, Lei; Lin, Yea-Lin; Gaydos, Charlotte A

2013-01-01

Respiratory tract infections caused by influenza A and B viruses often present nonspecifically, and a rapid, high-throughput laboratory technique that can identify influenza viruses is clinically and epidemiologically desirable. The PLEX-ID Flu assay (Abbott Molecular Inc., Des Plaines, IL) incorporates multilocus PCR and electrospray ionization-mass spectrometry to detect and differentiate influenza A 2009 H1N1 (H1N1-p), seasonal H1N1 (H1N1-s), influenza A H3N2, and influenza B viruses in nasopharyngeal swab (NPS) specimens. The clinical performance characteristics of the PLEX-ID Flu assay in symptomatic patients were determined in this multicenter trial. A total of 2,617 prospectively and retrospectively collected NPS specimens from patients with influenza-like illness between February 2008 and 28 May 2010 were eligible for inclusion in the study. Each specimen was tested in parallel by the PLEX-ID Flu assay and by the Prodesse ProFLU+ assay (Prodesse Inc., Madison, WI), to detect influenza A and B viruses. Specimens testing positive for influenza A virus by ProFLU+ were subtyped as H1N1-p, H1N1-s, or H3N2 by using the ProFAST+ assay (Gen-Probe Prodesse Inc.). The reproducibility of the PLEX-ID Flu assay ranged from 98.3 to 100.0%, as determined by testing a nine-specimen panel at three clinical sites on each of 5 days. Positive percent agreements (PPAs) and negative percent agreements (NPAs) of the PLEX-ID Flu assay were 94.5% and 99.0% for influenza A virus and 96.0% and 99.9% for influenza B virus, respectively. For the influenza A virus subtyping characterization, the PLEX-ID Flu assay had PPAs and NPAs of 98.3% and 97.5% for H1N1-p, 88.6% and 100.0% for H1N1-s, and 98.0% and 99.9% for H3N2, respectively. The overall agreements between the PLEX-ID and Prodesse ProFLU+/ProFAST+ assays were 97.1 to 100.0%. Bidirectional Sanger sequencing analysis revealed that 87.5% of 96 discrepant results between the PLEX-ID Flu and ProFLU+/ProFAST+ assays were found upon

Identification of Staphylococcus species and subspecies with the MicroScan Pos ID and Rapid Pos ID panel systems.

Science.gov (United States)

Kloos, W E; George, C G

1991-01-01

The accuracies of the MicroScan Pos ID and Rapid Pos ID panel systems (Baxter Diagnostic Inc., MicroScan Division, West Sacramento, Calif.) were compared with each other and with the accuracies of conventional methods for the identification of 25 Staphylococcus species and 4 subspecies. Conventional methods included those used in the original descriptions of species and subspecies and DNA-DNA hybridization. The Pos ID panel uses a battery of 18 tests, and the Rapid Pos ID panel uses a battery of 42 tests for the identification of Staphylococcus species. The Pos ID panel has modified conventional and chromogenic tests that can be read after 15 to 48 h of incubation; the Rapid Pos ID panel has tests that use fluorogenic substrates or fluorometric indicators, and test results can be read after 2 h of incubation in the autoSCAN-W/A. Results indicated that both MicroScan systems had a high degree of congruence (greater than or equal to 90%) with conventional methods for the species S. capitis, S. aureus, S. auricularis, S. saprophyticus, S. cohnii, S. arlettae, S. carnosus, S. lentus, and S. sciuri and, in particular, the subspecies S. capitis subsp. capitis and S. cohnii subsp. cohnii. The Rapid Pos ID panel system also had greater than or equal to 90% congruence with conventional methods for S. epidermidis, S. caprae, S. warneri subsp. 2, S. xylosus, S. kloosii, and S. caseolyticus. For both MicroScan systems, congruence with conventional methods was 80 to 90% for S. haemolyticus subsp. 1, S. equorum, S. intermedius, and S. hyicus; and in addition, with the Rapid Pos ID panel system congruence was 80 to 89% for S. capitis subsp. ureolyticus, S. warneri subsp. 1, S. hominis, S. cohnii subsp. urealyticum, and S. simulans. The MicroScan systems identified a lower percentage (50 to 75%) of strains of S. lugdunensis, S. gallinarum, S. schleiferi, and S. chromogenes, although the addition of specific tests to the systems might increase the accuracy of identification

LOX: Inferring level of expression from diverse methods of census sequencing

KAUST Repository

Zhang, Zhang

2010-06-10

Summary: We present LOX (Level Of eXpression) that estimates the Level Of gene eXpression from high-throughput-expressed sequence datasets with multiple treatments or samples. Unlike most analyses, LOX incorporates a gene bias model that facilitates integration of diverse transcriptomic sequencing data that arises when transcriptomic data have been produced using diverse experimental methodologies. LOX integrates overall sequence count tallies normalized by total expressed sequence count to provide expression levels for each gene relative to all treatments as well as Bayesian credible intervals. © The Author 2010. Published by Oxford University Press. All rights reserved.

LOX: Inferring level of expression from diverse methods of census sequencing

KAUST Repository

Zhang, Zhang; Ló pez-Girá ldez, Francesc Francisco; Townsend, Jeffrey P.

2010-01-01

Summary: We present LOX (Level Of eXpression) that estimates the Level Of gene eXpression from high-throughput-expressed sequence datasets with multiple treatments or samples. Unlike most analyses, LOX incorporates a gene bias model that facilitates integration of diverse transcriptomic sequencing data that arises when transcriptomic data have been produced using diverse experimental methodologies. LOX integrates overall sequence count tallies normalized by total expressed sequence count to provide expression levels for each gene relative to all treatments as well as Bayesian credible intervals. © The Author 2010. Published by Oxford University Press. All rights reserved.

Commissioning of the IDS Neutron Detector and $\\beta$-decay fast-timing studies at IDS

CERN Document Server

Piersa, Monika

2016-01-01

The following report describes my scientific activities performed during the Summer Student Programme at ISOLDE. The main part of my project was focused on commissioning the neutron detector dedicated to nuclear decay studies at ISOLDE Decay Station (IDS). I have participated in all the steps needed to make it operational for the IS609 experiment. In the testing phase, we obtained expected detector response and calibrations confirmed its successful commissioning. The detector was mounted in the desired geometry at IDS and used in measurements of the beta-delayed neutron emission of $^8$He. After completing aforementioned part of my project, I became familiar with the fast-timing method. This technique was applied at IDS in the IS610 experiment performed in June 2016 to explore the structure of neutron-rich $^{130-134}$Sn nuclei. Since the main part of my PhD studies will be the analysis of data collected in this experiment, the second part of my project was dedicated to acquiring knowledge about technical de...

A new module in neural differentiation control: two microRNAs upregulated by retinoic acid, miR-9 and -103, target the differentiation inhibitor ID2.

Directory of Open Access Journals (Sweden)

Daniela Annibali

Full Text Available The transcription factor ID2 is an important repressor of neural differentiation strongly implicated in nervous system cancers. MicroRNAs (miRNAs are increasingly involved in differentiation control and cancer development. Here we show that two miRNAs upregulated on differentiation of neuroblastoma cells--miR-9 and miR-103--restrain ID2 expression by directly targeting the coding sequence and 3' untranslated region of the ID2 encoding messenger RNA, respectively. Notably, the two miRNAs show an inverse correlation with ID2 during neuroblastoma cell differentiation induced by retinoic acid. Overexpression of miR-9 and miR-103 in neuroblastoma cells reduces proliferation and promotes differentiation, as it was shown to occur upon ID2 inhibition. Conversely, an ID2 mutant that cannot be targeted by either miRNA prevents retinoic acid-induced differentiation more efficient than wild-type ID2. These findings reveal a new regulatory module involving two microRNAs upregulated during neural differentiation that directly target expression of the key differentiation inhibitor ID2, suggesting that its alteration may be involved in neural cancer development.

Expression of Id2 in the Second Heart Field and Cardiac Defects in Id2 Knock-Out Mice

NARCIS (Netherlands)

Jongbloed, M. R. M.; Vicente-Steijn, R.; Douglas, Y. L.; Wisse, L. J.; Mori, K.; Yokota, Y.; Bartelings, M. M.; Schalij, M. J.; Mahtab, E. A.; Poelmann, R. E.; Gittenberger-De Groot, A. C.

2011-01-01

The inhibitor of differentiation Id2 is expressed in mesoderm of the second heart field, which contributes myocardial and mesenchymal cells to the primary heart tube. The role of Id2 in cardiac development is insufficiently known. Heart development was studied in sequential developmental stages in

Comparison of the optimized conditions for genotyping of ACE ID ...

African Journals Online (AJOL)

ACE ID polymorphism is inevitable for genetic epidemiology of several cardiovascular and non cardiovascular diseases due to its direct influence on ACE activity level. In the present work, conditions were optimized for its analysis using conventional and direct blood PCR (DB PCR). Blood samples from nine normotensive ...

Relationship between major depressive disorder and ACE gene I/D polymorphism in a Turkish population

Directory of Open Access Journals (Sweden)

Sema Inanir

2016-04-01

Full Text Available Abstract Background Major depressive disorder (MDD is a complex disease and a significant health problem that is prevalent across the world. Angiotensin-converting enzyme (ACE has an important role in renin-angiotensin system (RAS and converts inactive angiotensin I to a potent vasopressor and aldosterone-stimulating peptide angiotensin II. Levels of ACE in plasma vary according to the insertion/deletion (I/D polymorphism of ACE gene. Objective The aim of the current study was to examine the influence ACE gene I/D variations on the risk of MDD. Methods In the present case-control study, we analyzed ACE I/D polymorphism in 346 MDD patients and 210 healthy subjects using polymerase chain reaction technique. Results Comparing the two groups, no significant difference was observed with regard to either genotype distributions or allele frequencies of the I/D polymorphism of ACE gene. Discussion Our findings suggest that the ACE I/D polymorphism is not associated with MDD in Turkish case-control study. Further studies are still needed.

Promoter methylation-associated loss of ID4 expression is a marker of tumour recurrence in human breast cancer

International Nuclear Information System (INIS)

Noetzel, Erik; Veeck, Jürgen; Niederacher, Dieter; Galm, Oliver; Horn, Felicitas; Hartmann, Arndt; Knüchel, Ruth; Dahl, Edgar

2008-01-01

Inhibitor of DNA binding/Inhibitor of differentiation 4 (ID4) is a critical factor for cell proliferation and differentiation in normal vertebrate development. ID4 has regulative functions for differentiation and growth of the developing brain. The role of ID1, ID2 and ID3 are expected to be oncogenic due to their overexpression in pancreatic cancer and colorectal adenocarcinomas, respectively. Aside from these findings, loss of ID3 expression was demonstrated in ovarian cancer. The aim of the present study was to reveal the factual role of ID4 in carcinogenesis in more detail, since its role for the pathogenesis of human breast cancer has been discussed controversially, assigning both oncogenic and tumour suppressive functions. ID4 promoter methylation, ID4 mRNA expression and ID4 protein expression were analysed in primary human breast cancer specimens using methylation-specific PCR (MSP) (n=170), semiquantitative realtime RT-PCR (n=46) and immunhistochemistry (n=3), respectively. In order to demonstrate a functional association of ID4 promoter methylation with its gene silencing, we performed DNA demethylation analysis with four human breast cell lines using MSP and semiquantitative realtime RT-PCR. In addition, we performed correlations of ID4 promoter methylation with ID4 mRNA and ID4 protein expression in matched samples of breast tumour and corresponding normal tissue. We carried out statistical analyses in order to find correlations between ID4 promoter methylation and clinicopathological parameters. Frequent ID4 promoter methylation was observed in primary breast cancer samples (69%, 117/170). We found a tight correlation (P<0.0001) between ID4 promoter methylation and loss of ID4 expression in primary breast cancer 3 specimens. Demethylating treatment with breast cancer cell lines was associated with clear ID4 mRNA re-expression. Tumours with ID4 promoter methylation showed distinct loss of ID4 expression on both transcription and protein level

Association between ACE gene I/D polymorphism and clinical presentation and prognosis of sarcoidosis.

Science.gov (United States)

Alía, P; Mañá, J; Capdevila, O; Alvarez, A; Navarro, M A

2005-01-01

Serum angiotensin converting enzyme (SACE) concentration is considered a marker of sarcoidosis activity. This concentration is influenced by an insertion/deletion (I/D) polymorphism of the ACE gene, such that SACE levels follow the pattern DD>ID>II. The aim of our work was to study the relationship between I/D polymorphism and susceptibility to sarcoidosis, as well as the relation between this polymorphism and the clinical presentation and evolution of the disease in 177 sarcoidosis patients. A group of 104 individuals without sarcoidosis was included as control. Genotyping was done by a polymerase chain reaction (PCR) method, and SACE concentration at diagnosis was determined by a kinetic method. No differences were observed in genotype or allele distributions between patients and controls, nor between patients considering the type of presentation (Löfgren versus non-Löfgren) and evolution of the disease (acute versus chronic). As reported for healthy populations, SACE concentrations followed the pattern DD>ID>II in sarcoidosis patients, but significant differences between genotypes existed only in the Löfgren group (p = 0.003) and in acute patients (p = 0.02). SACE concentrations at diagnosis were lower in acute patients (p = 0.05) and in Löfgren's syndrome (p = 0.04), but this seemed to occur only in ID individuals (p = 0.02 and p = 0.01, respectively). No relation was thus found between I/D polymorphism and susceptibility to sarcoidosis, but ACE I/D genotyping may improve the assessment of disease activity, both at diagnosis and during the follow-up of treated and untreated patients.

Cyclin D1, Id1 and EMT in breast cancer

International Nuclear Information System (INIS)

Tobin, Nicholas P; Sims, Andrew H; Lundgren, Katja L; Lehn, Sophie; Landberg, Göran

2011-01-01

Cyclin D1 is a well-characterised cell cycle regulator with established oncogenic capabilities. Despite these properties, studies report contrasting links to tumour aggressiveness. It has previously been shown that silencing cyclin D1 increases the migratory capacity of MDA-MB-231 breast cancer cells with concomitant increase in 'inhibitor of differentiation 1' (ID1) gene expression. Id1 is known to be associated with more invasive features of cancer and with the epithelial-mesenchymal transition (EMT). Here, we sought to determine if the increase in cell motility following cyclin D1 silencing was mediated by Id1 and enhanced EMT-features. To further substantiate these findings we aimed to delineate the link between CCND1, ID1 and EMT, as well as clinical properties in primary breast cancer. Protein and gene expression of ID1, CCND1 and EMT markers were determined in MDA-MB-231 and ZR75 cells by western blot and qPCR. Cell migration and promoter occupancy were monitored by transwell and ChIP assays, respectively. Gene expression was analysed from publicly available datasets. The increase in cell migration following cyclin D1 silencing in MDA-MB-231 cells was abolished by Id1 siRNA treatment and we observed cyclin D1 occupancy of the Id1 promoter region. Moreover, ID1 and SNAI2 gene expression was increased following cyclin D1 knock-down, an effect reversed with Id1 siRNA treatment. Similar migratory and SNAI2 increases were noted for the ER-positive ZR75-1 cell line, but in an Id1-independent manner. In a meta-analysis of 1107 breast cancer samples, CCND1 low /ID1 high tumours displayed increased expression of EMT markers and were associated with reduced recurrence free survival. Finally, a greater percentage of CCND1 low /ID1 high tumours were found in the EMT-like 'claudin-low' subtype of breast cancer than in other subtypes. These results indicate that increased migration of MDA-MB-231 cells following cyclin D1 silencing can be mediated by Id

FlowIDS

OpenAIRE

Sabolčák, Peter

2006-01-01

FlowIDS is system which can detect some of the undesirable traffi c in computer networks (undesirable traffic could be also ie. virus activity or overloading of network) and mostly doing counteraction which are set by administrator. Information about data ows are provided by hardware of network infrastructure, eliminitaion of undesirable activity is done through changes in network hardware settings. Regarding the quantity of solution which are provided on market, I decided to focus on Cisco n...

Accident sequence precursor analysis level 2/3 model development

International Nuclear Information System (INIS)

Lui, C.H.; Galyean, W.J.; Brownson, D.A.

1997-01-01

The US Nuclear Regulatory Commission's Accident Sequence Precursor (ASP) program currently uses simple Level 1 models to assess the conditional core damage probability for operational events occurring in commercial nuclear power plants (NPP). Since not all accident sequences leading to core damage will result in the same radiological consequences, it is necessary to develop simple Level 2/3 models that can be used to analyze the response of the NPP containment structure in the context of a core damage accident, estimate the magnitude of the resulting radioactive releases to the environment, and calculate the consequences associated with these releases. The simple Level 2/3 model development work was initiated in 1995, and several prototype models have been completed. Once developed, these simple Level 2/3 models are linked to the simple Level 1 models to provide risk perspectives for operational events. This paper describes the methods implemented for the development of these simple Level 2/3 ASP models, and the linkage process to the existing Level 1 models

Securing remote services by integrating SecurID strong authentication technology in EFDA-Federation infrastructure

Energy Technology Data Exchange (ETDEWEB)

Castro, R., E-mail: rodrigo.castro@visite.es [Asociacion EURATOM/CIEMAT para Fusion, Madrid (Spain); Barbato, P. [Consorzio RFX, Euratom ENEA Association, Corso Stati Uniti 4, 35127 Padova (Italy); Vega, J. [Asociacion EURATOM/CIEMAT para Fusion, Madrid (Spain); Taliercio, C. [Consorzio RFX, Euratom ENEA Association, Corso Stati Uniti 4, 35127 Padova (Italy)

2011-10-15

Remote participation facilities among fusion laboratories require access control solutions with two main objectives: to preserve the usability of the systems and to guaranty the required level of security for accessing to shared services. On one hand, this security solution has to be: single-sign-on, transparent for users, compatible with user mobility, and compatible with used client applications. On the other hand, it has to be compatible with shared services and resources among organisations, providing in each case the required access security level. EFDA-Federation is a security infrastructure that integrates a set of fusion laboratories and enables to share resources and services fulfilling the requirements previously described. In EFDA community, JET and RFX have security access policies to some of their services that require strong authentication mechanisms. In both cases, strong authentication is based on RSA SecurID tokens. This is a hardware device that is supplied to and generates a new password every minute. The job presents two main results. The first one is the integration of RSA SecurID into EFDA-Federation. Thanks to it, federated organisations are able to offer SecurID to their users as an alternative strong authentication mechanism, with the corresponding increase of security level. The second result is the development of a new access control mechanism based on port knocking techniques and its integration into EFDA-Federation. Additionally, a real application in RFX is presented and includes the integration of its SecurID infrastructure as federated authentication mechanism, and the application of the new access control mechanism to its MDSplus server.

Securing remote services by integrating SecurID strong authentication technology in EFDA-Federation infrastructure

International Nuclear Information System (INIS)

Castro, R.; Barbato, P.; Vega, J.; Taliercio, C.

2011-01-01

Remote participation facilities among fusion laboratories require access control solutions with two main objectives: to preserve the usability of the systems and to guaranty the required level of security for accessing to shared services. On one hand, this security solution has to be: single-sign-on, transparent for users, compatible with user mobility, and compatible with used client applications. On the other hand, it has to be compatible with shared services and resources among organisations, providing in each case the required access security level. EFDA-Federation is a security infrastructure that integrates a set of fusion laboratories and enables to share resources and services fulfilling the requirements previously described. In EFDA community, JET and RFX have security access policies to some of their services that require strong authentication mechanisms. In both cases, strong authentication is based on RSA SecurID tokens. This is a hardware device that is supplied to and generates a new password every minute. The job presents two main results. The first one is the integration of RSA SecurID into EFDA-Federation. Thanks to it, federated organisations are able to offer SecurID to their users as an alternative strong authentication mechanism, with the corresponding increase of security level. The second result is the development of a new access control mechanism based on port knocking techniques and its integration into EFDA-Federation. Additionally, a real application in RFX is presented and includes the integration of its SecurID infrastructure as federated authentication mechanism, and the application of the new access control mechanism to its MDSplus server.

Aliénation et idéologie

OpenAIRE

Kanabus, Benoît; Popa, Délia

2017-01-01

Dès lors, on entend mieux la question sur laquelle se referment les mille pages du Marx : « La pensée de Marx nous place devant la question abyssale : qu’est-ce que la vie » ? Cette question peut être reposée à nouveaux frais à l’âge du capitalisme avancé, où, comme le notait Adorno, la vie est devenue « l’idéologie de sa propre absence ». La recherche d’un autre rapport à l’idéologie vient alors prendre le relais de la lutte anti-idéologique de la théorie critique. Cette recherche part du po...

Complete genome sequence of Catenulispora acidiphila type strain (ID 139908T)

Energy Technology Data Exchange (ETDEWEB)

Copeland, Alex; Lapidus, Alla; Rio, Tijana GlavinaDel; Nolan, Matt; Lucas, Susan; Chen, Feng; Tice, Hope; Cheng, Jan-Fang; Bruce, David; Goodwin, Lynne; Pitluck, Sam; Mikhailova, Natalia; Pati, Amrita; Ivanova, Natalia; Mavromatis, Konstantinos; Chen, Amy; Palaniappan, Krishna; Chain, Patrick; Land, Miriam; Hauser, Loren; Chang, Yun-Juan; Jefferies, Cynthia C.; Chertkov, Olga; Brettin, Thomas; Detter, John C.; Han, Cliff; Ali, Zahid; Tindall, Brian J.; Goker, Markus; Bristow, James; Eisen, Jonathan A.; Markowitz, Victor; Hugenholtz, Philip; Kyrpides, Nikos C.; Klenk, Hans-Peter

2009-05-20

Catenulispora acidiphila Busti et al. 2006 is the type species of the genus Catenulispora, and is of interest because of the rather isolated phylogenetic location of the genomically little studied suborder Catenulisporineae within the order Actinomycetales. C. acidiphilia is known for its acidophilic, aerobic lifestyle, but can also grow scantly under anaerobic conditions. Under regular conditions C. acidiphilia grows in long filaments of relatively short aerial hyphae with marked septation. It is a free living, non motile, Gram-positive bacterium isolated from a forest soil sample taken from a wooded area in Gerenzano, Italy. Here we describe the features of this organism, together with the complete genome sequence and annotation. This is the first complete genome sequence of the actinobacterial family Catenulisporaceae, and the 10,467,782 bp long single replicon genome with its 9056 protein-coding and 69 RNA genes is a part of the Genomic Encyclopedia of Bacteria and Archaea project.

System-level hazard analysis using the sequence-tree method

International Nuclear Information System (INIS)

Huang, H.-W.; Shih Chunkuan; Yih Swu; Chen, M.-H.

2008-01-01

A system-level PHA using the sequence-tree method is presented to perform safety-related digital I and C system SSA. The conventional PHA involves brainstorming among experts on various portions of the system to identify hazards through discussions. However, since the conventional PHA is not a systematic technique, the analysis results depend strongly on the experts' subjective opinions. The quality of analysis cannot be appropriately controlled. Therefore, this study presents a system-level sequence tree based PHA, which can clarify the relationship among the major digital I and C systems. This sequence-tree-based technique has two major phases. The first phase adopts a table to analyze each event in SAR Chapter 15 for a specific safety-related I and C system, such as RPS. The second phase adopts a sequence tree to recognize the I and C systems involved in the event, the working of the safety-related systems and how the backup systems can be activated to mitigate the consequence if the primary safety systems fail. The defense-in-depth echelons, namely the Control echelon, Reactor trip echelon, ESFAS echelon and Monitoring and indicator echelon, are arranged to build the sequence-tree structure. All the related I and C systems, including the digital systems and the analog back-up systems, are allocated in their specific echelons. This system-centric sequence-tree analysis not only systematically identifies preliminary hazards, but also vulnerabilities in a nuclear power plant. Hence, an effective simplified D3 evaluation can also be conducted

ID-pilet teeb Tallinnas võidukäiku / Anneli Lepp

Index Scriptorium Estoniae

Lepp, Anneli

2006-01-01

Vt. ka Postimees : na russkom jazõke 12. jaan. lk 3. Tallinna transpordiameti peaökonomisti Mart Moosuse sõnul moodustas ID-pilet 60,7% ühistranspordi piletituludest, Tartus oli vastav näitaja aga alla 1%. Tartut teenindava bussifirma AS Connex Eesti finantsjuht Tiina Telling peab suure erinevuse põhjuseks asjaolu, et Tallinnas on ID-pilet paberpiletist 40-88% soodsam, Tartus hinnavahe aga puudub või on lausa negatiivne ID-pileti kahjuks. Lisa: ID-pilet

PERSONAL BRANDING PRABOWO SUBIANTO (ANALISIS ISI KUANTITATIF PERSONAL BRANDING PRABOWO SUBIANTO DI SITUS BERITA ONLINE REPUBLIKA.CO.ID DAN TEMPO.CO.ID TANGGAL 9 JUNI - 9 JULI 2014

Directory of Open Access Journals (Sweden)

Hendro Agus Prakoso

2016-09-01

berita kedua media tersebut. Frekuensi berita berjumlah 107 di Republika.co.id dan 51 berita di Tempo.co.id Ragam berita Republika.co.id didominasi konsep Spesialisasi sebesar 22,4% dari 107 berita, sedangkan pada Tempo.co.id didominasi konsep Nama baik sebesar 23,5% dari 51 berita. Sumber berita pada Republika.co.id mayoritas berasal dari Liputan langsung sebesar 42,9% dari 107 berita sedangkan pada Tempo.co.id mayoritas berasal dari Intelektual sebesar 54,9% dari 51 berita.

Epigenetic inactivation of inhibitor of differentiation 4 (Id4) correlates with prostate cancer

International Nuclear Information System (INIS)

Sharma, Pankaj; Chinaranagari, Swathi; Patel, Divya; Carey, Jason; Chaudhary, Jaideep

2012-01-01

The inhibitor of DNA-binding (Id) proteins, Id1–4 are negative regulators of basic helix-loop-helix (bHLH) transcription factors. As key regulators of cell cycle and differentiation, expression of Id proteins are increasingly observed in many cancers and associated with aggressiveness of the disease. Of all the four Id proteins, the expression of Id1, Id2, and to a lesser extent, Id3 in prostate cancer and the underlying molecular mechanism is relatively well known. On the contrary, our previous results demonstrated that Id4 acts as a potential tumor suppressor in prostate cancer. In the present study, we extend these observations and demonstrate that Id4 is down-regulated in prostate cancer due to promoter hypermethylation. We used prostate cancer tissue microarrays to investigate Id4 expression. Methylation specific PCR on bisulfite treated DNA was used to determine methylation status of Id4 promoter in laser capture micro-dissected normal, stroma and prostate cancer regions. High Id4 expression was observed in the normal prostate epithelial cells. In prostate cancer, a stage-dependent decrease in Id4 expression was observed with majority of high grade cancers showing no Id4 expression. Furthermore, Id4 expression progressively decreased in prostate cancer cell line LNCaP and with no expression in androgen-insensitive LNCaP-C81 cell line. Conversely, Id4 promoter hypermethylation increased in LNCaP-C81 cells suggesting epigenetic silencing. In prostate cancer samples, loss of Id4 expression was also associated with promoter hypermethylation. Our results demonstrate loss of Id4 expression in prostate cancer due to promoter hypermethylation. The data strongly support the role of Id4 as a tumor suppressor

Comparison of Perinatal Risk Factors Associated with Autism Spectrum Disorder (ASD), Intellectual Disability (ID), and Co-Occurring ASD and ID

Science.gov (United States)

Schieve, Laura A.; Clayton, Heather B.; Durkin, Maureen S.; Wingate, Martha S.; Drews-Botsch, Carolyn

2015-01-01

While studies report associations between perinatal outcomes and both autism spectrum disorder (ASD) and intellectual disability (ID), there has been little study of ASD with versus without co-occurring ID. We compared perinatal risk factors among 7547 children in the 2006-2010 Autism and Developmental Disability Monitoring Network classified as…

Achieving Payoffs from an Industry Cloud Ecosystem at BankID

DEFF Research Database (Denmark)

Eaton, Ben; Hallingby, Hanne Kristine; Nesse, Per-Jonny

2014-01-01

BankID is an industry cloud owned by Norwegian banks. It provides electronic identity, authentication and electronic signing capabilities for banking, merchant and government services. More than 60% of the population uses BankID services. As the broader ecosystem around BankID evolved, challenges......—arising from tensions between different parts of the ecosystem—had to be resolved. The four lessons learned from the BankID case will help others to build an industry cloud and establish a healthy ecosystem to service a broad user base....

IMI's CANCER-ID: Status of liquid biopsy standardization

NARCIS (Netherlands)

Pantel, Klaus; Terstappen, Leon W. M. M.; Baggiani, Barbara; Krahn, Thomas; Schlange, Thomas

The CANCER-ID (www.cancer-id.eu) consortium was established in early 2015 with more than 30 partners as part of the Innovative Medicines Initiative (IMI), Europe's largest public-private partnership funded in equal parts by the European Union and the European Federation of Pharmaceutical Industries

Security analysis for biometric data in ID documents

NARCIS (Netherlands)

Schimke, S.; Kiltz, S.; Vielhauer, C.; Kalker, A.A.C.M.

2005-01-01

In this paper we analyze chances and challenges with respect to the security of using biometrics in ID documents. We identify goals for ID documents, set by national and international authorities, and discuss the degree of security, which is obtainable with the inclusion of biometric into documents

Identification of Escherichia coli and Shigella Species from Whole-Genome Sequences.

Science.gov (United States)

Chattaway, Marie A; Schaefer, Ulf; Tewolde, Rediat; Dallman, Timothy J; Jenkins, Claire

2017-02-01

Escherichia coli and Shigella species are closely related and genetically constitute the same species. Differentiating between these two pathogens and accurately identifying the four species of Shigella are therefore challenging. The organism-specific bioinformatics whole-genome sequencing (WGS) typing pipelines at Public Health England are dependent on the initial identification of the bacterial species by use of a kmer-based approach. Of the 1,982 Escherichia coli and Shigella sp. isolates analyzed in this study, 1,957 (98.4%) had concordant results by both traditional biochemistry and serology (TB&S) and the kmer identification (ID) derived from the WGS data. Of the 25 mismatches identified, 10 were enteroinvasive E. coli isolates that were misidentified as Shigella flexneri or S. boydii by the kmer ID, and 8 were S. flexneri isolates misidentified by TB&S as S. boydii due to nonfunctional S. flexneri O antigen biosynthesis genes. Analysis of the population structure based on multilocus sequence typing (MLST) data derived from the WGS data showed that the remaining discrepant results belonged to clonal complex 288 (CC288), comprising both S. boydii and S. dysenteriae strains. Mismatches between the TB&S and kmer ID results were explained by the close phylogenetic relationship between the two species and were resolved with reference to the MLST data. Shigella can be differentiated from E. coli and accurately identified to the species level by use of kmer comparisons and MLST. Analysis of the WGS data provided explanations for the discordant results between TB&S and WGS data, revealed the true phylogenetic relationships between different species of Shigella, and identified emerging pathoadapted lineages. © Crown copyright 2017.

Biofortification of riboflavin and folate in idli batter, based on fermented cereal and pulse, by Lactococcus lactis N8 and Saccharomyces boulardii SAA655.

Science.gov (United States)

Chandrasekar Rajendran, S C; Chamlagain, B; Kariluoto, S; Piironen, V; Saris, P E J

2017-06-01

Lactococcus lactis N8 and Saccharomyces boulardii SAA655 were investigated for their ability to synthesize B-vitamins (riboflavin and folate) and their functional role as microbial starters in idli fermentation. In this study, ultra-high performance liquid chromatography and microbiological assay were used to determine the total riboflavin and folate content respectively. Increased levels of folate were evident in both L. lactis N8 and S. boulardii SAA655 cultivated medium. Enhanced riboflavin levels were found only in S. boulardii SAA655 grown medium, whereas decreased riboflavin level was found in L. lactis N8 cultivated medium. To evaluate the functional role of microbial starter strains, L. lactis N8 and S. boulardii SAA655 were incorporated individually and in combination into idli batter, composed of wet grounded rice and black gram. For the experiments, naturally fermented idli batter was considered as control. The results indicated that natural idli fermentation did not enhance the riboflavin level and depleted folate levels by half. In comparison with control, L. lactis N8 and S. boulardii SAA655 incorporated idli batter (individually and in combination) increased riboflavin and folate levels by 40-90%. Apart from compensating the folate loss caused by natural fermentation, S. boulardii SAA655 fermented idli batter individually and in combination with L. lactis N8 also showed the highest leavening character. Moreover, the microbial starter incorporation did not significantly influence the pH of idli batter. Incorporation of L. lactis N8 and S. boulardii SAA655 can evidently enhance the functional and technological characteristics of idli batter. UN General Assembly declared 2016 the International Year of pulses emphasizing the importance of legumes as staple food. Furthermore, this is the first experimental report of in situ biofortifcation of riboflavin and folate using microbes in pulse based fermented staple food. The current study suggests possible

A brief review of revocable ID-based public key cryptosystem

Directory of Open Access Journals (Sweden)

Tsu-Yang Wu

2016-03-01

Full Text Available The design of ID-based cryptography has received much attention from researchers. However, how to revoke the misbehaviour/compromised user in ID-based public key cryptosystem becomes an important research issue. Recently, Tseng and Tsai proposed a novel public key cryptosystem called revocable ID-based public key cryptosystem (RIBE to solve the revocation problem. Later on, numerous research papers based on the Tseng-Tsai key RIBE were proposed. In this paper, we brief review Tseng and Tsai's RIBE. We hope this review can help the readers to understand the Tseng and Tsai's revocable ID-based public key cryptosystem.

OpenID Connect as a security service in cloud-based medical imaging systems.

Science.gov (United States)

Ma, Weina; Sartipi, Kamran; Sharghigoorabi, Hassan; Koff, David; Bak, Peter

2016-04-01

The evolution of cloud computing is driving the next generation of medical imaging systems. However, privacy and security concerns have been consistently regarded as the major obstacles for adoption of cloud computing by healthcare domains. OpenID Connect, combining OpenID and OAuth together, is an emerging representational state transfer-based federated identity solution. It is one of the most adopted open standards to potentially become the de facto standard for securing cloud computing and mobile applications, which is also regarded as "Kerberos of cloud." We introduce OpenID Connect as an authentication and authorization service in cloud-based diagnostic imaging (DI) systems, and propose enhancements that allow for incorporating this technology within distributed enterprise environments. The objective of this study is to offer solutions for secure sharing of medical images among diagnostic imaging repository (DI-r) and heterogeneous picture archiving and communication systems (PACS) as well as Web-based and mobile clients in the cloud ecosystem. The main objective is to use OpenID Connect open-source single sign-on and authorization service and in a user-centric manner, while deploying DI-r and PACS to private or community clouds should provide equivalent security levels to traditional computing model.

Id1 represses osteoclast-dependent transcription and affects bone formation and hematopoiesis.

Directory of Open Access Journals (Sweden)

April S Chan

2009-11-01

Full Text Available The bone-bone marrow interface is an area of the bone marrow microenvironment in which both bone remodeling cells, osteoblasts and osteoclasts, and hematopoietic cells are anatomically juxtaposed. The close proximity of these cells naturally suggests that they interact with one another, but these interactions are just beginning to be characterized.An Id1(-/- mouse model was used to assess the role of Id1 in the bone marrow microenvironment. Micro-computed tomography and fracture tests showed that Id1(-/- mice have reduced bone mass and increased bone fragility, consistent with an osteoporotic phenotype. Osteoclastogenesis and pit formation assays revealed that loss of Id1 increased osteoclast differentiation and resorption activity, both in vivo and in vitro, suggesting a cell autonomous role for Id1 as a negative regulator of osteoclast differentiation. Examination by flow cytometry of the hematopoietic compartment of Id1(-/- mice showed an increase in myeloid differentiation. Additionally, we found increased expression of osteoclast genes, TRAP, Oscar, and CTSK in the Id1(-/- bone marrow microenvironment. Lastly, transplantation of wild-type bone marrow into Id1(-/- mice repressed TRAP, Oscar, and CTSK expression and activity and rescued the hematopoietic and bone phenotype in these mice.In conclusion, we demonstrate an osteoporotic phenotype in Id1(-/- mice and a mechanism for Id1 transcriptional control of osteoclast-associated genes. Our results identify Id1 as a principal player responsible for the dynamic cross-talk between bone and bone marrow hematopoietic cells.

Environmental Enrichment Expedites Acquisition and Improves Flexibility on a Temporal Sequencing Task in Mice

Directory of Open Access Journals (Sweden)

Darius Rountree-Harrison

2018-03-01

Full Text Available Environmental enrichment (EE via increased opportunities for voluntary exercise, sensory stimulation and social interaction, can enhance the function of and behaviours regulated by cognitive circuits. Little is known, however, as to how this intervention affects performance on complex tasks that engage multiple, definable learning and memory systems. Accordingly, we utilised the Olfactory Temporal Order Discrimination (OTOD task which requires animals to recall and report sequence information about a series of recently encountered olfactory stimuli. This approach allowed us to compare animals raised in either enriched or standard laboratory housing conditions on a number of measures, including the acquisition of a complex discrimination task, temporal sequence recall accuracy (i.e., the ability to accurately recall a sequences of events and acuity (i.e., the ability to resolve past events that occurred in close temporal proximity, as well as cognitive flexibility tested in the style of a rule reversal and an Intra-Dimensional Shift (IDS. We found that enrichment accelerated the acquisition of the temporal order discrimination task, although neither accuracy nor acuity was affected at asymptotic performance levels. Further, while a subtle enhancement of overall performance was detected for both rule reversal and IDS versions of the task, accelerated performance recovery could only be attributed to the shift-like contingency change. These findings suggest that EE can affect specific elements of complex, multi-faceted cognitive processes.

La certificazione professionale I&D in Europa

OpenAIRE

Franco, Augusta

2003-01-01

The statement points out the activity of I&D European associations in the field of competences' certification, in ECIA federation's area as well as in the national one. In the statement there are references on history and outcomes of DECIDoc project; objectives and operative stages of CERTIDoc project, promoted by ECIA; and enterprises of I&D associations in France, Spain, Germany and Italy. Secondly, it is illustrated the activity of Italian librarians and archivists associatio...

ACE serum level and I/D gene polymorphism in children with obstructive uropathies and other congenital anomalies of the kidney and urinary tract.

Science.gov (United States)

Kostadinova, Emilya Stambolova; Miteva, Lyuba Dineva; Stanilova, Spaska Angelova

2017-08-01

The aim of this study was to investigate the association of an insertion/deletion (I/D) polymorphism in angiotensin-converting enzyme (ACE) gene with serum ACE level in relation to the type and severity of malformations from congenital anomalies of the kidney and urinary tract (CAKUT) spectrum. A group of 134 Bulgarian children with CAKUT divided into four subgroups according to the leading malformation and 109 controls were genotyped by classical polymerase chain reaction. The quantitative determination of serum ACE was performed by ELISA method. A significant elevation of DD-genotype was observed in high-grade hydronephrosis compared to low-grade (43% vs. 9%). The carrying of DD-genotype was associated with higher risk for severe hydronephrosis with OR = 7.5 (95% CI: 1.242÷45.278; P = 0.028). Also, elevated serum ACE concentrations in patients with high-grade compared to low-grade hydronephrosis (237.4 ± 45 ng/mL vs 180.5 ± 64 ng/mL; P = 0.0065) were found. ACE level was significantly lower in patients with unilateral renal agenesis; hypo/dysplasia and multicystic dysplastic kidney (156.6 ± 54 ng/mL) than controls (200.6 ± 56.7 ng/mL; P = 0.005) and the remaining CAKUT subgroups. The DD genotype of I/D ACE polymorphism encodes the highest serum ACE level may be an additional genetic risk factor contributing to the severe hydronephrosis in Bulgarian patients with obstructive uropathies in contrast to other investigated categories of CAKUT malformations. © 2016 Asian Pacific Society of Nephrology.

Sequencing of 16S rRNA gene for id ntification of Sta h lococcus ...

African Journals Online (AJOL)

Asdmin

2014-01-15

Jan 15, 2014 ... as the type strains of a species of genus Trichoderma based on phylogenetic tree analysis together with the 18S rRNA gene sequence search in Ribosomal Database Project, small subunit rRNA and large subunit rRNA databases. The sequence was deposited in GenBank with the accession numbers.

Increasing phylogenetic resolution at low taxonomic levels using massively parallel sequencing of chloroplast genomes

Directory of Open Access Journals (Sweden)

Cronn Richard

2009-12-01

Full Text Available Abstract Background Molecular evolutionary studies share the common goal of elucidating historical relationships, and the common challenge of adequately sampling taxa and characters. Particularly at low taxonomic levels, recent divergence, rapid radiations, and conservative genome evolution yield limited sequence variation, and dense taxon sampling is often desirable. Recent advances in massively parallel sequencing make it possible to rapidly obtain large amounts of sequence data, and multiplexing makes extensive sampling of megabase sequences feasible. Is it possible to efficiently apply massively parallel sequencing to increase phylogenetic resolution at low taxonomic levels? Results We reconstruct the infrageneric phylogeny of Pinus from 37 nearly-complete chloroplast genomes (average 109 kilobases each of an approximately 120 kilobase genome generated using multiplexed massively parallel sequencing. 30/33 ingroup nodes resolved with ≥ 95% bootstrap support; this is a substantial improvement relative to prior studies, and shows massively parallel sequencing-based strategies can produce sufficient high quality sequence to reach support levels originally proposed for the phylogenetic bootstrap. Resampling simulations show that at least the entire plastome is necessary to fully resolve Pinus, particularly in rapidly radiating clades. Meta-analysis of 99 published infrageneric phylogenies shows that whole plastome analysis should provide similar gains across a range of plant genera. A disproportionate amount of phylogenetic information resides in two loci (ycf1, ycf2, highlighting their unusual evolutionary properties. Conclusion Plastome sequencing is now an efficient option for increasing phylogenetic resolution at lower taxonomic levels in plant phylogenetic and population genetic analyses. With continuing improvements in sequencing capacity, the strategies herein should revolutionize efforts requiring dense taxon and character sampling

People with ID as interviewers and co-researchers: experiences and reflection.

NARCIS (Netherlands)

Lieshout, H. van

2012-01-01

Aim: To share the experience of working with people with intellectual disabilities (ID) as interviewers in a qualitative study about community participation of people with ID. We reflect on two perspectives: the interviewers and the researchers. Method: Eighteen people with ID were interviewed by

An online ID identification system for liquefied-gas cylinder plant

Science.gov (United States)

He, Jin; Ding, Zhenwen; Han, Lei; Zhang, Hao

2017-11-01

An automatic ID identification system for gas cylinders' online production was developed based on the production conditions and requirements of the Technical Committee for Standardization of Gas Cylinders. A cylinder ID image acquisition system was designed to improve the image contrast of ID regions on gas cylinders against the background. Then the ID digits region was located by the CNN template matching algorithm. Following that, an adaptive threshold method based on the analysis of local average grey value and standard deviation was proposed to overcome defects of non-uniform background in the segmentation results. To improve the single digit identification accuracy, two BP neural networks were trained respectively for the identification of all digits and the easily confusable digits. If the single digit was classified as one of confusable digits by the former BP neural network, it was further tested by the later one, and the later result was taken as the final identification result of this single digit. At last, the majority voting was adopted to decide the final identification result for the 6-digit cylinder ID. The developed system was installed on a production line of a liquefied-petroleum-gas cylinder plant and worked in parallel with the existing weighing step on the line. Through the field test, the correct identification rate for single ID digit was 94.73%, and none of the tested 2000 cylinder ID was misclassified through the majority voting.

Microbial Contaminants of Cord Blood Units Identified by 16S rRNA Sequencing and by API Test System, and Antibiotic Sensitivity Profiling.

Directory of Open Access Journals (Sweden)

Luís França

Full Text Available Over a period of ten months a total of 5618 cord blood units (CBU were screened for microbial contamination under routine conditions. The antibiotic resistance profile for all isolates was also examined using ATB strips. The detection rate for culture positive units was 7.5%, corresponding to 422 samples.16S rRNA sequence analysis and identification with API test system were used to identify the culturable aerobic, microaerophilic and anaerobic bacteria from CBUs. From these samples we recovered 485 isolates (84 operational taxonomic units, OTUs assigned to the classes Bacteroidia, Actinobacteria, Clostridia, Bacilli, Betaproteobacteria and primarily to the Gammaproteobacteria. Sixty-nine OTUs, corresponding to 447 isolates, showed 16S rRNA sequence similarities above 99.0% with known cultured bacteria. However, 14 OTUs had 16S rRNA sequence similarities between 95 and 99% in support of genus level identification and one OTU with 16S rRNA sequence similarity of 90.3% supporting a family level identification only. The phenotypic identification formed 29 OTUs that could be identified to the species level and 9 OTUs that could be identified to the genus level by API test system. We failed to obtain identification for 14 OTUs, while 32 OTUs comprised organisms producing mixed identifications. Forty-two OTUs covered species not included in the API system databases. The API test system Rapid ID 32 Strep and Rapid ID 32 E showed the highest proportion of identifications to the species level, the lowest ratio of unidentified results and the highest agreement to the results of 16S rRNA assignments. Isolates affiliated to the Bacilli and Bacteroidia showed the highest antibiotic multi-resistance indices and microorganisms of the Clostridia displayed the most antibiotic sensitive phenotypes.

Microbial Contaminants of Cord Blood Units Identified by 16S rRNA Sequencing and by API Test System, and Antibiotic Sensitivity Profiling.

Science.gov (United States)

França, Luís; Simões, Catarina; Taborda, Marco; Diogo, Catarina; da Costa, Milton S

2015-01-01

Over a period of ten months a total of 5618 cord blood units (CBU) were screened for microbial contamination under routine conditions. The antibiotic resistance profile for all isolates was also examined using ATB strips. The detection rate for culture positive units was 7.5%, corresponding to 422 samples.16S rRNA sequence analysis and identification with API test system were used to identify the culturable aerobic, microaerophilic and anaerobic bacteria from CBUs. From these samples we recovered 485 isolates (84 operational taxonomic units, OTUs) assigned to the classes Bacteroidia, Actinobacteria, Clostridia, Bacilli, Betaproteobacteria and primarily to the Gammaproteobacteria. Sixty-nine OTUs, corresponding to 447 isolates, showed 16S rRNA sequence similarities above 99.0% with known cultured bacteria. However, 14 OTUs had 16S rRNA sequence similarities between 95 and 99% in support of genus level identification and one OTU with 16S rRNA sequence similarity of 90.3% supporting a family level identification only. The phenotypic identification formed 29 OTUs that could be identified to the species level and 9 OTUs that could be identified to the genus level by API test system. We failed to obtain identification for 14 OTUs, while 32 OTUs comprised organisms producing mixed identifications. Forty-two OTUs covered species not included in the API system databases. The API test system Rapid ID 32 Strep and Rapid ID 32 E showed the highest proportion of identifications to the species level, the lowest ratio of unidentified results and the highest agreement to the results of 16S rRNA assignments. Isolates affiliated to the Bacilli and Bacteroidia showed the highest antibiotic multi-resistance indices and microorganisms of the Clostridia displayed the most antibiotic sensitive phenotypes.

Underground Storage Tank Integrated Demonstration (UST-ID)

International Nuclear Information System (INIS)

1994-02-01

The DOE complex currently has 332 underground storage tanks (USTs) that have been used to process and store radioactive and chemical mixed waste generated from weapon materials production. Very little of the over 100 million gallons of high-level and low-level radioactive liquid waste has been treated and disposed of in final form. Two waste storage tank design types are prevalent across the DOE complex: single-shell wall and double-shell wall designs. They are made of stainless steel, concrete, and concrete with carbon steel liners, and their capacities vary from 5000 gallons (19 m 3 ) to 10 6 gallons (3785 m 3 ). The tanks have an overburden layer of soil ranging from a few feet to tens of feet. Responding to the need for remediation of tank waste, driven by Federal Facility Compliance Agreements (FFCAs) at all participating sites, the Underground Storage Tank Integrated Demonstration (UST-ID) Program was created by the US DOE Office of Technology Development in February 1991. Its mission is to focus the development, testing, and evaluation of remediation technologies within a system architecture to characterize, retrieve, treat to concentrate, and dispose of radioactive waste stored in USTs at DOE facilities. The ultimate goal is to provide safe and cost-effective solutions that are acceptable to the public and the regulators. The UST-ID has focused on five DOE locations: the Hanford Site, which is the host site, in Richland, Washington; the Fernald Site in Fernald, Ohio; the Idaho National Engineering Laboratory near Idaho Falls, Idaho; the Oak Ridge Reservation in Oak Ridge, Tennessee, and the Savannah River Site in Savannah River, South Carolina

Supporting co-creation with software, the idSpace platform

NARCIS (Netherlands)

Van Rosmalen, Peter; Boon, Jo; Bitter-Rijpkema, Marlies; Sie, Rory; Sloep, Peter

2014-01-01

Innovation, in general, requires teamwork among specialist of different disciplines. The idSpace project developed ideas on how teams of collaborating innovators could best be supported. These ideas were embodied in a platform that the project developed. This idSpace platform allows its users to

ATRX mutation in two adult brothers with non-specific moderate intellectual disability identified by exome sequencing.

Science.gov (United States)

Moncini, S; Bedeschi, M F; Castronovo, P; Crippa, M; Calvello, M; Garghentino, R R; Scuvera, G; Finelli, P; Venturin, M

2013-12-01

In this report, we describe two adult brothers affected by moderate non-specific intellectual disability (ID). They showed minor facial anomalies, not clearly ascribable to any specific syndromic patterns, microcephaly, brachydactyly and broad toes. Both brothers presented seizures. Karyotype, subtelomeric and FMR1 analysis were normal in both cases. We performed array-CGH analysis that revealed no copy-number variations potentially associated with ID. Subsequent exome sequence analysis allowed the identification of the ATRX c.109C>T (p.R37X) mutation in both the affected brothers. Sanger sequencing confirmed the presence of the mutation in the brothers and showed that the mother is a healthy carrier. Mutations in the ATRX gene cause the X-linked alpha thalassemia/mental retardation (ATR-X) syndrome (MIM #301040), a severe clinical condition usually associated with profound ID, facial dysmorphism and alpha thalassemia. However, the syndrome is clinically heterogeneous and some mutations, including the c.109C>T, are associated with a broad phenotypic spectrum, with patients displaying a less severe phenotype with only mild-moderate ID. In the case presented here, exome sequencing provided an effective strategy to achieve the molecular diagnosis of ATR-X syndrome, which otherwise would have been difficult to consider due to the mild non-specific phenotype and the absence of a family history with typical severe cases.

Tobacco outlet density, retailer cigarette sales without ID checks and enforcement of underage tobacco laws: associations with youths' cigarette smoking and beliefs.

Science.gov (United States)

Lipperman-Kreda, Sharon; Grube, Joel W; Friend, Karen B; Mair, Christina

2016-03-01

To estimate the relationships of tobacco outlet density, cigarette sales without ID checks and local enforcement of underage tobacco laws with youth's life-time cigarette smoking, perceived availability of tobacco and perceived enforcement of underage tobacco laws and changes over time. The study involved: (a) three annual telephone surveys, (b) two annual purchase surveys in 2000 tobacco outlets and (c) interviews with key informants from local law enforcement agencies. Analyses were multi-level models (city, individual, time). A sample of 50 mid-sized non-contiguous cities in California, USA. A total of 1478 youths (aged 13-16 at wave 1, 52.2% male); 1061 participated in all waves. Measures at the individual level included life-time cigarette smoking, perceived availability and perceived enforcement. City-level measures included tobacco outlet density, cigarette sales without ID checks and compliance checks. Outlet density was associated positively with life-time smoking [OR = 1.12, P Sales rate without checking IDs was related to greater perceived availability (β = 0.01, P sales without ID checks and enforcement levels may influence beliefs about access to cigarettes and enforcement of underage tobacco sales laws. © 2015 Society for the Study of Addiction.

Minimization of Antinutrients in Idli by Using Response Surface Process Optimization

NARCIS (Netherlands)

Sharma, Anand; Kumari, Sarita; Nout, Martinus J.R.; Sarkar, Prabir K.

2017-01-01

Deploying response surface methodology, the stages of idli preparation were optimized for minimizing the level of antinutrients. Under optimum conditions of soaking blackgram dal (1:5 of dal and water at 16C, and pH 4.0 for 18 h) and rice (1:5 of rice and water at 16C, and pH 5.6 for 18 h), the

Association of ACE gene A2350G and I/D polymorphisms with essential hypertension in the northernmost province of China.

Science.gov (United States)

Sun, Feifei; He, Ning; Zhang, Keyong; Wu, Nan; Zhao, Jingbo; Qiu, Changchun

2018-01-01

Angiotensin converting enzyme (ACE) gene, as a strong candidate gene for essential hypertension(EH), has been extensively studied. In this study, we carried out a population-based case-control study to explore whether ACE gene I/D and A2350G polymorphisms could consider to be risk factors for EH. A total of 2040 subjeces were recruited from Chinese Han in this study, out of which 1010 were cases and 1030 were normotensive individuals. ACE gene A2350G and I/D polymorphisms were amplified by polymerase chain reaction (PCR) and A2350G polymorphism was detected after restriction enzyme digestion with BstuI. Besides, we choosed 10% samples randomly sequencing to verify the accuracy of results. Genotype and allele frequencies distribution of I/D and A2350G in EH and control groups were significantly different. After grouped by sex or age, there were still statistical significances for two polymorphisms. In dominant and recessive model of A2350G, we found significant differences between two groups, respectively. For ACE I/D polymorphism, we observed that the existence of dramatical difference in dominant model between two groups, while in recessive model, marginally significant difference was found. Among the four haplotypes composed by ACE gene A2350G and I/D, haplotype G-D reached the statistical significance in two groups, and exhibited to be a risk factor for the development of EH, whose P ACE gene A2350G and I/D polymorphisms were associated with increasing the risk of suffering from EH in the northernmost province of China individuals, with D allele and G allele individuals had a higher risk of EH(OR = 1.443, 95%CI = 1.273-1.636 and OR = 1.481, 95%CI = 1.303-1.684).

A Contextual Model for Identity Management (IdM) Interfaces

Science.gov (United States)

Fuller, Nathaniel J.

2014-01-01

The usability of Identity Management (IdM) systems is highly dependent upon design that simplifies the processes of identification, authentication, and authorization. Recent findings reveal two critical problems that degrade IdM usability: (1) unfeasible techniques for managing various digital identifiers, and (2) ambiguous security interfaces.…

Clarté des idées innées ?

DEFF Research Database (Denmark)

Schøsler, Jørn

2013-01-01

Der gives en analyse af begreberne 'evidens' og 'medfødte idéer' hos Descartes og Locke samt hos de franske oplysningsfilosoffer.......Der gives en analyse af begreberne 'evidens' og 'medfødte idéer' hos Descartes og Locke samt hos de franske oplysningsfilosoffer....

How to save distressed IDS-physician marriages: a case study.

Science.gov (United States)

Collins, H; Johnson, B A

1998-04-01

A hospital-driven IDS that encounters serious problems resulting from ownership of a physician practice should address those problems by focusing on three core areas: vision and leadership, effectiveness of operations, and physician compensation arrangements. If changes in these areas do not lead to improvements, the IDS may need to consider organizational restructuring. In one case study, a hospital-driven IDS faced the problem of owning a poorly performing MSO with a captive physician group. The IDS's governing board determined that the organization lacked effective communication with the physicians and that realization of the organization's vision would require greater physician involvement in organizational decision making. The organization is expected to undergo some corporate reorganization in which physicians will acquire an equity interest in the enterprise.

A Good IDS Response Protocol of MANET Containment Strategies

Science.gov (United States)

Cheng, Bo-Chao; Chen, Huan; Tseng, Ryh-Yuh

Much recent research concentrates on designing an Intrusion Detection System (IDS) to detect the misbehaviors of the malicious node in MANET with ad-hoc and mobility natures. However, without rapid and appropriate IDS response mechanisms performing follow-up management services, even the best IDS cannot achieve the desired primary goal of the incident response. A competent containment strategy is needed to limit the extent of an attack in the Incident Response Life Cycle. Inspired by the T-cell mechanisms in the human immune system, we propose an efficient MANET IDS response protocol (T-SecAODV) that can rapidly and accurately disseminate alerts of the malicious node attacks to other nodes so as to modify their AODV routing tables to isolate the malicious nodes. Simulations are conducted by the network simulator (Qualnet), and the experiment results indicate that T-SecAODV is able to spread alerts steadily while greatly reduce faulty rumors under simultaneous multiple malicious node attacks.

A functionally significant polymorphism in ID3 is associated with human coronary pathology.

Directory of Open Access Journals (Sweden)

Ani Manichaikul

Full Text Available We previously identified association between the ID3 SNP rs11574 and carotid intima-media thickness in the Diabetes Heart Study, a predominantly White diabetic population. The nonsynonymous SNP rs11574 results in an amino acid substitution in the C-terminal region of ID3, attenuating the dominant negative function of ID3 as an inhibitor of basic HLH factor E12-mediated transcription. In the current investigation, we characterize the association between the functionally significant polymorphism in ID3, rs11574, with human coronary pathology.The Multi-Ethnic Study of Atherosclerosis (MESA is a longitudinal study of subclinical cardiovascular disease, including non-Hispanic White (n = 2,588, African American (n = 2,560 and Hispanic (n = 2,130 participants with data on coronary artery calcium (CAC. The Coronary Assessment in Virginia cohort (CAVA included 71 patients aged 30-80 years, undergoing a medically necessary cardiac catheterization and intravascular ultrasound (IVUS at the University of Virginia. ID3 SNP rs11574 risk allele was associated with the presence of CAC in MESA Whites (P = 0.017. In addition, the risk allele was associated with greater atheroma burden and stenosis in the CAVA cohort (P = 0.003, P = 0.04 respectively. The risk allele remained predictive of atheroma burden in multivariate analysis (Model 1: covariates age, gender, and LDL, regression coefficient = 9.578, SE = 3.657, p = 0.0110; Model 2: covariates Model 1, presence of hypertension, presence of diabetes, regression coefficient = 8.389, SE = 4.788, p = 0.0163.We present additional cohorts that demonstrate association of ID3 SNP rs11574 directly with human coronary artery pathology as measured by CAC and IVUS: one a multiethnic, relatively healthy population with low levels of diabetes and the second a predominantly White population with a higher incidence of T2DM referred for cardiac catheterization.

Ekspert : mobiil-ID kasutamine valimistel turvariske ei tekita / Holger Roonemaa

Index Scriptorium Estoniae

Roonemaa, Holger

2008-01-01

E-valimiste projektijuhi Taavi Martensi väitel pole põhjust kahelda mobiil-ID turvalisuses. Valimiskomisjoni esimehe Heiki Sibula meelest peaks m-ID kaarte välja andma kodakondsus- ja migratsiooniamet

Evaluation of the RapID-ANA system for identification of anaerobic bacteria of veterinary origin.

Science.gov (United States)

Adney, W S; Jones, R L

1985-12-01

This study evaluated the ability of the RapID-ANA system (Innovative Diagnostic Systems, Inc., Atlanta, Ga.) to accurately identify a spectrum of freshly isolated veterinary anaerobes. A total of 183 isolates were tested and included 7 Actinomyces spp., 53 Bacteroides spp., 32 Clostridium spp., 2 Eubacterium spp., 65 Fusobacterium spp., 1 Peptococcus spp., 22 Peptostreptococcus spp., and 1 Propionibacterium spp. All isolates were initially identified by conventional biochemical testing and gas-liquid chromatography of short-chain fatty acid metabolites. Additional tests were performed as required by the RapID-ANA system. Of these isolates, 81.4% were correctly identified to the genus level, including 59.6% to the species level, 14.2% were incorrectly identified at the genus level, and 4.4% were not identified. Initially, 20.2% of the strains were not identified because the microcodes were not in the code book. The majority of the incorrect identifications were caused by the misidentification of Fusobacterium spp. as Bacteroides spp. Errors also occurred when veterinary anaerobes not included in the data base were assigned an identification from the existing data base. The RapID-ANA system appears to be a promising new method for rapid identification of veterinary anaerobes; however, further evaluation with an extended data base is needed before the system can accurately identify all clinically significant anaerobes.

Picture This: How to Establish an Effective School ID Card Program

Science.gov (United States)

Finkelstein, David

2013-01-01

Most school districts do not have an ID card policy that everyone knows and follows, yet. many school districts are implementing ID card programs to address concerns about safety, efficiency, and convenience. A well-thought-out ID card program leads to greater security and smoother operations throughout the school and should thus be a priority.…

Inhibition of muscle-specific gene expression by Id3: requirement of the C-terminal region of the protein for stable expression and function.

Science.gov (United States)

Chen, B; Han, B H; Sun, X H; Lim, R W

1997-01-15

We have examined the role of an Id-like protein, Id3 (also known as HLH462), in the regulation of muscle-specific gene expression. Id proteins are believed to block expression of muscle-specific genes by preventing the dimerization between ubiquitous bHLH proteins (E proteins) and myogenic bHLH proteins such as MyoD. Consistent with its putative role as an inhibitor of differentiation, Id3 mRNA was detected in proliferating skeletal muscle cells, was further induced by basic fibroblast growth factor (bFGF) and was down-regulated in differentiated muscle cultures. Overexpression of Id3 efficiently inhibited the MyoD-mediated activation of the muscle-specific creatine kinase (MCK) reporter gene. Deletion analysis indicated that the C-terminal 15 amino acids of Id3 are critical for the full inhibitory activity while deleting up to 42 residues from the C-terminus of the related protein, Id2, did not affect its ability to inhibit the MCK reporter gene. Chimeric protein containing the N-terminal region of Id3 and the C-terminus of Id2 was also non-functional in transfected cells. In contrast, wild-type Id3, the C-terminal mutants, and the Id3/Id2 chimera could all interact with the E-protein E47in vitro. Additional studies indicated that truncation of the Id3 C-terminus might have adversely affected the expression level of the mutant proteins but the Id3/Id2 chimera was stably expressed. Taken together, our results revealed a more complex requirement for the expression and proper function of the Id family proteins than was hitherto expected.

Id-1 is not expressed in the luminal epithelial cells of mammary glands

International Nuclear Information System (INIS)

Uehara, Norihisa; Chou, Yu-Chien; Galvez, Jose J; Candia, Paola de; Cardiff, Robert D; Benezra, Robert; Shyamala, Gopalan

2003-01-01

The family of inhibitor of differentiation/DNA binding (Id) proteins is known to regulate development in several tissues. One member of this gene family, Id-1, has been implicated in mammary development and carcinogenesis. Mammary glands contain various cell types, among which the luminal epithelial cells are primarily targeted for proliferation, differentiation and carcinogenesis. Therefore, to assess the precise significance of Id-1 in mammary biology and carcinogenesis, we examined its cellular localization in vivo using immunohistochemistry. Extracts of whole mammary glands from wild type and Id-1 null mutant mice, and tissue sections from paraffin-embedded mouse mammary glands from various developmental stages and normal human breast were subjected to immunoblot and immunohistochemical analyses, respectively. In both these procedures, an anti-Id-1 rabbit polyclonal antibody was used for detection of Id-1. In immunoblot analyses, using whole mammary gland extracts, Id-1 was detected. In immunohistochemical analyses, however, Id-1 was not detected in the luminal epithelial cells of mammary glands during any stage of development, but it was detected in vascular endothelial cells. Id-1 is not expressed in the luminal epithelial cells of mammary glands

OpenID connect as a security service in Cloud-based diagnostic imaging systems

Science.gov (United States)

Ma, Weina; Sartipi, Kamran; Sharghi, Hassan; Koff, David; Bak, Peter

2015-03-01

The evolution of cloud computing is driving the next generation of diagnostic imaging (DI) systems. Cloud-based DI systems are able to deliver better services to patients without constraining to their own physical facilities. However, privacy and security concerns have been consistently regarded as the major obstacle for adoption of cloud computing by healthcare domains. Furthermore, traditional computing models and interfaces employed by DI systems are not ready for accessing diagnostic images through mobile devices. RESTful is an ideal technology for provisioning both mobile services and cloud computing. OpenID Connect, combining OpenID and OAuth together, is an emerging REST-based federated identity solution. It is one of the most perspective open standards to potentially become the de-facto standard for securing cloud computing and mobile applications, which has ever been regarded as "Kerberos of Cloud". We introduce OpenID Connect as an identity and authentication service in cloud-based DI systems and propose enhancements that allow for incorporating this technology within distributed enterprise environment. The objective of this study is to offer solutions for secure radiology image sharing among DI-r (Diagnostic Imaging Repository) and heterogeneous PACS (Picture Archiving and Communication Systems) as well as mobile clients in the cloud ecosystem. Through using OpenID Connect as an open-source identity and authentication service, deploying DI-r and PACS to private or community clouds should obtain equivalent security level to traditional computing model.

The Self-Identity Protein IdsD Is Communicated between Cells in Swarming Proteus mirabilis Colonies.

Science.gov (United States)

Saak, Christina C; Gibbs, Karine A

2016-12-15

Proteus mirabilis is a social bacterium that is capable of self (kin) versus nonself recognition. Swarming colonies of this bacterium expand outward on surfaces to centimeter-scale distances due to the collective motility of individual cells. Colonies of genetically distinct populations remain separate, while those of identical populations merge. Ids proteins are essential for this recognition behavior. Two of these proteins, IdsD and IdsE, encode identity information for each strain. These two proteins bind in vitro in an allele-restrictive manner. IdsD-IdsE binding is correlated with the merging of populations, whereas a lack of binding is correlated with the separation of populations. Key questions remained about the in vivo interactions of IdsD and IdsE, specifically, whether IdsD and IdsE bind within single cells or whether IdsD-IdsE interactions occur across neighboring cells and, if so, which of the two proteins is exchanged. Here we demonstrate that IdsD must originate from another cell to communicate identity and that this nonresident IdsD interacts with IdsE resident in the recipient cell. Furthermore, we show that unbound IdsD in recipient cells does not cause cell death and instead appears to contribute to a restriction in the expansion radius of the swarming colony. We conclude that P. mirabilis communicates IdsD between neighboring cells for nonlethal kin recognition, which suggests that the Ids proteins constitute a type of cell-cell communication. We demonstrate that self (kin) versus nonself recognition in P. mirabilis entails the cell-cell communication of an identity-encoding protein that is exported from one cell and received by another. We further show that this intercellular exchange affects swarm colony expansion in a nonlethal manner, which adds social communication to the list of potential swarm-related regulatory factors. Copyright © 2016, American Society for Microbiology. All Rights Reserved.

Exome Sequencing and Linkage Analysis Identified Novel Candidate Genes in Recessive Intellectual Disability Associated with Ataxia.

Science.gov (United States)

Jazayeri, Roshanak; Hu, Hao; Fattahi, Zohreh; Musante, Luciana; Abedini, Seyedeh Sedigheh; Hosseini, Masoumeh; Wienker, Thomas F; Ropers, Hans Hilger; Najmabadi, Hossein; Kahrizi, Kimia

2015-10-01

Intellectual disability (ID) is a neuro-developmental disorder which causes considerable socio-economic problems. Some ID individuals are also affected by ataxia, and the condition includes different mutations affecting several genes. We used whole exome sequencing (WES) in combination with homozygosity mapping (HM) to identify the genetic defects in five consanguineous families among our cohort study, with two affected children with ID and ataxia as major clinical symptoms. We identified three novel candidate genes, RIPPLY1, MRPL10, SNX14, and a new mutation in known gene SURF1. All are autosomal genes, except RIPPLY1, which is located on the X chromosome. Two are housekeeping genes, implicated in transcription and translation regulation and intracellular trafficking, and two encode mitochondrial proteins. The pathogenesis of these variants was evaluated by mutation classification, bioinformatic methods, review of medical and biological relevance, co-segregation studies in the particular family, and a normal population study. Linkage analysis and exome sequencing of a small number of affected family members is a powerful new technique which can be used to decrease the number of candidate genes in heterogenic disorders such as ID, and may even identify the responsible gene(s).

Événement, idéologie et utopie

Directory of Open Access Journals (Sweden)

Jean-Luc AMALRIC

2014-12-01

Full Text Available RESUMEL’hypothèse que tente d’esquisser cet article est que l’idée ricœurienne d’une médiatisation dynamique des contradictions de l’imaginaire social présuppose une corrélation originaire de l’idéologie et de l’utopie qui ne peut elle-même être comprise qu’à partir de l’événement de l’institution d’un imaginaire social constituant. Dans un premier temps, l’article s’efforce de cerner ce qui fait la spécificité de la théorie ricœurienne de l’idéologie et de l’utopie comme « pratiques imaginatives », en soulignant à ce titre l’influence déterminante des thèses de Jacques Ellul sur l’idéologie. Puis, dans un second temps, il s’engage dans une analyse régressive qui conduit de la réappropriation ricœurienne de la conception dialectique de l’idéologie et de l’utopie exposée par Mannheim à l’idée d’un fondement événementiel de ces deux formes opposées de l’imaginaire social.Mots-Clés : Evénement, idéologie, utopie, Ellul, Mannheim. ABSTRACTThis paper attempts to sketch out the hypothesis that the Ricœurian conception of a dynamic mediatization of the contradictions of the social imaginary presupposes an original correlation between ideology and utopia, which can itself be understood only from the event that institutes a constitutive social imaginary. The first part of the paper marks out the specificity of the Ricœurian theory of ideology and utopia in terms of “imaginative practices”, underlining the determining influence of Jacques Ellul’s theses on ideology. The second part tries to develop a regressive argument, starting from the Ricœurian re-appropriation of Mannheim’s dialectical conception of ideology and utopia, and leading back to the idea of an event foundation for these two opposed forms of the social imaginary.Keywords : Event, Ideology, Utopia, Ellul, Mannheim   

Best practices for the implementation of the REAL ID Act.

Science.gov (United States)

2015-10-01

The REAL ID Act specifies the minimum standards that must be used to produce and issue drivers license and : identification cards that are REAL ID compliant. Beginning in 2020, if a person does not possess a form of : identification that meets REA...

ID card number detection algorithm based on convolutional neural network

Science.gov (United States)

Zhu, Jian; Ma, Hanjie; Feng, Jie; Dai, Leiyan

2018-04-01

In this paper, a new detection algorithm based on Convolutional Neural Network is presented in order to realize the fast and convenient ID information extraction in multiple scenarios. The algorithm uses the mobile device equipped with Android operating system to locate and extract the ID number; Use the special color distribution of the ID card, select the appropriate channel component; Use the image threshold segmentation, noise processing and morphological processing to take the binary processing for image; At the same time, the image rotation and projection method are used for horizontal correction when image was tilting; Finally, the single character is extracted by the projection method, and recognized by using Convolutional Neural Network. Through test shows that, A single ID number image from the extraction to the identification time is about 80ms, the accuracy rate is about 99%, It can be applied to the actual production and living environment.

What's Going on in Your Professor's Head? Demonstrating the Id, Ego, and Superego

Science.gov (United States)

Segrist, Dan J.

2009-01-01

This article describes an in-class activity designed to demonstrate Freud's structural theory of the psyche, specifically the roles of the id, ego, and superego, as well as the interplay among them. Additionally, the activity visually illustrates Freud's ideas about the levels of consciousness associated with these 3 components. Pre-post quiz…

REFORMASI PEMAHAMAN TEORI MAQᾹṢID SYARIAH Analisis Pendekatan Sistem Jasser Auda

Directory of Open Access Journals (Sweden)

Muhammad Iqbal Fasa

2016-12-01

Full Text Available This paper attempts to offer reform ideas Jasser Auda thought related reforms theoretical understanding of maqᾱṣid sharia. The systems approach is done by Auda critize the theory of classical maqᾱṣid more likely to hierarchical and narrow mindset. The classical maqᾱṣid pressure a point more on protection and preservation. Whereas the new maqᾱṣid theory emphasizes development (construction, development and rights (rights. Thus, Auda developed the concept of human development as the main target of maslahah (public interest. Auda offers the systems approach, namely: cognitive nature; interrelated; wholeness; openness; multi dimentionality and purposefulness. At the end of the discussion in this paper, the authors develop the idea of Jasser Auda by offering Sharia Maqᾱṣid concept in the context of Islamic Economics

Exome sequencing of Pakistani consanguineous families identifies 30 novel candidate genes for recessive intellectual disability.

Science.gov (United States)

Riazuddin, S; Hussain, M; Razzaq, A; Iqbal, Z; Shahzad, M; Polla, D L; Song, Y; van Beusekom, E; Khan, A A; Tomas-Roca, L; Rashid, M; Zahoor, M Y; Wissink-Lindhout, W M; Basra, M A R; Ansar, M; Agha, Z; van Heeswijk, K; Rasheed, F; Van de Vorst, M; Veltman, J A; Gilissen, C; Akram, J; Kleefstra, T; Assir, M Z; Grozeva, D; Carss, K; Raymond, F L; O'Connor, T D; Riazuddin, S A; Khan, S N; Ahmed, Z M; de Brouwer, A P M; van Bokhoven, H; Riazuddin, S

2017-11-01

Intellectual disability (ID) is a clinically and genetically heterogeneous disorder, affecting 1-3% of the general population. Although research into the genetic causes of ID has recently gained momentum, identification of pathogenic mutations that cause autosomal recessive ID (ARID) has lagged behind, predominantly due to non-availability of sizeable families. Here we present the results of exome sequencing in 121 large consanguineous Pakistani ID families. In 60 families, we identified homozygous or compound heterozygous DNA variants in a single gene, 30 affecting reported ID genes and 30 affecting novel candidate ID genes. Potential pathogenicity of these alleles was supported by co-segregation with the phenotype, low frequency in control populations and the application of stringent bioinformatics analyses. In another eight families segregation of multiple pathogenic variants was observed, affecting 19 genes that were either known or are novel candidates for ID. Transcriptome profiles of normal human brain tissues showed that the novel candidate ID genes formed a network significantly enriched for transcriptional co-expression (P<0.0001) in the frontal cortex during fetal development and in the temporal-parietal and sub-cortex during infancy through adulthood. In addition, proteins encoded by 12 novel ID genes directly interact with previously reported ID proteins in six known pathways essential for cognitive function (P<0.0001). These results suggest that disruptions of temporal parietal and sub-cortical neurogenesis during infancy are critical to the pathophysiology of ID. These findings further expand the existing repertoire of genes involved in ARID, and provide new insights into the molecular mechanisms and the transcriptome map of ID.

Evaluation of the Precision ID Ancestry Panel for crime case work: A SNP typing assay developed for typing of 165 ancestral informative markers.

Science.gov (United States)

Pereira, Vania; Mogensen, Helle S; Børsting, Claus; Morling, Niels

2017-05-01

The application of massive parallel sequencing (MPS) methodologies in forensic genetics is promising and it is gradually being implemented in forensic genetic case work. One of the major advantages of these technologies is that several traditional electrophoresis assays can be combined into one single MPS assay. This reduces both the amount of sample used and the time of the investigations. This study assessed the utility of the Precision ID Ancestry Panel (Thermo Fisher Scientific, Waltham, USA) in forensic genetics. This assay was developed for the Ion Torrent PGM™ System and genotypes 165 ancestry informative SNPs. The performance of the assay and the accompanying software solution for ancestry inference was assessed by typing 142 Danes and 98 Somalis. Locus balance, heterozygote balance, and noise levels were calculated and future analysis criteria for crime case work were estimated. Overall, the Precision ID Ancestry Panel performed well, and only minor changes to the recommended protocol were implemented. Three out of the 165 loci (rs459920, rs7251928, and rs7722456) had consistently poor performance, mainly due to misalignment of homopolymeric stretches. We suggest that these loci should be excluded from the analyses. The different statistical methods for reporting ancestry in forensic genetic case work are discussed. Copyright © 2017 Elsevier B.V. All rights reserved.

Interoperability for electronic ID

OpenAIRE

Zygadlo, Zuzanna

2009-01-01

Electronic Business, including eBanking, eCommerce and eGovernmental services, is today based on a large variety of security solutions, comprising electronic IDs provided by a broad community of Public Key Infrastructure (PKI) vendors. Significant differences in implementations of those solutions introduce a problem of lack of interoperability in electronic business, which have not yet been resolved by standardization and interoperability initiatives based on existing PKI trust models. It i...

Comparison of manual and automated AmpliSeq™ workflows in the typing of a Somali population with the Precision ID Identity Panel.

Science.gov (United States)

van der Heijden, Suzanne; de Oliveira, Susanne Juel; Kampmann, Marie-Louise; Børsting, Claus; Morling, Niels

2017-11-01

The Precision ID Identity Panel was used to type 109 Somali individuals in order to obtain allele frequencies for the Somali population. These frequencies were used to establish a Somali HID-SNP database, which will be used for the biostatistic calculations in family and immigration cases. Genotypes obtained with the Precision ID Identity Panel were found to be almost in complete concordance with genotypes obtained with the SNPforID PCR-SBE-CE assay. In seven SNP loci, silent alleles were identified, of which most were previously described in the literature. The project also set out to compare different AmpliSeq™ workflows to investigate the possibility of using automated library building in forensic genetic case work. In order to do so, the SNP typing of the Somalis was performed using three different workflows: 1) manual library building and sequencing on the Ion PGM™, 2) automated library building using the Biomek ® 3000 and sequencing on the Ion PGM™, and 3) automated library building using the Ion Chef™ and sequencing on the Ion S5™. AmpliSeq™ workflows were compared based on coverage, locus balance, noise, and heterozygote balance. Overall, the Ion Chef™/Ion S5™ workflow was found to give the best results and required least hands-on time in the laboratory. However, the Ion Chef™/Ion S5™ workflow was also the most expensive. The number of libraries that may be constructed in one Ion Chef™ library building run was limited to eight, which is too little for high throughput workflows. The Biomek ® 3000/Ion PGM™ workflow was found to perform similarly to the manual/Ion PGM™ workflow. This argues for the use of automated library building in forensic genetic case work. Automated library building decreases the workload of the laboratory staff, decreases the risk of pipetting errors, and simplifies the daily workflow in forensic genetic laboratories. Copyright © 2017 Elsevier B.V. All rights reserved.

Psychometrics and latent structure of the IDS and QIDS with young adult students.

Science.gov (United States)

González, David Andrés; Boals, Adriel; Jenkins, Sharon Rae; Schuler, Eric R; Taylor, Daniel

2013-07-01

Students and young adults have high rates of suicide and depression, thus are a population of interest. To date, there is no normative psychometric information on the IDS and QIDS in these populations. Furthermore, there is equivocal evidence on the factor structure and subscales of the IDS. Two samples of young adult students (ns=475 and 1681) were given multiple measures to test the psychometrics and dimensionality of the IDS and QIDS. The IDS, its subscales, and QIDS had acceptable internal consistencies (αs=.79-90) and favorable convergent and divergent validity correlations. A three-factor structure and two Rasch-derived subscales best fit the IDS. The samples were collected from one university, which may influence generalizability. The IDS and QIDS are desirable measures of depressive symptoms when studying young adult students. Copyright © 2013 Elsevier B.V. All rights reserved.

78 FR 65555 - Establishment of Class E Airspace; Salmon, ID

Science.gov (United States)

2013-11-01

...-0531; Airspace Docket No. 13-ANM-20] Establishment of Class E Airspace; Salmon, ID AGENCY: Federal... at the Salmon VHF Omni-Directional Radio Range/Distance Measuring Equipment (VOR/DME) navigation aid, Salmon, ID, to facilitate vectoring of Instrument Flight Rules (IFR) aircraft under control of Salt Lake...

CASK inhibits ECV304 cell growth and interacts with Id1

International Nuclear Information System (INIS)

Qi Jie; Su Yongyue; Sun Rongju; Zhang Fang; Luo Xiaofeng; Yang Zongcheng; Luo Xiangdong

2005-01-01

Calcium/calmodulin-dependent serine protein kinase (CASK) is generally known as a scaffold protein. Here we show that overexpression of CASK resulted in a reduced rate of cell growth, while inhibition of expression of endogenous CASK via RNA-mediated interference resulted in an increased rate of cell growth in ECV304 cells. To explore the molecular mechanism, we identified a novel CASK-interacting protein, inhibitor of differentiation 1 (Id1) with a yeast two-hybrid screening. Furthermore, endogenous CASK and Id1 proteins were co-precipitated from the lysates of ECV304 cells by immunoprecipitation. Mammalian two-hybrid protein-protein interaction assays indicated that CASK possessed a different binding activity for Id1 and its alternative splicing variant. It is known that Id proteins play important roles in regulation of cell proliferation and differentiation. Thus, we speculate that the regulation of cell growth mediated by CASK may be involved in Id1. Our findings indicate a novel function of CASK, the mechanism that remains to be further investigated

Genetic architecture of vitamin B12 and folate levels uncovered applying deeply sequenced large datasets

DEFF Research Database (Denmark)

Grarup, Niels; Sulem, Patrick; Sandholt, Camilla H

2013-01-01

of the underlying biology of human traits and diseases. Here, we used a large Icelandic whole genome sequence dataset combined with Danish exome sequence data to gain insight into the genetic architecture of serum levels of vitamin B12 (B12) and folate. Up to 22.9 million sequence variants were analyzed in combined...... in serum B12 or folate levels do not modify the risk of developing these conditions. Yet, the study demonstrates the value of combining whole genome and exome sequencing approaches to ascertain the genetic and molecular architectures underlying quantitative trait associations....

ATRX mutation in two adult brothers with non-specific moderate intellectual disability identified by exome sequencing

OpenAIRE

Moncini, S.; Bedeschi, M.F.; Castronovo, P.; Crippa, M.; Calvello, M.; Garghentino, R.R.; Scuvera, G.; Finelli, P.; Venturin, M.

2013-01-01

In this report, we describe two adult brothers affected by moderate non-specific intellectual disability (ID). They showed minor facial anomalies, not clearly ascribable to any specific syndromic patterns, microcephaly, brachydactyly and broad toes. Both brothers presented seizures. Karyotype, subtelomeric and FMR1 analysis were normal in both cases. We performed array-CGH analysis that revealed no copy-number variations potentially associated with ID. Subsequent exome sequence analysis allow...

Peritoneal VEGF-A expression is regulated by TGF-β1 through an ID1 pathway in women with endometriosis.

Science.gov (United States)

Young, Vicky J; Ahmad, Syed F; Brown, Jeremy K; Duncan, W Colin; Horne, Andrew W

2015-11-18

VEGF-A, an angiogenic factor, is increased in the peritoneal fluid of women with endometriosis. The cytokine TGF-β1 is thought to play a role in the establishment of endometriosis lesions. Inhibitor of DNA binding (ID) proteins are transcriptional targets of TGF-β1 and ID1 has been implicated in VEGF-A regulation during tumor angiogenesis. Herein, we determined whether peritoneal expression of VEGF-A is regulated by TGF-β1 through the ID1 pathway in women with endometriosis. VEGF-A was measured in peritoneal fluid by ELISA (n = 16). VEGF-A and ID1 expression was examined in peritoneal biopsies (n = 13), and primary peritoneal and immortalized mesothelial cells (MeT5A) by immunohistochemistry, qRT-PCR and ELISA. VEGF-A was increased in peritoneal fluid from women with endometriosis and levels correlated with TGF-β1 concentrations (P peritoneal mesothelium and TGF-β1 increased VEGFA mRNA (P endometriosis and TGF-β1 increased concentrations of ID1 mRNA (P endometriosis, as an effector of TGFβ1 dependent upregulation of VEGF-A, and highlights a novel potential therapeutic target.

Id4 functions downstream of Bmp signaling to restrict TCF function in endocardial cells during atrioventricular valve development.

Science.gov (United States)

Ahuja, Suchit; Dogra, Deepika; Stainier, Didier Y R; Reischauer, Sven

2016-04-01

The atrioventricular canal (AVC) connects the atrial and ventricular chambers of the heart and its formation is critical for the development of the cardiac valves, chamber septation and formation of the cardiac conduction system. Consequently, problems in AVC formation can lead to congenital defects ranging from cardiac arrhythmia to incomplete cardiac septation. While our knowledge about early heart tube formation is relatively comprehensive, much remains to be investigated about the genes that regulate AVC formation. Here we identify a new role for the basic helix-loop-helix factor Id4 in zebrafish AVC valve development and function. id4 is first expressed in the AVC endocardium and later becomes more highly expressed in the atrial chamber. TALEN induced inactivation of id4 causes retrograde blood flow at the AV canal under heat induced stress conditions, indicating defects in AV valve function. At the molecular level, we found that id4 inactivation causes misexpression of several genes important for AVC and AV valve formation including bmp4 and spp1. We further show that id4 appears to control the number of endocardial cells that contribute to the AV valves by regulating Wnt signaling in the developing AVC endocardium. Copyright © 2016 Elsevier Inc. All rights reserved.

idRHa+ProMod - Rail Hardening Control System

International Nuclear Information System (INIS)

Ferro, L

2016-01-01

idRHa+ProMod is the process control system developed by Primetals Technologies to foresee the thermo-mechanical evolution and micro-structural composition of rail steels subjected to slack quenching into idRHa+ Rail Hardening equipments in a simulation environment. This tool can be used both off-line or in-line, giving the user the chance to test and study the best cooling strategies or letting the automatic control system free to adjust the proper cooling recipe. Optimization criteria have been tailored in order to determine the best cooling conditions according to the metallurgical requirements imposed by the main rail standards and also taking into account the elastoplastic bending phenomena occurring during all stages of the head hardening process. The computational core of idRHa+ProMod is a thermal finite element procedure coupled with special algorithms developed to work out the main thermo-physical properties of steel, to predict the non-isothermal austenite decomposition into all the relevant phases and subsequently to evaluate the amount of latent heat of transformation released, the compound thermal expansion coefficient and the amount of plastic deformation in the material. Air mist and air blades boundary conditions have been carefully investigated by means of pilot plant tests aimed to study the jet impingement on rail surfaces and the cooling efficiency at all working conditions. Heat transfer coefficients have been further checked and adjusted directly on field during commissioning. idRHa+ is a trademark of Primetals Technologies Italy Srl (paper)

idRHa+ProMod - Rail Hardening Control System

Science.gov (United States)

Ferro, L.

2016-03-01

idRHa+ProMod is the process control system developed by Primetals Technologies to foresee the thermo-mechanical evolution and micro-structural composition of rail steels subjected to slack quenching into idRHa+ Rail Hardening equipments in a simulation environment. This tool can be used both off-line or in-line, giving the user the chance to test and study the best cooling strategies or letting the automatic control system free to adjust the proper cooling recipe. Optimization criteria have been tailored in order to determine the best cooling conditions according to the metallurgical requirements imposed by the main rail standards and also taking into account the elastoplastic bending phenomena occurring during all stages of the head hardening process. The computational core of idRHa+ProMod is a thermal finite element procedure coupled with special algorithms developed to work out the main thermo-physical properties of steel, to predict the non-isothermal austenite decomposition into all the relevant phases and subsequently to evaluate the amount of latent heat of transformation released, the compound thermal expansion coefficient and the amount of plastic deformation in the material. Air mist and air blades boundary conditions have been carefully investigated by means of pilot plant tests aimed to study the jet impingement on rail surfaces and the cooling efficiency at all working conditions. Heat transfer coefficients have been further checked and adjusted directly on field during commissioning. idRHa+ is a trademark of Primetals Technologies Italy Srl

ID Barrel installed in cryostat

CERN Multimedia

Apsimon, R.; Romaniouk, A.

Wednesday 23rd August was a memorable day for the Inner Detector community as they witnessed the transport and installation of the central part of the inner detector (ID-barrel) into the ATLAS detector. Many members of the collaboration gathered to witness this moment at Point 1. After years of design, construction and commissioning, the outer two detectors (TRT and SCT) of the ID barrel were moved from the SR1 cleanroom to the ATLAS cavern. The barrel was moved across the car park from building 2175 to SX1. Although only a journey of about 100 metres, this required weeks of planning and some degree of luck as far as the weather was concerned. Accelerometers were fitted to the barrel to provide real-time monitoring and no values greater than 0.1 g were recorded, fully satisfying the transport specification for this extremely precise and fragile detector. Muriel, despite her fear of heights, bravely volunteered to keep a close eye on the detector. Swapping cranes to cross the entire parking lot, while Mur...

[Application of single nucleotide polymorphism-microarray and target gene sequencing in the study of genetic etiology of children with unexplained intellectual disability or developmental delay].

Science.gov (United States)

Gao, Z J; Jiang, Q; Cheng, D Z; Yan, X X; Chen, Q; Xu, K M

2016-10-02

Objective: To evaluate the application of single nucleotide polymorphism (SNP)-microarray and target gene sequencing technology in the clinical molecular genetic diagnosis of unexplained intellectual disability(ID) or developmental delay (DD). Method: Patients with ID or DD were recruited in the Department of Neurology, Affiliated Children's Hospital of Capital Institute of Pediatrics between September 2015 and February 2016. The intellectual assessment of the patients was performed using 0-6-year-old pediatric examination table of neuropsychological development or Wechsler intelligence scale (>6 years). Patients with a DQ less than 49 or IQ less than 51 were included in this study. The patients were scanned by SNP-array for detection of genomic copy number variations (CNV), and the revealed genomic imbalance was confirmed by quantitative real time-PCR. Candidate gene mutation screening was carried out by target gene sequencing technology.Causal mutations or likely pathogenic variants were verified by polymerase chain reaction and direct sequencing. Result: There were 15 children with ID or DD enrolled, 9 males and 6 females. The age of these patients was 7 months-16 years and 9 months. SNP-array revealed that two of the 15 patients had genomic CNV. Both CNV were de novo micro deletions, one involved 11q24.1q25 and the other micro deletion located on 21q22.2q22.3. Both micro deletions were proved to have a clinical significance due to their association with ID, brain DD, unusual faces etc. by querying Decipher database. Thirteen patients with negative findings in SNP-array were consequently examined with target gene sequencing technology, genotype-phenotype correlation analysis and genetic analysis. Five patients were diagnosed with monogenic disorder, two were diagnosed with suspected genetic disorder and six were still negative. Conclusion: Sequential use of SNP-array and target gene sequencing technology can significantly increase the molecular genetic etiologic

ID.alistic: identificatie met een touch voor de patiënt

NARCIS (Netherlands)

M. Wilschut; M. Zijlmans; Dr. L.S.G.L Wauben

2017-01-01

ID.alistic is een conceptuele patiëntidentificatie methode (middels een vingerafdrukscanner), ter vervanging van het polsbandjessysteem van het Albert Schweitzer ziekenhuis (ASz) dialysecentrum. Dit onderzoek bepaalt de implementeerbaarheid van ID.alistic binnen het dialysecentrum door

The antibody response of pregnant Cameroonian women to VAR2CSA ID1-ID2a, a small recombinant protein containing the CSA-binding site

DEFF Research Database (Denmark)

Babakhanyan, Anna; Leke, Rose G F; Salanti, Ali

2014-01-01

In pregnant women, Plasmodium falciparum-infected erythrocytes expressing the VAR2CSA antigen bind to chondroitin sulfate A in the placenta causing placental malaria. The binding site of VAR2CSA is present in the ID1-ID2a region. This study sought to determine if pregnant Cameroonian women natura...

Internal validation of the RapidHIT® ID system.

Science.gov (United States)

Wiley, Rachel; Sage, Kelly; LaRue, Bobby; Budowle, Bruce

2017-11-01

Traditionally, forensic DNA analysis has required highly skilled forensic geneticists in a dedicated laboratory to generate short tandem repeat (STR) profiles. STR profiles are routinely used either to associate or exclude potential donors of forensic biological evidence. The typing of forensic reference samples has become more demanding, especially with the requirement in some jurisdictions to DNA profile arrestees. The Rapid DNA (RDNA) platform, the RapidHIT ® ID (IntegenX ® , Pleasanton, CA), is a fully automated system capable of processing reference samples in approximately 90min with minimal human intervention. Thus, the RapidHIT ID instrument can be deployed to non-laboratory environments (e.g., booking stations) and run by trained atypical personnel such as law enforcement. In order to implement the RapidHIT ID platform, validation studies are needed to define the performance and limitations of the system. Internal validation studies were undertaken with four early-production RapidHIT ID units. Reliable and concordant STR profiles were obtained from reference buccal swabs. Throughout the study, no contamination was observed. The overall first-pass success rate with an "expert-like system" was 72%, which is comparable to another current RDNA platform commercially available. The system's second-pass success rate (involving manual interpretation on first-pass inconclusive results) increased to 90%. Inhibitors (i.e., coffee, smoking tobacco, and chewing tobacco) did not appear to affect typing by the instrument system; however, substrate (i.e., swab type) did impact typing success. Additionally, one desirable feature not available with other Rapid systems is that in the event of a system failed run, a swab can be recovered and subsequently re-analyzed in a new sample cartridge. Therefore, rarely should additional sampling or swab consumption be necessary. The RapidHIT ID system is a robust and reliable tool capable of generating complete STR profiles within

Bio-fortification and shelf-life extension of idli batter using curry leaves (Murraya koenigii).

Science.gov (United States)

Chelliah, R; Ramakrishnan, S R; Premkumar, D; Antony, U

2016-06-01

Among several traditional foods of India, idli is one of the most popular and commonly consumed steamed products. A new method of adding Murraya koenigii (curry leaves) to idli batter as a vehicle for fortification and extension of shelf-life has been developed. Dried curry leaves powder was incorporated with other ingredients like rice and dehusked black gram in different proportions to optimize the most palatable formulation. Rate of fermentation and microbial changes in the batter; nutritional qualities, texture and sensory properties of the prepared product were assessed. Incorporation of curry leaves powder (5 %) in idli batter increased the shelf-life and also increased the flavour, texture and appearance of the idli. The calcium content of the prepared idli was 10 times more than that of the control idli, while dietary fiber content increased by 18.6 %. Anti-microbial activity of the curry leaves in idli batter extended the shelf-life from 2 to 5 days when stored at 30 °C.

The Wnt/β-catenin signaling/Id2 cascade mediates the effects of hypoxia on the hierarchy of colorectal-cancer stem cells.

Science.gov (United States)

Dong, Hye-Jin; Jang, Gyu-Beom; Lee, Hwa-Yong; Park, Se-Ra; Kim, Ji-Young; Nam, Jeong-Seok; Hong, In-Sun

2016-03-11

Hypoxia, a feature common to most solid tumors, is known to regulate many aspects of tumorigenesis. Recently, it was suggested that hypoxia increased the size of the cancer stem-cell (CSC) subpopulations and promoted the acquisition of a CSC-like phenotype. However, candidate hypoxia-regulated mediators specifically relevant to the stemness-related functions of colorectal CSCs have not been examined in detail. In the present study, we showed that hypoxia specifically promoted the self-renewal potential of CSCs. Through various in vitro studies, we found that hypoxia-induced Wnt/β-catenin signaling increased the occurrence of CSC-like phenotypes and the level of Id2 expression in colorectal-cancer cells. Importantly, the levels of hypoxia-induced CSC-sphere formation and Id2 expression were successfully attenuated by treatment with a Wnt/β-catenin-signaling inhibitor. We further demonstrated, for the first time, that the degree of hypoxia-induced CSC-sphere formation (CD44(+) subpopulation) in vitro and of tumor metastasis/dissemination in vivo were markedly suppressed by knocking down Id2 expression. Taken together, these data suggested that Wnt/β-catenin signaling mediated the hypoxia-induced self-renewal potential of colorectal-cancer CSCs through reactivating Id2 expression.

To ID or Not to ID? Changes in Classification Rates of Intellectual Disability Using "DSM-5"

Science.gov (United States)

Papazoglou, Aimilia; Jacobson, Lisa A.; McCabe, Marie; Kaufmann, Walter; Zabel, T. Andrew

2014-01-01

The "Diagnostic and Statistical Manual of Mental Disorders-Fifth Edition" ("DSM-5") diagnostic criteria for intellectual disability (ID) include a change to the definition of adaptive impairment. New criteria require impairment in one adaptive domain rather than two or more skill areas. The authors examined the diagnostic…

ACE I/D genotype, adiposity, and blood pressure in children

Directory of Open Access Journals (Sweden)

Rothschild Max

2009-03-01

Full Text Available Abstract Background Angiotensin converting enzyme (ACE is a possible candidate gene that may influence both body fatness and blood pressure. Although several genetic studies have been conducted in adults, relatively few studies have examined the contribution of potential candidate genes, and specifically ACE I/D, on adiposity and BP phenotypes in childhood. Such studies may prove insightful for the development of the obesity-hypertension phenotype early in life. The purpose of this study was to examine differences in body fatness and resting blood pressure (BP by ACE I/D genotype, and determine if the association between adiposity and BP varies by ACE I/D genotype in children. Methods 152 children (75 girls, 77 boys were assessed for body composition (% body fat using dual energy x-ray absorbtiometry and resting BP according to American Heart Association recommendations. Buccal cell samples were genotyped using newly developed PCR-RFLP tests for two SNPs (rs4341 and rs4343 in complete linkage disequilibrium with the ACE I/D polymorphism. Partial correlations were computed to assess the ociations between % body fat and BP in the total sample and by genotype. ANCOVA was used to examine differences in resting BP by ACE I/D genotype and fatness groups. Results Approximately 39% of youth were overfat based on % body fat (>30% fat in girls, 25% fat in boys. Body mass, body mass index, and fat-free mass were significantly higher in the ACE D-carriers compared to the II group (p Conclusion ACE D-carriers are heavier than ACE II children; however, BP did not differ by ACE I/D genotype but was adversely influenced in the overfat D-carriers. Further studies are warranted to investigate the genetics of fatness and BP phenotypes in children.

sRNAnalyzer-a flexible and customizable small RNA sequencing data analysis pipeline.

Science.gov (United States)

Wu, Xiaogang; Kim, Taek-Kyun; Baxter, David; Scherler, Kelsey; Gordon, Aaron; Fong, Olivia; Etheridge, Alton; Galas, David J; Wang, Kai

2017-12-01

Although many tools have been developed to analyze small RNA sequencing (sRNA-Seq) data, it remains challenging to accurately analyze the small RNA population, mainly due to multiple sequence ID assignment caused by short read length. Additional issues in small RNA analysis include low consistency of microRNA (miRNA) measurement results across different platforms, miRNA mapping associated with miRNA sequence variation (isomiR) and RNA editing, and the origin of those unmapped reads after screening against all endogenous reference sequence databases. To address these issues, we built a comprehensive and customizable sRNA-Seq data analysis pipeline-sRNAnalyzer, which enables: (i) comprehensive miRNA profiling strategies to better handle isomiRs and summarization based on each nucleotide position to detect potential SNPs in miRNAs, (ii) different sequence mapping result assignment approaches to simulate results from microarray/qRT-PCR platforms and a local probabilistic model to assign mapping results to the most-likely IDs, (iii) comprehensive ribosomal RNA filtering for accurate mapping of exogenous RNAs and summarization based on taxonomy annotation. We evaluated our pipeline on both artificial samples (including synthetic miRNA and Escherichia coli cultures) and biological samples (human tissue and plasma). sRNAnalyzer is implemented in Perl and available at: http://srnanalyzer.systemsbiology.net/. © The Author(s) 2017. Published by Oxford University Press on behalf of Nucleic Acids Research.

sRNAnalyzer—a flexible and customizable small RNA sequencing data analysis pipeline

Science.gov (United States)

Kim, Taek-Kyun; Baxter, David; Scherler, Kelsey; Gordon, Aaron; Fong, Olivia; Etheridge, Alton; Galas, David J.

2017-01-01

Abstract Although many tools have been developed to analyze small RNA sequencing (sRNA-Seq) data, it remains challenging to accurately analyze the small RNA population, mainly due to multiple sequence ID assignment caused by short read length. Additional issues in small RNA analysis include low consistency of microRNA (miRNA) measurement results across different platforms, miRNA mapping associated with miRNA sequence variation (isomiR) and RNA editing, and the origin of those unmapped reads after screening against all endogenous reference sequence databases. To address these issues, we built a comprehensive and customizable sRNA-Seq data analysis pipeline—sRNAnalyzer, which enables: (i) comprehensive miRNA profiling strategies to better handle isomiRs and summarization based on each nucleotide position to detect potential SNPs in miRNAs, (ii) different sequence mapping result assignment approaches to simulate results from microarray/qRT-PCR platforms and a local probabilistic model to assign mapping results to the most-likely IDs, (iii) comprehensive ribosomal RNA filtering for accurate mapping of exogenous RNAs and summarization based on taxonomy annotation. We evaluated our pipeline on both artificial samples (including synthetic miRNA and Escherichia coli cultures) and biological samples (human tissue and plasma). sRNAnalyzer is implemented in Perl and available at: http://srnanalyzer.systemsbiology.net/. PMID:29069500

Id3 induces an Elk-1–caspase-8-dependent apoptotic pathway in squamous carcinoma cells

International Nuclear Information System (INIS)

Chen, You-Shin; Aubee, Joseph; DiVito, Kyle A; Zhou, Hengbo; Zhang, Weiyi; Chou, Fen-Pi; Simbulan-Rosenthal, Cynthia M; Rosenthal, Dean S

2015-01-01

Inhibitor of differentiation/DNA-binding (Id) proteins are helix–loop–helix (HLH) transcription factors. The Id protein family (Id1–Id4) mediates tissue homeostasis by regulating cellular processes including differentiation, proliferation, and apoptosis. Ids typically function as dominant negative HLH proteins, which bind other HLH proteins and sequester them away from DNA promoter regions. Previously, we have found that Id3 induced apoptosis in immortalized human keratinocytes upon UVB exposure, consistent with its role as a tumor suppressor. To investigate the role of Id3 in malignant squamous cell carcinoma (SCC) cells (A431), a tetracycline-regulated inducible system was used to induce Id3 in cell culture and mouse xenograft models. We found that upon Id3 induction, there was a decrease in cell number under low serum conditions, as well as in soft agar. Microarray, RT-PCR, immunoblot, siRNA, and inhibitor studies revealed that Id3 induced expression of Elk-1, an E-twenty-six (ETS)-domain transcription factor, inducing procaspase-8 expression and activation. Id3 deletion mutants revealed that 80 C-terminal amino acids, including the HLH, are important for Id3-induced apoptosis. In a mouse xenograft model, Id3 induction decreased tumor size by 30%. Using immunofluorescent analysis, we determined that the tumor size decrease was also mediated through apoptosis. Furthermore, we show that Id3 synergizes with 5-FU and cisplatin therapies for nonmelanoma skin cancer cells. Our studies have shown a molecular mechanism by which Id3 induces apoptosis in SCC, and this information can potentially be used to develop new treatments for SCC patients

Implementing New-age Authentication Techniques using OpenID for Security Automation

OpenAIRE

Dharmendra Choukse; Umesh Kumar Singh; Deepak Sukheja; Rekha Shahapurkar

2010-01-01

Security of any software can be enhanced manifolds if multiple factors for authorization and authentication are used .The main aim of this work was to design and implement an Academy Automation Software for IPS Academy which uses OpenID and Windows CardSpace as Authentication Techniques in addition to Role Based Authentication (RBA) System to ensure that only authentic users can access the predefined roles as per their Authorization level. The Automation covers different computing hardware an...

78 FR 8596 - Hartford Financial Services Group, Inc., Commercial/Actuarial/ Information Delivery Services (IDS...

Science.gov (United States)

2013-02-06

... Services Group, Inc., Commercial/Actuarial/ Information Delivery Services (IDS)/Corporate & Financial... workers and former workers of Hartford Financial Services Group, Inc., Commercial/Actuarial/Information Delivery Services (IDS)/Corporate & Financial Reporting group, Hartford, Connecticut (The Hartford-IDS...

Identity Management ToolKit (IdM TK)

Data.gov (United States)

Department of Veterans Affairs — With the IdM TK, authorized users can search and view identity and exception information from the Administrative Data Repository (ADR). Specifically, users can view...

Improvement of methods for large scale sequencing; application to human Xq28

Energy Technology Data Exchange (ETDEWEB)

Gibbs, R.A.; Andersson, B.; Wentland, M.A. [Baylor College of Medicine, Houston, TX (United States)] [and others

1994-09-01

Sequencing of a one-metabase region of Xq28, spanning the FRAXA and IDS loci has been undertaken in order to investigate the practicality of the shotgun approach for large scale sequencing and as a platform to develop improved methods. The efficiency of several steps in the shotgun sequencing strategy has been increased using PCR-based approaches. An improved method for preparation of M13 libraries has been developed. This protocol combines a previously described adaptor-based protocol with the uracil DNA glycosylase (UDG)-cloning procedure. The efficiency of this procedure has been found to be up to 100-fold higher than that of previously used protocols. In addition the novel protocol is more reliable and thus easy to establish in a laboratory. The method has also been adapted for the simultaneous shotgun sequencing of multiple short fragments by concentrating them before library construction is presented. This protocol is suitable for rapid characterization of cDNA clones. A library was constructed from 15 PCR-amplified and concentrated human cDNA inserts, and the insert sequences could easily be identified as separate contigs during the assembly process and the sequence coverage was even along each fragment. Using this strategy, the fine structures of the FraxA and IDS loci have been revealed and several EST homologies indicating novel expressed sequences have been identified. Use of PCR to close repetitive regions that are difficult to clone was tested by determination of the sequence of a cosmid mapping DXS455 in Xq28, containing a polymorphic VNTR. The region containing the VNTR was not represented in the shotgun library, but by designing PCR primers in the sequences flanking the gap and by cloning and sequencing the PCR product, the fine structure of the VNTR has been determined. It was found to be an AT-rich VNTR with a repeated 25-mer at the center.

Security and Privacy Improvements for the Belgian eID Technology

Science.gov (United States)

Verhaeghe, Pieter; Lapon, Jorn; de Decker, Bart; Naessens, Vincent; Verslype, Kristof

The Belgian Electronic Identity Card enables Belgian citizens to prove their identity digitally and to sign electronic documents. At the end of 2009, every Belgian citizen older than 12 years will have such an eID card. In the future, usage of the eID card may be mandatory. However, irresponsible use of the card may cause harm to individuals.

Idaho National Laboratory Supervisory Control and Data Acquisition Intrusion Detection System (SCADA IDS)

Energy Technology Data Exchange (ETDEWEB)

Jared Verba; Michael Milvich

2008-05-01

Current Intrusion Detection System (IDS) technology is not suited to be widely deployed inside a Supervisory, Control and Data Acquisition (SCADA) environment. Anomaly- and signature-based IDS technologies have developed methods to cover information technology-based networks activity and protocols effectively. However, these IDS technologies do not include the fine protocol granularity required to ensure network security inside an environment with weak protocols lacking authentication and encryption. By implementing a more specific and more intelligent packet inspection mechanism, tailored traffic flow analysis, and unique packet tampering detection, IDS technology developed specifically for SCADA environments can be deployed with confidence in detecting malicious activity.

78 FR 25406 - Proposed Modification of Class E Airspace; Twin Falls, ID

Science.gov (United States)

2013-05-01

...) Global Positioning System (GPS) and the Instrument Landing System (ILS) or Localizer (LOC) standard... the earth. * * * * * ANM ID E5 Twin Falls, ID [Modified] Twin Falls Joslin Field-Magic Valley Regional...

Exploring sequence characteristics related to high-level production of secreted proteins in Aspergillus niger.

Directory of Open Access Journals (Sweden)

Bastiaan A van den Berg

Full Text Available Protein sequence features are explored in relation to the production of over-expressed extracellular proteins by fungi. Knowledge on features influencing protein production and secretion could be employed to improve enzyme production levels in industrial bioprocesses via protein engineering. A large set, over 600 homologous and nearly 2,000 heterologous fungal genes, were overexpressed in Aspergillus niger using a standardized expression cassette and scored for high versus no production. Subsequently, sequence-based machine learning techniques were applied for identifying relevant DNA and protein sequence features. The amino-acid composition of the protein sequence was found to be most predictive and interpretation revealed that, for both homologous and heterologous gene expression, the same features are important: tyrosine and asparagine composition was found to have a positive correlation with high-level production, whereas for unsuccessful production, contributions were found for methionine and lysine composition. The predictor is available online at http://bioinformatics.tudelft.nl/hipsec. Subsequent work aims at validating these findings by protein engineering as a method for increasing expression levels per gene copy.

78 FR 45478 - Proposed Establishment of Class E Airspace; Salmon, ID

Science.gov (United States)

2013-07-29

...-0531; Airspace Docket No. 13-ANM-20] Proposed Establishment of Class E Airspace; Salmon, ID AGENCY... action proposes to establish Class E airspace at the Salmon VHF Omni-Directional Radio Range/Distance Measuring Equipment (VOR/DME) navigation aid, Salmon, ID, to facilitate vectoring of Instrument Flight Rules...

Muon Identification performance: hadron mis-Id measurements and RPC Muon selections

CERN Document Server

CMS Collaboration

2014-01-01

Pion, kaon, proton mis-identification probabilities as muons have been measured for different Muon ID algorithms. Results from two independent analyses are presented. The performance of a new muon ID algorithm based on matching of inner tracks with hits in muon RPC chambers is also presented.

Comparison of sequencing the D2 region of the large subunit ribosomal RNA gene (MicroSEQ®) versus the internal transcribed spacer (ITS) regions using two public databases for identification of common and uncommon clinically relevant fungal species.

Science.gov (United States)

Arbefeville, S; Harris, A; Ferrieri, P

2017-09-01

Fungal infections cause considerable morbidity and mortality in immunocompromised patients. Rapid and accurate identification of fungi is essential to guide accurately targeted antifungal therapy. With the advent of molecular methods, clinical laboratories can use new technologies to supplement traditional phenotypic identification of fungi. The aims of the study were to evaluate the sole commercially available MicroSEQ® D2 LSU rDNA Fungal Identification Kit compared to the in-house developed internal transcribed spacer (ITS) regions assay in identifying moulds, using two well-known online public databases to analyze sequenced data. 85 common and uncommon clinically relevant fungi isolated from clinical specimens were sequenced for the D2 region of the large subunit (LSU) of ribosomal RNA (rRNA) gene with the MicroSEQ® Kit and the ITS regions with the in house developed assay. The generated sequenced data were analyzed with the online GenBank and MycoBank public databases. The D2 region of the LSU rRNA gene identified 89.4% or 92.9% of the 85 isolates to the genus level and the full ITS region (f-ITS) 96.5% or 100%, using GenBank or MycoBank, respectively, when compared to the consensus ID. When comparing species-level designations to the consensus ID, D2 region of the LSU rRNA gene aligned with 44.7% (38/85) or 52.9% (45/85) of these isolates in GenBank or MycoBank, respectively. By comparison, f-ITS possessed greater specificity, followed by ITS1, then ITS2 regions using GenBank or MycoBank. Using GenBank or MycoBank, D2 region of the LSU rRNA gene outperformed phenotypic based ID at the genus level. Comparing rates of ID between D2 region of the LSU rRNA gene and the ITS regions in GenBank or MycoBank at the species level against the consensus ID, f-ITS and ITS2 exceeded performance of the D2 region of the LSU rRNA gene, but ITS1 had similar performance to the D2 region of the LSU rRNA gene using MycoBank. Our results indicated that the MicroSEQ® D2 LSU r

Extending the Intermediate Data Structure (IDS for longitudinal historical databases to include geographic data

Directory of Open Access Journals (Sweden)

Finn Hedefalk

2014-09-01

Full Text Available The Intermediate Data Structure (IDS is a standardised database structure for longitudinal historical databases. Such a common structure facilitates data sharing and comparative research. In this study, we propose an extended version of IDS, named IDS-Geo, that also includes geographic data. The geographic data that will be stored in IDS-Geo are primarily buildings and/or property units, and the purpose of these geographic data is mainly to link individuals to places in space. When we want to assign such detailed spatial locations to individuals (in times before there were any detailed house addresses available, we often have to create tailored geographic datasets. In those cases, there are benefits of storing geographic data in the same structure as the demographic data. Moreover, we propose the export of data from IDS-Geo using an eXtensible Markup Language (XML Schema. IDS-Geo is implemented in a case study using historical property units, for the period 1804 to 1913, stored in a geographically extended version of the Scanian Economic Demographic Database (SEDD. To fit into the IDS-Geo data structure, we included an object lifeline representation of all of the property units (based on the snapshot time representation of single historical maps and poll-tax registers. The case study verifies that the IDS-Geo model is capable of handling geographic data that can be linked to demographic data.

Independence Day 2004 (ID04) / Raul Hindov

Index Scriptorium Estoniae

Hindov, Raul

2004-01-01

Ülevaade 20.-22. veebruarini 2004 toimunud kaugluurepatrullide rännaku ja sõdurioskuste kompleksõppusest ID04 (Independence Day 2004 - Iseseisvuspäev 2004), millel osales 25 patrullvõistlusteks valmistuvat meest ja naist

Increased Inhibitor of Differentiation 4 (Id4 Expression in Glioblastoma: A Tissue Microarray Study

Directory of Open Access Journals (Sweden)

Weifin Zeng, Elisabeth J. Rushing, Daniel P. Hartmann, Norio Azumi

2010-01-01

Full Text Available Background: The inhibitor of differentiation/DNA binding protein family (Id1-4 is involved in cell cycle control, tumorigenesis and angiogenesis through the negative regulation of helix-loop-helix transcription factors. Of these proteins, Id4 is known to play an important role in neural stem cell differentiation, and deregulation has been implicated in glial neoplasia. However, the expression and significance of Id4 in astrocytomas has not been fully addressed. Herein we report the differential expression of Id4 in astrocytomas of various grades using tissue microarrays (TMA and immunohistochemistry (IHC. Design: The GBM TMA was constructed from 53 archival cases at Georgetown University Hospital and a TMA with normal brain controls and grades II-III astrocytoma was obtained from Cybrdi (Rockville, MD. TMA sections were stained with Id4 antibody and the slides were scored according to the percentage of staining astrocytic nuclei (<9% -, 10-50% +, >51% ++. The Fisher Exact test was used to test for statistical significance. Results: Nuclear staining for Id4 was seen in 73.58% GBMs, 25% grade III, and 12.5% grade II astrocytomas; staining was absent in normal brain tissue. There was a statistically significant difference between GBM and grades II, III astrocytoma (p <0.01. Significant Id4 expression was not detected in normal brain. Conclusions: Our study confirms the frequent upregulation of Id4 expression in GBM, which lends support to its role in tumorigenesis, possibly in the transformation of low to high-grade astrocytoma (i.e. GBM. Further studies are warranted to determine the precise role of Id4 in glial neoplasia and its potential use in targeted therapy for GBM.

Determination of 241Am in sediments by isotope dilution high resolution inductively coupled plasma mass spectrometry (ID HR ICP-MS).

Science.gov (United States)

Agarande, M; Benzoubir, S; Bouisset, P; Calmet, D

2001-08-01

Trace levels (pg kg(-1)) of 241Am in sediments were determined by isotope dilution high resolution inductively coupled plasma mass spectrometry (ID HR ICP-MS) using a microconcentric nebulizer. 241Am was isolated from major elements like Ca and Fe by different selective precipitations. In further steps. Am was first separated from other transuranic elements and purified by anion exchange and extraction chromatography prior to the mass spectrometric measurements. The ID HR ICP-MS results are compared with isotope dilution alpha spectrometry.

Analysis of expressed sequence tags from Prunus mume flower and fruit and development of simple sequence repeat markers

Directory of Open Access Journals (Sweden)

Gao Zhihong

2010-07-01

Full Text Available Abstract Background Expressed Sequence Tag (EST has been a cost-effective tool in molecular biology and represents an abundant valuable resource for genome annotation, gene expression, and comparative genomics in plants. Results In this study, we constructed a cDNA library of Prunus mume flower and fruit, sequenced 10,123 clones of the library, and obtained 8,656 expressed sequence tag (EST sequences with high quality. The ESTs were assembled into 4,473 unigenes composed of 1,492 contigs and 2,981 singletons and that have been deposited in NCBI (accession IDs: GW868575 - GW873047, among which 1,294 unique ESTs were with known or putative functions. Furthermore, we found 1,233 putative simple sequence repeats (SSRs in the P. mume unigene dataset. We randomly tested 42 pairs of PCR primers flanking potential SSRs, and 14 pairs were identified as true-to-type SSR loci and could amplify polymorphic bands from 20 individual plants of P. mume. We further used the 14 EST-SSR primer pairs to test the transferability on peach and plum. The result showed that nearly 89% of the primer pairs produced target PCR bands in the two species. A high level of marker polymorphism was observed in the plum species (65% and low in the peach (46%, and the clustering analysis of the three species indicated that these SSR markers were useful in the evaluation of genetic relationships and diversity between and within the Prunus species. Conclusions We have constructed the first cDNA library of P. mume flower and fruit, and our data provide sets of molecular biology resources for P. mume and other Prunus species. These resources will be useful for further study such as genome annotation, new gene discovery, gene functional analysis, molecular breeding, evolution and comparative genomics between Prunus species.

VLM Tool for IDS Integration

Directory of Open Access Journals (Sweden)

Cǎtǎlin NAE

2010-03-01

Full Text Available This paper is dedicated to a very specific type of analysis tool (VLM - Vortex Lattice Method to be integrated in a IDS - Integrated Design System, tailored for the usage of small aircraft industry. The major interest is to have the possibility to simulate at very low computational costs a preliminary set of aerodynamic characteristics for basic aerodynamic global characteristics (Lift, Drag, Pitching Moment and aerodynamic derivatives for longitudinal and lateral-directional stability analysis. This work enables fast investigations of the influence of configuration changes in a very efficient computational environment. Using experimental data and/or CFD information for a specific calibration of VLM method, reliability of the analysis may me increased so that a first type (iteration zero aerodynamic evaluation of the preliminary 3D configuration is possible. The output of this tool is basic state aerodynamic and associated stability and control derivatives, as well as a complete set of information on specific loads on major airframe components.The major interest in using and validating this type of methods is coming from the possibility to integrate it as a tool in an IDS system for conceptual design phase, as considered for development for CESAR project (IP, UE FP6.

Implementasi Cell ID dan GPS dalam Pencarian Lokasi Fasilitas Kesehatan Terdekat

Directory of Open Access Journals (Sweden)

Fahmi Candra Permana

2017-07-01

Full Text Available Cell ID dan GPS merupakan layanan berbasis lokasi dan teknologi yang banyak membantu manusia dalam hal navigasi dan penemuan tempat-tempat yang bermanfaat di sekitarnya. Salah satu komponen utama dari teknologi ini dapat diterapkan pada telepon seluler. Dalam penelitian ini, dirancang sebuah aplikasi dengan memanfaatkan teknologi berdasar implementasi dari Cell ID dan GPS untuk mengetahui posisi user dan lokasi fasilitas kesehatan terdekat di sekitar user dan penggunaan JSON sebagai sarana untuk menyimpan database pada web. Aplikasi ini diimplementasikan pada telepon seluler dengan sistem operasi Android. Hasil dari penelitian ini menunjukkan bahwa Cell ID dan GPS dapat diimplementasikan dengan baik dengan memanfaatkan akses Internet dan Google Maps untuk mencari fasilitas kesehatan terdekat dan menggambarkan daerah sekitar user.

Efficient coding and detection of ultra-long IDs for visible light positioning systems.

Science.gov (United States)

Zhang, Hualong; Yang, Chuanchuan

2018-05-14

Visible light positioning (VLP) is a promising technique to complement Global Navigation Satellite System (GNSS) such as Global positioning system (GPS) and BeiDou Navigation Satellite System (BDS) which features the advantage of low-cost and high accuracy. The situation becomes even more crucial for indoor environments, where satellite signals are weak or even unavailable. For large-scale application of VLP, there would be a considerable number of Light emitting diode (LED) IDs, which bring forward the demand of long LED ID detection. In particular, to provision indoor localization globally, a convenient way is to program a unique ID into each LED during manufacture. This poses a big challenge for image sensors, such as the CMOS camera in everybody's hands since the long ID covers the span of multiple frames. In this paper, we investigate the detection of ultra-long ID using rolling shutter cameras. By analyzing the pattern of data loss in each frame, we proposed a novel coding technique to improve the efficiency of LED ID detection. We studied the performance of Reed-Solomon (RS) code in this system and designed a new coding method which considered the trade-off between performance and decoding complexity. Coding technique decreases the number of frames needed in data processing, significantly reduces the detection time, and improves the accuracy of detection. Numerical and experimental results show that the detected LED ID can be much longer with the coding technique. Besides, our proposed coding method is proved to achieve a performance close to that of RS code while the decoding complexity is much lower.

Vibrational measurements in 3-ID-B

International Nuclear Information System (INIS)

Sutter, J.; Alp, E.; Barraza, J.; Shu, D.

1998-04-01

The authors have undertaken a series of vibrational measurements in hutch 3-ID-B. Their motivation was to compare two different methods of mounting an interferometer for effectiveness in vibrational isolation and stability. In addition they were able to compare the stability of the optical table with and without its eight large bolts inserted

Toward operation of series IDs at BL43LXU of SPring-8

Energy Technology Data Exchange (ETDEWEB)

Baron, A. Q. R.; Tanaka, T.; Soutome, K.; Takao, M.; Nakamura, T.; Kobayashi, K.; Fujita, T.; Takahashi, S.; Aoyagi, H.; Shimosaki, Y.; Seike, T.; Uchiyama, H.; Ishikawa, D.; Chuang, T.-H.; Kimura, H.; Tanaka, H.; Kitamura, H.; Ishikawa, T. [SPring-8, 1-1-1 Kouto, Sayo, Hyogo, 679 (Japan)

2016-07-27

This paper discusses two issues relating to using 3 small gap insertion devices in series at BL43LXU of SPring-8 to make a uniquely powerful source in the 15-26 keV region of the x-ray spectrum. The issues discussed are (1) damage to the covers of the downstream IDs by radiation from the upstream IDs and (2) proper steering of the electron beam to get the best photon beam properties. After tests in several configurations, including one where an ID was run without an impedance-reducing cover, the damage issue was solved by installing a distributed absorber in the most downstream ID. The steering issues were mostly resolved by the introduction of appropriate corrector magnets and feedback. The paper is written from the viewpoint of an interested beamline scientist impressed with the cooperation of different groups to make a source for new science possible.

ID'ing innate and innate-like lymphoid cells.

Science.gov (United States)

Verykokakis, Mihalis; Zook, Erin C; Kee, Barbara L

2014-09-01

The immune system can be divided into innate and adaptive components that differ in their rate and mode of cellular activation, with innate immune cells being the first responders to invading pathogens. Recent advances in the identification and characterization of innate lymphoid cells have revealed reiterative developmental programs that result in cells with effector fates that parallel those of adaptive lymphoid cells and are tailored to effectively eliminate a broad spectrum of pathogenic challenges. However, activation of these cells can also be associated with pathologies such as autoimmune disease. One major distinction between innate and adaptive immune system cells is the constitutive expression of ID proteins in the former and inducible expression in the latter. ID proteins function as antagonists of the E protein transcription factors that play critical roles in lymphoid specification as well as B- and T-lymphocyte development. In this review, we examine the transcriptional mechanisms controlling the development of innate lymphocytes, including natural killer cells and the recently identified innate lymphoid cells (ILC1, ILC2, and ILC3), and innate-like lymphocytes, including natural killer T cells, with an emphasis on the known requirements for the ID proteins. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

FDIC Institution Directory (ID) -- Insured Insitution Download File

Data.gov (United States)

Federal Deposit Insurance Corporation — The FDIC's Institution Directory (ID) download file provides a list of all FDIC-insured institutions. The file includes demographic information related to the...

DNA sequence explains seemingly disordered methylation levels in partially methylated domains of Mammalian genomes.

Directory of Open Access Journals (Sweden)

Dimos Gaidatzis

2014-02-01

Full Text Available For the most part metazoan genomes are highly methylated and harbor only small regions with low or absent methylation. In contrast, partially methylated domains (PMDs, recently discovered in a variety of cell lines and tissues, do not fit this paradigm as they show partial methylation for large portions (20%-40% of the genome. While in PMDs methylation levels are reduced on average, we found that at single CpG resolution, they show extensive variability along the genome outside of CpG islands and DNase I hypersensitive sites (DHS. Methylation levels range from 0% to 100% in a roughly uniform fashion with only little similarity between neighboring CpGs. A comparison of various PMD-containing methylomes showed that these seemingly disordered states of methylation are strongly conserved across cell types for virtually every PMD. Comparative sequence analysis suggests that DNA sequence is a major determinant of these methylation states. This is further substantiated by a purely sequence based model which can predict 31% (R(2 of the variation in methylation. The model revealed CpG density as the main driving feature promoting methylation, opposite to what has been shown for CpG islands, followed by various dinucleotides immediately flanking the CpG and a minor contribution from sequence preferences reflecting nucleosome positioning. Taken together we provide a reinterpretation for the nucleotide-specific methylation levels observed in PMDs, demonstrate their conservation across tissues and suggest that they are mainly determined by specific DNA sequence features.

Angiotensin Converting Enzyme Gene I/D Polymorphism in Pakistani Rheumatic Heart Disease Patients and Healthy Controls

Directory of Open Access Journals (Sweden)

Sadia Rehman

2015-09-01

Full Text Available Background: Valve scarring and collagen deposition are crucial in pathogenesis of Rheumatic Heart Disease (RHD, an autoimmune disorder of the heart. Angiotensin I-Converting Enzyme (ACE plays a major role in fibrous tissue formation. Objectives: The present research work aimed to assess the role of ACE Insertion/Deletion (I/D polymorphism in progress of RHD. Patients and Methods: DNA was pre pared from blood samples from 156 RHD patients (156 and 204 healthy ethnically-matched controls. Then, it was screened using sequence-specific Primers. Polymerase chain reaction and Agarose gel electrophoresis. The data were analyzed using Vassar stats (http://faculty.vassar.edu/lowry/VassarStats.html. Results: I allele (P = 0.024, OR = 1.42 and II genotype (P = 0.001, OR = 3.07 were significantly higher in Pakistani RHD patients compared to the healthy controls. Also, a significant difference was found between the female, but not male, patients and the controls regarding I allele and II genotype. Conclusions: The study results provided information about involvement of ACE I/D polymorphism in molecular mechanism of RHD. Thus, it can become one of the useful tools in risk assessment and help with designing strategies to combat the disease.

77 FR 68065 - Amendment of Class D and Class E Airspace; Lewiston, ID

Science.gov (United States)

2012-11-15

... Measuring Equipment (VOR/ DME), and the Lewiston-Nez Perce Instrument Landing System (ILS) Localizer... feet or more above the surface of the earth. * * * * * ANM ID E5 Lewiston, ID [Modified] Lewiston-Nez...

78 FR 40382 - Modification of Class D and E Airspace; Twin Falls, ID

Science.gov (United States)

2013-07-05

... using the Navigation (RNAV) Global Positioning System (GPS) and the Instrument Landing System (ILS) or... or more above the surface of the earth. * * * * * ANM ID E5 Twin Falls, ID [Modified] Twin Falls...

Use of Sequenom sample ID Plus® SNP genotyping in identification of FFPE tumor samples.

Directory of Open Access Journals (Sweden)

Jessica K Miller

Full Text Available Short tandem repeat (STR analysis, such as the AmpFlSTR® Identifiler® Plus kit, is a standard, PCR-based human genotyping method used in the field of forensics. Misidentification of cell line and tissue DNA can be costly if not detected early; therefore it is necessary to have quality control measures such as STR profiling in place. A major issue in large-scale research studies involving archival formalin-fixed paraffin embedded (FFPE tissues is that varying levels of DNA degradation can result in failure to correctly identify samples using STR genotyping. PCR amplification of STRs of several hundred base pairs is not always possible when DNA is degraded. The Sample ID Plus® panel from Sequenom allows for human DNA identification and authentication using SNP genotyping. In comparison to lengthy STR amplicons, this multiplexing PCR assay requires amplification of only 76-139 base pairs, and utilizes 47 SNPs to discriminate between individual samples. In this study, we evaluated both STR and SNP genotyping methods of sample identification, with a focus on paired FFPE tumor/normal DNA samples intended for next-generation sequencing (NGS. The ability to successfully validate the identity of FFPE samples can enable cost savings by reducing rework.

Id2 reinforces TH1 differentiation and inhibits E2A to repress TFH differentiation.

Science.gov (United States)

Shaw, Laura A; Bélanger, Simon; Omilusik, Kyla D; Cho, Sunglim; Scott-Browne, James P; Nance, J Philip; Goulding, John; Lasorella, Anna; Lu, Li-Fan; Crotty, Shane; Goldrath, Ananda W

2016-07-01

The differentiation of helper T cells into effector subsets is critical to host protection. Transcription factors of the E-protein and Id families are important arbiters of T cell development, but their role in the differentiation of the TH1 and TFH subsets of helper T cells is not well understood. Here, TH1 cells showed more robust Id2 expression than that of TFH cells, and depletion of Id2 via RNA-mediated interference increased the frequency of TFH cells. Furthermore, TH1 differentiation was blocked by Id2 deficiency, which led to E-protein-dependent accumulation of effector cells with mixed characteristics during viral infection and severely impaired the generation of TH1 cells following infection with Toxoplasma gondii. The TFH cell-defining transcriptional repressor Bcl6 bound the Id2 locus, which provides a mechanism for the bimodal Id2 expression and reciprocal development of TH1 cells and TFH cells.

The Implementation of C-ID, R2D2 Model on Learning Reading Comprehension

Science.gov (United States)

Rayanto, Yudi Hari; Rusmawan, Putu Ngurah

2016-01-01

The purposes of this research are to find out, (1) whether C-ID, R2D2 model is effective to be implemented on learning Reading comprehension, (2) college students' activity during the implementation of C-ID, R2D2 model on learning Reading comprehension, and 3) college students' learning achievement during the implementation of C-ID, R2D2 model on…

Anmeldung in ILIAS ohne Uni-Login-ID

OpenAIRE

Schanz, Nadja

2016-01-01

Gewusst wie...! Online-Tutorial der Universitätsbibliothek Tübingen. Erklärt die Anmeldung in Ilias zu Führungen ohne Uni-Login-ID Online Tutorial from university library tuebingen. teaches how to register in Ilias for courses and guided tours without university login

Draft genome sequence of Sclerospora graminicola, the pearl millet downy mildew pathogen

Directory of Open Access Journals (Sweden)

Navajeet Chakravartty

2017-12-01

Full Text Available Sclerospora graminicola pathogen is the most important biotic production constraints of pearl millet in India, Africa and other parts of the world. We report a de novo whole genome assembly and analysis of pathotype 1, one of the most virulent pathotypes of S. graminicola from India. The whole genome sequencing was performed by sequencing of 7.38 Gb with 73,889,924 paired end reads from the paired-end library, and 1.15 Gb with 3,851,788 reads from the mate pair library generated from Illumina HiSeq 2500 and Illumina MiSeq, respectively. A total 597,293 filtered sub reads with average read length of 6.39 Kb was generated on PACBIO RSII with P6-C4 chemistry. Assembled draft genome sequence of S. graminicola pathotype 1 was 299,901,251 bp in length, N50 of 17,909 bp with a minimum of 1 Kb scaffold size. The GC content was 47.2 % consisting of 26,786 scaffolds with longest scaffold size of 238,843 bp. The overall coverage was 40X. The draft genome sequence was used for gene prediction using AUGUSTUS which resulted in 65,404 genes using Saccharomyces cerevisiae as a model. A total of 52,285 predicted genes found homology using BLASTX against nr database and 38,120 genes were observed with a significant BLASTX match with E-value cutoff of 1e-5 and 40% identity percentage. Out of 38,120 genes annotated a set of 11,873 genes had UniProt entries, while 7,248 were GO terms and 9,686 with KEGG IDs. Of the 7,248 GO terms, 2,724 were associated with the biological processes. The genome information of downy mildew pathogen is available in the NCBI GenBank database. The Sclerospora graminicola whole genome shotgun (WGS project has the project accession MIQA00000000. This version of the project (02 has the accession number MIQA02000000, and consists of sequences MIQA02000001-MIQA02026786, with BioProject ID PRJNA325098 and BioSample ID SAMN05219233. This study may help understand the evolutionary pattern of pathogen and aid elucidation of effector evolution for

On the validity of Ksub(Id)-measurements in instrumented impact tests

International Nuclear Information System (INIS)

Kalthoff, J.F.; Winkler, S.; Klemm, W.; Beinert, J.

1979-01-01

The influence of inertia effects in determining the dynamic fracture toughness Ksub(Id) by instrumented impact testing is investigated. Model experiments in the brittle fracture regime are carried out with precracked bend specimens machined from the epoxy resin Araldite B. As is usual in these tests, the loads at the tup of the impinging striker are recorded as a function of time during the impact process. For reference purposes, the dynamic fracture toughness value Ksub(Id)sup(m1) is derived from the measured maximum load utilizing static stress intensity factor formulas. In addition to this conventional procedure, the actual stress intensity factors are measured directly at the tip of the crack by means of the shadow optical method of caustics applied in combination with high speed photography. The critical value of these optically measured stress intensity factors (for onset of crack propagation), Ksub(Id)sup(opt), is the true dynamic fracture toughness. In the experiments, the specimen size and the impact velocity were varied. In accordance with expectations, it is found that the hammer load signal is not correlated with the actual crack tip stress intensity factor values by a simple proportionality. The conventionally determined Ksub(Id)sup(m1)-value overestimates the true dynamic fracture toughness Ksub(Id)sup(opt). This overestimation becomes larger for larger specimen sizes and larger impact velocities. The results demonstrate the dominating influence inertia effects can have on hammer load measurements and emphasize the importance of eliminating these effects in order to determine non-erroneous dynamic fracture toughness values. (orig.)

Wnt/β-catenin signaling changes C2C12 myoblast proliferation and differentiation by inducing Id3 expression

International Nuclear Information System (INIS)

Zhang, Long; Shi, Songting; Zhang, Juan; Zhou, Fangfang; Dijke, Peter ten

2012-01-01

Highlights: ► Expression of Id3 but not Id1 is induced by Wnt3a stimulation in C2C12 cells. ► Wnt3a induces Id3 expression via canonical Wnt/β-catenin pathway. ► Wnt3a-induced Id3 expression does not depend on BMP signaling activation. ► Induction of Id3 expression is critical determinant in Wnt3a-induced cell proliferation and differentiation. -- Abstract: Canonical Wnt signaling plays important roles in regulating cell proliferation and differentiation. In this study, we report that inhibitor of differentiation (Id)3 is a Wnt-inducible gene in mouse C2C12 myoblasts. Wnt3a induced Id3 expression in a β-catenin-dependent manner. Bone morphogenetic protein (BMP) also potently induced Id3 expression. However, Wnt-induced Id3 expression occurred independent of the BMP/Smad pathway. Functional studies showed that Id3 depletion in C2C12 cells impaired Wnt3a-induced cell proliferation and alkaline phosphatase activity, an early marker of osteoblast cells. Id3 depletion elevated myogenin induction during myogenic differentiation and partially impaired Wnt3a suppressed myogenin expression in C2C12 cells. These results suggest that Id3 is an important Wnt/β-catenin induced gene in myoblast cell fate determination.

Role of ID Proteins in BMP4 Inhibition of Profibrotic Effects of TGF-β2 in Human TM Cells.

Science.gov (United States)

Mody, Avani A; Wordinger, Robert J; Clark, Abbot F

2017-02-01

Increased expression of TGF-β2 in primary open-angle glaucoma (POAG) aqueous humor (AH) and trabecular meshwork (TM) causes deposition of extracellular matrix (ECM) in the TM and elevated IOP. Bone morphogenetic proteins (BMPs) regulate TGF-β2-induced ECM production. The underlying mechanism for BMP4 inhibition of TGF-β2-induced fibrosis remains undetermined. Bone morphogenic protein 4 induces inhibitor of DNA binding proteins (ID1, ID3), which suppress transcription factor activities to regulate gene expression. Our study will determine whether ID1and ID3 proteins are downstream targets of BMP4, which attenuates TGF-β2 induction of ECM proteins in TM cells. Primary human TM cells were treated with BMP4, and ID1 and ID3 mRNA, and protein expression was determined by quantitative PCR (Q-PCR) and Western immunoblotting. Intracellular ID1 and ID3 protein localization was studied by immunocytochemistry. Transformed human TM cells (GTM3 cells) were transfected with ID1 or ID3 expression vectors to determine their potential inhibitory effects on TGF-β2-induced fibronectin and plasminogen activator inhibitor-I (PAI-1) protein expression. Basal expression of ID1-3 was detected in primary human TM cells. Bone morphogenic protein 4 significantly induced early expression of ID1 and ID3 mRNA (P protein in primary TM cells, and a BMP receptor inhibitor blocked this induction. Overexpression of ID1 and ID3 significantly inhibited TGF-β2-induced expression of fibronectin and PAI-1 in TM cells (P protein 4 induced ID1 and ID3 expression suppresses TGF-β2 profibrotic activity in human TM cells. In the future, targeting specific regulators may control the TGF-β2 profibrotic effects on the TM, leading to disease modifying IOP lowering therapies.

An enhanced dynamic ID-based authentication scheme for telecare medical information systems

Directory of Open Access Journals (Sweden)

Ankita Chaturvedi

2017-01-01

Full Text Available The authentication schemes for telecare medical information systems (TMIS try to ensure secure and authorized access. ID-based authentication schemes address secure communication, but privacy is not properly addressed. In recent times, dynamic ID-based remote user authentication schemes for TMIS have been presented to protect user’s privacy. The dynamic ID-based authentication schemes efficiently protect the user’s privacy. Unfortunately, most of the existing dynamic ID-based authentication schemes for TMIS ignore the input verifying condition. This makes login and password change phases inefficient. Inefficiency of the password change phase may lead to denial of service attack in the case of incorrect input in the password change phase. To overcome these weaknesses, we proposed a new dynamic ID-based authentication scheme using a smart card. The proposed scheme can quickly detect incorrect inputs which makes the login and password change phase efficient. We adopt the approach with the aim to protect privacy, and efficient login and password change phases. The proposed scheme also resists off-line password guessing attack and denial of service attack. We also demonstrate the validity of the proposed scheme by utilizing the widely-accepted BAN (Burrows, Abadi, and Needham logic. In addition, our scheme is comparable in terms of the communication and computational overheads with relevant schemes for TMIS.

Automatic spent fuel ID number reader (I)

International Nuclear Information System (INIS)

Tanabe, S.; Kawamoto, H.; Fujimaki, K.; Kobe, A.

1991-01-01

An effective and efficient technique has been developed for facilitating identification works of LWR spent fuel stored in large scale spent fuel storage pools of such as processing plants. Experience shows that there are often difficulties in the implementation of operator's nuclear material accountancy and control works as well as safeguards inspections conducted on spent fuel assemblies stored in deep water pool. This paper reports that the technique is realized as an automatic spent fuel ID number reader system installed on fuel handling machine. The ID number reader system consists of an optical sub-system and an image processing sub-system. Thousands of spent fuel assemblies stored in under water open racks in each storage pool could be identified within relatively short time (e.g. within several hours) by using this combination. Various performance tests were carried out on image processing sub-system in 1990 using TV images obtained from different types of spent fuel assemblies stored in various storage pools of PWR and BWR power stations

Cloning and shake flask expression of hrIDS- Like in Pichia pastoris ...

African Journals Online (AJOL)

The human Iduronate-2-sulfate sulfatase (hIDS-Like) was cloned into the methylotrophic yeast Pichia pastoris under the control of alcohol oxidase promoter (AOX1) and the -mating factor signal peptide (a-factor). Six clones were identified by PCR. Using clone IDS28, the enzyme was secreted into the culture medium, ...

Zircaloy cladding ID/OD oxidation studies. Final report

International Nuclear Information System (INIS)

Westerman, R.E.; Hesson, G.M.

1977-11-01

The ID/OD oxide ratio that forms on Zircaloy tubing at temperatures relevant to postulated LOCA conditions was measured as a function of time, temperature, and distance from the rupture. The average ratio at the rupture position was less than unity, and decreased with decreasing test time and increasing distance from the point of rupture. The maximum observed ID/OD oxide ratio was 1.4. Ratios in excess of unity were typically found to be a consequence of the OD oxide being thinner than would have been anticipated from the nominal test conditions. Confirmatory data were also obtained on the isothermal oxidation kinetics of Zircaloy. These data are in good agreement with those obtained by other investigators and confirm the conservative nature of the Baker-Just equation that is required for use in licensing calculations

RPD: Reusable Pseudo-Id Distribution for a Secure and Privacy Preserving VANET

Directory of Open Access Journals (Sweden)

Sulaiman Ashraph

2013-08-01

Full Text Available In any VANET, security and privacy are the two fundamental issues. Obtaining efficient security in vehicular communication is essential without compromising privacy-preserving mechanisms. Designing a suitable protocol for VANET by having these two issues in mind is challenging because efficiency, unlinkablity and traceability are the three qualities having contradictions between them. In this paper, we introduce an efficient Reusable Pseudo-id Distribution (RPD scheme. The Trusted Authority (TA designating the Road Side Units (RSUs to generate n reusable pseudo ids and distribute them to the On Board Units (OBUs on request characterizes the proposed protocol. RSUs issue the aggregated hashes of all its valid pseudo-ids along with a symmetric shared key and a particular pseudo-id to each vehicle that enters into its coverage range. Through this the certificates attached to the messages can be eliminated and thus resulting in a significantly reduced packet size. The same anonymous keys can then be re-distributed by the RSUs episodically to other vehicles. We analyze the proposed protocol extensively to demonstrate its merits and efficiency.

Demonstrating idAnimate : a multi-touch system for sketching and rapidly manipulating animations

NARCIS (Netherlands)

Quevedo Fernandez, Javier; Martens, J.B.O.S.

2012-01-01

This demonstration presents idAnimate, a multi-touch application for sketching animations. Thanks to the affordances provided by multitouch interfaces, idAnimate yields a novel, intuitive and easy to use animation technique named transformation-by-example, that allows users to author animations in

Análisis de la colaboración entre las empresas biotecnológicas españolas con actividades de I+D y el sistema público de I+D

Directory of Open Access Journals (Sweden)

García-Carpintero, Esther

2014-06-01

Full Text Available The development and improvement of cooperation between the industrial sector and the public R&D system can produce competitive advantages for the companies. The present work describes experiences and perceptions of Spanish biotechnology companies in their collaboration with the public R&D system. Results show that almost all the biotechnological companies with R&D activities (93.6% have cooperated with the public R&D system. The main barriers found by the companies are the excess of bureaucracy and the slow response of public researchers. Results obtained also suggest the need to establish public policies and programmes to promote knowledge and technology transfer from public research centres to companies, with a special focus on encouraging researchers from the public R&D system and on improving how Technology Transfer Offices work.El desarrollo y la mejora de la cooperación entre el sector productivo y el sistema público de I+D puede generar un conjunto de ventajas competitivas para estas empresas. El presente trabajo describe las experiencias y percepciones de las empresas biotecnológicas españolas en su colaboración con el sistema público de I+D. Los resultados muestran que prácticamente la totalidad de empresas biotecnológicas españolas con actividades de I+D (un 93,6% han mantenido algún tipo de colaboración con el sistema público de I+D. Los principales obstáculos percibidos por estas empresas en su colaboración con el sistema público de I+D son el exceso de burocracia y la respuesta lenta de los investigadores. Los resultados obtenidos sugieren la conveniencia de establecer políticas y programas públicos para fomentar la transferencia de conocimiento y tecnología desde el sistema público de I+D a las empresas, fundamentalmente centrados en la necesidad de incentivar a los investigadores del sistema público de I+D y mejorar el funcionamiento de las Oficinas de Transferencia de Tecnología.

TLR4 and TLR7/8 Adjuvant Combinations Generate Different Vaccine Antigen-Specific Immune Outcomes in Minipigs when Administered via the ID or IN Routes.

Directory of Open Access Journals (Sweden)

Paul F McKay

Full Text Available The induction of high levels of systemic and mucosal humoral immunity is a key goal for many prophylactic vaccines. However, adjuvant strategies developed in mice have often performed poorly in the clinic. Due to their closer similarity to humans, minipigs may provide a more accurate picture of adjuvant performance. Based on their complementary signalling pathways, we assessed humoral immune responses to model antigens after co-administration with the toll-like receptor 4 (TLR4 stimulator glucopyranosyl lipid adjuvant (GLA-AF or the TLR7/8 agonist resiquimod (R848 (alone and in combination via the intradermal (ID, intranasal (IN or combined routes in the Gottingen minipig animal model. Surprisingly, we discovered that while GLA-AF additively enhanced the adjuvant effect of R848 when injected ID, it abrogated the adjuvant activity of R848 after IN inoculation. We then performed a route comparison study using a CN54 gp140 HIV Envelope model antigen adjuvanted with R848 + GLA-AF (ID or R848 alone (IN. Animals receiving priming inoculations via one route were then boosted by the alternate route. Although differences were observed in the priming phase (IN or ID, responses converged upon boosting by the alternative route with no observable impact resultant from the order of administration (ID/IN vs IN/ID. Specific IgG responses were measured at a distal mucosal site (vaginal, although there was no evidence of mucosal linkage as these closely reflected serum antibody levels. These data indicate that the complex in vivo cross-talk between innate pathways are likely tissue specific and cannot be predicted by simple in vitro models.

Transfusion-transmitted hepatitis B virus (HBV) infection from an individual-donation nucleic acid (ID-NAT) non-reactive donor.

LENUS (Irish Health Repository)

O'Flaherty, N

2018-02-14

Lookback was initiated upon notification of an acute HBV infection in a repeat Irish donor, 108 days post-donation. The donation screened non-reactive by individual-donation nucleic acid testing (ID-NAT) using the Procleix Ultrio Elite multiplex assay and again when the archived sample was retested, but the discriminatory assay for HBV was reactive. The immunocompromised recipient of the implicated red cell component was tested 110 days post-transfusion, revealing a HBV DNA viral load of 470 IU\\/ml. Genotype C2 sequences identical across two regions of the HBV genome were found in samples from the donor and recipient.

Physical activity levels in adults with intellectual disabilities: A systematic review

Directory of Open Access Journals (Sweden)

Yetunde Marion Dairo

2016-12-01

Fifteen studies were included consisting of 3159 awID, aged 16–81 years, 54% male and 46% female. Only 9% of participants achieved minimum PA guidelines. PA levels were measured using objective and subjective methods. ID severity, living in care, gender, and age were independently significantly correlated with the number of participants achieving PA guidelines with the strongest predictor being ID severity (Beta 0.631, p < 0.001. Findings should be in the context that most of the participants were in the mild/moderate range of ID severity and none of the studies objectively measured PA in people with profound ID. To inform measurement and intervention design for improved PA, we recommend that there is an urgent need for future PA studies in awID population to include all disability severity levels. PROSPERO registration number CRD42015016675.

The paradox of IDs: an account of an ethnographic experience in the US

Directory of Open Access Journals (Sweden)

Mariza Peirano

2008-01-01

Full Text Available In the modern world, IDs are indispensable objects, without which we cannot prove that we are who we say we are. We need material substantiation that attests to the authenticity of our self-identification. This paper is an account of an ethnographic experience about IDs and identification processes in the US, based on the examination of two events in which Eliot Spitzer, the New York State governor from January 2007 to March 2008, was a central figure. A comparison with the Brazilian scenario is present throughout the paper, and it ends by focusing on the ID theft phenomenon.

Id2 reinforces TH1 cell differentiation and inhibits E2A to repress TFH cell differentiation

Science.gov (United States)

Shaw, Laura A.; Bélanger, Simon; Omilusik, Kyla D.; Cho, Sunglim; Scott-Browne, James P.; Nance, J. Philip; Goulding, John; Lasorella, Anna; Lu, Li-Fan; Crotty, Shane; Goldrath, Ananda W.

2016-01-01

Differentiation of T helper (TH) effector subsets is critical for host protection. E protein transcription factors and Id proteins are important arbiters of T cell development, but their role in differentiation of TH1 and TFH cells is not well understood. TH1 cells showed robust Id2 expression compared to TFH cells, and RNAi depletion of Id2 increased TFH cell frequencies. Further, TH1 cell differentiation was blocked by Id2 deficiency, leading to E protein-dependent accumulation of effector cells with mixed characteristics during viral infection and severely impaired generation of TH1 cells following Toxoplasma gondii infection. The TFH-defining transcriptional repressor Bcl6 bound the Id2 locus, providing a mechanism for the bimodal Id2 expression and reciprocal development of TH1 and TFH cell fates. PMID:27213691

Use of Whole-Genus Genome Sequence Data To Develop a Multilocus Sequence Typing Tool That Accurately Identifies Yersinia Isolates to the Species and Subspecies Levels

Science.gov (United States)

Hall, Miquette; Chattaway, Marie A.; Reuter, Sandra; Savin, Cyril; Strauch, Eckhard; Carniel, Elisabeth; Connor, Thomas; Van Damme, Inge; Rajakaruna, Lakshani; Rajendram, Dunstan; Jenkins, Claire; Thomson, Nicholas R.

2014-01-01

The genus Yersinia is a large and diverse bacterial genus consisting of human-pathogenic species, a fish-pathogenic species, and a large number of environmental species. Recently, the phylogenetic and population structure of the entire genus was elucidated through the genome sequence data of 241 strains encompassing every known species in the genus. Here we report the mining of this enormous data set to create a multilocus sequence typing-based scheme that can identify Yersinia strains to the species level to a level of resolution equal to that for whole-genome sequencing. Our assay is designed to be able to accurately subtype the important human-pathogenic species Yersinia enterocolitica to whole-genome resolution levels. We also report the validation of the scheme on 386 strains from reference laboratory collections across Europe. We propose that the scheme is an important molecular typing system to allow accurate and reproducible identification of Yersinia isolates to the species level, a process often inconsistent in nonspecialist laboratories. Additionally, our assay is the most phylogenetically informative typing scheme available for Y. enterocolitica. PMID:25339391

78 FR 773 - Hartford Financial Services Group, Inc., Commercial/Actuarial/Information Delivery Services (IDS...

Science.gov (United States)

2013-01-04

... Services Group, Inc., Commercial/Actuarial/ Information Delivery Services (IDS)/Corporate & Financial... Assistance (TAA) applicable to workers and former workers of Hartford Financial Services Group, Inc., Commercial/ Actuarial/Information Delivery Services (IDS)/Corporate & Financial Reporting group, Hartford...

Le traitement de l’idéologie dans la sociologie de Luc Boltanski

Directory of Open Access Journals (Sweden)

David Vrydaghs

2006-10-01

Full Text Available IntroductionLe concept d’idéologie apparaît dans la sociologie de Luc Boltanski à partir du Nouvel Esprit du capitalisme, publié en 1999. L’auteur y revient dans La Condition fœtale, paru en 2004. On aurait donc pu se contenter de ces ouvrages pour examiner le traitement réservé à l’idéologie dans la sociologie de Luc Boltanski. On préférera pourtant revenir aux travaux antérieurs du sociologue, et ce pour deux raisons.D’abord parce que le concept d’idéologie tel qu’il est employé dans Le Nou...

Suurnimed jäid müümata / Maria-Kristiina Soomre

Index Scriptorium Estoniae

Soomre, Maria-Kristiina, 1978-

2001-01-01

9. mai Christie' oksjonist, müümata jäänud Picasso, Degas', Cezanne'i tööd. 8. mai Sotheby oksjonist, kus edukalt müüdi töid S. J. Seegeri kogust, 3,85 miljoni dollari eest M. Beckmanni "Perseuse viimane katsumus". Sotheby kaasaegse kunsti oksjonil New Yorgis müüdi 5,6 miljoni dollari eest J. Koonsi skulptuur M. Jacksonist. Müümata jäid A. Warholi "Viis supipurki", A. Calderi 3 skulptuuri

Elimination of zero sequence circulating current between parallel operating three-level inverters

DEFF Research Database (Denmark)

Li, Kai; Wang, Xiaodong; Dong, Zhenhua

2016-01-01

In order to suppress the zero sequence circulating currents (ZSCCs) between parallel operating three level voltage source inverters with common AC and DC buses, a common mode voltage reduction PWM (CMVR-PWM) technique and neural point potentials (NPPs) control based method is proposed in this paper...

Evaluation of the iPLEX(®) Sample ID Plus Panel designed for the Sequenom MassARRAY(®) system. A SNP typing assay developed for human identification and sample tracking based on the SNPforID panel

DEFF Research Database (Denmark)

Johansen, P; Andersen, J D; Børsting, Claus

2013-01-01

on the peak height and the signal to noise data exported from the TYPER 4.0 software. With the forensic analysis parameters, all inconsistencies were eliminated in reactions with ≥10ng DNA. However, the average call rate decreased to 69.9%. The iPLEX(®) Sample ID Plus Panel was tested on 10 degraded samples......Sequenom launched the first commercial SNP typing kit for human identification, named the iPLEX(®) Sample ID Plus Panel. The kit amplifies 47 of the 52 SNPs in the SNPforID panel, amelogenin and two Y-chromosome SNPs in one multiplex PCR. The SNPs were analyzed by single base extension (SBE......) and Matrix Assisted Laser Desorption/Ionization-Time of Flight Mass Spectrometry (MALDI-TOF MS). In this study, we evaluated the accuracy and sensitivity of the iPLEX(®) Sample ID Plus Panel by comparing the typing results of the iPLEX(®) Sample ID Plus Panel with those obtained with our ISO 17025 accredited...

ACE Gene I/D Polymorphism and Obesity in 1,574 Patients with Type 2 Diabetes Mellitus.

Science.gov (United States)

Pan, Yan-Hong; Wang, Min; Huang, Yan-Mei; Wang, Ying-Hui; Chen, Yin-Ling; Geng, Li-Jun; Zhang, Xiao-Xi; Zhao, Hai-Lu

2016-01-01

Association between ACE gene I/D polymorphism and the risk of overweight/obesity remains controversial. We investigated the possible relationship between ACE gene I/D polymorphism and obesity in Chinese type 2 diabetes mellitus (T2DM) patients. In this study, obesity was defined as a body mass index (BMI) value ≥ 25 kg/m 2 and subjects were classified into 4 groups (lean, normal, overweight, and obese). PCR (polymerase chain reaction) was used to detect the ACE gene I/D polymorphism in T2DM patients. Metabolic measurements including blood glucose, lipid profile, and blood pressure were obtained. Frequencies of the ACE genotypes (DD, ID, and II) were not significant among the 4 groups of BMI-defined patients ( P = 0.679) while ACE II carriers showed higher systolic blood pressure (SBP) and pulse pressure (PP) (all P ACE gene I/D polymorphism with obesity is insignificant in Chinese patients with T2DM. SBP and PP might be higher in the ACE II carriers than in the DD and ID carriers.

Combination of electron beam irradiation and thermal treatment to enhance the shelf-life of traditional Indian fermented food (Idli)

International Nuclear Information System (INIS)

Mulmule, Manoj D.; Shimmy, Shankar M.; Bambole, Vaishali; Jamdar, Sahayog N.; Rawat, K.P.; Sarma, K.S.S.

2017-01-01

Idli, a steam-cooked breakfast food item consumed in India, is famous as a staple food for its spongy texture and unique fermented taste. Idli preparation is a time consuming process; although instant Idli pre-mixes as powder or batter are available in the market, they do not have the distinctive taste and aroma similar to the Idli prepared at home. Hence ready-to-eat (RTE) form of this food is in demand. Therefore, an attempt was made to prepare RTE Idli bearing similar taste as home-cooked Idli with an extended shelf-life of up to two months at an ambient temperature using Electron Beam Irradiation (EBI) at dosages 2.5 kGy, 5 kGy and 7.5 kGy and combination processing comprised of EBI dosage at 2.5 kGy and thermal treatment (80 °C for 20 min). The treated Idli's were microbiologically and sensorially evaluated at storage periods of zero day, 14 days, 30 days and 60 days. Idli's irradiated at 7.5 kGy and subjected to combination processing at 2.5 kGy and thermal treatment were shelf-stable for 60 days. 2.5 kGy and 5 kGy radiation dosages alone were not sufficient to preserve Idli samples for more than 14 days. Undesirable change in sensory properties of Idli was observed at an EBI dosage of 7.5 kGy. Sensory properties of combination processed Idli's were found to undergo minor change over the storage period. The present work suggests that lowest radiation dosage in combination with thermal treatment could be useful to achieve the extended shelf-life without considerably impairing the organoleptic quality of Ready-to-Eat Idli. - Highlights: • Idli (traditional Indian fermented food) was prepared in ready-to-eat (RTE) form. • Ready-to-eat Idli was then subjected to combination processing comprised of lowest irradiation dosage of 2.5 kGy with mild heat treatment to extend its shelf life. • Increase in hardness and decrease in brightness of combination processed Idli was observed. • Combination processed Idli was microbiologically safe and

Expression of Genes Related to Phenylpropanoid Biosynthesis in Different Organs of Ixeris dentata var. albiflora.

Science.gov (United States)

Lee, Sang-Hoon; Park, Yun-Ji; Park, Sang Un; Lee, Sang-Won; Kim, Seong-Cheol; Jung, Chan-Sik; Jang, Jae-Ki; Hur, Yoonkang; Kim, Yeon Bok

2017-05-30

Members of the genus Ixeris have long been used in traditional medicines as stomachics, sedatives, and diuretics. Phenylalanine ammonia-lyase (PAL), cinnamate-4-hydroxylase (C4H), 4-coumarate: coenzyme-A (CoA) ligase (4CL), chalcone synthase (CHS), and dihydroflavonol 4-reductase (DFR) are important enzymes in the phenylpropanoid pathway. In this study, we analyzed seven genes from Ixeris dentata var. albiflora that are involved in phenylpropanoid biosynthesis, using an Illumina/Solexa HiSeq 2000 platform. The amino acid sequence alignments for IdPAL s, IdC4H, Id4CL s, IdCHS , and IdDFR showed high identity to sequences from other plants. We also investigated transcript levels using quantitative real-time PCR, and analyzed the accumulation of phenylpropanoids in different organs of I. dentata var. albiflora using high-performance liquid chromatography. The transcript levels of IdC4H, Id4CL1 , IdCHS , and IdDFR were highest in the leaf. The catechin, chlorogenic acid, ferulic acid, and quercetin contents were also highest in the leaf. We suggest that expression of IdC4H, Id4CL1 , IdCHS , and IdDFR is associated with the accumulation of phenylpropanoids. Our results may provide baseline information for elucidating the mechanism of phenylpropanoid biosynthesis in different organs of I. dentata var. albiflora .

The Inventory of Depressive Symptomatology Self Report (IDS-SR: Psychometric properties of the Indonesian version.

Directory of Open Access Journals (Sweden)

Retha Arjadi

Full Text Available Depression screening and examination in Indonesia are highly challenging due to the disproportionately low number of mental health professionals in comparison to the Indonesian population. Self-report questionnaires on depression are cost-effective and time-efficient. The current study investigates the psychometric properties of the Indonesian Inventory of Depressive Symptomatology Self Report (IDS-SR.The participants were 904 Indonesians (aged 16-61; 50.2% female, recruited via an online survey using Qualtrics. Confirmatory factor analysis of the one-factor, three-factor, and four-factor model were explored. Convergent and divergent validity of the total score of the Indonesian IDS-SR and each factor were examined, as well as the Cronbach's Alpha reliability. In addition, an optimal cut-off score for the Indonesian IDS-SR was established using ROC curve analysis.The three-factor model of "cognitive/mood", "anxiety/arousal", and "sleep disturbance" was the best fit with the Indonesian IDS-SR data. Convergent and divergent validity were good. Cronbach's Alpha reliability was excellent for the total score, good for the factors "cognitive/mood" and "anxiety/arousal", but insufficient for the factor "sleep disturbance". The optimal cut-off score of the Indonesian IDS-SR was 14, with 87% sensitivity and 86% specificity.As a multifactorial instrument to measure depression that has good validity and reliability, the Indonesian IDS-SR can be used to assess depressive symptoms for the purpose of research and clinical practice. The optimal cut-off score of the Indonesian IDS-SR is in accordance with the internationally used cut-off score.

XLID-causing mutations and associated genes challenged in light of data from large-scale human exome sequencing.

Science.gov (United States)

Piton, Amélie; Redin, Claire; Mandel, Jean-Louis

2013-08-08

Because of the unbalanced sex ratio (1.3-1.4 to 1) observed in intellectual disability (ID) and the identification of large ID-affected families showing X-linked segregation, much attention has been focused on the genetics of X-linked ID (XLID). Mutations causing monogenic XLID have now been reported in over 100 genes, most of which are commonly included in XLID diagnostic gene panels. Nonetheless, the boundary between true mutations and rare non-disease-causing variants often remains elusive. The sequencing of a large number of control X chromosomes, required for avoiding false-positive results, was not systematically possible in the past. Such information is now available thanks to large-scale sequencing projects such as the National Heart, Lung, and Blood (NHLBI) Exome Sequencing Project, which provides variation information on 10,563 X chromosomes from the general population. We used this NHLBI cohort to systematically reassess the implication of 106 genes proposed to be involved in monogenic forms of XLID. We particularly question the implication in XLID of ten of them (AGTR2, MAGT1, ZNF674, SRPX2, ATP6AP2, ARHGEF6, NXF5, ZCCHC12, ZNF41, and ZNF81), in which truncating variants or previously published mutations are observed at a relatively high frequency within this cohort. We also highlight 15 other genes (CCDC22, CLIC2, CNKSR2, FRMPD4, HCFC1, IGBP1, KIAA2022, KLF8, MAOA, NAA10, NLGN3, RPL10, SHROOM4, ZDHHC15, and ZNF261) for which replication studies are warranted. We propose that similar reassessment of reported mutations (and genes) with the use of data from large-scale human exome sequencing would be relevant for a wide range of other genetic diseases. Copyright © 2013 The American Society of Human Genetics. Published by Elsevier Inc. All rights reserved.

Inhibitor of DNA binding 1 (Id1) induces differentiation and proliferation of mouse embryonic carcinoma P19CL6 cells

International Nuclear Information System (INIS)

Meng, Qingzhen; Jia, Zhuqing; Wang, Weiping; Li, Binhong; Ma, Kangtao; Zhou, Chunyan

2011-01-01

Highlights: → Id1 was upregulated during the cardiac differentiation process of P19CL6 cells. → Id1 upregulated expression of cardiac specific genes Gata4, α-MHC and ISL1. → Id1 promoted proliferation of P19CL6 cells. → Overexpression of Id1 increased activity of TOP flash. → Wnt3a or LiCl treatment promoted Id1 expression in P19CL6 cells. -- Abstract: The inhibitor of DNA binding (Id) family of genes encodes negative regulators of basic helix-loop-helix transcription factors and has been implicated in such diverse cellular processes as differentiation, proliferation, apoptosis and migration. Id knockout mouse embryos display multiple cardiac defects but the specific role of Id1 in cardiac differentiation is unclear. In the present study, we investigated the function of Id1 in DMSO-induced P19CL6 cells, a widely-accepted cell model of cardiac differentiation. We found that Id1 was upregulated during the cardiac differentiation of P19CL6 cells. The expression of cardiac specific marker genes, Gata4, α-MHC and ISL1, was upregulated in P19CL6 cells stably transfected with Id1 (P19CL6-Id1) during cardiac differentiation. The overexpression of Id1 reduced the number of cells in G1 phase and increased the cell population in G2, M and S phases, while knockdown of Id1 increased the number of cells in G1 phase from 48.6 ± 2.51% to 62.2 ± 1.52% at day 0 of cardiac induction, and from 52.5 ± 3.41% to 63.7 ± 1.02% at day 3 after cardiac induction, indicating that Id1 promoted proliferation of P19CL6 cells. Luciferase assays showed that the activity of TOP flash was higher in P19CL6-Id1 cells than wildtype P19CL6 cells, while Id1 expression was also upregulated in P19CL6 cells treated with Wnt3a or LiCl. This indicates that there may be positive feedback between Id1 and Wnt signaling which plays an important role in cardiac differentiation.

Identification of pathogenic gene variants in small families with intellectually disabled siblings by exome sequencing.

Science.gov (United States)

Schuurs-Hoeijmakers, Janneke H M; Vulto-van Silfhout, Anneke T; Vissers, Lisenka E L M; van de Vondervoort, Ilse I G M; van Bon, Bregje W M; de Ligt, Joep; Gilissen, Christian; Hehir-Kwa, Jayne Y; Neveling, Kornelia; del Rosario, Marisol; Hira, Gausiya; Reitano, Santina; Vitello, Aurelio; Failla, Pinella; Greco, Donatella; Fichera, Marco; Galesi, Ornella; Kleefstra, Tjitske; Greally, Marie T; Ockeloen, Charlotte W; Willemsen, Marjolein H; Bongers, Ernie M H F; Janssen, Irene M; Pfundt, Rolph; Veltman, Joris A; Romano, Corrado; Willemsen, Michèl A; van Bokhoven, Hans; Brunner, Han G; de Vries, Bert B A; de Brouwer, Arjan P M

2013-12-01

Intellectual disability (ID) is a common neurodevelopmental disorder affecting 1-3% of the general population. Mutations in more than 10% of all human genes are considered to be involved in this disorder, although the majority of these genes are still unknown. We investigated 19 small non-consanguineous families with two to five affected siblings in order to identify pathogenic gene variants in known, novel and potential ID candidate genes. Non-consanguineous families have been largely ignored in gene identification studies as small family size precludes prior mapping of the genetic defect. Using exome sequencing, we identified pathogenic mutations in three genes, DDHD2, SLC6A8, and SLC9A6, of which the latter two have previously been implicated in X-linked ID phenotypes. In addition, we identified potentially pathogenic mutations in BCORL1 on the X-chromosome and in MCM3AP, PTPRT, SYNE1, and ZNF528 on autosomes. We show that potentially pathogenic gene variants can be identified in small, non-consanguineous families with as few as two affected siblings, thus emphasising their value in the identification of syndromic and non-syndromic ID genes.

Effect of energy level sequences and neutron–proton interaction on α-particle preformation probability

International Nuclear Information System (INIS)

Ismail, M.; Adel, A.

2013-01-01

A realistic density-dependent nucleon–nucleon (NN) interaction with finite-range exchange part which produces the nuclear matter saturation curve and the energy dependence of the nucleon–nucleus optical model potential is used to calculate the preformation probability, S α , of α-decay from different isotones with neutron numbers N=124,126,128,130 and 132. We studied the variation of S α with the proton number, Z, for each isotone and found the effect of neutron and proton energy levels of parent nuclei on the behavior of the α-particle preformation probability. We found that S α increases regularly with the proton number when the proton pair in α-particle is emitted from the same level and the neutron level sequence is not changed during the Z-variation. In this case the neutron–proton (n–p) interaction of the two levels, contributing to emission process, is too small. On the contrary, if the proton or neutron level sequence is changed during the emission process, S α behaves irregularly, the irregular behavior increases if both proton and neutron levels are changed. This behavior is accompanied by change or rapid increase in the strength of n–p interaction

Enhancing privacy of users in eID schemes

NARCIS (Netherlands)

Shrishak, Kris; Erkin, Z.; Schaar, Remco

2016-01-01

In todays world transactions are increasingly being performed over the internetbut require identication of users as in face-to-face transactions. In order to facilitate eGovernance as well as other eCommerce services Electronic Identiation(eID) schemes, which intend to provide unique and reliable

Cenozoic global sea level, sequences, and the New Jersey transect: Results from coastal plain and continental slope drilling

Science.gov (United States)

Miller, K.G.; Mountain, Gregory S.; Browning, J.V.; Kominz, M.; Sugarman, P.J.; Christie-Blick, N.; Katz, M.E.; Wright, J.D.

1998-01-01

The New Jersey Sea Level Transect was designed to evaluate the relationships among global sea level (eustatic) change, unconformity-bounded sequences, and variations in subsidence, sediment supply, and climate on a passive continental margin. By sampling and dating Cenozoic strata from coastal plain and continental slope locations, we show that sequence boundaries correlate (within ??0.5 myr) regionally (onshore-offshore) and interregionally (New Jersey-Alabama-Bahamas), implicating a global cause. Sequence boundaries correlate with ??18O increases for at least the past 42 myr, consistent with an ice volume (glacioeustatic) control, although a causal relationship is not required because of uncertainties in ages and correlations. Evidence for a causal connection is provided by preliminary Miocene data from slope Site 904 that directly link ??18O increases with sequence boundaries. We conclude that variation in the size of ice sheets has been a primary control on the formation of sequence boundaries since ~42 Ma. We speculate that prior to this, the growth and decay of small ice sheets caused small-amplitude sea level changes (changes on mid-ocean ridges. Although our results are consistent with the general number and timing of Paleocene to middle Miocene sequences published by workers at Exxon Production Research Company, our estimates of sea level amplitudes are substantially lower than theirs. Lithofacies patterns within sequences follow repetitive, predictable patterns: (1) coastal plain sequences consist of basal transgressive sands overlain by regressive highstand silts and quartz sands; and (2) although slope lithofacies variations are subdued, reworked sediments constitute lowstand deposits, causing the strongest, most extensive seismic reflections. Despite a primary eustatic control on sequence boundaries, New Jersey sequences were also influenced by changes in tectonics, sediment supply, and climate. During the early to middle Eocene, low siliciclastic and

Combination of electron beam irradiation and thermal treatment to enhance the shelf-life of traditional Indian fermented food (Idli)

Science.gov (United States)

Mulmule, Manoj D.; Shimmy, Shankar M.; Bambole, Vaishali; Jamdar, Sahayog N.; Rawat, K. P.; Sarma, K. S. S.

2017-02-01

Idli, a steam-cooked breakfast food item consumed in India, is famous as a staple food for its spongy texture and unique fermented taste. Idli preparation is a time consuming process; although instant Idli pre-mixes as powder or batter are available in the market, they do not have the distinctive taste and aroma similar to the Idli prepared at home. Hence ready-to-eat (RTE) form of this food is in demand. Therefore, an attempt was made to prepare RTE Idli bearing similar taste as home-cooked Idli with an extended shelf-life of up to two months at an ambient temperature using Electron Beam Irradiation (EBI) at dosages 2.5 kGy, 5 kGy and 7.5 kGy and combination processing comprised of EBI dosage at 2.5 kGy and thermal treatment (80 °C for 20 min). The treated Idli's were microbiologically and sensorially evaluated at storage periods of zero day, 14 days, 30 days and 60 days. Idli's irradiated at 7.5 kGy and subjected to combination processing at 2.5 kGy and thermal treatment were shelf-stable for 60 days. 2.5 kGy and 5 kGy radiation dosages alone were not sufficient to preserve Idli samples for more than 14 days. Undesirable change in sensory properties of Idli was observed at an EBI dosage of 7.5 kGy. Sensory properties of combination processed Idli's were found to undergo minor change over the storage period. The present work suggests that lowest radiation dosage in combination with thermal treatment could be useful to achieve the extended shelf-life without considerably impairing the organoleptic quality of Ready-to-Eat Idli.

Cross-cultural adaptation, reliability, and validation of the Korean version of the identification functional ankle instability (IdFAI).

Science.gov (United States)

Ko, Jupil; Rosen, Adam B; Brown, Cathleen N

2017-09-12

To cross-culturally adapt the Identification Functional Ankle Instability for use with Korean-speaking participants. The English version of the IdFAI was cross-culturally adapted into Korean based on the guidelines. The psychometric properties in the Korean version of the IdFAI were measured for test-retest reliability, internal consistency, criterion-related validity, discriminative validity, and measurement error 181 native Korean-speakers. Intra-class correlation coefficients (ICC 2,1 ) between the English and Korean versions of the IdFAI for test-retest reliability was 0.98 (standard error of measurement = 1.41). The Cronbach's alpha coefficient was 0.89 for the Korean versions of IdFAI. The Korean versions of the IdFAI had a strong correlation with the SF-36 (r s  = -0.69, p 10 was the optimal cutoff score to distinguish between the group memberships. The minimally detectable change of the Korean versions of the IdFAI score was 3.91. The Korean versions of the IdFAI have shown to be an excellent, reliable, and valid instrument. The Korean versions of the IdFAI can be utilized to assess the presence of Chronic Ankle Instability by researchers and clinicians working among Korean-speaking populations. Implications for rehabilitation The high recurrence rate of sprains may result into Chronic Ankle Instability (CAI). The Identification of Functional Ankle Instability Tool (IdFAI) has been validated and recommended to identify patients with Chronic Ankle Instability (CAI). The Korean version of the Identification of Functional Ankle Instability Tool (IdFAI) may be also recommend to researchers and clinicians for assessing the presence of Chronic Ankle Instability (CAI) in Korean-speaking population.

SU-F-T-350: Continuous Leaf Optimization (CLO) for IMRT Leaf Sequencing

Energy Technology Data Exchange (ETDEWEB)

Long, T; Chen, M; Jiang, S; Lu, W [UT Southwestern Medical Center, Dallas, TX (United States)

2016-06-15

Purpose: To study a new step-and-shoot IMRT leaf sequencing model that avoids the two main pitfalls of conventional leaf sequencing: (1) target fluence being stratified into a fixed number of discrete levels and/or (2) aperture leaf positions being restricted to a discrete set of locations. These assumptions induce error into the sequence or reduce the feasible region of potential plans, respectively. Methods: We develop a one-dimensional (single leaf pair) methodology that does not make assumptions (1) or (2) that can be easily extended to a multi-row model. The proposed continuous leaf optimization (CLO) methodology takes in an existing set of apertures and associated intensities, or solution “seed,” and improves the plan without the restrictiveness of 1or (2). It then uses a first-order descent algorithm to converge onto a locally optimal solution. A seed solution can come from models that assume (1) and (2), thus allowing the CLO model to improve upon existing leaf sequencing methodologies. Results: The CLO model was applied to 208 generated target fluence maps in one dimension. In all cases for all tested sequencing strategies, the CLO model made improvements on the starting seed objective function. The CLO model also was able to keep MUs low. Conclusion: The CLO model can improve upon existing leaf sequencing methods by avoiding the restrictions of (1) and (2). By allowing for more flexible leaf positioning, error can be reduced when matching some target fluence. This study lays the foundation for future models and solution methodologies that can incorporate continuous leaf positions explicitly into the IMRT treatment planning model. Supported by Cancer Prevention & Research Institute of Texas (CPRIT) - ID RP150485.

ACE I/D sequence variants but not MTHFR C677T, is strongly linked to malignant glioma risk and its variant DD genotype may act as a promising predictive biomarker for overall survival of glioma patients.

Science.gov (United States)

Pandith, Arshad A; Qasim, Iqbal; Zahoor, Wani; Shah, Parveen; Bhat, Abdul R

2018-01-10

ACE I/D and MTHFR C677T gene polymorphisms can be seen as candidate genes for glioma on the basis of their biological functions and their involvement in different cancers. The aim of this study was to analyze potential association and overall survival between MTHFR C677T and ACE I/D polymorphism in glioma patients in our population. We tested genotype distribution of 112 glioma patients against 141 cancer-free controls from the same region. Kaplan-Meier survival analysis was performed to evaluate overall survival of patients for both genes. No significant differences were found among MTHFR C677T wild type C and variant genotypes CT/TT with glioma patients. In ACE, the distribution of variant ID and DD was found to be significantly higher in glioma cases as compared to controls (pACE DD genotypes were highly presented in glioma cases 26.8% versus 10.6% in controls (pACE DD genotypes had the least estimated overall survival of 13.4months in comparison to 21. 7 and 17.6months for ACE II and I/D genotypes respectively. We conclude ACE I/D polymorphism plays a vital role in predisposition of higher risk for glioma. We also suggest that ACE DD genotypes may act as an important predictive biomarker for overall survival of glioma patients. Copyright © 2017. Published by Elsevier B.V.

Screening of Lactobacillus plantarum isolated from fermented idli ...

African Journals Online (AJOL)

Probiotics are defined as live microorganisms which when administered in adequate amounts confer a health benefit on the host. The objective of this study was to screen eight potential probiotic Lactobacillus plantarum strains from fermented idli batter using in vitro assays such as bile tolerance, acid tolerance, transit ...

Knoto-ID: a tool to study the entanglement of open protein chains using the concept of knotoids.

Science.gov (United States)

Dorier, Julien; Goundaroulis, Dimos; Benedetti, Fabrizio; Stasiak, Andrzej

2018-05-02

The backbone of most proteins forms an open curve. To study their entanglement, a common strategy consists in searching for the presence of knots in their backbones using topological invariants. However, this approach requires to close the curve into a loop, which alters the geometry of curve. Knoto-ID allows evaluating the entanglement of open curves without the need to close them, using the recent concept of knotoids which is a generalization of the classical knot theory to open curves. Knoto-ID can analyse the global topology of the full chain as well as the local topology by exhaustively studying all subchains or only determining the knotted core. Knoto-ID permits to localize topologically non-trivial protein folds that are not detected by informatics tools detecting knotted protein folds. Knoto-ID is written in C ++ and includes R (www.R-project.org) scripts to generate plots of projections maps, fingerprint matrices and disk matrices. Knoto-ID is distributed under the GNU General Public License (GPL), version 2 or any later version and is available at https://github.com/sib-swiss/Knoto-ID. A binary distribution for Mac OS X, Linux and Windows with detailed user guide and examples can be obtained from https://www.vital-it.ch/software/Knoto-ID. julien.dorier@sib.swiss.

KONSEP MᾹQᾹṢID AL-SYᾹRĪAH MENURUT ṬᾹHᾹ JᾹBIR AL-‘ALWᾹNĪ

Directory of Open Access Journals (Sweden)

Chasnak Najidah

2017-03-01

Full Text Available One discourse which is receiving considerable attention from scholars of Islam is about the objectives of Islamic law (maqasid al-shari'ah. Taha Jabir al-'Alwānī as one reviewer of Maqasid al-shari'ah contemporary formulate the concept of maqasid al-shari'ah different from previous scholars. This article describes the concept of maqasid al-shari'ah by Taha Jabir al-'Alwānī. According to him, there are three levels of hierarchical of Maqasid al-Sharia. The highest value of maqasid al-shari'ah says is what he describes as al-Maqasid al-'ulyā al-Hakimah (intentions of the highest shari'ah and a legal basis, which consists of three main elements, namely al-Tawhid ( Onesess of God, al-Tazkiyah (purification and al-'umrān (prosperity. The position of the second al-shari'ah Maqasid are universal values such as justice, freedom, and equality. While the third position is the formulation of the previous scholars regarding maqasid al-shari'ah consisting of ḍarūriyyat, ḥājiyyāt, and taḥsīniyyāt. In terms of methodological, Taha Jabir al-'Alwānī basing the new system for Maqasid al-syarī'ahnya on the methods of al-jam'u Baina al-qirā'atain, a reading of the two entities: the revelation of God and the universe. With this basis, he argues that the maqasid al-shari'ah formulations are qaṭ'ī, so it can be a reference to the scholars in solving the problems of contemporary law.   [Salah satu diskursus yang mendapat perhatian cukup besar dari para akademisi Islam adalah seputar tujuan-tujuan hukum islam  (maqāṣid al-syarī'ah. Ṭāhā Jābir al-‘Alwānī sebagai salah satu ulama pengkaji maqāṣid asy-syarī’ahkontemporer merumuskan konsep maqāṣid asy-syarī’ahyang berbeda dari ulama sebelumnya. Artikel ini mendeskripsikan konsep maqāṣid asy-syarī’ahmenurut Ṭāhā Jābir al-‘Alwānī. Menurutnya, ada tiga tingkatan hierarkis maqāṣid al-syarī'ah. Nilai tertinggi maqāṣid asy-syarī’ahmenurutnya adalah apa

Fraudulent ID using face morphs: Experiments on human and automatic recognition.

Science.gov (United States)

Robertson, David J; Kramer, Robin S S; Burton, A Mike

2017-01-01

Matching unfamiliar faces is known to be difficult, and this can give an opportunity to those engaged in identity fraud. Here we examine a relatively new form of fraud, the use of photo-ID containing a graphical morph between two faces. Such a document may look sufficiently like two people to serve as ID for both. We present two experiments with human viewers, and a third with a smartphone face recognition system. In Experiment 1, viewers were asked to match pairs of faces, without being warned that one of the pair could be a morph. They very commonly accepted a morphed face as a match. However, in Experiment 2, following very short training on morph detection, their acceptance rate fell considerably. Nevertheless, there remained large individual differences in people's ability to detect a morph. In Experiment 3 we show that a smartphone makes errors at a similar rate to 'trained' human viewers-i.e. accepting a small number of morphs as genuine ID. We discuss these results in reference to the use of face photos for security.

IVisTMSA: Interactive Visual Tools for Multiple Sequence Alignments.

Science.gov (United States)

Pervez, Muhammad Tariq; Babar, Masroor Ellahi; Nadeem, Asif; Aslam, Naeem; Naveed, Nasir; Ahmad, Sarfraz; Muhammad, Shah; Qadri, Salman; Shahid, Muhammad; Hussain, Tanveer; Javed, Maryam

2015-01-01

IVisTMSA is a software package of seven graphical tools for multiple sequence alignments. MSApad is an editing and analysis tool. It can load 409% more data than Jalview, STRAP, CINEMA, and Base-by-Base. MSA comparator allows the user to visualize consistent and inconsistent regions of reference and test alignments of more than 21-MB size in less than 12 seconds. MSA comparator is 5,200% efficient and more than 40% efficient as compared to BALiBASE c program and FastSP, respectively. MSA reconstruction tool provides graphical user interfaces for four popular aligners and allows the user to load several sequence files at a time. FASTA generator converts seven formats of alignments of unlimited size into FASTA format in a few seconds. MSA ID calculator calculates identity matrix of more than 11,000 sequences with a sequence length of 2,696 base pairs in less than 100 seconds. Tree and Distance Matrix calculation tools generate phylogenetic tree and distance matrix, respectively, using neighbor joining% identity and BLOSUM 62 matrix.

Exploring the Link between ACE Insertion/Deletion (I/D Polymorphism and Uterine Leiomyomas

Directory of Open Access Journals (Sweden)

Shirin Shahbazi

2017-03-01

Full Text Available Introduction: Uterine leiomyomas arise from the proliferation of smooth muscle cells. ACE gene encodes a convertase enzyme mainly secreted in vascular endothelial cells which is involved in the renin–angiotensin system and blood pressure controlling. This gene has an insertion/deletion (I/D polymorphism correlates to serum and tissue ACE levels. The aim of this study is to elucidate the relationship between ACE gene variation and the development of myom. Methods: The samples of 55 uterine leiomyoma patients and 78 healthy women were studied. After obtaining informed consent, blood samples were collected and DNA extraction was performed by Salting-out method. Genotyping was performed using PCR reaction. The amplified products were two bands of 190 and 490 bp, which represents D allele and I allele, respectively. Statistical analysis was done using Chi-square test. Results: The D allele frequency was 0.55 in the patient group and 0.51 in the control group. The I allele frequencies in the two groups were 0.45 and 0.49, respectively. The results showed that taking the II genotype into account as reference genotype; homozygous DD individuals were at increased risk of uterine myoma (Odds ratio: 1.37. However, heterozygous ID showed a similar risk with the II genotype as the reference group. Conclusion: High blood pressure is significantly associated with uterine fibroids. It has been shown that atherosclerotic damage of uterine blood vessels and the inflammatory process caused by it may play an important role in the development of uterine myoma. This study indicates a positive relationship between the ACE (I/D polymorphism and the risk of uterine myoma. This finding is evidence of the important role of the renin–angiotensin system in the pathogenesis of myoma

Application of Sharī‘ah contracts in contemporary Islamic finance: A maqāṣid perspective

Directory of Open Access Journals (Sweden)

Younes Soualhi

2015-12-01

Full Text Available This research exposes the underlying maqāṣid embedded in Sharī‘ah contracts as applied in Islamic banking and finance. It addresses the problem of not observing maqāṣid in nominated and combined Sharī‘ah contracts as well as the problem of not sufficiently imbuing maqāṣid in products developed by Islamic financial institutions. As a benchmark of the maqāṣid of wealth, the research adopts Ibn ‘Āshūr’s classification of maqāṣid to evaluate the conformity of Sharī‘ah contracts to Maqāṣid al-Sharī‘ah namely, justice, circulation, transparency, and firmness. The study focuses on three markets related to the application of Sharī‘ah contracts, namely, banking, Islamic capital market, and takāful. The study concludes that, by and large, the application of Sharī‘ah contracts has observed Maqāṣid al-Sharī‘ah during its development and initial application stages of Islamic finance products; however, offering such products in the market has raised economic questions as to their viability and economic values. In addition, the malpractice of some Sharī‘ah contracts has long raised concerns as to the maqāṣid compliance of such products. The research recommends a de-sophistication of Islamic financial engineering to minimise the possibility of convergence with conventional finance. The research also emphasises product differentiation based on less complicated combined Sharī‘ah contracts.

ACE I/D polymorphism in Indian patients with hypertrophic cardiomyopathy and dilated cardiomyopathy

DEFF Research Database (Denmark)

Rai, Taranjit Singh; Dhandapany, Perundurai Subramaniam; Ahluwalia, Tarun Veer Singh

2008-01-01

The study was carried to determine the association of angiotensin converting enzyme (ACE) insertion/deletion (I/D) polymorphism with the risk of hypertrophic cardiomyopathy (HCM), dilated cardiomyopathy (DCM), and restrictive cardiomyopathy (RCM).......The study was carried to determine the association of angiotensin converting enzyme (ACE) insertion/deletion (I/D) polymorphism with the risk of hypertrophic cardiomyopathy (HCM), dilated cardiomyopathy (DCM), and restrictive cardiomyopathy (RCM)....

ID-1 mass storage system for mainframe by using FDDI network

International Nuclear Information System (INIS)

Morita, Y.; Fujii, H.; Inoue, E.; Kodama, H. Manabe, A.; Miyamoto, A.; Nomachi, M.; Watase, Y.; Yasu, Y.

1994-01-01

The authors have developed an ID-1 mass storage system as a distributed data server for Fujitsu mainframe computers. The system consists of a SONY ID-1 recorder DIR-1000, a tape robot system DMS-24 and a SCSI-II interface DFC-1500, which are connected to Spar Station 10 with an FDDI interface. The maximum speed of 7.5 Mbytes/sec is achieved for data transfer between Sparc Station 10 memory and DIR-1000 with a buffer size of 1 Mbytes. The system has been used successfully since last October to migrate more than 1 Tbytes data

Evaluation of the Micro-ID system for the identification of Yersinia pestis.

OpenAIRE

Harrison, D N; Williams, J E

1985-01-01

One hundred isolates of Yersinia pestis identified by conventional means were tested by the Micro-ID system to assess its reliability for distinguishing Y. pestis from other members of the family Enterobacteriaceae. The Micro-ID system gave Y. pestis as a choice for the identification of 89 of these cultures, although not always as the first choice. Most nitrate-negative strains of Y. pestis keyed out with Yersinia pseudotuberculosis as first choice and Y. pestis as second or fourth choice.

Id-1 gene and gene products as therapeutic targets for treatment of breast cancer and other types of carcinoma

Science.gov (United States)

Desprez, Pierre-Yves; Campisi, Judith

2014-08-19

A method for treatment of breast cancer and other types of cancer. The method comprises targeting and modulating Id-1 gene expression, if any, for the Id-1 gene, or gene products in breast or other epithelial cancers in a patient by delivering products that modulate Id-1 gene expression. When expressed, Id-1 gene is a prognostic indicator that cancer cells are invasive and metastatic.

Vitek 2 ANC card versus BBL Crystal Anaerobe and RapID ANA II for identification of clinical anaerobic bacteria.

Science.gov (United States)

Blairon, Laurent; Maza, Mengi L; Wybo, Ingrid; Piérard, Denis; Dediste, Anne; Vandenberg, Olivier

2010-08-01

The Vitek 2 Anaerobe and Corynebacterium Identification Card (ANC) was recently evaluated in a multicentre study. In the present work, this system was compared with the BBL Crystal Anaerobe and RapID ANA II panels. These kits were tested using 196 strains of anaerobes that had been previously identified by gas-liquid chromatography. Identification to the species or to the genus level was 75.0%, 81.1% and 70.9% for Crystal, RapID and Vitek, respectively. Vitek ANC failed to provide any identification in 20.4% of the strains, but it had fewer misidentifications than RapID. The confidence factors provided on the results report of each kit were not always correlated with a lower risk of major errors, with the exception of Vitek 2 in which a confidence factor higher than 0.86 excluded the risk of misidentification in more than 87% of isolates. The lower rate of identification by the Vitek and Crystal panels is mostly due the lower ability of these systems to identify the Clostridia. Overall, the three panels are comparable but need improvement to a better accuracy. Copyright (c) 2010 Elsevier Ltd. All rights reserved.

Evaluation of ACE gene I/D polymorphism in Iranian elite athletes.

Science.gov (United States)

Shahmoradi, Somayeh; Ahmadalipour, Ali; Salehi, Mansoor

2014-01-01

Angiotensin converting enzyme (ACE) is an important gene, which is associated with the successful physical activity. The ACE gene has a major polymorphism (I/D) in intron 16 that determines its plasma and tissue levels. In this study, we aimed to determine whether there is an association between this polymorphism and sports performance in our studied population including elite athletes of different sports disciplines. We investigated allele frequency and genotype distribution of the ACE gene in 156 Iranian elite athletes compared to 163 healthy individuals. We also investigated this allele frequency between elite athletes in three functional groups of endurance, power, and mixed sports performances. DNA was extracted from peripheral blood, and polymerase chain reaction (PCR) method was performed on intron 16 of the ACE gene. The ACE genotype was determined for each subject. Statistical analysis was performed by SPSS 15, and results were analyzed by Chi-Square test. There was a significant difference in genotype distribution and allele frequency of the ACE gene in athletes and control group (P = 0.05, P = 0.03, respectively). There was also a significant difference in allele frequency of the ACE gene in 3 groups of athletes with different sports disciplines (P = 0.045). Proportion of the ACE gene D allele was greater in elite endurance athletes (37 high-distance cyclists) than two other groups. Findings of the present study demonstrated that there is an association between the ACE gene I/D polymorphism and sports performance in Iranian elite athletes.

Pulmonary immunity and durable protection induced by the ID93/GLA-SE vaccine candidate against the hyper-virulent Korean Beijing Mycobacterium tuberculosis strain K.

Science.gov (United States)

Cha, Seung Bin; Kim, Woo Sik; Kim, Jong-Seok; Kim, Hongmin; Kwon, Kee Woong; Han, Seung Jung; Cho, Sang-Nae; Coler, Rhea N; Reed, Steven G; Shin, Sung Jae

2016-04-27

The majority of tuberculosis (TB) vaccine candidates advanced to clinical trials have been evaluated preclinically using laboratory-adapted strains. However, it has been proposed that challenge with clinical isolates in preclinical vaccine testing could provide further and more practical validation. Here, we tested the ID93/GLA-SE TB vaccine candidate against the clinical Mycobacterium tuberculosis (Mtb) strain K (Mtb K) belonging to the Beijing family, the most prevalent Mtb strain in South Korea. Mice immunized with ID93/GLA-SE exhibited a significant reduction in bacteria and reduced lung inflammation against Mtb K when compared to non-immunized controls. In addition, we analyzed the immune responses in the lungs of ID93/GLA-SE-immunized mice, and showed that ID93/GLA-SE was able to elicit sustained Th1-biased immune responses including antigen-specific multifunctional CD4(+) T cell co-producing IFN-γ, TNF-α, and IL-2 as well as a high magnitude of IFN-γ response for up to 10 weeks post-challenge. Notably, further investigation of T cell subsets in the lung following challenge showed remarkable generation of CD8(+) central memory T cells by ID93/GLA-SE-immunization. Our findings showed that ID93/GLA-SE vaccine confers a high level of robust protection against the hypervirulent Mtb Beijing infection which was characterized by pulmonary Th1-polarized T-cell immune responses. These findings may also provide relevant information for potential utility of this vaccine candidate in East-Asian countries where the Beijing genotype is highly prevalent. Copyright © 2016 Elsevier Ltd. All rights reserved.

Radikal konservativ idédebat og højreautoritær fascination i Danmark, ca. 1928-1940

DEFF Research Database (Denmark)

Holm, Adam

1999-01-01

Historie, Højreradikalisme, Konservatisme, Fascisme, Mellemkrigstid, Idéhistorie, Intellektuelle......Historie, Højreradikalisme, Konservatisme, Fascisme, Mellemkrigstid, Idéhistorie, Intellektuelle...

The ubiquitin ligase ASB4 promotes trophoblast differentiation through the degradation of ID2.

Directory of Open Access Journals (Sweden)

W H Davin Townley-Tilson

Full Text Available Vascularization of the placenta is a critical developmental process that ensures fetal viability. Although the vascular health of the placenta affects both maternal and fetal well being, relatively little is known about the early stages of placental vascular development. The ubiquitin ligase Ankyrin repeat, SOCS box-containing 4 (ASB4 promotes embryonic stem cell differentiation to vascular lineages and is highly expressed early in placental development. The transcriptional regulator Inhibitor of DNA binding 2 (ID2 negatively regulates vascular differentiation during development and is a target of many ubiquitin ligases. Due to their overlapping spatiotemporal expression pattern in the placenta and contrasting effects on vascular differentiation, we investigated whether ASB4 regulates ID2 through its ligase activity in the placenta and whether this activity mediates vascular differentiation. In mouse placentas, ASB4 expression is restricted to a subset of cells that express both stem cell and endothelial markers. Placentas that lack Asb4 display immature vascular patterning and retain expression of placental progenitor markers, including ID2 expression. Using JAR placental cells, we determined that ASB4 ubiquitinates and represses ID2 expression in a proteasome-dependent fashion. Expression of ASB4 in JAR cells and primary isolated trophoblast stem cells promotes the expression of differentiation markers. In functional endothelial co-culture assays, JAR cells ectopically expressing ASB4 increased endothelial cell turnover and stabilized endothelial tube formation, both of which are hallmarks of vascular differentiation within the placenta. Co-transfection of a degradation-resistant Id2 mutant with Asb4 inhibits both differentiation and functional responses. Lastly, deletion of Asb4 in mice induces a pathology that phenocopies human pre-eclampsia, including hypertension and proteinuria in late-stage pregnant females. These results indicate that

Group-ID based RFID Mutual Authentication

Directory of Open Access Journals (Sweden)

LEE, Y.

2013-11-01

Full Text Available For passive type RFID tags, EPCglobal Class 1 Generation-2 Revision is used widely as a de facto standard. As it was designed for low cost, it is quite vulnerable to security issues, such as privacy concerns. This paper presents a new RFID mutual authentication protocol, which is designed to be configured on EPC Gen2 platform and to meet various security requirements while providing efficiency using PRNG (Pseudo Random Number Generator. Group-ID is used to minimize the authentication time. Security analysis of the proposed protocol is discussed.

Angiotensin-converting enzyme I/D polymorphism in chronic obstructive pulmonary disease

Directory of Open Access Journals (Sweden)

Pabst S

2009-12-01

Full Text Available Abstract Study objective The etiology of chronic obstructive lung disease (COPD is unclear. It is supposed to be the product of an exogenous antigenic stimulus, such as tobacco smoke, and an endogenous genetic susceptibility. The angiotensin-converting enzyme (ACE gene contains a polymorphism based on the presence (insertion [I] or absence (deletion [D] of a 287-bp nonsense domain, resulting in three different genotypes (II, ID and DD. The aim of the study was to find out whether the ACE gene polymorphism can determine the course of COPD. Patients and design We genotyped 152 Caucasian patients with COPD and 158 healthy controls for the ACE (I/D polymorphism. We divided the COPD group into one group of 64 patients with a stable course of disease, defined as less than three hospitalizations over the last three years due to COPD, and another group of 88 patients with an instable course with more than three hospitalizations. Results The I-allele was significantly associated with an increased risk for COPD in a dominant model (OR 1.67 (95% CI 1.00 to 2.78, p = 0.048, but not in a recessive or co-dominant model. Moreover, the I-allele of ACE (I/D was significantly increased in patients with a stable course of COPD (p = 0.012 compared with controls. In a dominant model (II/ID v DD we found an even stronger association between the I-allele and a stable course of COPD (OR 3.24 (95% CI 1.44 to 7.31, p = 0.003. Conclusion These data suggest that the presence of an ACE I-allele determines a stable course of COPD.

Batf3 and Id2 have a synergistic effect on Irf8-directed classical CD8α+ dendritic cell development

KAUST Repository

Jaiswal, Hemant

2013-11-13

Dendritic cells (DCs) are heterogeneous cell populations represented by different subtypes, each varying in terms of gene expression patterns and specific functions. Recent studies identified transcription factors essential for the development of different DC subtypes, yet molecular mechanisms for the developmental program and functions remain poorly understood. In this study, we developed and characterized a mouse DC progenitor-like cell line, designated DC9, from Irf8-/- bone marrow cells as a model for DC development and function. Expression of Irf8 in DC9 cells led to plasmacytoid DCs and CD8α+ DC-like cells, with a concomitant increase in plasmacytoid DC- and CD8α+ DC-specific gene transcripts and induction of type I IFNs and IL12p40 following TLR ligand stimulation. Irf8 expression in DC9 cells led to an increase in Id2 and Batf3 transcript levels, transcription factors shown to be important for the development of CD8α+ DCs. We show that, without Irf8 , expression of Id2 and Batf3 was not sufficient for directing classical CD8α+ DC development. When coexpressed with Irf8, Batf3 and Id2 had a synergistic effect on classical CD8α+ DC development. We demonstrate that Irf8 is upstream of Batf3 and Id2 in the classical CD8α+ DC developmental program and define the hierarchical relationship of transcription factors important for classical CD8α+ DC development.

Angiotensin-I converting enzyme gene and I/D polymorphism ...

Indian Academy of Sciences (India)

Angiotensin-I converting enzyme gene and I/D polymorphism distribution in the Greek population and a comparison with other European populations. Sekerli Eleni Katsanidis Dimitrios Papadopoulou Vaya Makedou Areti Vavatsi Norma Gatzola Magdalini. Research Note Volume 87 Issue 1 April 2008 pp 91-93 ...

Angiotensin-converting enzyme gene I/D polymorphism in Pakistani ...

African Journals Online (AJOL)

hope&shola

two were the cases of antiphospholipid syndrome. Parsa et al. (2002) conducted an association of 3 polymor- phisms in angiotensin-converting enzyme including I/D polymorphism and 2 polymorphisms were associated with systemic lupus erythematosus and Lupus Nephritis among non-Caucasians that includes Hispanic, ...

Pätid võtsid varastatud ID-kaardiga kiirlaene / Põim Kama

Index Scriptorium Estoniae

Kama, Põim, 1985-

2008-01-01

ID-kaardi vargusega seotud pettusjuhtumist ning jaanuaris jõustunud rahapesu ja terrorismi rahastamise tõkestamise seaduse sättest, mis kohustab laenufirmasid esimese tehingu sooritamisel kliendiga silmast silma kohtuma. Lisatud: kiirlaenufirmad vilistavad seadusele

The helix-loop-helix protein id1 controls stem cell proliferation during regenerative neurogenesis in the adult zebrafish telencephalon.

Science.gov (United States)

Rodriguez Viales, Rebecca; Diotel, Nicolas; Ferg, Marco; Armant, Olivier; Eich, Julia; Alunni, Alessandro; März, Martin; Bally-Cuif, Laure; Rastegar, Sepand; Strähle, Uwe

2015-03-01

The teleost brain has the remarkable ability to generate new neurons and to repair injuries during adult life stages. Maintaining life-long neurogenesis requires careful management of neural stem cell pools. In a genome-wide expression screen for transcription regulators, the id1 gene, encoding a negative regulator of E-proteins, was found to be upregulated in response to injury. id1 expression was mapped to quiescent type I neural stem cells in the adult telencephalic stem cell niche. Gain and loss of id1 function in vivo demonstrated that Id1 promotes stem cell quiescence. The increased id1 expression observed in neural stem cells in response to injury appeared independent of inflammatory signals, suggesting multiple antagonistic pathways in the regulation of reactive neurogenesis. Together, we propose that Id1 acts to maintain the neural stem cell pool by counteracting neurogenesis-promoting signals. © 2014 AlphaMed Press.

Telomere length is associated with ACE I/D polymorphism in hypertensive patients with left ventricular hypertrophy

DEFF Research Database (Denmark)

Fyhrquist, Frej; Eriksson, Anders; Saijonmaa, Outi

2013-01-01

INTRODUCTION: Short telomeres are often associated with cardiovascular risk factors and age-related diseases, while the angiotensin converting enzyme (ACE) gene insertion/deletion polymorphism (DD, ID, II) has shown such associations less consistently. We hypothesized that telomere length...... and association of telomere length with cardiovascular risk is affected by ACE (I/D) genotype. METHODS: We measured leucocyte telomere length (LTL) by Southern blot and analysed ACE I/D genotypes in 1249 subjects with hypertension and left ventricular hypertrophy (LVH). We examined interactions of ACE I...

AcEST(EST sequences of Adiantum capillus-veneris and their annotation) - AcEST | LSDB Archive [Life Science Database Archive metadata

Lifescience Database Archive (English)

Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris

76 FR 46721 - Salmon-Challis National Forest, ID; Upper North Fork HFRA Ecosystem Restoration Project...

Science.gov (United States)

2011-08-03

...-Challis National Forest, ID; Upper North Fork HFRA Ecosystem Restoration Project Environmental Impact... improve the health of the ecosystem and reach the desired future condition. DATES: Comments concerning the... Ecosystem Restoration Project EIS, P.O. Box 180, 11 Casey Rd., North Fork, ID 83466. Comments may also be...

idSpace Tooling and Training for collaborative distributed product innovation

NARCIS (Netherlands)

Rutjens, Marjo; Bitter-Rijpkema, Marlies; Grube, Pascal; Heider, Thomas

2009-01-01

Rutjens, M., Bitter-Rijpkema, M., Grube, P. P., & Heider, T. (2009). idSpace Tooling and Training for collaborative distributed product innovation. Workshop during the e-Learning Baltic conference. June, 17-19, 2009, Rostock, Germany.

Id1 expression promotes peripheral CD4{sup +} T cell proliferation and survival upon TCR activation without co-stimulation

Energy Technology Data Exchange (ETDEWEB)

Liu, Chen; Jin, Rong [Department of Immunology, Peking University Health Science Center, Beijing (China); Wang, Hong-Cheng [Oklahoma Medical Research Foundation, Oklahoma City, OK (United States); Tang, Hui; Liu, Yuan-Feng; Qian, Xiao-Ping; Sun, Xiu-Yuan; Ge, Qing [Department of Immunology, Peking University Health Science Center, Beijing (China); Sun, Xiao-Hong, E-mail: sunx@omrf.org [Oklahoma Medical Research Foundation, Oklahoma City, OK (United States); Zhang, Yu, E-mail: zhangyu007@bjmu.edu.cn [Department of Immunology, Peking University Health Science Center, Beijing (China)

2013-06-21

Highlights: •Id1 expression enables naïve T cell proliferation without anti-CD28 co-stimulation. •Id1 expression facilitates T cells survival when stimulated with anti-CD3. •Elevation of IL-2 production by Id1 contributes increased proliferation and survival. •Id1 potentiates NF-κB activation by anti-CD3 stimulation. -- Abstract: Although the role of E proteins in the thymocyte development is well documented, much less is known about their function in peripheral T cells. Here we demonstrated that CD4 promoter-driven transgenic expression of Id1, a naturally occurring dominant-negative inhibitor of E proteins, can substitute for the co-stimulatory signal delivered by CD28 to facilitate the proliferation and survival of naïve CD4{sup +} cells upon anti-CD3 stimulation. We next discovered that IL-2 production and NF-κB activity after anti-CD3 stimulation were significantly elevated in Id1-expressing cells, which may be, at least in part, responsible for the augmentation of their proliferation and survival. Taken together, results from this study suggest an important role of E and Id proteins in peripheral T cell activation. The ability of Id proteins to by-pass co-stimulatory signals to enable T cell activation has significant implications in regulating T cell immunity.

Exploring Sequence Characteristics Related to High- Level Production of Secreted Proteins in Aspergillus niger

NARCIS (Netherlands)

Van den Berg, B.A.; Reinders, M.J.T.; Hulsman, M.; Wu, L.; Pel, H.J.; Roubos, J.A.; De Ridder, D.

2012-01-01

Protein sequence features are explored in relation to the production of over-expressed extracellular proteins by fungi. Knowledge on features influencing protein production and secretion could be employed to improve enzyme production levels in industrial bioprocesses via protein engineering. A large

Revocable ID-Based Signature with Short Size over Lattices

Directory of Open Access Journals (Sweden)

Ying-Hao Hung

2017-01-01

Full Text Available In the past, many ID-based signature (IBS schemes based on the integer factorization or discrete logarithm problems were proposed. With the progress on the development of quantum technology, IBS schemes mentioned above would become vulnerable. Recently, several IBS schemes over lattices were proposed to be secure against attacks in the quantum era. As conventional public-key settings, ID-based public-key settings have to offer a revocation mechanism to revoke misbehaving or malicious users. However, in the past, little work focuses on the revocation problem in the IBS schemes over lattices. In this article, we propose a new revocable IBS (RIBS scheme with short size over lattices. Based on the short integer solution (SIS assumption, we prove that the proposed RIBS scheme provides existential unforgeability against adaptive chosen-message attacks. As compared to the existing IBS schemes over lattices, our RIBS scheme has better performance in terms of signature size, signing key size, and the revocation mechanism with public channels.

Assessment of the relationship between ACE I/D gene polymorphism and renal allograft survival.

Science.gov (United States)

Yang, Chun-Hua; Lu, Yi; Chen, Xue-Xia; Xian, Wen-Feng; Tu, Wei-Feng; Li, Hong-Yan

2015-12-01

The relationship between the angiotensin-converting enzyme (ACE) insertion/deletion (I/D) gene polymorphism and renal allograft survival after renal transplantation from the published reports are still debatable. This study was performed to evaluate the relationship between the ACE I/D gene polymorphism and renal allograft survival after renal transplantation using meta-analysis. Eligible studies were identified from PubMed and Cochrane Library on 1 November 2014, and eligible studies were recruited and synthesized using a meta-analysis methodology. Twelve investigations were included in this meta-analysis for the assessment of the relationship between the ACE I/D gene polymorphism and renal allograft survival. In this meta-analysis, the ACE I/D gene polymorphism was not associated with renal allograft survival after renal transplantation for overall populations, Caucasians, Brazilians and Africans. Interestingly, the ACE D allele and DD genotype were associated with renal allograft survival after renal transplantation in the Asian population. ACE D allele and DD genotype were associated with renal allograft survival after renal transplantation in the Asian population. However, more studies should be performed to confirm this association. © The Author(s) 2015.

Identification of clinical yeasts by Vitek MS system compared with API ID 32 C.

Science.gov (United States)

Durán-Valle, M Teresa; Sanz-Rodríguez, Nuria; Muñoz-Paraíso, Carmen; Almagro-Moltó, María; Gómez-Garcés, José Luis

2014-05-01

We performed a clinical evaluation of the Vitek MS matrix-assisted laser desorption ionization-time-of-flight mass spectrometry (MALDI-TOF MS) system with the commercial database version 2.0 for rapid identification of medically important yeasts as compared with the conventional phenotypic method API ID 32 C. We tested 161 clinical isolates, nine isolates from culture collections and five reference strains. In case of discrepant results or no identification with one or both methods, molecular identification techniques were employed. Concordance between both methods was observed with 160/175 isolates (91.42%) and misidentifications by both systems occurred only when taxa were not included in the respective databases, i.e., one isolate of Candida etchellsii was identified as C. globosa by Vitek MS and two isolates of C. orthopsilosis were identified as C. parapsilosis by API ID 32 C. Vitek MS could not identify nine strains (5.14%) and API ID 32 C did not identify 13 (7.42%). Vitek MS was more reliable than API ID 32 C and reduced the time required for the identification of clinical isolates to only a few minutes.

Ubiquitin-SUMO Circuitry Controls Activated Fanconi Anemia ID Complex Dosage in Response to DNA Damage

DEFF Research Database (Denmark)

Gibbs-Seymour, Ian; Oka, Yasuyoshi; Rajendra, Eeson

2015-01-01

We show that central components of the Fanconi anemia (FA) DNA repair pathway, the tumor suppressor proteins FANCI and FANCD2 (the ID complex), are SUMOylated in response to replication fork stalling. The ID complex is SUMOylated in a manner that depends on the ATR kinase, the FA ubiquitin ligase...

Quantitative X-ray fluorescence analysis at the ESRF ID18F microprobe

CERN Document Server

Vekemans, B; Somogyi, A; Drakopoulos, M; Kempenaers, L; Simionovici, A; Adams, F

2003-01-01

The new ID18F end-station at the European synchrotron radiation facility (ESRF) in Grenoble (France) is dedicated to sensitive and accurate quantitative micro-X-ray fluorescence (XRF) analysis at the ppm level with accuracy better than 10% for elements with atomic numbers above 18. For accurate quantitative analysis, given a high level of instrumental stability, major steps are the extraction and conversion of experimental X-ray line intensities into elemental concentrations. For this purpose a two-step quantification approach was adopted. In the first step, the collected XRF spectra are deconvoluted on the basis of a non-linear least-squares fitting algorithm (AXIL). The extracted characteristic line intensities are then used as input for a detailed Monte Carlo (MC) simulation code dedicated to XRF spectroscopy taking into account specific experimental conditions (excitation/detection) as well as sample characteristics (absorption and enhancement effects, sample topology, heterogeneity etc.). The iterative u...

Classification of video sequences into chosen generalized use classes of target size and lighting level.

Science.gov (United States)

Leszczuk, Mikołaj; Dudek, Łukasz; Witkowski, Marcin

The VQiPS (Video Quality in Public Safety) Working Group, supported by the U.S. Department of Homeland Security, has been developing a user guide for public safety video applications. According to VQiPS, five parameters have particular importance influencing the ability to achieve a recognition task. They are: usage time-frame, discrimination level, target size, lighting level, and level of motion. These parameters form what are referred to as Generalized Use Classes (GUCs). The aim of our research was to develop algorithms that would automatically assist classification of input sequences into one of the GUCs. Target size and lighting level parameters were approached. The experiment described reveals the experts' ambiguity and hesitation during the manual target size determination process. However, the automatic methods developed for target size classification make it possible to determine GUC parameters with 70 % compliance to the end-users' opinion. Lighting levels of the entire sequence can be classified with an efficiency reaching 93 %. To make the algorithms available for use, a test application has been developed. It is able to process video files and display classification results, the user interface being very simple and requiring only minimal user interaction.

Phylum-Level Conservation of Regulatory Information in Nematodes despite Extensive Non-coding Sequence Divergence

Science.gov (United States)

Gordon, Kacy L.; Arthur, Robert K.; Ruvinsky, Ilya

2015-01-01

Gene regulatory information guides development and shapes the course of evolution. To test conservation of gene regulation within the phylum Nematoda, we compared the functions of putative cis-regulatory sequences of four sets of orthologs (unc-47, unc-25, mec-3 and elt-2) from distantly-related nematode species. These species, Caenorhabditis elegans, its congeneric C. briggsae, and three parasitic species Meloidogyne hapla, Brugia malayi, and Trichinella spiralis, represent four of the five major clades in the phylum Nematoda. Despite the great phylogenetic distances sampled and the extensive sequence divergence of nematode genomes, all but one of the regulatory elements we tested are able to drive at least a subset of the expected gene expression patterns. We show that functionally conserved cis-regulatory elements have no more extended sequence similarity to their C. elegans orthologs than would be expected by chance, but they do harbor motifs that are important for proper expression of the C. elegans genes. These motifs are too short to be distinguished from the background level of sequence similarity, and while identical in sequence they are not conserved in orientation or position. Functional tests reveal that some of these motifs contribute to proper expression. Our results suggest that conserved regulatory circuitry can persist despite considerable turnover within cis elements. PMID:26020930

Phylum-Level Conservation of Regulatory Information in Nematodes despite Extensive Non-coding Sequence Divergence.

Directory of Open Access Journals (Sweden)

Kacy L Gordon

2015-05-01

Full Text Available Gene regulatory information guides development and shapes the course of evolution. To test conservation of gene regulation within the phylum Nematoda, we compared the functions of putative cis-regulatory sequences of four sets of orthologs (unc-47, unc-25, mec-3 and elt-2 from distantly-related nematode species. These species, Caenorhabditis elegans, its congeneric C. briggsae, and three parasitic species Meloidogyne hapla, Brugia malayi, and Trichinella spiralis, represent four of the five major clades in the phylum Nematoda. Despite the great phylogenetic distances sampled and the extensive sequence divergence of nematode genomes, all but one of the regulatory elements we tested are able to drive at least a subset of the expected gene expression patterns. We show that functionally conserved cis-regulatory elements have no more extended sequence similarity to their C. elegans orthologs than would be expected by chance, but they do harbor motifs that are important for proper expression of the C. elegans genes. These motifs are too short to be distinguished from the background level of sequence similarity, and while identical in sequence they are not conserved in orientation or position. Functional tests reveal that some of these motifs contribute to proper expression. Our results suggest that conserved regulatory circuitry can persist despite considerable turnover within cis elements.

Sequencing of sporadic Attention-Deficit Hyperactivity Disorder (ADHD) identifies novel and potentially pathogenic de novo variants and excludes overlap with genes associated with autism spectrum disorder.

Science.gov (United States)

Kim, Daniel Seung; Burt, Amber A; Ranchalis, Jane E; Wilmot, Beth; Smith, Joshua D; Patterson, Karynne E; Coe, Bradley P; Li, Yatong K; Bamshad, Michael J; Nikolas, Molly; Eichler, Evan E; Swanson, James M; Nigg, Joel T; Nickerson, Deborah A; Jarvik, Gail P

2017-06-01

Attention-Deficit Hyperactivity Disorder (ADHD) has high heritability; however, studies of common variation account for ADHD variance. Using data from affected participants without a family history of ADHD, we sought to identify de novo variants that could account for sporadic ADHD. Considering a total of 128 families, two analyses were conducted in parallel: first, in 11 unaffected parent/affected proband trios (or quads with the addition of an unaffected sibling) we completed exome sequencing. Six de novo missense variants at highly conserved bases were identified and validated from four of the 11 families: the brain-expressed genes TBC1D9, DAGLA, QARS, CSMD2, TRPM2, and WDR83. Separately, in 117 unrelated probands with sporadic ADHD, we sequenced a panel of 26 genes implicated in intellectual disability (ID) and autism spectrum disorder (ASD) to evaluate whether variation in ASD/ID-associated genes were also present in participants with ADHD. Only one putative deleterious variant (Gln600STOP) in CHD1L was identified; this was found in a single proband. Notably, no other nonsense, splice, frameshift, or highly conserved missense variants in the 26 gene panel were identified and validated. These data suggest that de novo variant analysis in families with independently adjudicated sporadic ADHD diagnosis can identify novel genes implicated in ADHD pathogenesis. Moreover, that only one of the 128 cases (0.8%, 11 exome, and 117 MIP sequenced participants) had putative deleterious variants within our data in 26 genes related to ID and ASD suggests significant independence in the genetic pathogenesis of ADHD as compared to ASD and ID phenotypes. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

The Danish eID Case: Twenty years of Delay

DEFF Research Database (Denmark)

Hoff, Jens Villiam; Hoff, Frederik Villiam

2010-01-01

the technological, organizational and legal dimensions of eID in Denmark, and comparing these with a number of other European countries made it possible to explain this paradox. Thus, the three main reasons for the special route development has taken in Denmark seems to be concerns over privacy, lack...

Problematika Pendidikan Islam Perspektif Maqâṣid Sharîʻah

Directory of Open Access Journals (Sweden)

Rosidin Rosidin

2016-11-01

Full Text Available The article seeks to reveal problems faced by Islamic education from the perspective of Maqâṣid al-Sharîʻah, namely ideological (h}ifẓ al-dîn, practical (h}ifẓ al-nafs, academic (h}ifẓ al-‘aql, relationships or networks (h}ifẓ al-nasl, vocational (h}ifẓ al-mâl and quality (h}ifẓ al-‘irḍ aspects. In order to know the details of crucial problems of the Islamic education along with their alternative solutions, this paper suggests that the Islamic education should consider the insider’s and outsider’s perspective which has four types of roles as follow: a complete observer; b observer as participant; c participant as observer; d complete participant. This article proposes three important implications, are: first, the problems of the Islamic education can be categorized and mapped based on Maqâṣid al-Sharîʻah, in order to ease the analysis of such problems. Second, the analysis of the problems should be based on the insiders’ and outsiders’ point of views, so that it would be able to comprehensively detect the problems of Islamic education and show the inclusiveness of the Islamic education. Third, problem solving alternatives should be oriented at the level of theological (faith and religious [îmân], theoretical (philosophical and empirical [‘ilm], practical (learning and teaching [‘amal] and moral (ethics and aesthetics [akhlâq] realms.

Time-and-ID-Based Proxy Reencryption Scheme

OpenAIRE

Mtonga, Kambombo; Paul, Anand; Rho, Seungmin

2014-01-01

Time- and ID-based proxy reencryption scheme is proposed in this paper in which a type-based proxy reencryption enables the delegator to implement fine-grained policies with one key pair without any additional trust on the proxy. However, in some applications, the time within which the data was sampled or collected is very critical. In such applications, for example, healthcare and criminal investigations, the delegatee may be interested in only some of the messages with some types sampled wi...

Sequencing learning experiences to engage different level learners in the workplace: An interview study with excellent clinical teachers.

Science.gov (United States)

Chen, H Carrie; O'Sullivan, Patricia; Teherani, Arianne; Fogh, Shannon; Kobashi, Brent; ten Cate, Olle

2015-01-01

Learning in the clinical workplace can appear to rely on opportunistic teaching. The cognitive apprenticeship model describes assigning tasks based on learner rather than just workplace needs. This study aimed to determine how excellent clinical teachers select clinical learning experiences to support the workplace participation and development of different level learners. Using a constructivist grounded theory approach, we conducted semi-structured interviews with medical school faculty identified as excellent clinical teachers teaching multiple levels of learners. We explored their approach to teach different level learners and their perceived role in promoting learner development. We performed thematic analysis of the interview transcripts using open and axial coding. We interviewed 19 clinical teachers and identified three themes related to their teaching approach: sequencing of learning experiences, selection of learning activities and teacher responsibilities. All teachers used sequencing as a teaching strategy by varying content, complexity and expectations by learner level. The teachers initially selected learning activities based on learner level and adjusted for individual competencies over time. They identified teacher responsibilities for learner education and patient safety, and used sequencing to promote both. Excellent clinical teachers described strategies for matching available learning opportunities to learners' developmental levels to safely engage learners and improve learning in the clinical workplace.

77 FR 55800 - Foreign-Trade Zone 242-Boundary County, ID; Application for Subzone AREVA Enrichment Services...

Science.gov (United States)

2012-09-11

... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [B-68-2012] Foreign-Trade Zone 242--Boundary County, ID; Application for Subzone AREVA Enrichment Services, LLC; Bonneville County, ID An application... FTZ 242, requesting special-purpose subzone status for the facility of AREVA Enrichment Services, LLC...

Causes of Mortality in Older People with Intellectual Disability: Results from the HA-ID Study

Science.gov (United States)

Oppewal, Alyt; Schoufour, Josje D.; van der Maarl, Hanne J. K.; Evenhuis, Heleen M.; Hilgenkamp, Thessa I. M.; Festen, Dederieke A.

2018-01-01

We aim to provide insight into the cause-specific mortality of older adults with intellectual disability (ID), with and without Down syndrome (DS), and compare this to the general population. Immediate and primary cause of death were collected through medical files of 1,050 older adults with ID, 5 years after the start of the Healthy Ageing and…

The Mathematica package TopoID and its application to the Higgs boson production cross section

Energy Technology Data Exchange (ETDEWEB)

Hoff, Jens

2016-07-15

We present the Mathematica package TopoID which aims at the automation of several steps in multiloop calculations. The algorithm which lies at the very core of the package is described and illustrated with an example. The main features of TopoID are stated and some of them are briefly demonstrated for NLO or NNLO Higgs boson production.

Insights into bacterioplankton community structure from Sundarbans mangrove ecoregion using Sanger and Illumina MiSeq sequencing approaches: A comparative analysis

Directory of Open Access Journals (Sweden)

Anwesha Ghosh

2017-03-01

Full Text Available Next generation sequencing using platforms such as Illumina MiSeq provides a deeper insight into the structure and function of bacterioplankton communities in coastal ecosystems compared to traditional molecular techniques such as clone library approach which incorporates Sanger sequencing. In this study, structure of bacterioplankton communities was investigated from two stations of Sundarbans mangrove ecoregion using both Sanger and Illumina MiSeq sequencing approaches. The Illumina MiSeq data is available under the BioProject ID PRJNA35180 and Sanger sequencing data under accession numbers KX014101-KX014140 (Stn1 and KX014372-KX014410 (Stn3. Proteobacteria-, Firmicutes- and Bacteroidetes-like sequences retrieved from both approaches appeared to be abundant in the studied ecosystem. The Illumina MiSeq data (2.1 GB provided a deeper insight into the structure of bacterioplankton communities and revealed the presence of bacterial phyla such as Actinobacteria, Cyanobacteria, Tenericutes, Verrucomicrobia which were not recovered based on Sanger sequencing. A comparative analysis of bacterioplankton communities from both stations highlighted the presence of genera that appear in both stations and genera that occur exclusively in either station. However, both the Sanger sequencing and Illumina MiSeq data were coherent at broader taxonomic levels. Pseudomonas, Devosia, Hyphomonas and Erythrobacter-like sequences were the abundant bacterial genera found in the studied ecosystem. Both the sequencing methods showed broad coherence although as expected the Illumina MiSeq data helped identify rarer bacterioplankton groups and also showed the presence of unassigned OTUs indicating possible presence of novel bacterioplankton from the studied mangrove ecosystem.

Attachment quality of children with ID and its link to maternal sensitivity and structuring.

Science.gov (United States)

Feniger-Schaal, Rinat; Joels, Tirtsa

2018-05-01

Attachment theory produced a fertile field of research and clinical application. Although the topic of attachment of children with intellectual disability (ID) has received increasing research attention over the past 15 years, the empirical evidence is still limited. We applied theoretical and empirical knowledge of parenting typically developing children to examine the mother-child relationship in the ID population. The aim was to examine maternal sensitivity and structuring and its association with children's attachment classification and their disability. Forty preschool children (mean age 47.25, range 26-75 months) with non-specific ID and their mothers participated in the study. The mean developmental age was 25.92 months (SD = 10.89), The DQ mean score was 55.45 (SD = 17.28). We assessed children's quality of attachment using the SSP and maternal interactive behavior using the Emotional Availability Scales. Forty percent of children showed secure attachment, and 32.5% showed disorganized attachment. Attachment classifications correlated significantly with maternal sensitivity and maternal structuring but not with the child's cognitive disability. The results point to the importance of maternal interactive behavior for children with ID. Clinical implication may consider interventions aiming to enhance maternal sensitivity and structuring to improve children's quality of attachment. Copyright © 2018 Elsevier Ltd. All rights reserved.

DD Genotype of ACE I/D Polymorphism Might Confer Protection against Dental Caries in Polish Children.

Science.gov (United States)

Olszowski, Tomasz; Adler, Grażyna; Janiszewska-Olszowska, Joanna; Safranow, Krzysztof; Chlubek, Dariusz

2015-01-01

The aim of the study was to examine the frequencies of the genotypes and alleles of ACE insertion/deletion (I/D) polymorphism and their association with dental caries in a sample of Polish children. The study subjects were 120 children with dental caries experience (cases) and 41 caries-free individuals (controls). The genotyping was performed using polymerase chain reaction. The genotype distributions of ACE I/D polymorphism were not statistically different between carious and control children. However, we found a borderline overrepresentation of the II + ID genotypes versus the DD genotype in the carious compared to the control group (69.2% and 51.2%, respectively, p = 0.057). Logistic regression analysis adjusted for age and sex revealed that I allele carriage was a significant predictor of dental caries susceptibility (OR = 2.14, 95% CI = 1.02-4.49, p = 0.041). In conclusion, the DD genotype of ACE I/D polymorphism might be protective against dental caries in Polish children. © 2015 S. Karger AG, Basel.

Quantitative X-ray fluorescence analysis at the ESRF ID18F microprobe

International Nuclear Information System (INIS)

Vekemans, B.; Vincze, L.; Somogyi, A.; Drakopoulos, M.; Kempenaers, L.; Simionovici, A.; Adams, F.

2003-01-01

The new ID18F end-station at the European synchrotron radiation facility (ESRF) in Grenoble (France) is dedicated to sensitive and accurate quantitative micro-X-ray fluorescence (XRF) analysis at the ppm level with accuracy better than 10% for elements with atomic numbers above 18. For accurate quantitative analysis, given a high level of instrumental stability, major steps are the extraction and conversion of experimental X-ray line intensities into elemental concentrations. For this purpose a two-step quantification approach was adopted. In the first step, the collected XRF spectra are deconvoluted on the basis of a non-linear least-squares fitting algorithm (AXIL). The extracted characteristic line intensities are then used as input for a detailed Monte Carlo (MC) simulation code dedicated to XRF spectroscopy taking into account specific experimental conditions (excitation/detection) as well as sample characteristics (absorption and enhancement effects, sample topology, heterogeneity etc.). The iterative use of the MC code gives a 'no-compromise' solution for the quantification problem

Quantitative X-ray fluorescence analysis at the ESRF ID18F microprobe

Energy Technology Data Exchange (ETDEWEB)

Vekemans, B. E-mail: vekemans@uia.ua.ac.be; Vincze, L.; Somogyi, A.; Drakopoulos, M.; Kempenaers, L.; Simionovici, A.; Adams, F

2003-01-01

The new ID18F end-station at the European synchrotron radiation facility (ESRF) in Grenoble (France) is dedicated to sensitive and accurate quantitative micro-X-ray fluorescence (XRF) analysis at the ppm level with accuracy better than 10% for elements with atomic numbers above 18. For accurate quantitative analysis, given a high level of instrumental stability, major steps are the extraction and conversion of experimental X-ray line intensities into elemental concentrations. For this purpose a two-step quantification approach was adopted. In the first step, the collected XRF spectra are deconvoluted on the basis of a non-linear least-squares fitting algorithm (AXIL). The extracted characteristic line intensities are then used as input for a detailed Monte Carlo (MC) simulation code dedicated to XRF spectroscopy taking into account specific experimental conditions (excitation/detection) as well as sample characteristics (absorption and enhancement effects, sample topology, heterogeneity etc.). The iterative use of the MC code gives a 'no-compromise' solution for the quantification problem.

A Plan to Optimize the Management of Weld ID SSN Numbering System for Nuclear Power Plants in Korea

International Nuclear Information System (INIS)

Yoo, Hyun Ju; Cho, Chan Hee; Kim, Jin Hoi; Park, Dong Min

2016-01-01

Summary Sheet Number(SSN) in the current LTP is an ID which means a weldment in a nuclear power plant. However, the SSN ID, which is unique on in a nuclear power plant, is not unique one if the weldments of entire nuclear power plant in Korea are treated in one system. Therefore, it is hard to manage the data during life time using the existing SSN ID system. It is also hard to configure the characteristics of weldment in mind because IDs implying Alloy600 and overlay weld do not exist in the existing SSN ID System. An optimized SSN numbering system managing weldments for the life time is introduced in this paper. Moreover, it is explained how to manage the SSN numbering system in the computer program system, too. The problem, which the weld is not harmoniously managed, would be solved provided adapting the new SSN ID introduced in this paper. A weld is managed during its life time from creation to extinction. The inquiry of inspection history of a concerned weld and the reference of statistics would be performed easily and rightly because the concerned weld can be accessed from anywhere connected to KHNP network such as KHNP headquater, plants and CRI

The development and psychometric evaluation of the Internet Disorder Scale (IDS-15).

Science.gov (United States)

Pontes, Halley M; Griffiths, Mark D

2017-01-01

Previously published research suggests that improvement in the assessment of Internet addiction (IA) is paramount in advancing the field. However, little has been done to address inconsistencies in the assessment of IA using a more updated framework. The aim of the present study was to develop a new instrument to assess IA based on a modification of the nine Internet Gaming Disorder (IGD) criteria as suggested by the American Psychiatric Association in the latest (fifth) edition of the Diagnostic and Statistical Manual of Mental Disorders (DSM-5), and to provide a taxonomy of the potential risk of IA risk among participants. A heterogeneous sample of Internet users (n=1105) was recruited online (61.3% males, mean age 33years). Construct validity of the new instrument - Internet Disorder Scale (IDS-15) - was assessed by means of factorial, convergent, and discriminant validity. Criterion-related validity and reliability were also investigated. Additionally, latent profile analysis (LPA) was carried out to differentiate and characterize Internet users based on their potential IA risk. The construct and criterion-related validity of the IDS-15 were both warranted. The IDS-15 proved to be a valid and reliable tool. Using the LPA, participants were classed as "low addiction risk" (n=183, 18.2%), "medium addiction risk" (n=456, 41.1%), and "high addiction risk" (n=455, 40.77%). Furthermore, key differences emerged among these classes in terms of age, relationship status, cigarette consumption, weekly Internet usage, age of Internet use initiation, and IDS-15 total scores. The present findings support the viability of using adapted IGD criteria as a framework to assess IA. Copyright © 2015 Elsevier Ltd. All rights reserved.

Towards fraud-proof ID documents using multiple data hiding technologies and biometrics

Science.gov (United States)

Picard, Justin; Vielhauer, Claus; Thorwirth, Niels

2004-06-01

Identity documents, such as ID cards, passports, and driver's licenses, contain textual information, a portrait of the legitimate holder, and eventually some other biometric characteristics such as a fingerprint or handwritten signature. As prices for digital imaging technologies fall, making them more widely available, we have seen an exponential increase in the ease and the number of counterfeiters that can effectively forge documents. Today, with only limited knowledge of technology and a small amount of money, a counterfeiter can effortlessly replace a photo or modify identity information on a legitimate document to the extent that it is very diffcult to differentiate from the original. This paper proposes a virtually fraud-proof ID document based on a combination of three different data hiding technologies: digital watermarking, 2-D bar codes, and Copy Detection Pattern, plus additional biometric protection. As will be shown, that combination of data hiding technologies protects the document against any forgery, in principle without any requirement for other security features. To prevent a genuine document to be used by an illegitimate user,biometric information is also covertly stored in the ID document, to be used for identification at the detector.

Angiotensin-converting enzyme gene I/D polymorphism in Pakistani ...

African Journals Online (AJOL)

The frequency of DD allele in SLE patients with lupus nephritis is 100%, Sjogren's syndrome 100%, Raynaud's phenomenon 88.88%, and with rheumatoid arthritis it is 78.94%. The frequency of ID allele in SLE patients with Raynaud's phenomenon is 5.55%, and with rheumatoid arthritis it is 10.52%. The frequency of II ...

The Effect of Using a Visual Representation Tool in a Teaching-Learning Sequence for Teaching Newton's Third Law

Science.gov (United States)

Savinainen, Antti; Mäkynen, Asko; Nieminen, Pasi; Viiri, Jouni

2017-01-01

This paper presents a research-based teaching-learning sequence (TLS) that focuses on the notion of interaction in teaching Newton's third law (N3 law) which is, as earlier studies have shown, a challenging topic for students to learn. The TLS made systematic use of a visual representation tool--an interaction diagram (ID)--highlighting…

Le point de vue de la philosophie: L'entreprise idéologique

OpenAIRE

Pesqueux , Yvon

2004-01-01

Parler de l'entreprise conduit à questionner ce qui fonde le discours – scientifique ou médiatique – qui permette d'en parler. Et c'est bien en cela qu'il est nécessaire d'approfondir l'univers de l'idéologie et de la croyance qui est celui dans lequel modèle, image, métaphore et figure de l'entreprise plongent leurs racines dans la mesure où l'usage de ces notions, quand on les applique à l'entreprise, conduit à créer un monde qui soit cohérent avec ce qu'ils portent en eux. L'idéologie comm...

Secure OpenID Authentication Model by Using Trusted Computing

Directory of Open Access Journals (Sweden)

E. Ghazizadeh

2014-01-01

Full Text Available The growth of Internet online services has been very quick in recent years. Each online service requires Internet users to create a new account to use the service. The problem can be seen when each user usually needs more than one service and, consequently, has numerous accounts. These numerous accounts have to be managed in a secure and simple way to be protected against identity theft. Single sign-on (SSO and OpenID have been used to decrease the complexity of managing numerous accounts required in the Internet identity environment. Trusted Platform Module (TPM and Trust Multitenancy are great trusted computing-based technologies to solve security concerns in the Internet identity environment. Since trust is one of the pillars of security in the cloud, this paper analyzes the existing cloud identity techniques in order to investigate their strengths and weaknesses. This paper proposes a model in which One Time Password (OTP, TPM, and OpenID are used to provide a solution against phishing as a common identity theft in cloud environment.

Student ID Cards: What You Should Know About Them

Science.gov (United States)

Hoffman, Jonathan; McGuire, Agnes C.

1973-01-01

Discusses the usefulness of photo ID cards for school security purposes, library control, student activities, and bus transportation control. Examines ways in which card costs can be reduced and the pros and cons of producing the cards at the school or of letting the work out. Problems involving card abuse and student rights are also considered.…

High level of APOBEC3F/3G editing in HIV-2 DNA vif and pol sequences from antiretroviral-naive patients.

Science.gov (United States)

Bertine, Mélanie; Charpentier, Charlotte; Visseaux, Benoit; Storto, Alexandre; Collin, Gilles; Larrouy, Lucile; Damond, Florence; Matheron, Sophie; Brun-Vézinet, Françoise; Descamps, Diane

2015-04-24

In HIV-1, hypermutation introduced by APOBEC3F/3G cytidine deaminase activity leads to defective viruses. In-vivo impact of APOBEC3F/3G editing on HIV-2 sequences remains unknown. The objective of this study was to assess the level of APOBEC3F/3G editing in HIV-2-infected antiretroviral-naive patients. Direct sequencing of vif and pol regions was performed on HIV-2 proviral DNA from antiretroviral-naive patients included in the French Agence Nationale de Recherches sur le SIDA et les hépatites virales CO5 HIV-2 cohort. Hypermutated sequences were identified using Hypermut2.0 program. HIV-1 proviral sequences from Genbank were also assessed. Among 82 antiretroviral-naive HIV-2-infected patients assessed, 15 (28.8%) and five (16.7%) displayed Vif proviral defective sequences in HIV-2 groups A and B, respectively. A lower proportion of defective sequences was observed in protease-reverse transcriptase region. A higher median number of G-to-A mutations was observed in HIV-2 group B than in group A, both in Vif and protease-reverse transcriptase regions (P = 0.02 and P = 0.006, respectively). Compared with HIV-1 Vif sequences, a higher number of Vif defective sequences was observed in HIV-2 group A (P = 0.00001) and group B sequences (P = 0.013). We showed for the first time a high level of APOBEC3F/3G editing in HIV-2 sequences from antiretroviral-naive patients. Our study reported a group effect with a significantly higher level of APOBEC3F/3G editing in HIV-2 group B than in group A sequences.

Development and Psychometric Properties of an Assessment for Persons with Intellectual Disability--The InterRAI ID

Science.gov (United States)

Martin, Lynn; Hirdes, John P.; Fries, Brant E.; Smith, Trevor F.

2007-01-01

This paper describes the development of the interRAI-Intellectual Disability (interRAI ID), a comprehensive instrument that assesses all key domains of interest to service providers relative to a person with an intellectual disability (ID). The authors report on the reliability and validity of embedded scales for cognition, self-care, aggression,…

Phonotactic probability of brand names: I'd buy that!

Science.gov (United States)

Vitevitch, Michael S; Donoso, Alexander J

2012-11-01

Psycholinguistic research shows that word-characteristics influence the speed and accuracy of various language-related processes. Analogous characteristics of brand names influence the retrieval of product information and the perception of risks associated with that product. In the present experiment we examined how phonotactic probability-the frequency with which phonological segments and sequences of segments appear in a word-might influence consumer behavior. Participants rated brand names that varied in phonotactic probability on the likelihood that they would buy the product. Participants indicated that they were more likely to purchase a product if the brand name was comprised of common segments and sequences of segments rather than less common segments and sequences of segments. This result suggests that word-characteristics may influence higher-level cognitive processes, in addition to language-related processes. Furthermore, the benefits of using objective measures of word characteristics in the design of brand names are discussed.

Application of game theory for the interpretation of inventory differences (ID)

International Nuclear Information System (INIS)

Moglewer, S.

1978-01-01

In a study performed by the Test and Evaluation Branch, Division of Safeguards, at the U.S. Nuclear Regulatory Commission with contract assistance from Lawrence Berkeley Laboratory, the validity of the ID concept for estabilishing assurance concerning possible unauthorized diversion of SNM was examined. The evaluation methodology was based upon the theory of games and produced results that were quite different from those derived by classical statistical hypothesis testing. A model was developed based upon a decision maker's utilities and solved for generic facilities. Based upon the value of ID, obtained from each inventory, and specific for each facility, there is a best policy for estimating unauthorized deliberate diversion and establishing action limits (alarm thresholds). This paper presents the results of this study as applied to a generic facility

British military operation at Sheikh Sa‘id in the First World War

Directory of Open Access Journals (Sweden)

Abdol Rauh Yaccob

2017-09-01

Full Text Available It is a difficult task to measure the importance of South West Arabia to the Ottomans and the British prior to and during World War I. Early history of imperial expansion in the area which followed by constant conflicts and involved a considerable amount of diplomacy and intrigues with the natives may suggest that South West Arabia was considered as equally as important to other areas within the empire. However from the beginning of the 20th century South West Arabia was considered something of a backwater. It may also be observed that during the First World War the position of South West Arabia to these powers in relation to other war theatres remained practically the same except in the episodes of British action at Sheikh Said and the Ottomans advance at Lahej. The Indian authorities who believed that the Ottomans were contemplating a move to Sheikh Sa‘id with the aim of acting against British Perim with the telegraphic communication, convoys and shipping, only two miles away, took the opportunity of the movement of the troops through the Red Sea to attack the fort of Sheikh Sa‘id. The action was quickly taken before obtaining official approval from the Admiralty and the India Office in London. The action was taken due to the persistent reports of the Ottoman reinforcement with guns had been sent to Sheikh Sa‘id, further to take advantage of the presence of transports with troops for Egypt. Subsequently future military operations at Sheikh Sa‘id and the Red Sea appeared to dominate the discussions among the authorities at the India Office, the Admiralty, the Indian authorities and the Resident at Aden throughout the war without materializing any further military action.

On Eddy current examination (ECE) of Incoloy 800 SG tube using OD encircling and ID bobbin coil

International Nuclear Information System (INIS)

Kapoor, K.; Sunder Krishna, K.; Bakshu, S.A.

2015-01-01

The purpose of this paper is to present and compare the results of ECE carried out on steam generator tubes from OD side and ID side. During the manufacturing of the tubes Eddy current testing is being carried out using OD encircling probe as per ASTM E 571. Here the purpose of the test is to capture the manufacturing defects. The parameters of the test are optimized to achieve best sensitivity to this requirement. These tubes are then installed in the steam generator and once again ECE is carried out during installation (pre-service inspection-PSI) and during in-service inspection (ISI) by using ID bobbin coil. These tests are carried out as per ASME section V article 8 appendix 1. Here the purpose of the test is to detect wall thinning, dent, pits etc due to operation and to locate these defects (OD side or ID side). Here the operating parameters are optimized for phase separation of defects from OD and ID. These parameters are quite different from those used during the manufacturing ECE. Interpretation of the signals detected in PSI/ISI in must be done with care to correlate with defect indications detected during manufacturing. In the present study, tubes with certain manufacturing defects, detected with OD encircling test were subjected to ID bobbin coil examination. Also certain tubes with signal picked up during test from ID were examined by using the OD encircling probe. This comparison of the results provides a clear picture about the sensitivity and deficiency of the either type of test. (author)

77 FR 55813 - Transition of DOE-ID Public Reading Room

Science.gov (United States)

2012-09-11

... to the INL Research Library at 1776 Science Center Drive, Idaho Falls, ID 83401, beginning September 1, 2012. Access to documents will also be electronically accessible through the World Wide Web. For direction in accessing documents electronically through the World Wide Web, please refer to the Idaho...

Brief, unidimensional melancholia rating scales are highly sensitive to the effect of citalopram and may have biological validity

DEFF Research Database (Denmark)

Østergaard, Søren Dinesen; Bech, Per; Trivedi, Madhukar H

2014-01-01

-item Inventory of Depressive Symptomatology (IDS-C30) to that of their unidimensional six-item melancholia subscales (HAM-D6 and IDS-C6). METHODS: A total of 2242 subjects from level 1 (citalopram) of the Sequenced Treatment Alternatives to Relieve Depression (STAR* study were included in the analysis...

X-exome sequencing of 405 unresolved families identifies seven novel intellectual disability genes

OpenAIRE

Hu, H.; Haas, S.A.; Chelly, J.; Van Esch, H.; Raynaud, M.; de Brouwer, A.P.M.; Weinert, S.; Froyen, G.; Frints, S.G.M.; Laumonnier, F.; Zemojtel, T.; Love, M.I.; Richard, H.; Emde, A.K.; Bienek, M.

2016-01-01

X-linked intellectual disability (XLID) is a clinically and genetically heterogeneous disorder. During the past two decades in excess of 100 X-chromosome ID genes have been identified. Yet, a large number of families mapping to the X-chromosome remained unresolved suggesting that more XLID genes or loci are yet to be identified. Here, we have investigated 405 unresolved families with XLID. We employed massively parallel sequencing of all X-chromosome exons in the index males. The majority of ...

Exome sequencing identifies a novel mutation of the GDI1 gene in a Chinese non-syndromic X-linked intellectual disability family

Directory of Open Access Journals (Sweden)

Yongheng Duan

2017-08-01

Full Text Available Abstract X-linked intellectual disability (XLID has been associated with various genes. Diagnosis of XLID, especially for non-syndromic ones (NS-XLID, is often hampered by the heterogeneity of this disease. Here we report the case of a Chinese family in which three males suffer from intellectual disability (ID. The three patients shared the same phenotype: no typical clinical manifestation other than IQ score ≤ 70. For a genetic diagnosis for this family we carried out whole exome sequencing on the proband, and validated 16 variants of interest in the genomic DNA of all the family members. A missense mutation (c.710G > T, which mapped to exon 6 of the Rab GDP-Dissociation Inhibitor 1 (GDI1 gene, was found segregating with the ID phenotype, and this mutation changes the 237th position in the guanosine diphosphate dissociation inhibitor (GDI protein from glycine to valine (p. Gly237Val. Through molecular dynamics simulations we found that this substitution results in a conformational change of GDI, possibly affecting the Rab-binding capacity of this protein. In conclusion, our study identified a novel GDI1 mutation that is possibly NS-XLID causative, and showed that whole exome sequencing provides advantages for detecting novel ID-associated variants and can greatly facilitate the genetic diagnosis of the disease.

An Improved Dynamic ID-Based Remote User Authentication with Key Agreement Scheme

Directory of Open Access Journals (Sweden)

Juan Qu

2013-01-01

Full Text Available In recent years, several dynamic ID-based remote user authentication schemes have been proposed. In 2012, Wen and Li proposed a dynamic ID-based remote user authentication with key agreement scheme. They claimed that their scheme can resist impersonation attack and insider attack and provide anonymity for the users. However, we will show that Wen and Li's scheme cannot withstand insider attack and forward secrecy, does not provide anonymity for the users, and inefficiency for error password login. In this paper, we propose a novel ECC-based remote user authentication scheme which is immune to various known types of attack and is more secure and practical for mobile clients.

Reliability of the Identification of Functional Ankle Instability (IdFAI) Scale Across Different Age Groups in Adults.

Science.gov (United States)

Gurav, Reshma S; Ganu, Sneha S; Panhale, Vrushali P

2014-10-01

Functional ankle instability (FAI) is the tendency of the foot to 'give way'. Identification of Functional Ankle Instability questionnaire (IdFAI) is a newly developed questionnaire to detect whether individuals meet the minimum criteria necessary for inclusion in an FAI population. However, the reliability of the questionnaire was studied only in a restricted age group. The purpose of this investigation was to examine the reliability of IdFAI across different age groups in adults. One hundred and twenty participants in the age group of 20-60 years consisting of 30 individuals in each age group were asked to complete the IdFAI on two occasions. Test-retest reliability was evaluated by intraclass correlation coefficient (ICC2,1). The study revealed that IdFAI has excellent test-retest reliability when studied across different age groups. The ICC2,1 in the age groups 20-30 years, 30-40 years, 40-50 years and 50-60 years was 0.978, 0.975, 0.961 and 0.922, respectively with Cronbach's alpha >0.9 in all the age groups. The IdFAI can accurately predict if an individual meets the minimum criterion for FAI across different age groups in adults. Thus, the questionnaire can be applied over different age groups in clinical and research set-ups.

The importance of association between angiotensin-converting enzyme (ACE) Gene I/D polymorphism and diabetic peripheral neuropathy.

Science.gov (United States)

Inanir, Ahmet; Basol, Nursah; Karakus, Nevin; Yigit, Serbulent

2013-11-10

Diabetic peripheral neuropathy (DPN) is a microvascular complication of diabetes mellitus (DM) due to decreasing quality of life. In the present study, it is aimed to evaluate angiotensin-converting enzyme (ACE) Gene I/D polymorphism in Turkish population. Two hundred and thirty-five DPN patients and two hundred and eighty-one controls were enrolled in this study. Genomic DNA was isolated and genotyped using polymerase chain reaction (PCR) analyses for the ACE gene I/D polymorphism. Baseline characteristics of the DPN patients according to ACE genotypes were similar, except for history of hypertension. The frequency of II genotype was significantly higher in patients with positive history of hypertension than the patients with negative history of hypertension (p=0.013). DD genotype of I/D polymorphism was found to be a susceptibility factor for DPN in homozygous form (p=0.032). According to allele frequencies, D allele of I/D polymorphism was found to be a susceptibility factor for DPN (p=0.031). ACE gene I/D polymorphism may research in DM patients to determine genetic predisposition for DPN. It can be useful for taking early measures and avoiding DPN in a Turkish population. © 2013 Elsevier B.V. All rights reserved.

High levels of diversity characterize mandrill (Mandrillus sphinx) Mhc-DRB sequences.

Science.gov (United States)

Abbott, Kristin M; Wickings, E Jean; Knapp, Leslie A

2006-08-01

The major histocompatibility complex (MHC) is highly polymorphic in most primate species studied thus far. The rhesus macaque (Macaca mulatta) has been studied extensively and the Mhc-DRB region demonstrates variability similar to humans. The extent of MHC diversity is relatively unknown for other Old World monkeys (OWM), especially among genera other than Macaca. A molecular survey of the Mhc-DRB region in mandrills (Mandrillus sphinx) revealed extensive variability, suggesting that other OWMs may also possess high levels of Mhc-DRB polymorphism. In the present study, 33 Mhc-DRB loci were identified from only 13 animals. Eleven were wild-born and presumed to be unrelated and two were captive-born twins. Two to seven different sequences were identified for each individual, suggesting that some mandrills may have as many as four Mhc-DRB loci on a single haplotype. From these sequences, representatives of at least six Mhc-DRB loci or lineages were identified. As observed in other primates, some new lineages may have arisen through the process of gene conversion. These findings indicate that mandrills have Mhc-DRB diversity not unlike rhesus macaques and humans.

Quand l’idée fixe se met « à table »

Directory of Open Access Journals (Sweden)

Cécile de Bary

2008-03-01

Full Text Available Un livre de cuisine, comme A table de Claudian, édité en 1963, peut relever de la prose d’idées dans la mesure où son projet est sous-tendu par une idéologie très précise, qui seule lui donne sa cohérence. Si l’ethnocentrisme consiste à ne pas reconnaître à l’autre une culture, par exemple, ce livre apparaît comme ethnocentrique, puisqu’il a pour projet de départager les peuples qui savent et ceux qui ne savent pas. Il est encore réactionnaire, voué au rétablissement des savoir-faire des terroirs, contre les corruptions parisiennes en particulier. Dès lors, la présentation d’un plat est toujours susceptible de s’étendre ou de se faire discours, sous la poussée d’un lyrisme acrimonieux. Pour autant, il ne s’agit pas d’un faux livre de cuisine, d’un traité ou d’une « physiologie ». La recette est l’aboutissement logique de l’idée fixe. Elle est le lieu d’une bataille que l’argumentation sert, qu’elle met en scène et qu’elle prépare.

Association of ACE Gene I/D polymorphism with migraine in Kashmiri population.

Science.gov (United States)

Wani, Irfan Yousuf; Sheikh, Saleem; Shah, Zafar Amin; Pandith, Arshid A; Wani, Mushtaq; Asimi, Ravouf; Wani, Maqbool; Sheikh, Shahnawaz; Mehraj, Iqra

2016-01-01

Migraine is a complex, recurrent headache disorder that is one of the most common complaints in neurology practice. The role of various genes in its pathogenesis is being studied. We did this study to see whether an association exists between ACE gene I/D polymorphism and migraine in our region. The study included 100 patients diagnosed with migraine and 121 healthy controls. The study subject were age and gender matched. The analysis was based on Polymerase Chain Reaction (PCR) and included following steps: DNA extraction from blood, PCR and Restriction Fragment Length Polymorphism (RFLP). Out of 100 cases, 69 were females and 31 were males. Fifty-seven were having migraine without aura and 43 had migraine with aura. 45 of the cases had II polymorphism, 40 had ID polymorphism and 15 had DD polymorphism in ACE gene. We were not able to find a statistically significant association between ACE gene I/D polymorphism with migraine. The reason for difference in results between our study and other studies could be because of different ethnicity in study populations. So a continuous research is needed in this regard in order to find the genes and different polymorphism that increase the susceptibility of Kashmiri population to migraine.

Conformal image-guided microbeam radiation therapy at the ESRF biomedical beamline ID17

International Nuclear Information System (INIS)

Donzelli, Mattia; Bräuer-Krisch, Elke; Nemoz, Christian; Brochard, Thierry; Oelfke, Uwe

2016-01-01

Purpose: Upcoming veterinary trials in microbeam radiation therapy (MRT) demand for more advanced irradiation techniques than in preclinical research with small animals. The treatment of deep-seated tumors in cats and dogs with MRT requires sophisticated irradiation geometries from multiple ports, which impose further efforts to spare the normal tissue surrounding the target. Methods: This work presents the development and benchmarking of a precise patient alignment protocol for MRT at the biomedical beamline ID17 of the European Synchrotron Radiation Facility (ESRF). The positioning of the patient prior to irradiation is verified by taking x-ray projection images from different angles. Results: Using four external fiducial markers of 1.7  mm diameter and computed tomography-based treatment planning, a target alignment error of less than 2  mm can be achieved with an angular deviation of less than 2 ∘ . Minor improvements on the protocol and the use of smaller markers indicate that even a precision better than 1  mm is technically feasible. Detailed investigations concerning the imaging dose lead to the conclusion that doses for skull radiographs lie in the same range as dose reference levels for human head radiographs. A currently used online dose monitor for MRT has been proven to give reliable results for the imaging beam. Conclusions: The ESRF biomedical beamline ID17 is technically ready to apply conformal image-guided MRT from multiple ports to large animals during future veterinary trials.

Conformal image-guided microbeam radiation therapy at the ESRF biomedical beamline ID17

Energy Technology Data Exchange (ETDEWEB)

Donzelli, Mattia, E-mail: donzelli@esrf.fr [European Synchrotron Radiation Facility, 71, Avenue des Martyrs, Grenoble 38000, France and The Institute of Cancer Research, 15 Cotswold Road, Sutton SM2 5NG (United Kingdom); Bräuer-Krisch, Elke; Nemoz, Christian; Brochard, Thierry [European Synchrotron Radiation Facility, 71, Avenue des Martyrs, Grenoble 38000 (France); Oelfke, Uwe [The Institute of Cancer Research, 15 Cotswold Road, Sutton SM2 5NG (United Kingdom)

2016-06-15

Purpose: Upcoming veterinary trials in microbeam radiation therapy (MRT) demand for more advanced irradiation techniques than in preclinical research with small animals. The treatment of deep-seated tumors in cats and dogs with MRT requires sophisticated irradiation geometries from multiple ports, which impose further efforts to spare the normal tissue surrounding the target. Methods: This work presents the development and benchmarking of a precise patient alignment protocol for MRT at the biomedical beamline ID17 of the European Synchrotron Radiation Facility (ESRF). The positioning of the patient prior to irradiation is verified by taking x-ray projection images from different angles. Results: Using four external fiducial markers of 1.7  mm diameter and computed tomography-based treatment planning, a target alignment error of less than 2  mm can be achieved with an angular deviation of less than 2{sup ∘}. Minor improvements on the protocol and the use of smaller markers indicate that even a precision better than 1  mm is technically feasible. Detailed investigations concerning the imaging dose lead to the conclusion that doses for skull radiographs lie in the same range as dose reference levels for human head radiographs. A currently used online dose monitor for MRT has been proven to give reliable results for the imaging beam. Conclusions: The ESRF biomedical beamline ID17 is technically ready to apply conformal image-guided MRT from multiple ports to large animals during future veterinary trials.

Limited concordance between teachers, parents and healthcare professionals on the presence of chronic diseases in ID-adolescents

NARCIS (Netherlands)

Oeseburg, B.; Jansen, D. E. M. C.; Reijneveld, S. A.; Dijkstra, G. J.; Groothoff, J. W.

2010-01-01

Evidence on teachers' knowledge about somatic and mental chronic diseases among ID-adolescent compared to the knowledge parents and healthcare professionals have, is limited. The aim of this study is: (1) to assess the knowledge of teachers on the presence of chronic diseases in ID-adolescents; (2)

ID based cryptography for secure cloud data storage

OpenAIRE

Kaaniche , Nesrine; Boudguiga , Aymen; Laurent , Maryline

2013-01-01

International audience; This paper addresses the security issues of storing sensitive data in a cloud storage service and the need for users to trust the commercial cloud providers. It proposes a cryptographic scheme for cloud storage, based on an original usage of ID-Based Cryptography. Our solution has several advantages. First, it provides secrecy for encrypted data which are stored in public servers. Second, it offers controlled data access and sharing among users, so that unauthorized us...

ASSOCIATION OF ACTN3 R577X AND ACE I/D POLYMORPHISMS IN BRAZILIANS WRESTLERS

Directory of Open Access Journals (Sweden)

Marcelo Romanovitch Ribas

Full Text Available ABSTRACT Introduction: By associating genetics and sport, it is possible to identify subjects with greater capacity to adapt to training, and lower chances of injury. Objective: The investigation evaluated the genotypic and allelic distribution of ACTN3 R577X and ACE I/D polymorphisms in Brazilian high-performance athletes in wrestling and percussion combat sports. Methods: The study included 37 male athletes ranked from first to third place in world scenarios, divided into two groups: wrestling (23 wrestlers, being 11 of Judo, 4 of Greco-Roman style, 8 of Brazilian Jiu Jitsu, with mean age of 27.3 ± 6.9 years and percussion combat sports (14 athletes with a mean age of 25.7±4.4 years, being 6 of Karate, 3 of Muay Thai, 4 of Taekwondo, 1 Boxing. Genotyping of ACTN3 and ACE I/D polymorphisms was performed by polymerase chain reaction (PCR from the genomic DNA. Genotypic and allelic distributions were compared with control populations and athletes by Chi-square test and Fisher’s exact test; all analyzes considered p ≤ 0.05. Results: The genotypic distributions and allelic frequencies of ACTN3 RR=46%, RX=38% and XX=16%; R=65% and X=35%, and ACE I/D DD=47.7%, ID=34.3% and II=20%; D=62.9% and I=37.1% did not differ from the control population; however, when compared with wrestling athletes a significant difference was observed. Conclusion: These results suggest an association of ACTN3 R577X and ACE I/D genes with Brazilian high-performance wrestling athletes.

[Comparison of Phoenix™ Yeast ID Panel and API® ID 32C commercial systems for the identification of Candida species isolated from clinical samples].

Science.gov (United States)

Gayibova, Ülkü; Dalyan Cılo, Burcu; Ağca, Harun; Ener, Beyza

2014-07-01

Opportunistic fungal pathogens are one of the important causes of nosocomial infections, and several different types of yeasts, especially Candida species are increasingly recovered from immunocompromised patients. Since many of the yeasts are resistant to the commonly used antifungal agents, the introduction of appropriate therapy depends on rapid and accurate identification. The aims of this study were to compare the commercial identification systems namely API® ID 32C (bioMerieux, France) and Phoenix™ Yeast ID Panel (Becton Dickinson Diagnostics, USA) for the identification of Candida species and to evaluate the effect of morphological findings in the identification process. A total of 211 yeast strains isolated from different clinical samples (111 urine, 34 blood/vascular catheter, 27 upper/lower respiratory tract, 16 abscess/pus, 13 throat/vagina swabs and 10 sterile body fluids) of 137 patients hospitalized in Uludag University Health and Research Center between October 2013 to January 2014, were included in the study. Samples were cultured on blood agar, chromogenic agar (CHROMagar Candida, BD, USA) and Saboraud's dextrose agar (SDA), and isolated yeast colonies were evaluated with germ tube test and morphological examination by microscopy on cornmeal/Tween-80 agar. The isolates were identified as well by two commercial systems according to the manufacturers' recommendations. Discrepant results between the systems were tried to be resolved by using morphological characteristics of the yeasts. Of the isolates 159 were identified identical by both of the systems, and the concordance between those systems were estimated as 75.4%. According to the concordant identification, the most frequently isolated species was C.albicans (44.1%) followed by C.tropicalis (9.9%), C.glabrata (9.5%), C.parapsilosis (8.5%) and C.kefyr (8.1%). The concordance rate was 81.7% in identification of frequently isolated species (C.albicans, C.tropicalis, C.parapsilosis, C.glabrata, C

Mapping of Id locus for dermal shank melanin in a Chinese ...

Indian Academy of Sciences (India)

JIGUO XU

2017-12-08

Dec 8, 2017 ... Information on the SNPs used for the association analysis. ID. Position (galGal3) .... using Bio-Rad Manager software, and the data were nor- malized to the ..... This work was supported by the High Technology Research.

Globicatella sanguinis bacteraemia identified by partial 16S rRNA gene sequencing

DEFF Research Database (Denmark)

Abdul-Redha, Rawaa Jalil; Balslew, Ulla; Christensen, Jens Jørgen

2007-01-01

Globicatella sanguinis is a gram-positive coccus, resembling non-haemolytic streptococci. The organism has been isolated infrequently from normally sterile sites of humans. Three isolates obtained by blood culture could not be identified by Rapid 32 ID Strep, but partial sequencing of the 16S r......RNA gene revealed the identity of the isolated bacteria, and supplementary biochemical tests confirmed the species identification. The cases histories illustrate the dilemma of finding relevant, newly recognized, opportunistic pathogens and the identification achievement (s) that can be obtained by using...

Rapid, autonomous analysis of He spectra I: Overview of the RadID program, user experience, and structure

Energy Technology Data Exchange (ETDEWEB)

Gosnell, Thomas B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Chavez, Joseph R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Rowland, Mark S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Wong, James L. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2014-02-26

RadID is a new gamma-ray spectrum analysis program for rapid screening of HPGe gamma-ray data to reveal the presence of radionuclide signatures. It is an autonomous, rule-based heuristic system that can identify well over 200 radioactive sources with particular interest in uranium and plutonium characteristics. It executes in about one second. RadID does not require knowledge of the detector efficiency, the source-to-detector distance, or the geometry of the inspected radiation source—including any shielding. In this first of a three-document series we sketch the RadID program’s origin, its minimal requirements, the user experience, and the program operation.

Benchmark exercises on PWR level-1 PSA (step 3). Analyses of accident sequence and conclusions

International Nuclear Information System (INIS)

Niwa, Yuji; Takahashi, Hideaki.

1996-01-01

The results of level 1 PSA generate fluctuations due to the assumptions based on several engineering judgements set in the stages of PSA analysis. On the purpose of the investigation of uncertainties due to assumptions, three kinds of a standard problem, what we call benchmark exercise have been set. In this report, sensitivity studies (benchmark exercise) of sequence analyses are treated and conclusions are mentioned. The treatment of inter-system dependency would generate uncertainly of PSA. In addition, as a conclusion of the PSA benchmark exercise, several findings in the sequence analysis together with previous benchmark analyses in earlier INSS Journals are treated. (author)

Use of false ID cards and other deceptive methods to purchase alcoholic beverages during high school.

Science.gov (United States)

Schwartz, R H; Farrow, J A; Banks, B; Giesel, A E

1998-01-01

Altered motor vehicle drivers's licenses or other falsified or counterfeit photo identification cards are widely and illegally used by teenagers to obtain beer and other alcohol beverages. We obtained information on the methods currently used by teenagers to purchase beer and wine by asking nine hundred teenagers, between 16-19 years old to complete a brief, confidential questionnaire. High school students most often obtained alcoholic beverages by requesting someone of legal age to purchase it for them. College students used borrowed, altered, or counterfeit identification (ID) more often than high school students. Photo IDs purchased through mail order from a magazine advertisement were used infrequently and when use was attempted, they were sometimes (25%) unsuccessful. Fifteen percent of high school students, 14% of college freshmen, and 24% of teenage drug abusers were able to purchase beer by the case with borrowed, altered, or fake ID. Suggestions to reduce sales of alcohol-containing beverages to minors include universal "carding" of prospective purchasers, use of two view or hologram photos on a drivers' license, requiring three different ID cards at the point of purchase, and penalties to stores that fail to make a good effort to identify underage customers.

Factor structure and dimensionality of the two depression scales in STAR*D using level 1 datasets

DEFF Research Database (Denmark)

Bech, P; Fava, M; Trivedi, M H

2011-01-01

the HAM-D(6) and IDS-C(6) were found to be unidimensional scales, i.e., their total scores are each a sufficient statistic for the measurement of depressive states. LIMITATIONS: STAR*D used only one medication in Level 1. CONCLUSIONS: The unidimensional HAM-D(6) and IDS-C(6) should be used when evaluating......BACKGROUND: The factor structure and dimensionality of the HAM-D(17) and the IDS-C(30) are as yet uncertain, because psychometric analyses of these scales have been performed without a clear separation between factor structure profile and dimensionality (total scores being a sufficient statistic......). METHODS: The first treatment step (Level 1) in the STAR*D study provided a dataset of 4041 outpatients with DSM-IV nonpsychotic major depression. The HAM-D(17) and IDS-C(30) were evaluated by principal component analysis (PCA) without rotation. Mokken analysis tested the unidimensionality of the IDS-C(6...

Clinical evaluation of further-developed MRCP sequences in comparison with standard MRCP sequences

International Nuclear Information System (INIS)

Hundt, W.; Scheidler, J.; Reiser, M.; Petsch, R.

2002-01-01

The purpose of this study was the comparison of technically improved single-shot magnetic resonance cholangiopancreatography (MRCP) sequences with standard single-shot rapid acquisition with relaxation enhancement (RARE) and half-Fourier acquired single-shot turbo spin-echo (HASTE) sequences in evaluating the normal and abnormal biliary duct system. The bile duct system of 45 patients was prospectively investigated on a 1.5-T MRI system. The investigation was performed with RARE and HASTE MR cholangiography sequences with standard and high spatial resolutions, and with a delayed-echo half-Fourier RARE (HASTE) sequence. Findings of the improved MRCP sequences were compared with the standard MRCP sequences. The level of confidence in assessing the diagnosis was divided into five groups. The Wilcoxon signed-rank test at a level of p<0.05 was applied. In 15 patients no pathology was found. The MRCP showed stenoses of the bile duct system in 10 patients and choledocholithiasis and cholecystolithiasis in 16 patients. In 12 patients a dilatation of the bile duct system was found. Comparison of the low- and high spatial resolution sequences and the short and long TE times of the half-Fourier RARE (HASTE) sequence revealed no statistically significant differences regarding accuracy of the examination. The diagnostic confidence level in assessing normal or pathological findings for the high-resolution RARE and half-Fourier RARE (HASTE) was significantly better than for the standard sequences. For the delayed-echo half-Fourier RARE (HASTE) sequence no statistically significant difference was seen. The high-resolution RARE and half-Fourier RARE (HASTE) sequences had a higher confidence level, but there was no significant difference in diagnosis in terms of detection and assessment of pathological changes in the biliary duct system compared with standard sequences. (orig.)

SequenceCEROSENE: a computational method and web server to visualize spatial residue neighborhoods at the sequence level.

Science.gov (United States)

Heinke, Florian; Bittrich, Sebastian; Kaiser, Florian; Labudde, Dirk

2016-01-01

To understand the molecular function of biopolymers, studying their structural characteristics is of central importance. Graphics programs are often utilized to conceive these properties, but with the increasing number of available structures in databases or structure models produced by automated modeling frameworks this process requires assistance from tools that allow automated structure visualization. In this paper a web server and its underlying method for generating graphical sequence representations of molecular structures is presented. The method, called SequenceCEROSENE (color encoding of residues obtained by spatial neighborhood embedding), retrieves the sequence of each amino acid or nucleotide chain in a given structure and produces a color coding for each residue based on three-dimensional structure information. From this, color-highlighted sequences are obtained, where residue coloring represent three-dimensional residue locations in the structure. This color encoding thus provides a one-dimensional representation, from which spatial interactions, proximity and relations between residues or entire chains can be deduced quickly and solely from color similarity. Furthermore, additional heteroatoms and chemical compounds bound to the structure, like ligands or coenzymes, are processed and reported as well. To provide free access to SequenceCEROSENE, a web server has been implemented that allows generating color codings for structures deposited in the Protein Data Bank or structure models uploaded by the user. Besides retrieving visualizations in popular graphic formats, underlying raw data can be downloaded as well. In addition, the server provides user interactivity with generated visualizations and the three-dimensional structure in question. Color encoded sequences generated by SequenceCEROSENE can aid to quickly perceive the general characteristics of a structure of interest (or entire sets of complexes), thus supporting the researcher in the initial

Factor structure and dimensionality of the two depression scales in STAR*D using level 1 datasets.

Science.gov (United States)

Bech, P; Fava, M; Trivedi, M H; Wisniewski, S R; Rush, A J

2011-08-01

The factor structure and dimensionality of the HAM-D(17) and the IDS-C(30) are as yet uncertain, because psychometric analyses of these scales have been performed without a clear separation between factor structure profile and dimensionality (total scores being a sufficient statistic). The first treatment step (Level 1) in the STAR*D study provided a dataset of 4041 outpatients with DSM-IV nonpsychotic major depression. The HAM-D(17) and IDS-C(30) were evaluated by principal component analysis (PCA) without rotation. Mokken analysis tested the unidimensionality of the IDS-C(6), which corresponds to the unidimensional HAM-D(6.) For both the HAM-D(17) and IDS-C(30), PCA identified a bi-directional factor contrasting the depressive symptoms versus the neurovegetative symptoms. The HAM-D(6) and the corresponding IDS-C(6) symptoms all emerged in the depression factor. Both the HAM-D(6) and IDS-C(6) were found to be unidimensional scales, i.e., their total scores are each a sufficient statistic for the measurement of depressive states. STAR*D used only one medication in Level 1. The unidimensional HAM-D(6) and IDS-C(6) should be used when evaluating the pure clinical effect of antidepressive treatment, whereas the multidimensional HAM-D(17) and IDS-C(30) should be considered when selecting antidepressant treatment. Copyright © 2011 Elsevier B.V. All rights reserved.

Comparison of the optimized conditions for genotyping of ACE ID ...

African Journals Online (AJOL)

STORAGESEVER

2009-10-19

Oct 19, 2009 ... variants (Koyama et al., 2008). This method removed the chances of mistyping and gave 100% accuracy in the confirmation of ID heterozygotes but expenses of chromatography did not prove it to be cost effective. Normally, genomic DNA is used as template DNA for. PCR based studies. It is very difficult to ...

Level 1 - level 2 interface

International Nuclear Information System (INIS)

Boneham, P.

2003-01-01

The Plant Damage States (PDS) are the starting point for the level 2 analysis. A PDS is group of core damage sequences that are expected to have similar severe accident progressions. In this paper an overview of Level 1/Level 2 interface, example PDS parameters, example PDS definitions using codes and example Bridge Tree are presented. PDS frequency calculation (identification of sequences for each PDS in level 1,split some CD sequences which have different level 2 progressions), code calculations providing support for grouping decisions and timings as well as PDS frequencies and definitions input to level 2 are also discussed

EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA); Scientific Opinion on the substantiation of health claims related to very low calorie diets (VLCDs) and reduction in body weight (ID 1410), reduction in the sense of hunger (ID 1411), reduction in body fat mass while maintaining lean

DEFF Research Database (Denmark)

Tetens, Inge

claims in relation to very low calorie diets (VLCDs) and reduction in body weight, reduction in the sense of hunger, reduction in body fat mass while maintaining lean body mass, reduction of post-prandial glycaemic responses, and maintenance of normal blood lipid profile. The scientific substantiation...... that whereas the diet that is the subject of the claim, very low calorie diet, is sufficiently characterised in relation to the following claimed effects: reduction in body weight (ID 1410), reduction in the sense of hunger (ID 1411), and reduction in body fat mass while maintaining lean body mass (ID 1412...... that formula foods for use in very low calorie diets should contain. The Panel concludes that a cause and effect relationship cannot be established between the consumption of a very low calorie diet and reduction of post-prandial glycaemic responses (ID 1414) and maintenance of normal blood lipid profile (ID...

Predicting Students’ Performance using Modified ID3 Algorithm

OpenAIRE

Ramanathan L; Saksham Dhanda; Suresh Kumar D

2013-01-01

The ability to predict performance of students is very crucial in our present education system. We can use data mining concepts for this purpose. ID3 algorithm is one of the famous algorithms present today to generate decision trees. But this algorithm has a shortcoming that it is inclined to attributes with many values. So , this research aims to overcome this shortcoming of the algorithm by using gain ratio(instead of information gain) as well as by giving weights to each attribute at every...

RFID and Auto-ID in planning and logistics

CERN Document Server

Jones, Erick C

2011-01-01

As RFID technology is becoming increasingly popular, the need has arisen to address the challenges and approaches to successful implementation. RFID and Auto-ID in Planning and Logistics: A Practical Guide for Military UID Applications presents the concepts for students, military personnel and contractors, and corporate managers to learn about RFID and other automatic information capture technologies, and their integration into planning and logistics functions. The text includes comparisons of RFID with technologies such as bar codes, satellite tags, and global positioning systems and provides

In I isoelectronic sequence: wavelengths and energy levels for Xe VI through La IX

International Nuclear Information System (INIS)

Kaufman, V.; Sugar, J.

1987-01-01

Spectra of Xe, Cs, Ba, and La produced with a high-voltage spark discharge were observed photographically with the National Bureau of Standards 10.7-m normal- and grazing-incidence spectrographs. Identified lines of the In I isoelectronic sequence were used to determine the energy levels of the 5s 2 5p, 5s5p 2 , 5s 2 5d, and 5s 2 6s configurations. Their interactions with unobserved configurations that include a 4f electron are discussed. Fitted values of the radial energy integrals were determined from the known levels

Design of Distortion-Invariant Optical ID Tags for Remote Identification and Verification of Objects

Science.gov (United States)

Pérez-Cabré, Elisabet; Millán, María Sagrario; Javidi, Bahram

Optical identification (ID) tags [1] have a promising future in a number of applications such as the surveillance of vehicles in transportation, control of restricted areas for homeland security, item tracking on conveyor belts or other industrial environment, etc. More specifically, passive optical ID tag [1] was introduced as an optical code containing a signature (that is, a characteristic image or other relevant information of the object), which permits its real-time remote detection and identification. Since their introduction in the literature [1], some contributions have been proposed to increase their usefulness and robustness. To increase security and avoid counterfeiting, the signature was introduced in the optical code as an encrypted function [2-5] following the double-phase encryption technique [6]. Moreover, the design of the optical ID tag was done in such a way that tolerance to variations in scale and rotation was achieved [2-5]. To do that, the encrypted information was multiplexed and distributed in the optical code following an appropriate topology. Further studies were carried out to analyze the influence of different sources of noise. In some proposals [5, 7], the designed ID tag consists of two optical codes where the complex-valued encrypted signature was separately introduced in two real-valued functions according to its magnitude and phase distributions. This solution was introduced to overcome some difficulties in the readout of complex values in outdoors environments. Recently, the fully phase encryption technique [8] has been proposed to increase noise robustness of the authentication system.

Effect of sequence variants on variance in glucose levels predicts type 2 diabetes risk and accounts for heritability.

Science.gov (United States)

Ivarsdottir, Erna V; Steinthorsdottir, Valgerdur; Daneshpour, Maryam S; Thorleifsson, Gudmar; Sulem, Patrick; Holm, Hilma; Sigurdsson, Snaevar; Hreidarsson, Astradur B; Sigurdsson, Gunnar; Bjarnason, Ragnar; Thorsson, Arni V; Benediktsson, Rafn; Eyjolfsson, Gudmundur; Sigurdardottir, Olof; Olafsson, Isleifur; Zeinali, Sirous; Azizi, Fereidoun; Thorsteinsdottir, Unnur; Gudbjartsson, Daniel F; Stefansson, Kari

2017-09-01

Sequence variants that affect mean fasting glucose levels do not necessarily affect risk for type 2 diabetes (T2D). We assessed the effects of 36 reported glucose-associated sequence variants on between- and within-subject variance in fasting glucose levels in 69,142 Icelanders. The variant in TCF7L2 that increases fasting glucose levels increases between-subject variance (5.7% per allele, P = 4.2 × 10 -10 ), whereas variants in GCK and G6PC2 that increase fasting glucose levels decrease between-subject variance (7.5% per allele, P = 4.9 × 10 -11 and 7.3% per allele, P = 7.5 × 10 -18 , respectively). Variants that increase mean and between-subject variance in fasting glucose levels tend to increase T2D risk, whereas those that increase the mean but reduce variance do not (r 2 = 0.61). The variants that increase between-subject variance increase fasting glucose heritability estimates. Intuitively, our results show that increasing the mean and variance of glucose levels is more likely to cause pathologically high glucose levels than increase in the mean offset by a decrease in variance.

The Id, Ego and Super-Ego in "Pride and Prejudice"

Science.gov (United States)

Liang, Yamin

2011-01-01

This paper mainly analyses the the id, ego, and super-ego which exists in the main character Elizabeth from several aspects, such as her pursuit for love, her prejudice towards Mr. Darcy, and the changes in her attitudes towards Wickham. This analysis helps readers appreciate this masterpiece from a different aspect which is related to the…

A decade of user operation on the macromolecular crystallography MAD beamline ID14-4 at the ESRF

International Nuclear Information System (INIS)

McCarthy, Andrew A.; Brockhauser, Sandor; Nurizzo, Didier; Theveneau, Pascal; Mairs, Trevor; Spruce, Darren; Guijarro, Matias; Lesourd, Marc; Ravelli, Raimond B. G.; McSweeney, Sean

2009-01-01

The improvement of the X-ray beam quality achieved on ID14-4 by the installation of new X-ray optical elements is described. ID14-4 at the ESRF is the first tunable undulator-based macromolecular crystallography beamline that can celebrate a decade of user service. During this time ID14-4 has not only been instrumental in the determination of the structures of biologically important molecules but has also contributed significantly to the development of various instruments, novel data collection schemes and pioneering radiation damage studies on biological samples. Here, the evolution of ID14-4 over the last decade is presented, and some of the major improvements that were carried out in order to maintain its status as one of the most productive macromolecular crystallography beamlines are highlighted. The experimental hutch has been upgraded to accommodate a high-precision diffractometer, a sample changer and a large CCD detector. More recently, the optical hutch has been refurbished in order to improve the X-ray beam quality on ID14-4 and to incorporate the most modern and robust optical elements used at other ESRF beamlines. These new optical elements will be described and their effect on beam stability discussed. These studies may be useful in the design, construction and maintenance of future X-ray beamlines for macromolecular crystallography and indeed other applications, such as those planned for the ESRF upgrade

Overview of the ID, EPI and REL tasks of BioNLP Shared Task 2011

Directory of Open Access Journals (Sweden)

Pyysalo Sampo

2012-06-01

Full Text Available Abstract We present the preparation, resources, results and analysis of three tasks of the BioNLP Shared Task 2011: the main tasks on Infectious Diseases (ID and Epigenetics and Post-translational Modifications (EPI, and the supporting task on Entity Relations (REL. The two main tasks represent extensions of the event extraction model introduced in the BioNLP Shared Task 2009 (ST'09 to two new areas of biomedical scientific literature, each motivated by the needs of specific biocuration tasks. The ID task concerns the molecular mechanisms of infection, virulence and resistance, focusing in particular on the functions of a class of signaling systems that are ubiquitous in bacteria. The EPI task is dedicated to the extraction of statements regarding chemical modifications of DNA and proteins, with particular emphasis on changes relating to the epigenetic control of gene expression. By contrast to these two application-oriented main tasks, the REL task seeks to support extraction in general by separating challenges relating to part-of relations into a subproblem that can be addressed by independent systems. Seven groups participated in each of the two main tasks and four groups in the supporting task. The participating systems indicated advances in the capability of event extraction methods and demonstrated generalization in many aspects: from abstracts to full texts, from previously considered subdomains to new ones, and from the ST'09 extraction targets to other entities and events. The highest performance achieved in the supporting task REL, 58% F-score, is broadly comparable with levels reported for other relation extraction tasks. For the ID task, the highest-performing system achieved 56% F-score, comparable to the state-of-the-art performance at the established ST'09 task. In the EPI task, the best result was 53% F-score for the full set of extraction targets and 69% F-score for a reduced set of core extraction targets, approaching a level

Cell culture compositions

Science.gov (United States)

Dunn-Coleman, Nigel; Goedegebuur, Frits; Ward, Michael; Yiao, Jian

2014-03-18

The present invention provides a novel endoglucanase nucleic acid sequence, designated egl6 (SEQ ID NO:1 encodes the full length endoglucanase; SEQ ID NO:4 encodes the mature form), and the corresponding endoglucanase VI amino acid sequence ("EGVI"; SEQ ID NO:3 is the signal sequence; SEQ ID NO:2 is the mature sequence). The invention also provides expression vectors and host cells comprising a nucleic acid sequence encoding EGVI, recombinant EGVI proteins and methods for producing the same.

Identity-level representations affect unfamiliar face matching performance in sequential but not simultaneous tasks.

Science.gov (United States)

Menon, Nadia; White, David; Kemp, Richard I

2015-01-01

According to cognitive and neurological models of the face-processing system, faces are represented at two levels of abstraction. First, image-based pictorial representations code a particular instance of a face and include information that is unrelated to identity-such as lighting, pose, and expression. Second, at a more abstract level, identity-specific representations combine information from various encounters with a single face. Here we tested whether identity-level representations mediate unfamiliar face matching performance. Across three experiments we manipulated identity attributions to pairs of target images and measured the effect on subsequent identification decisions. Participants were instructed that target images were either two photos of the same person (1ID condition) or photos of two different people (2ID condition). This manipulation consistently affected performance in sequential matching: 1ID instructions improved accuracy on "match" trials and caused participants to adopt a more liberal response bias than the 2ID condition. However, this manipulation did not affect performance in simultaneous matching. We conclude that identity-level representations, generated in working memory, influence the amount of variation tolerated between images, when making identity judgements in sequential face matching.

A case control association study of ACE gene polymorphism (I/D) with hypertension in Punjabi population from Faisalabad, Pakistan.

Science.gov (United States)

Hussain, Misbah; Awan, Fazli Rabbi; Gujjar, Amna; Hafeez, Shakir; Islam, Mehboob

2018-01-01

Angiotensin converting enzyme (ACE) is a key component of renin angiotensin aldosterone system. It converts angiotensin I to angiotensin II. Insertion/deletion (I/D) polymorphism of ACE gene is found associated with several complications. However, its association with hypertension and related metabolic diseases is still controversial. So, the aim of the present study was to check this association for Punjabi population from Faisalabad, Pakistan. For this purpose, blood samples (patients = 100, controls = 48) were collected and several biochemical parameters were measured. Genotyping for ACE (I/D) polymorphism was performed by polymerase chain reaction (PCR) assay. ID genotype is found prevalent in the studied population as 41% in control subjects and 61% in patients. Furthermore, chi-square analysis showed significant (p = 0.005) difference for genotypic frequencies between both groups. One-way ANOVA for association of II, ID, and DD genotypes with anthropometric, clinical, and biochemical parameters showed that in patient group, DD genotype is significantly (p = 0.041) associated with systolic blood pressure (SBP). Moreover, ID genotype is found associated with the presence of cardiovascular diseases. This study concludes that DD genotype is strongly associated with higher SBP in hypertensive patients.

Evaluating and Redesigning Teaching Learning Sequences at the Introductory Physics Level

Science.gov (United States)

Guisasola, Jenaro; Zuza, Kristina; Ametller, Jaume; Gutierrez-Berraondo, José

2017-01-01

In this paper we put forward a proposal for the design and evaluation of teaching and learning sequences in upper secondary school and university. We will connect our proposal with relevant contributions on the design of teaching sequences, ground it on the design-based research methodology, and discuss how teaching and learning sequences designed…

Extended RF shimming: Sequence-level parallel transmission optimization applied to steady-state free precession MRI of the heart.

Science.gov (United States)

Beqiri, Arian; Price, Anthony N; Padormo, Francesco; Hajnal, Joseph V; Malik, Shaihan J

2017-06-01

Cardiac magnetic resonance imaging (MRI) at high field presents challenges because of the high specific absorption rate and significant transmit field (B 1 + ) inhomogeneities. Parallel transmission MRI offers the ability to correct for both issues at the level of individual radiofrequency (RF) pulses, but must operate within strict hardware and safety constraints. The constraints are themselves affected by sequence parameters, such as the RF pulse duration and TR, meaning that an overall optimal operating point exists for a given sequence. This work seeks to obtain optimal performance by performing a 'sequence-level' optimization in which pulse sequence parameters are included as part of an RF shimming calculation. The method is applied to balanced steady-state free precession cardiac MRI with the objective of minimizing TR, hence reducing the imaging duration. Results are demonstrated using an eight-channel parallel transmit system operating at 3 T, with an in vivo study carried out on seven male subjects of varying body mass index (BMI). Compared with single-channel operation, a mean-squared-error shimming approach leads to reduced imaging durations of 32 ± 3% with simultaneous improvement in flip angle homogeneity of 32 ± 8% within the myocardium. © 2017 The Authors. NMR in Biomedicine published by John Wiley & Sons Ltd.

Vanillin improves scopolamine‑induced memory impairment through restoration of ID1 expression in the mouse hippocampus.

Science.gov (United States)

Lee, Jae-Chul; Kim, In Hye; Cho, Jeong Hwi; Lee, Tae-Kyeong; Park, Joon Ha; Ahn, Ji Hyeon; Shin, Bich Na; Yan, Bing Chun; Kim, Jong-Dai; Jeon, Yong Hwan; Lee, Young Joo; Won, Moo-Ho; Kang, Il Jun

2018-03-01

4-Hydroxy-3-methoxybenzaldehyde (vanillin), contained in a number of species of plant, has been reported to display beneficial effects against brain injuries. In the present study, the impact of vanillin on scopolamine‑induced alterations in cognition and the expression of DNA binding protein inhibitor ID‑1 (ID1), one of the inhibitors of DNA binding/differentiation proteins that regulate gene transcription, in the mouse hippocampus. Mice were treated with 1 mg/kg scopolamine with or without 40 mg/kg vanillin once daily for 4 weeks. Scopolamine‑induced cognitive impairment was observed from 1 week and was deemed to be severe 4 weeks following the administration of scopolamine. However, treatment with vanillin in scopolamine‑treated mice markedly attenuated cognitive impairment 4 weeks following treatment with scopolamine. ID1‑immunoreactive cells were revealed in the hippocampus of vehicle‑treated mice, and were hardly detected 4 weeks following treatment with scopolamine. However, treatment with vanillin in scopolamine‑treated mice markedly restored ID1‑immunoreactive cells and expression 4 weeks subsequent to treatment. The results of the present study suggested that vanillin may be beneficial for cognitive impairment, by preventing the reduction of ID1 expression which may be associated with cognitive impairment.

A estabilização heterodoxa no brasil: idéias e redes políticas

Directory of Open Access Journals (Sweden)

Pio Carlos

2001-01-01

Full Text Available O artigo discute o papel das idéias e das "redes políticas" na explicação do conteúdo de políticas de estabilização no Brasil. As idéias heterodoxas dos economistas da Pontifícia Universidade Católica do Rio de Janeiro (PUC-RJ são apresentadas e comparadas ao conteúdo de dois programas de estabilização implementados no país: o Plano Cruzado (1986 e o Plano Real (desde 1993. Variáveis políticas são apontadas para explicar por que o segundo programa apresenta maior semelhança com as idéias originais dos economistas do que o primeiro, o que, segundo o autor, explica, em grande medida, seu maior êxito em reduzir a inflação.

Urinary hepcidin level as an early predictor of iron deficiency in children: A case control study

Directory of Open Access Journals (Sweden)

Gharib Amal F

2011-08-01

Full Text Available Abstract Background The ideal screening test would be capable of identifying iron deficiency in the absence of anemia. We tried to detect role of urinary hepcidin-25 level in early prediction of iron deficiency in children. Methods This is a case control study performed on 100 children in Hematology Unit of Pediatric Department, Zagazig University Hospital, Egypt. Our study included 25 cases of iron deficiency (ID stage-1 (iron depletion, 25 cases ID stage-2 (iron-deficient erythropoiesis, 25 cases ID stage-3 (iron deficiency anemia and 25 healthy children as a control group. Estimation of iron status parameters was done. Urinary hepcidin-25 level was detected. Results Urinary hepcidin-25 level was significantly lower in all stages of iron deficiency than in control group, more significant reduction in its level was observed with the progress in severity of iron deficiency. Urinary hepcidin showed significant positive correlation with hemoglobin, mean corpuscular volume, hematocrit value, serum iron and ferritin and transferrin saturation. In contrary, it showed significant negative correlation with serum transferrin and total iron binding capacity. Urinary hepcidin at cutoff point ≤0.94 nmol/mmol Cr could Predict ID stage-1 with sensitivity 88% and specificity 88%. Cutoff point ≤0.42 nmol/mmol Cr could predict ID stage-2 with sensitivity 96% and specificity 92%. Cutoff point ≤0.08 nmol/mmol Cr could Predict ID stage-3 with Sensitivity 96% and specificity 100%. Conclusions We can conclude that detection of urinary hepcidin-25 level was a simple and non invasive test and could predict iron deficiency very early, before appearance of hematological affections.

ORCID Integration: Services to Create and Use ORCID IDs at KAUST

KAUST Repository

Grenz, Daryl M.

2015-06-09

As ORCID IDs become accepted as a global standard, the potential benefits to researchers and institutions of making use of them are multiplying. At King Abdullah University of Science and Technology (KAUST) we adopted the first institutional open access policy in the Arab region in June 2014 and are integrating with ORCID as part of services to researchers that improve the preservation and dissemination of their research. We started by using ORCID IDs to identify authors in our institutional repository. Our next step was to join ORCID as an institutional member and then set up a plan to support our faculty, researchers and students in the creation and use of ORCID identifiers. This presentation will look at the choices made and lessons learned during this process, focusing on the tools we developed to interact with the ORCID member API and the ways in which introducing ORCID has complemented other repository initiatives, such as the implementation of our institutional open access policy.

A Neighborhood Condition for Fractional ID-[A, B]-Factor-Critical Graphs

Directory of Open Access Journals (Sweden)

Zhou Sizhong

2016-05-01

Full Text Available Let G be a graph of order n, and let a and b be two integers with 1 ≤ a ≤ b. Let h : E(G → [0, 1] be a function. If a ≤ ∑e∋x h(e ≤ b holds for any x ∈ V (G, then we call G[Fh] a fractional [a, b]-factor of G with indicator function h, where Fh = {e ∈ E(G : h(e > 0}. A graph G is fractional independent-set-deletable [a, b]-factor-critical (in short, fractional ID-[a, b]- factor-critical if G − I has a fractional [a, b]-factor for every independent set I of G. In this paper, it is proved that if for any two nonadjacent vertices x, y ∈ V (G, then G is fractional ID-[a, b]-factor-critical. Furthermore, it is shown that this result is best possible in some sense.

Understanding low levels of physical activity in people with intellectual disabilities : A systematic review to identify barriers and facilitators

NARCIS (Netherlands)

Bossink, Leontien; van der Putten, Annette; Vlaskamp, Carla

2017-01-01

Background: People with intellectual disabilities (ID) undertake extremely low levels of physical activity. Aims: To enhance understanding concerning low levels of physical activity in people with ID, this study has three aims: (1) to identify barriers to and facilitators of physical activity in

ID-kaart on mugav ja praktiline dokument / Heiki Raudla

Index Scriptorium Estoniae

Raudla, Heiki, 1949-

2001-01-01

Ilmunud ka: Severnoje Poberezhje 12. okt., lk. 2; Lääne Elu 13. okt., lk. 2; Hiiumaa 13. okt., lk. 2; Koit 16. okt., lk. 6; Nädaline 16. okt., lk. 4; Sakala 18. okt., lk. 2; Valgamaalane 18. okt., lk. 2; Pjarnuskii Ekspress 12. okt., lk. 2; Meie Maa 19. okt., lk. 2; Hiiu Leht 23. okt., lk. 2; Järva Teataja 30. okt., lk. 2. Siseministri nõunik Heiki Raudla ID-kaardist

Photograms of a city: a didactic sequency to avanced level in SFL

Directory of Open Access Journals (Sweden)

Yanet Portes-Fernández

2016-10-01

Full Text Available The present work shows a designed proposal with the objective of contributing with the teaching learning process of Spanish as Foreign Language (SFL in Santiago of Cuba. It takes into consideration the relevance, practicality and impact of the audiovisual materials –but only those that are considered authentic materials- in education, with a particular emphasis on language classrooms. In this sense, it focuses on the utility of the aforementioned materials to deal with the cultural component, for which a didactic sequence has been elaborated of the short film Cuando vuelvo. The proposal is particularly targeted towards the advanced level.

76 FR 43196 - Implementation of the Truth in Caller ID Act

Science.gov (United States)

2011-07-20

... National Network to End Domestic Violence (NNEDV) that the term ``harm'' is a broad concept that... evolution of technology, and the consequences of spoofing ANI and pseudo-ANI, we find that the delivery of... ID spoofing to protect victims of domestic violence. According to NNEDV, a verification requirement...

Molecular characterization, sequence analysis and tissue expression of a porcine gene – MOSPD2

Directory of Open Access Journals (Sweden)

Yang Jie

2017-01-01

Full Text Available The full-length cDNA sequence of a porcine gene, MOSPD2, was amplified using the rapid amplification of cDNA ends method based on a pig expressed sequence tag sequence which was highly homologous to the coding sequence of the human MOSPD2 gene. Sequence prediction analysis revealed that the open reading frame of this gene encodes a protein of 491 amino acids that has high homology with the motile sperm domain-containing protein 2 (MOSPD2 of five species: horse (89%, human (90%, chimpanzee (89%, rhesus monkey (89% and mouse (85%; thus, it could be defined as a porcine MOSPD2 gene. This novel porcine gene was assigned GeneID: 100153601. This gene is structured in 15 exons and 14 introns as revealed by computer-assisted analysis. The phylogenetic analysis revealed that the porcine MOSPD2 gene has a closer genetic relationship with the MOSPD2 gene of horse. Tissue expression analysis indicated that the porcine MOSPD2 gene is generally and differentially expressed in the spleen, muscle, skin, kidney, lung, liver, fat and heart. Our experiment is the first to establish the primary foundation for further research on the porcine MOSPD2 gene.

Insertion/Deletion Polymorphisms and Serum Angiotensin-converting Enzyme Levels in Iranian Patients with Sarcoidosis

Science.gov (United States)

JAVADI, Alireza; SHAMAEI, Masoud; ZAREI, Masoud; REZAEIAN, Lida; KIANI, Arda; ABEDINI, Atefeh

2016-01-01

Background: Sarcoidosis is a multisystem inflammatory disease of unknown origin with characterization of small granulomas. Angiotensin-converting enzyme (ACE) is a pathophysiologic marker of sarcoidosis. We present the ACE insertion/deletion (I/D) polymorphism in correlation with serum ACE level in Iranian patients with sarcoidosis. Methods: From Jan 2014 to Jan 2015, 102 Iranian patients who histopathologically diagnosed for sarcoidosis and 192 healthy age and sex-matched controls were recruited. PCR was used for detection of I/D polymorphism in ACE gene. Results: Frequency of II/ID/DD genotype in sarcoidosis disease was 17%, 35.5%, and 47.1%, respectively. The frequency of D allele was 0.65. A significant association between I/D genotypes and mean of sACE level was seen (DD=85.2±22.9, P<0.001). More frequent genotype in sarcoidosis patients was DD (47%), ID genotype (45.9%) was found more in controls. Logistic regression analysis adjusting age and sex showed that ID to II (OR=0.35, 95%CI=0.17–0.73, P=0.005) and DD to II (OR=2.11, 95%CI=0.98–4.54, P=0.05) could be considered as a predictor factor for the disease activity. No significant model for men in sarcoidosis group was seen, while women with II/ID were associated with a reduced risk for the disease. Conclusion: Although more regional studies with appropriate statistical scale must be done to provide a better diagnosis and prognostic tool for this disease, this study demonstrates that ID and DD genotype could be predictive factors for sarcoidosis. PMID:28032065

Application of whole-exome sequencing to unravel the molecular basis of undiagnosed syndromic congenital neutropenia with intellectual disability.

Science.gov (United States)

Gauthier-Vasserot, Alexandra; Thauvin-Robinet, Christel; Bruel, Ange-Line; Duffourd, Yannis; St-Onge, Judith; Jouan, Thibaud; Rivière, Jean-Baptiste; Heron, Delphine; Donadieu, Jean; Bellanné-Chantelot, Christine; Briandet, Claire; Huet, Frédéric; Kuentz, Paul; Lehalle, Daphné; Duplomb-Jego, Laurence; Gautier, Elodie; Maystadt, Isabelle; Pinson, Lucile; Amram, Daniel; El Chehadeh, Salima; Melki, Judith; Julia, Sophia; Faivre, Laurence; Thevenon, Julien

2017-01-01

Neutropenia can be qualified as congenital when of neonatal onset or when associated with extra-hematopoietic manifestations. Overall, 30% of patients with congenital neutropenia (CN) remain without a molecular diagnosis after a multidisciplinary consultation and tedious diagnostic strategy. In the rare situations when neutropenia is identified and associated with intellectual disability (ID), there are few diagnostic hypotheses to test. This retrospective multicenter study reports on a clinically heterogeneous cohort of 10 unrelated patients with CN associated with ID and no molecular diagnosis prior to whole-exome sequencing (WES). WES provided a diagnostic yield of 40% (4/10). The results suggested that in many cases neutropenia and syndromic manifestations could not be assigned to the same molecular alteration. Three sub-groups of patients were highlighted: (i) severe, symptomatic chronic neutropenia, detected early in life, and related to a known mutation in the CN spectrum (ELANE); (ii) mild to moderate benign intermittent neutropenia, detected later, and associated with mutations in genes implicated in neurodevelopmental disorders (CHD2, HUWE1); and (iii) moderate to severe intermittent neutropenia as a probably undiagnosed feature of a newly reported syndrome (KAT6A). Unlike KAT6A, which seems to be associated with a syndromic form of CN, the other reported mutations may not explain the entire clinical picture. Although targeted gene sequencing can be discussed for the primary diagnosis of severe CN, we suggest that performing WES for the diagnosis of disorders associating CN with ID will not only provide the etiological diagnosis but will also pave the way towards personalized care and follow-up. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

Marked induction of the helix-loop-helix protein Id3 promotes the gammadelta T cell fate and renders their functional maturation Notch independent

DEFF Research Database (Denmark)

Lauritsen, Jens Peter Holst; Wong, Gladys W; Lee, Sang-Yun

2009-01-01

)-inhibitor of DNA binding 3 (Id3) pathway plays a defining role in this process. In particular, Id3 expression served to regulate adoption of the gammadelta fate. Moreover, Id3 was both necessary and sufficient to enable gammadelta-lineage cells to differentiate independently of Notch signaling and become competent...

5'-end sequences of budding yeast full-length cDNA clones - Budding yeast cDNA sequencing project | LSDB Archive [Life Science Database Archive metadata

Lifescience Database Archive (English)

Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.

Genetic characterization of Venezuelan equine encephalitis virus from Bolivia, Ecuador and Peru: identification of a new subtype ID lineage.

Science.gov (United States)

Aguilar, Patricia V; Adams, A Paige; Suárez, Victor; Beingolea, Luis; Vargas, Jorge; Manock, Stephen; Freire, Juan; Espinoza, Willan R; Felices, Vidal; Diaz, Ana; Liang, Xiaodong; Roca, Yelin; Weaver, Scott C; Kochel, Tadeusz J

2009-09-15

Venezuelan equine encephalitis virus (VEEV) has been responsible for hundreds of thousands of human and equine cases of severe disease in the Americas. A passive surveillance study was conducted in Peru, Bolivia and Ecuador to determine the arboviral etiology of febrile illness. Patients with suspected viral-associated, acute, undifferentiated febrile illness of Peru, and more recently (2005), in Madre de Dios, Peru. We performed phylogenetic analyses with VEEV from Bolivia, Ecuador and Peru and compared their relationships to strains from other parts of South America. We found that VEEV subtype ID Panama/Peru genotype is the predominant one circulating in Peru. We also demonstrated that VEEV subtype ID strains circulating in Ecuador belong to the Colombia/Venezuela genotype and VEEV from Madre de Dios, Peru and Cochabamba, Bolivia belong to a new ID genotype. In summary, we identified a new major lineage of enzootic VEEV subtype ID, information that could aid in the understanding of the emergence and evolution of VEEV in South America.

Automatic ID heat load generation in ANSYS code

International Nuclear Information System (INIS)

Wang, Zhibi.

1992-01-01

Detailed power density profiles are critical in the execution of a thermal analysis using a finite element (FE) code such as ANSYS. Unfortunately, as yet there is no easy way to directly input the precise power profiles into ANSYS. A straight-forward way to do this is to hand-calculate the power of each node or element and then type the data into the code. Every time a change is made to the FE model, the data must be recalculated and reentered. One way to solve this problem is to generate a set of discrete data, using another code such as PHOTON2, and curve-fit the data. Using curve-fitted formulae has several disadvantages. It is time consuming because of the need to run a second code for generation of the data, curve-fitting, and doing the data check, etc. Additionally, because there is no generality for different beamlines or different parameters, the above work must be repeated for each case. And, errors in the power profiles due to curve-fitting result in errors in the analysis. To solve the problem once and for all and with the capability to apply to any insertion device (ID), a program for ED power profile was written in ANSYS Parametric Design Language (APDL). This program is implemented as an ANSYS command with input parameters of peak magnetic field, deflection parameter, length of ID, and distance from the source. Once the command is issued, all the heat load will be automatically generated by the code

Wicked ID: Conceptual Framework for Considering Instructional Design as a Wicked Problem

Directory of Open Access Journals (Sweden)

Katrin Becker

2007-02-01

Full Text Available The process of instructional design has parallels in other design disciplines. Software design is one that has experienced intense attention in the last 30 or so years, and many lessons learned there can be applied to ID. Using software design as a springboard, this concept paper seeks to propose a new approach to ID. It suggests that instructional design is almost always a Wicked Problem. The connection is formed between Wicked Problems as first described by Rittel and Webber in 1973, and the models in and processes of instructional design. The areas of social planning, organizational management and software design all posses some accepted and tested approaches to the solution of Wicked Problems. These will be described, and how they can be applied to ID will be explained. Finally, this paper will propose a meta-model for ID and explain how it can be used in the current context. Résumé : Le processus de conception pédagogique a des similitudes avec d’autres disciplines. La conception de logiciels a fait l’objet d’une grande attention dans les trente dernières années et de nombreuses leçons tirées peuvent s’appliquer à la conception pédagogique. En se basant sur la conception de logiciels, cet article cherche à proposer une nouvelle méthode à la conception pédagogique. Il laisse entendre que la conception pédagogique constitue presque toujours un problème épineux. Le lien est formé entre les problèmes épineux tels que décrits par Rittel et Webber en 1973 et les modèles et processus de la conception pédagogique. Les secteurs de l’organisation sociale, de la gestion des organisations et de la conception de logiciels comptent des méthodes acceptées et validées à la résolution de problèmes épineux. Nous les décrirons et expliquerons comment ils peuvent servir à la conception pédagogique. Enfin, l’article proposera un meta-modèle de la conception pédagogique et expliquera comment il peut servir dans le

BMP-6 inhibits growth of mature human B cells; induction of Smad phosphorylation and upregulation of Id1

Directory of Open Access Journals (Sweden)

Kersten Christian

2005-05-01

Full Text Available Abstract Background Bone morphogenetic proteins (BMPs belong to the TGF-β superfamily and are secreted proteins with pleiotropic roles in many different cell types. A potential role of BMP-6 in the immune system has been implied by various studies of malignant and rheumatoid diseases. In the present study, we explored the role of BMP-6 in normal human peripheral blood B cells. Results The B cells were found to express BMP type I and type II receptors and BMP-6 rapidly induced phosphorylation of Smad1/5/8. Furthermore, Smad-phosphorylation was followed by upregulation of Id1 mRNA and Id1 protein, whereas Id2 and Id3 expression was not affected. Furthermore, we found that BMP-6 had an antiproliferative effect both in naïve (CD19+CD27- and memory B cells (CD19+CD27+ stimulated with anti-IgM alone or the combined action of anti-IgM and CD40L. Additionally, BMP-6 induced cell death in activated memory B cells. Importantly, the antiproliferative effect of BMP-6 in B-cells was completely neutralized by the natural antagonist, noggin. Furthermore, B cells were demonstrated to upregulate BMP-6 mRNA upon stimulation with anti-IgM. Conclusion In mature human B cells, BMP-6 inhibited cell growth, and rapidly induced phosphorylation of Smad1/5/8 followed by an upregulation of Id1.

Consecutive epigenetically-active agent combinations act in ID1-RUNX3-TET2 and HOXA pathways for Flt3ITD+ve AML.

Science.gov (United States)

Sayar, Hamid; Liu, Yan; Gao, Rui; Zaid, Mohammad Abu; Cripe, Larry D; Weisenbach, Jill; Sargent, Katie J; Nassiri, Mehdi; Li, Lang; Konig, Heiko; Suvannasankha, Attaya; Pan, Feng; Shanmugam, Rajasubramaniam; Goswami, Chirayu; Kapur, Reuben; Xu, Mingjiang; Boswell, H Scott

2018-01-19

Co-occurrence of Flt3ITD and TET2 mutations provoke an animal model of AML by epigenetic repression of Wnt pathway antagonists, including RUNX3, and by hyperexpression of ID1, encoding Wnt agonist. These affect HOXA over-expression and treatment resistance. A comparable epigenetic phenotype was identified among adult AML patients needing novel intervention. We chose combinations of targeted agents acting on distinct effectors, at the levels of both signal transduction and chromatin remodeling, in relapsed/refractory AML's, including Flt3ITD+ve, described with a signature of repressed tumor suppressor genes, involving Wnt antagonist RUNX3 , occurring along with ID1 and HOXA over-expressions. We tracked patient response to combination of Flt3/Raf inhibitor, Sorafenib, and Vorinostat, pan-histone deacetylase inhibitor, without or with added Bortezomib, in consecutive phase I trials. A striking association of rapid objective remissions (near-complete, complete responses) was noted to accompany induced early pharmacodynamic changes within patient blasts in situ, involving these effectors, significantly linking RUNX3 /Wnt antagonist de-repression (80%) and ID1 downregulation (85%), to a response, also preceded by profound HOXA9 repression. Response occurred in context of concurrent TET2 mutation/hypomorphy and Flt3ITD+ve mutation (83% of complete responses). Addition of Bortezomib to the combination was vital to attainment of complete response in Flt3ITD+ve cases exhibiting such Wnt pathway dysregulation.

Protective effects of ID331 Triticum monococcum gliadin on in vitro models of the intestinal epithelium.

Science.gov (United States)

Iacomino, Giuseppe; Di Stasio, Luigia; Fierro, Olga; Picariello, Gianluca; Venezia, Antonella; Gazza, Laura; Ferranti, Pasquale; Mamone, Gianfranco

2016-12-01

A growing interest in developing new strategies for preventing coeliac disease has motivated efforts to identify cereals with null or reduced toxicity. In the current study, we investigate the biological effects of ID331 Triticum monococcum gliadin-derived peptides in human Caco-2 intestinal epithelial cells. Triticum aestivum gliadin derived peptides were employed as a positive control. The effects on epithelial permeability, zonulin release, viability, and cytoskeleton reorganization were investigated. Our findings confirmed that ID331 gliadin did not enhance permeability and did not induce zonulin release, cytotoxicity or cytoskeleton reorganization of Caco-2 cell monolayers. We also demonstrated that ID331 ω-gliadin and its derived peptide ω(105-123) exerted a protective action, mitigating the injury of Triticum aestivum gliadin on cell viability and cytoskeleton reorganization. These results may represent a new opportunity for the future development of innovative strategies to reduce gluten toxicity in the diet of patients with gluten intolerance. Copyright © 2016 Elsevier Ltd. All rights reserved.

An ID-based Blind Signature Scheme from Bilinear Pairings

OpenAIRE

B.Umaprasada Rao; K.A.Ajmath

2010-01-01

Blind signatures, introduced by Chaum, allow a user to obtain a signature on a message without revealing any thing about the message to the signer. Blind signatures play on important role in plenty of applications such as e-voting, e-cash system where anonymity is of great concern. Identity based(ID-based) public key cryptography can be a good alternative for certified based public key setting, especially when efficient key management and moderate security are required. In this paper, we prop...

Calling genotypes from public RNA-sequencing data enables identification of genetic variants that affect gene-expression levels

NARCIS (Netherlands)

Deelen, Patrick; Zhernakova, Daria V.; de Haan, Mark; van der Sijde, Marijke; Bonder, Marc Jan; Karjalainen, Juha; van der Velde, K. Joeri; Abbott, Kristin M.; Fu, Jingyuan; Wijmenga, Cisca; Sinke, Richard J.; Swertz, Morris A.; Franke, Lude

2015-01-01

Background: RNA-sequencing (RNA-seq) is a powerful technique for the identification of genetic variants that affect gene-expression levels, either through expression quantitative trait locus (eQTL) mapping or through allele-specific expression (ASE) analysis. Given increasing numbers of RNA-seq

A Design-Based Research Case Study Documenting a Constructivist ID Process and Instructional Solution for a Cross-Cultural Workforce

Science.gov (United States)

Tracey, Monica W.; Unger, Kelly L.

2012-01-01

As the need for instructing a globalized workforce increases, instructional designers must embrace the constraints and the opportunities these projects provide in order to move the field of cross-cultural instructional design (ID) forward. Cross-cultural projects offer multiple avenues for growth in ID practice, overcoming cultural barriers, and a…

Robust Fourier Watermarking for ID Images on Smart Card Plastic Supports

Directory of Open Access Journals (Sweden)

RIAD, R.

2016-11-01

Full Text Available Security checking can be improved by watermarking identity (ID images printed on smart cards plastic supports. The major challenge is resistance to attacks: printing the images on the plastic cards, durability and other attacks then scanning the image from the plastic card. In this work, a robust watermarking technique is presented in this context. It is composed of three main mechanisms. The first is a watermarking algorithm based on the Fourier transform to cope with global geometric distortions. The second comprises a filter that reduces image blurring. The third attenuates color degradations. Experiments on 400 ID images show that the Wiener filter strongly improves the detection rate and outperforms competitive algorithms (blind deconvolution and unsharp filter. Color corrections also enhance the watermarking score. The whole scheme has a high efficiency and a low computational cost. It makes it compatible with the desired industrial constraints, i.e. the watermark is to be invisible, the error rate must be lower than 1%, and the detection of the mark should be fast and simple for the user.

Measuring symptoms of post-traumatic stress disorder in people with intellectual disabilities: the development and psychometric properties of the Impact of Event Scale-Intellectual Disabilities (IES-IDs).

Science.gov (United States)

Hall, James C; Jobson, Laura; Langdon, Peter E

2014-09-01

The aims of the study were to (1) revise the Impact of Event Scale-Revised for use with people with intellectual disabilities (IDs), creating the Impact of Event Scale-Intellectual Disabilities (IES-IDs), (2) assess the reliability of the IES-IDs, and (3) compare the IES-IDs to an existing measure trauma-related symptomatology, namely the Lancaster and Northgate Trauma Scale (LANTS), along with measures of anxiety and depression. Forty adults with IDs who had experienced at least one traumatic event were recruited and completed the IES-IDs and the LANTS on two occasions, separated by 2 weeks. Participants also completed the Glasgow Depression Scale and the Glasgow Anxiety Scale, along with the Trauma Information Form which was used to collect information about trauma history. Fifteen per cent of the sample had encountered five or more traumatic events. The IES-IDs and the LANTS had good to excellent internal consistency and test-retest reliability. Both measures correlated with self-report measures of depression and anxiety, although the strength of this correlation was greater with the LANTS. There was a significant positive correlation between trauma frequency and the IES-IDs, while trauma frequency did not correlate with the LANTS. Both the IES-IDs and the LANTS appear to have good reliability. There is a lack of well-developed questionnaires that can be used to assess symptoms of post-traumatic stress disorder (PTSD) in people with intellectual disabilities. The Impact of Event Scale-Revised was augmented creating the Impact of Event Scale-Intellectual Disabilities (IES-IDs). The IES-IDs was shown to have good psychometric properties. The IES-IDs was compared to the Lancaster and Northgate Trauma Scale (LANTS), but the LANTS did not correlate with trauma frequency. However, this study had a small sample size, and a much larger study is needed to examine the factor structure of both the IES-IDs and the LANTS. Future studies should attempt to recruit people with

Levels of integration in cognitive control and sequence processing in the prefrontal cortex.

Science.gov (United States)

Bahlmann, Jörg; Korb, Franziska M; Gratton, Caterina; Friederici, Angela D

2012-01-01

Cognitive control is necessary to flexibly act in changing environments. Sequence processing is needed in language comprehension to build the syntactic structure in sentences. Functional imaging studies suggest that sequence processing engages the left ventrolateral prefrontal cortex (PFC). In contrast, cognitive control processes additionally recruit bilateral rostral lateral PFC regions. The present study aimed to investigate these two types of processes in one experimental paradigm. Sequence processing was manipulated using two different sequencing rules varying in complexity. Cognitive control was varied with different cue-sets that determined the choice of a sequencing rule. Univariate analyses revealed distinct PFC regions for the two types of processing (i.e. sequence processing: left ventrolateral PFC and cognitive control processing: bilateral dorsolateral and rostral PFC). Moreover, in a common brain network (including left lateral PFC and intraparietal sulcus) no interaction between sequence and cognitive control processing was observed. In contrast, a multivariate pattern analysis revealed an interaction of sequence and cognitive control processing, such that voxels in left lateral PFC and parietal cortex showed different tuning functions for tasks involving different sequencing and cognitive control demands. These results suggest that the difference between the process of rule selection (i.e. cognitive control) and the process of rule-based sequencing (i.e. sequence processing) find their neuronal underpinnings in distinct activation patterns in lateral PFC. Moreover, the combination of rule selection and rule sequencing can shape the response of neurons in lateral PFC and parietal cortex.

ID2 mediates the transforming growth factor-β1-induced Warburg-like effect seen in the peritoneum of women with endometriosis.

Science.gov (United States)

Young, Vicky J; Ahmad, Syed F; Brown, Jeremy K; Duncan, W Colin; Horne, Andrew W

2016-09-01

Is inhibitor of DNA-binding protein 2 (ID2) a mediator of the transforming growth factor (TGF)-β1-induced Warburg-like effect seen in the peritoneum of women with endometriosis? The TGF-β1-induced changes in the metabolic phenotype of peritoneal mesothelial cells from women with endometriosis are mediated through the ID2 pathway. TGF-β1 induces the metabolic conversion of glucose to lactate via aerobic glycolysis (the 'Warburg effect') in the peritoneum of women with endometriosis, through increased expression of the transcription factor hypoxia inducible factor α (HIF-1α). ID proteins are transcriptional targets of TGF-β1. Expression of ID2 was investigated in luteal phase peritoneal biopsies from women with regular menstrual cycles, with and without endometriosis (n = 8-10 each group) by quantitative RT-PCR (qRT-PCR) and immunohistochemistry. ID2 mRNA expression in primary human peritoneal mesothelial cells (HPMC) and immortalized mesothelial cells (MeT-5A) was assessed by qRT-PCR (n = 6). The effects of TGF-β1 and ID2 siRNA on HIF-1α mRNA expression and lactate secretion was assessed using qRT-PCR and a colorimetric lactate assay. ID2 is localized to peritoneal mesothelial and stromal cells of women with and without endometriosis. ID2 mRNA expression is lower in peritoneum adjacent to the endometriosis lesions compared to distal sites (P endometriosis. None. This work was funded by a Wellbeing of Women research grant (R42533) awarded to A.W.H., J.K.B. and W.C.D.; and an MRC Centre Grant G1002033. V.J.Y. received grant support from Federation of Women Graduates (134225) and a PhD studentship from the College of Medicine and Veterinary Medicine at the University of Edinburgh. There are no competing interests to declare. © The Author 2016. Published by Oxford University Press on behalf of the European Society of Human Reproduction and Embryology. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Molecular characterization of lactobacilli isolated from fermented idli batter

Directory of Open Access Journals (Sweden)

Perumal Jayaprabha Agaliya

2013-12-01

Full Text Available Lactic acid bacteria are non pathogenic organism widely distributed in nature typically involved in a large number of spontaneous food fermentation. The purpose of this study was to characterize the bacteriocinogenic lactobacilli from fermented idli batter which can find application in biopreservation and biomedicine. Eight most promising lactobacilli were chosen from twenty two isolates based on their spectrum of activity against other lactic acid bacteria and pathogens. The eight lactobacilli were characterized based on the various classical phenotypic tests, physiological tests and biochemical tests including various carbohydrate utilization profiles. All isolates were homo fermentative, catalase, and gelatin negative. Molecular characterization was performed by RAPD, 16S rRNA analysis, 16S ARDRA, and Multiplex PCR for species identification. RAPD was carried out using the primer R2 and M13. Five different clusters were obtained based on RAPD indicating strain level variation. 16S rRNA analysis showed 99 to 100% homology towards Lactobacillus plantarum. The restriction digestion pattern was similar for all the isolates with the restriction enzyme AluI. The subspecies were identified by performing Multiplex PCR using species specific primer. Among the five clusters, three clusters were clearly identified as Lactobacillus plantarum subsp. plantarum, Lactobacillus pentosus, and Lactobacillus plantarum subsp. argentoratensis.

Expansion and maintenance of human embryonic stem cell–derived endothelial cells by TGFβ inhibition is Id1 dependent

Science.gov (United States)

James, Daylon; Nam, Hyung-song; Seandel, Marco; Nolan, Daniel; Janovitz, Tyler; Tomishima, Mark; Studer, Lorenz; Lee, Gabsang; Lyden, David; Benezra, Robert; Zaninovic, Nikica; Rosenwaks, Zev; Rabbany, Sina Y; Rafii, Shahin

2010-01-01

Previous efforts to differentiate human embryonic stem cells (hESCs) into endothelial cells have not achieved sustained expansion and stability of vascular cells. To define vasculogenic developmental pathways and enhance differentiation, we used an endothelial cell–specific VE-cadherin promoter driving green fluorescent protein (GFP) (hVPr-GFP) to screen for factors that promote vascular commitment. In phase 1 of our method, inhibition of transforming growth factor (TGF)β at day 7 of differentiation increases hVPr-GFP+ cells by tenfold. In phase 2, TGFβ inhibition maintains the proliferation and vascular identity of purified endothelial cells, resulting in a net 36-fold expansion of endothelial cells in homogenous monolayers, which exhibited a transcriptional profile of Id1highVEGFR2highVE-cadherin+ ephrinB2+. Using an Id1-YFP hESC reporter line, we showed that TGFβ inhibition sustains Id1 expression in hESC-derived endothelial cells and that Id1 is required for increased proliferation and preservation of endothelial cell commitment. Our approach provides a serum-free method for differentiation and long-term maintenance of hESC-derived endothelial cells at a scale relevant to clinical application. PMID:20081865

PROYECTOS DE I+D, CARACTERIZACIÓN DEL TIPO DE INVESTIGACIÓN Y EL ROL DE GERENTE DE PROYECTOS

Directory of Open Access Journals (Sweden)

Aníbal N. Cassanelli

2014-12-01

Full Text Available En este artículo se pone de manifiesto la importancia del sector de la I+D y su organización fuertemente proyectizada que la convierte en un área clave para la aplicación de metodologías de gestión de proyectos. Se analizan los modelos de procesos de la I+D para proponer un esquema basado en dominios interrelacionados que permite dar pie a la identificación y caracterización de la investigación básica, aplicada, desarrollo e innovación. A partir de ahí, se comparan las competencias entre el gestor de proyectos general y los investigadores principales (gestores de proyectos de I+D de facto. Se concluye que existe una gran diferencia entre conocimientos y competencias requeridos para la gestión. Se muestran las dos tendencias que existen en el sector de I+D y la propuesta de separación del roles y la creación de una nueva figura distintiva del investigador principal que se ocupe de la gestión de proyectos.

VIPP-LD: A promising Video Feedback intervention program for parents with ID

NARCIS (Netherlands)

Hodes, M.W.; Kef, S.; Meppelder, H.M.; Schuengel, C.

2012-01-01

Aim: Parenting support has been shown to be of benefit to parents with intellectual disabilities (ID) on several outcomes; however, effects on parent-child interaction in the form of sensitive responsiveness and positive inductive discipline are still under debate. This study tested the effects of an

Validation of the Inventory of Depressive Symptomatology (IDS) in Cocaine Dependent Inmates.

Science.gov (United States)

Suris, Alina; Kashner, T. Michael; Gillaspy, James A., Jr.; Biggs, Melanie; Rush, A. John

2001-01-01

While the reliability and validity of Inventory of Depressive Symptomatology (IDS) scores have been established with outpatient adults being treated in community psychiatric clinics, it has not been used in special or dually diagnosed populations. Establishes internal consistency, concurrent validity, and construct validity for both the clinical…

Design and performance of the 2-ID-B scanning x-ray microscope

International Nuclear Information System (INIS)

McNulty, I.

1998-01-01

We have constructed a high resolution scanning x-ray microscope at the 2-ID-B beamline at the Advanced Photon Source for 1-4 keV x-ray imaging and microspectroscopy experiments. The microscope uses a Fresnel zone plate to focus coherent x-ray undulator radiation to a 150 nm focal spot on a sample. The spectral flux in the focus is 10 8 ph/s/0.1% BW. X-ray photons transmitted by the sample are detected by an avalanche photodiode as the sample is scanned to form an absorption image. The sample stage has both coarse and fine translation axes for raster scanning and a rotation axis for microtomography experiments. The incident x-ray beam energy can also be scanned via the 2-ID-B monochromator while the sample is kept in focus to record spatially resolved absorption spectra. We have measured the performance of the instrument with various test objects. The microscope hardware, software, and performance are discussed in this paper

Accelerating next generation sequencing data analysis with system level optimizations.

Science.gov (United States)

Kathiresan, Nagarajan; Temanni, Ramzi; Almabrazi, Hakeem; Syed, Najeeb; Jithesh, Puthen V; Al-Ali, Rashid

2017-08-22

Next generation sequencing (NGS) data analysis is highly compute intensive. In-memory computing, vectorization, bulk data transfer, CPU frequency scaling are some of the hardware features in the modern computing architectures. To get the best execution time and utilize these hardware features, it is necessary to tune the system level parameters before running the application. We studied the GATK-HaplotypeCaller which is part of common NGS workflows, that consume more than 43% of the total execution time. Multiple GATK 3.x versions were benchmarked and the execution time of HaplotypeCaller was optimized by various system level parameters which included: (i) tuning the parallel garbage collection and kernel shared memory to simulate in-memory computing, (ii) architecture-specific tuning in the PairHMM library for vectorization, (iii) including Java 1.8 features through GATK source code compilation and building a runtime environment for parallel sorting and bulk data transfer (iv) the default 'on-demand' mode of CPU frequency is over-clocked by using 'performance-mode' to accelerate the Java multi-threads. As a result, the HaplotypeCaller execution time was reduced by 82.66% in GATK 3.3 and 42.61% in GATK 3.7. Overall, the execution time of NGS pipeline was reduced to 70.60% and 34.14% for GATK 3.3 and GATK 3.7 respectively.

Environmental and state-level regulatory factors affect the incidence of autism and intellectual disability.

Directory of Open Access Journals (Sweden)

Andrey Rzhetsky

2014-03-01

Full Text Available Many factors affect the risks for neurodevelopmental maladies such as autism spectrum disorders (ASD and intellectual disability (ID. To compare environmental, phenotypic, socioeconomic and state-policy factors in a unified geospatial framework, we analyzed the spatial incidence patterns of ASD and ID using an insurance claims dataset covering nearly one third of the US population. Following epidemiologic evidence, we used the rate of congenital malformations of the reproductive system as a surrogate for environmental exposure of parents to unmeasured developmental risk factors, including toxins. Adjusted for gender, ethnic, socioeconomic, and geopolitical factors, the ASD incidence rates were strongly linked to population-normalized rates of congenital malformations of the reproductive system in males (an increase in ASD incidence by 283% for every percent increase in incidence of malformations, 95% CI: [91%, 576%], p<6×10(-5. Such congenital malformations were barely significant for ID (94% increase, 95% CI: [1%, 250%], p = 0.0384. Other congenital malformations in males (excluding those affecting the reproductive system appeared to significantly affect both phenotypes: 31.8% ASD rate increase (CI: [12%, 52%], p<6×10(-5, and 43% ID rate increase (CI: [23%, 67%], p<6×10(-5. Furthermore, the state-mandated rigor of diagnosis of ASD by a pediatrician or clinician for consideration in the special education system was predictive of a considerable decrease in ASD and ID incidence rates (98.6%, CI: [28%, 99.99%], p = 0.02475 and 99% CI: [68%, 99.99%], p = 0.00637 respectively. Thus, the observed spatial variability of both ID and ASD rates is associated with environmental and state-level regulatory factors; the magnitude of influence of compound environmental predictors was approximately three times greater than that of state-level incentives. The estimated county-level random effects exhibited marked spatial clustering, strongly

Três idéias sedutoras e quatro sugestões preciosas: algumas reflexões de Jerome Kagan

Directory of Open Access Journals (Sweden)

José Fernando Bitencourt Lomônaco

Full Text Available São consideradas três idéias, denominadas por Jerome Kagan idéias sedutoras pela sua capacidade de se apresentarem como intuitivamente verdadeiras. A primeira é a de que processos psicológicos tais como inteligência, consciência, etc, podem ser amplamente generalizados para uma ampla gama de situações. A segunda refere-se ao determinismo infantil, à crença de que as primeiras experiências infantis constituem uma influência determinante no desenvolvimento. A terceira é relativa ao princípio do prazer, à noção de que o comportamento humano é regido fundamentalmente pela busca do prazer. Fundamentado em dados de diferentes áreas do conhecimento, Kagan demonstra a falácia de cada uma dessas idéias e apresenta quatro sugestões construtivas para aqueles que trabalham nas ciências sociais e comportamentais.

Expression of the helix-loop-helix protein inhibitor of DNA binding-1 (ID-1) is activated by all-trans retinoic acid in normal human keratinocytes

International Nuclear Information System (INIS)

Villano, C.M.; White, L.A.

2006-01-01

The ID (inhibitor of differentiation or DNA binding) helix-loop-helix proteins are important mediators of cellular differentiation and proliferation in a variety of cell types through regulation of gene expression. Overexpression of the ID proteins in normal human keratinocytes results in extension of culture lifespan, indicating that these proteins are important for epidermal differentiation. Our hypothesis is that the ID proteins are targets of the retinoic acid signaling pathway in keratinocytes. Retinoids, vitamin A analogues, are powerful regulators of cell growth and differentiation and are widely used in the prevention and treatment of a variety of cancers in humans. Furthermore, retinoic acid is necessary for the maintenance of epithelial differentiation and demonstrates an inhibitory action on skin carcinogenesis. We examined the effect of all-trans retinoic acid on expression of ID-1, -2, -3, and -4 in normal human keratinocytes and found that exposure of these cells to all-trans retinoic acid causes an increase in both ID-1 and ID-3 gene expression. Furthermore, our data show that this increase is mediated by increased transcription involving several cis-acting elements in the distal portion of the promoter, including a CREB-binding site, an Egr1 element, and an YY1 site. These data demonstrate that the ID proteins are direct targets of the retinoic acid signaling pathway. Given the importance of the ID proteins to epidermal differentiation, these results suggest that IDs may be mediating some of the effects of all-trans retinoic acid in normal human keratinocytes

Species-level analysis of DNA sequence data from the NIH Human Microbiome Project.

Science.gov (United States)

Conlan, Sean; Kong, Heidi H; Segre, Julia A

2012-01-01

Outbreaks of antibiotic-resistant bacterial infections emphasize the importance of surveillance of potentially pathogenic bacteria. Genomic sequencing of clinical microbiological specimens expands our capacity to study cultivable, fastidious and uncultivable members of the bacterial community. Herein, we compared the primary data collected by the NIH's Human Microbiome Project (HMP) with published epidemiological surveillance data of Staphylococcus aureus. The HMP's initial dataset contained microbial survey data from five body regions (skin, nares, oral cavity, gut and vagina) of 242 healthy volunteers. A significant component of the HMP dataset was deep sequencing of the 16S ribosomal RNA gene, which contains variable regions enabling taxonomic classification. Since species-level identification is essential in clinical microbiology, we built a reference database and used phylogenetic placement followed by most recent common ancestor classification to look at the species distribution for Staphylococcus, Klebsiella and Enterococcus. We show that selecting the accurate region of the 16S rRNA gene to sequence is analogous to carefully selecting culture conditions to distinguish closely related bacterial species. Analysis of the HMP data showed that Staphylococcus aureus was present in the nares of 36% of healthy volunteers, consistent with culture-based epidemiological data. Klebsiella pneumoniae and Enterococcus faecalis were found less frequently, but across many habitats. This work demonstrates that large 16S rRNA survey studies can be used to support epidemiological goals in the context of an increasing awareness that microbes flourish and compete within a larger bacterial community. This study demonstrates how genomic techniques and information could be critically important to trace microbial evolution and implement hospital infection control.

Purification, crystallization and preliminary crystallographic study of an IDS-epimerase from Agrobacterium tumefaciens BY6

International Nuclear Information System (INIS)

Bäuerle, Bettina; Sandalova, Tatyana; Schneider, Gunter; Rieger, Paul-Gerhard

2006-01-01

This is the first report of the crystallization of an IDS-epimerase from A. tumefaciens BY6 and its l-selenomethionine derivative. The initial degradation of all stereoisomers of the complexing agent iminodisuccinate (IDS) is enabled by an epimerase in the bacterial strain Agrobacterium tumefaciens BY6. This protein was produced in Escherichia coli, purified and crystallized by the hanging-drop vapour-diffusion method. Crystals of IDS-epimerase were obtained under several conditions. The best diffracting crystals were grown in 22% PEG 3350, 0.2 M (NH 4 ) 2 SO 4 and 0.1 M bis-Tris propane pH 7.2 at 293 K. These crystals belong to the monoclinic space group P2 1 , with unit-cell parameters a = 55.4, b = 104.2, c = 78.6 Å, β = 103.3°, and diffracted to 1.7 Å resolution. They contain two protein molecules per asymmetric unit. In order to solve the structure using the MAD phasing method, crystals of the l-selenomethionine-substituted epimerase were grown in the presence of 20% PEG 3350, 0.2 M Na 2 SO 4 and 0.1 M bis-Tris propane pH 8.5

Associations of ACE I/D, AGT M235T gene polymorphisms with pregnancy induced hypertension in Chinese population: a meta-analysis.

Science.gov (United States)

Zhu, Ming; Zhang, Jie; Nie, Shaofa; Yan, Weirong

2012-09-01

There have been many studies concerning the associations of angiotensin-converting enzyme (ACE) I/D, angiotensinogen (AGT) M235T polymorphisms with pregnancy induced hypertension (PIH) among Chinese populations. However, the results were inconsistent, prompting the necessity of meta-analysis. Studies published in English and Chinese were mainly searched in EMbase, PubMed and CBM up to January 2012. Twenty-three studies with 3,551 subjects for ACE I/D and seven studies with 1,296 subjects for AGT M235T were included. Significant associations were found between ACE I/D and PIH under dominant, recessive and allelic models. A separate analysis confined to preeclampsia suggested that ACE I/D was associated with preeclampsia under recessive model and allelic model, but not dominant model. Stratified analyses were conducted as meta-regression analysis indicated that the sample size of case group was a significant source of heterogeneity, which suggested no significant association between ACE I/D and PIH in the subgroup of more than 100 cases. Associations were found between AGT M235T and PIH under dominant genetic model (OR = 1.59; 95 %CI: 1.04-2.42), recessive genetic model (OR = 1.60; 95 %CI: 1.07-2.40), and allelic model (OR = 1.40; 95 %CI: 1.17-1.68). No publication bias was found in either meta-analysis. The present meta-analysis suggested significant associations between ACE I/D, AGT M235T and PIH in Chinese populations. However, no significant association was found between ACE I/D and PIH in the subgroup of more than 100 cases. Studies with larger sample sizes are necessary to investigate the associations between gene polymorphisms and PIH in Chinese populations.

The treatable intellectual disability APP www.treatable-id.org: A digital tool to enhance diagnosis & care for rare diseases

Directory of Open Access Journals (Sweden)

van Karnebeek Clara D M

2012-07-01

Full Text Available Abstract Background Intellectual disability (ID is a devastating and frequent condition, affecting 2-3% of the population worldwide. Early recognition of treatable underlying conditions drastically improves health outcomes and decreases burdens to patients, families and society. Our systematic literature review identified 81 such inborn errors of metabolism, which present with ID as a prominent feature and are amenable to causal therapy. The WebAPP translates this knowledge of rare diseases into a diagnostic tool and information portal. Methods & results Freely available as a WebAPP via http://www.treatable-id.org and end 2012 via the APP store, this diagnostic tool is designed for all specialists evaluating children with global delay / ID and laboratory scientists. Information on the 81 diseases is presented in different ways with search functions: 15 biochemical categories, neurologic and non-neurologic signs & symptoms, diagnostic investigations (metabolic screening tests in blood and urine identify 65% of all IEM, therapies & effects on primary (IQ/developmental quotient and secondary outcomes, and available evidence For each rare condition a ‘disease page’ serves as an information portal with online access to specific genetics, biochemistry, phenotype, diagnostic tests and therapeutic options. As new knowledge and evidence is gained from expert input and PubMed searches this tool will be continually updated. The WebAPP is an integral part of a protocol prioritizing treatability in the work-up of every child with global delay / ID. A 3-year funded study will enable an evaluation of its effectiveness. Conclusions For rare diseases, a field for which financial and scientific resources are particularly scarce, knowledge translation challenges are abundant. With this WebAPP technology is capitalized to raise awareness for rare treatable diseases and their common presenting clinical feature of ID, with the potential to improve health outcomes

The treatable intellectual disability APP www.treatable-id.org: A digital tool to enhance diagnosis & care for rare diseases

Science.gov (United States)

2012-01-01

Background Intellectual disability (ID) is a devastating and frequent condition, affecting 2-3% of the population worldwide. Early recognition of treatable underlying conditions drastically improves health outcomes and decreases burdens to patients, families and society. Our systematic literature review identified 81 such inborn errors of metabolism, which present with ID as a prominent feature and are amenable to causal therapy. The WebAPP translates this knowledge of rare diseases into a diagnostic tool and information portal. Methods & results Freely available as a WebAPP via http://www.treatable-id.org and end 2012 via the APP store, this diagnostic tool is designed for all specialists evaluating children with global delay / ID and laboratory scientists. Information on the 81 diseases is presented in different ways with search functions: 15 biochemical categories, neurologic and non-neurologic signs & symptoms, diagnostic investigations (metabolic screening tests in blood and urine identify 65% of all IEM), therapies & effects on primary (IQ/developmental quotient) and secondary outcomes, and available evidence For each rare condition a ‘disease page’ serves as an information portal with online access to specific genetics, biochemistry, phenotype, diagnostic tests and therapeutic options. As new knowledge and evidence is gained from expert input and PubMed searches this tool will be continually updated. The WebAPP is an integral part of a protocol prioritizing treatability in the work-up of every child with global delay / ID. A 3-year funded study will enable an evaluation of its effectiveness. Conclusions For rare diseases, a field for which financial and scientific resources are particularly scarce, knowledge translation challenges are abundant. With this WebAPP technology is capitalized to raise awareness for rare treatable diseases and their common presenting clinical feature of ID, with the potential to improve health outcomes. This innovative digital

Sequences within the 5' untranslated region regulate the levels of a kinetoplast DNA topoisomerase mRNA during the cell cycle.

Science.gov (United States)

Pasion, S G; Hines, J C; Ou, X; Mahmood, R; Ray, D S

1996-12-01

Gene expression in trypanosomatids appears to be regulated largely at the posttranscriptional level and involves maturation of mRNA precursors by trans splicing of a 39-nucleotide miniexon sequence to the 5' end of the mRNA and cleavage and polyadenylation at the 3' end of the mRNA. To initiate the identification of sequences involved in the periodic expression of DNA replication genes in trypanosomatids, we have mapped splice acceptor sites in the 5' flanking region of the TOP2 gene, which encodes the kinetoplast DNA topoisomerase, and have carried out deletion analysis of this region on a plasmid-encoded TOP2 gene. Block deletions within the 5' untranslated region (UTR) identified two regions (-608 to -388 and -387 to -186) responsible for periodic accumulation of the mRNA. Deletion of one or the other of these sequences had no effect on periodic expression of the mRNA, while deletion of both regions resulted in constitutive expression of the mRNA throughout the cell cycle. Subcloning of these sequences into the 5' UTR of a construct lacking both regions of the TOP2 5' UTR has shown that an octamer consensus sequence present in the 5' UTR of the TOP2, RPA1, and DHFR-TS mRNAs is required for normal cycling of the TOP2 mRNA. Mutation of the consensus octamer sequence in the TOP2 5' UTR in a plasmid construct containing only a single consensus octamer and that shows normal cycling of the plasmid-encoded TOP2 mRNA resulted in substantial reduction of the cycling of the mRNA level. These results imply a negative regulation of TOP2 mRNA during the cell cycle by a mechanism involving redundant elements containing one or more copies of a conserved octamer sequence within the 5' UTR of TOP2 mRNA.

Projectc conception for city logistics with utilization of IDS element applicated to the Nitra city

Directory of Open Access Journals (Sweden)

Michal Balog

2010-02-01

Full Text Available Nowadays traffic situation in the town-residential area is characterized by growing requirement for quality and quantityof transfer performance and services that result in congestion increasing in the some towns. Currently the similar problem has Nitracity, where it is necessary to solve this situation immediately. One of the possibilities of increasing traffic fluency is to extend roads, butin case of Nitra that possibility is irrelevant because of non-available space. Other possibility is an utilization of IDS elements(Intelligent Transport System. The contribution presents the conception of transportation in the town, founded on creation of trafficcircles with subsequent IDS elements application.

Limited copy number-high resolution melting (LCN-HRM) enables the detection and identification by sequencing of low level mutations in cancer biopsies.

Science.gov (United States)

Do, Hongdo; Dobrovic, Alexander

2009-10-08

Mutation detection in clinical tumour samples is challenging when the proportion of tumour cells, and thus mutant alleles, is low. The limited sensitivity of conventional sequencing necessitates the adoption of more sensitive approaches. High resolution melting (HRM) is more sensitive than sequencing but identification of the mutation is desirable, particularly when it is important to discriminate false positives due to PCR errors or template degradation from true mutations.We thus developed limited copy number - high resolution melting (LCN-HRM) which applies limiting dilution to HRM. Multiple replicate reactions with a limited number of target sequences per reaction allow low level mutations to be detected. The dilutions used (based on Ct values) are chosen such that mutations, if present, can be detected by the direct sequencing of amplicons with aberrant melting patterns. Using cell lines heterozygous for mutations, we found that the mutations were not readily detected when they comprised 10% of total alleles (20% tumour cells) by sequencing, whereas they were readily detectable at 5% total alleles by standard HRM. LCN-HRM allowed these mutations to be identified by direct sequencing of those positive reactions.LCN-HRM was then used to review formalin-fixed paraffin-embedded (FFPE) clinical samples showing discordant findings between sequencing and HRM for KRAS exon 2 and EGFR exons 19 and 21. Both true mutations present at low levels and sequence changes due to artefacts were detected by LCN-HRM. The use of high fidelity polymerases showed that the majority of the artefacts were derived from the damaged template rather than replication errors during amplification. LCN-HRM bridges the sensitivity gap between HRM and sequencing and is effective in distinguishing between artefacts and true mutations.

Labelling IDS clusters by means of the silhouette index

OpenAIRE

Petrovic, Slovodan; Álvarez, Gonzalo; Orfila, Agustín; Carbó, Javier

2006-01-01

Proceeding of: IX Reunión Española sobre Criptología y Seguridad de la Información. Barcelona, 2006 One of the most difficult problems in the design of an anomaly based intrusion detection system (IDS) that uses clustering is that of labelling the ob- tained clusters, i.e. determining which of them correspond to ”good” behaviour on the network/host and which to ”bad” behaviour. In this paper, a new clusters’ labelling strategy, which makes use of the Silhouette clustering quality index is ...

PENGARUH TERPAAN INFORMASI RISET MELALUI WEBSITE www.ppet.lipi.go.id TERHADAP SIKAP MAHASISWA MENGENAI PENELITIAN

Directory of Open Access Journals (Sweden)

Noorfiya Umniyati

2017-06-01

Full Text Available Penelitian ini bertujuan untuk mengukur pengaruh terpaan informasi riset di Pusat Penelitian Elektronika dan Telekomunikasi LIPI melalui website www.ppet.lipi.go.id terhadap sikap mahasiswa mengenai penelitian. Tujuan penelitian ini untuk mengetahui besarnya pengaruh jumlah waktu yang digunakan dalam mengakses informasi terhadap sikap mahasiswa mengenai penelitian, isi pesan terhadap sikap mahasiswa mengenai penelitian, dan hubungan individu dengan media terhadap sikap mahasiswa mengenai penelitian. Penelitian ini menggunakan metode kuantitatif dengan analisis jalur. Hasil penelitian ini menunjukan bahwa secara keseluruhan terpaan informasi riset melalui website www.ppet.lipi.go.id berpengaruh secara signifikan terhadap sikap mahasiswa Teknik Telekomunikasi Telkom University mengenai penelitian. Secara parsial, hasil penelitian menunjukkan bahwa variabel jumlah waktu yang digunakan dalam informasi dan variabel hubungan individu dengan media memberikan pengaruh yang siginifikan terhadap sikap mahasiswa mengenai penelitian. Sedangkan variabel isi pesan tidak memberikan pengaruh yang siginifikan karena memberikan pengaruh yang sedikit. Kesimpulan pada penelitian ini menunjukan bahwa secara keseluruhan informasi riset telah melakukan terpaan cukup besar terhadap sikap mahasiswa jurusan Teknik Telekomunikasi Telkom University mengenai penelitian yang mengakses website www.ppet.lipi.go.id.

Drug evaluation: FavId, a patient-specific idiotypic vaccine for non-Hodgkin's lymphoma.

Czech Academy of Sciences Publication Activity Database

Reiniš, Milan

2007-01-01

Roč. 9, č. 3 (2007), s. 291-298 ISSN 1464-8431 Institutional research plan: CEZ:AV0Z50520514 Keywords : non-Hodgkin's lymphoma * lymphoma vaccine FavId Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.526, year: 2007

Multineuronal Spike Sequences Repeat with Millisecond Precision

Directory of Open Access Journals (Sweden)

Koki eMatsumoto

2013-06-01

Full Text Available Cortical microcircuits are nonrandomly wired by neurons. As a natural consequence, spikes emitted by microcircuits are also nonrandomly patterned in time and space. One of the prominent spike organizations is a repetition of fixed patterns of spike series across multiple neurons. However, several questions remain unsolved, including how precisely spike sequences repeat, how the sequences are spatially organized, how many neurons participate in sequences, and how different sequences are functionally linked. To address these questions, we monitored spontaneous spikes of hippocampal CA3 neurons ex vivo using a high-speed functional multineuron calcium imaging technique that allowed us to monitor spikes with millisecond resolution and to record the location of spiking and nonspiking neurons. Multineuronal spike sequences were overrepresented in spontaneous activity compared to the statistical chance level. Approximately 75% of neurons participated in at least one sequence during our observation period. The participants were sparsely dispersed and did not show specific spatial organization. The number of sequences relative to the chance level decreased when larger time frames were used to detect sequences. Thus, sequences were precise at the millisecond level. Sequences often shared common spikes with other sequences; parts of sequences were subsequently relayed by following sequences, generating complex chains of multiple sequences.

Replication and Comparison of the Newly Proposed ADOS-2, Module 4 Algorithm in ASD without ID: A Multi-Site Study

Science.gov (United States)

Pugliese, Cara E.; Kenworthy, Lauren; Bal, Vanessa Hus; Wallace, Gregory L.; Yerys, Benjamin E.; Maddox, Brenna B.; White, Susan W.; Popal, Haroon; Armour, Anna Chelsea; Miller, Judith; Herrington, John D.; Schultz, Robert T.; Martin, Alex; Anthony, Laura Gutermuth

2015-01-01

Recent updates have been proposed to the Autism Diagnostic Observation Schedule-2 Module 4 diagnostic algorithm. This new algorithm, however, has not yet been validated in an independent sample without intellectual disability (ID). This multi-site study compared the original and revised algorithms in individuals with ASD without ID. The revised…

GPCR sequence information - GRIPDB | LSDB Archive [Life Science Database Archive metadata

Lifescience Database Archive (English)

Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.

Monetizing a Meme: YouTube, Content ID, and the Harlem Shake

Directory of Open Access Journals (Sweden)

Michael Soha

2016-01-01

Full Text Available This article analyzes the creation, evolution, and monetization of the Harlem Shake meme on YouTube to explore contemporary implementation of copyright and understanding of authorship in regard to monetization of works with distributed authorship. This article has three main findings: first, we highlight the collection of digital labor that comprises the “Harlem Shake” meme, its rise in popularity, and the subsequent rise in popularity of Baauer, the composer of the song which forms the backbone of the meme; second, we examine how YouTube’s “new bargain” of Content ID, as a departure from the site’s origins creates coercive control mechanisms, shedding new light on the concept of and debate over “digital sharecropping.” Finally, we argue for a “Fair(er use” system by exploring how memes might be understood outside of the contemporary copyright system, rethinking the rights of users engaged in collective production. The article is significant in that it challenges the current distribution of Content ID payments solely to copyright holders in an attempt to rethink a system that acknowledges the creative labor of memetic phenomena and collective authorship.

Penerimaan Masyarakat terhadap Website P3M.Sidoarjokab.go.id

OpenAIRE

Ningrum, Dyah Ary Setya; Rochmaniah, Ainur

2016-01-01

This study aimed to describe community reception of website P3M.sidoarjokab.go.id. This research used descriptive qualitative method with in-depth interview technique. The focus of this research discussed perception, thinking, preference, interpretation, ease of use, easy of finding information, design of page, web traffic and search in website of Complaint Service Center (P3M). Data analysis technique in this research used interactive analysis, with five informant. The research found that P3...

Environmental Science and Research Foundation annual technical report to DOE-ID, January , 1995--December 31, 1995

International Nuclear Information System (INIS)

1996-06-01

The foundation conducts an environmental monitoring and surveillance program over an area covering much of the upper Snake River Plain and provide environmental education and support services related to INEL natural resource issues. Also, the foundation, with its university affiliates, conducts ecological and radioecological research on the Idaho National Environmental Research Park. This research benefits major DOE-ID programs including waste management, environmental restoration, spent nuclear fuels, and land management issues. Major accomplishments during CY1995 can be divided into five categories: environmental surveillance program, environmental education, environmental services and support, ecological risk assessment, and research benefitting the DOE-ID mission

Environmental Science and Research Foundation annual technical report to DOE-ID, January , 1995--December 31, 1995

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-06-01

The foundation conducts an environmental monitoring and surveillance program over an area covering much of the upper Snake River Plain and provide environmental education and support services related to INEL natural resource issues. Also, the foundation, with its university affiliates, conducts ecological and radioecological research on the Idaho National Environmental Research Park. This research benefits major DOE-ID programs including waste management, environmental restoration, spent nuclear fuels, and land management issues. Major accomplishments during CY1995 can be divided into five categories: environmental surveillance program, environmental education, environmental services and support, ecological risk assessment, and research benefitting the DOE-ID mission.

Direct identification and recognition of yeast species from clinical material by using albicans ID and CHROMagar Candida plates.

OpenAIRE

Baumgartner, C; Freydiere, A M; Gille, Y

1996-01-01

Two chromogenic media, Albicans ID and CHROMagar Candida agar plates, were compared with a reference medium, Sabouraud-chloramphenicol agar, and standard methods for the identification of yeast species. This study involved 951 clinical specimens. The detection rates for the two chromogenic media for polymicrobial specimens were 20% higher than that for the Sabouraud-chloramphenicol agar plates. The rates of identification of Candida albicans for Albicans ID and CHROMagar Candida agar plates w...

Supplementation of Nucleosides During Selection can Reduce Sequence Variant Levels in CHO Cells Using GS/MSX Selection System.

Science.gov (United States)

Tang, Danming; Lam, Cynthia; Louie, Salina; Hoi, Kam Hon; Shaw, David; Yim, Mandy; Snedecor, Brad; Misaghi, Shahram

2018-01-01

In the process of generating stable monoclonal antibody (mAb) producing cell lines, reagents such as methotrexate (MTX) or methionine sulfoximine (MSX) are often used. However, using such selection reagent(s) increases the possibility of having higher occurrence of sequence variants in the expressed antibody molecules due to the effects of MTX or MSX on de novo nucleotide synthesis. Since MSX inhibits glutamine synthase (GS) and results in both amino acid and nucleoside starvation, it is questioned whether supplementing nucleosides into the media could lower sequence variant levels without affecting titer. The results show that the supplementation of nucleosides to the media during MSX selection decreased genomic DNA mutagenesis rates in the selected cells, probably by reducing nucleotide mis-incorporation into the DNA. Furthermore, addition of nucleosides enhance clone recovery post selection and does not affect antibody expression. It is further observed that nucleoside supplements lowered DNA mutagenesis rates only at the initial stage of the clone selection and do not have any effect on DNA mutagenesis rates after stable cell lines are established. Therefore, the data suggests that addition of nucleosides during early stages of MSX selection can lower sequence variant levels without affecting titer or clone stability in antibody expression. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Species-level analysis of DNA sequence data from the NIH Human Microbiome Project.

Directory of Open Access Journals (Sweden)

Sean Conlan

Full Text Available BACKGROUND: Outbreaks of antibiotic-resistant bacterial infections emphasize the importance of surveillance of potentially pathogenic bacteria. Genomic sequencing of clinical microbiological specimens expands our capacity to study cultivable, fastidious and uncultivable members of the bacterial community. Herein, we compared the primary data collected by the NIH's Human Microbiome Project (HMP with published epidemiological surveillance data of Staphylococcus aureus. METHODS: The HMP's initial dataset contained microbial survey data from five body regions (skin, nares, oral cavity, gut and vagina of 242 healthy volunteers. A significant component of the HMP dataset was deep sequencing of the 16S ribosomal RNA gene, which contains variable regions enabling taxonomic classification. Since species-level identification is essential in clinical microbiology, we built a reference database and used phylogenetic placement followed by most recent common ancestor classification to look at the species distribution for Staphylococcus, Klebsiella and Enterococcus. MAIN RESULTS: We show that selecting the accurate region of the 16S rRNA gene to sequence is analogous to carefully selecting culture conditions to distinguish closely related bacterial species. Analysis of the HMP data showed that Staphylococcus aureus was present in the nares of 36% of healthy volunteers, consistent with culture-based epidemiological data. Klebsiella pneumoniae and Enterococcus faecalis were found less frequently, but across many habitats. CONCLUSIONS: This work demonstrates that large 16S rRNA survey studies can be used to support epidemiological goals in the context of an increasing awareness that microbes flourish and compete within a larger bacterial community. This study demonstrates how genomic techniques and information could be critically important to trace microbial evolution and implement hospital infection control.

An integrated multiple capillary array electrophoresis system for high-throughput DNA sequencing

Energy Technology Data Exchange (ETDEWEB)

Lu, X.

1998-03-27

A capillary array electrophoresis system was chosen to perform DNA sequencing because of several advantages such as rapid heat dissipation, multiplexing capabilities, gel matrix filling simplicity, and the mature nature of the associated manufacturing technologies. There are two major concerns for the multiple capillary systems. One concern is inter-capillary cross-talk, and the other concern is excitation and detection efficiency. Cross-talk is eliminated through proper optical coupling, good focusing and immersing capillary array into index matching fluid. A side-entry excitation scheme with orthogonal detection was established for large capillary array. Two 100 capillary array formats were used for DNA sequencing. One format is cylindrical capillary with 150 {micro}m o.d., 75 {micro}m i.d and the other format is square capillary with 300 {micro}m out edge and 75 {micro}m inner edge. This project is focused on the development of excitation and detection of DNA as well as performing DNA sequencing. The DNA injection schemes are discussed for the cases of single and bundled capillaries. An individual sampling device was designed. The base-calling was performed for a capillary from the capillary array with the accuracy of 98%.

Evaluating and redesigning teaching learning sequences at the introductory physics level

Science.gov (United States)

Guisasola, Jenaro; Zuza, Kristina; Ametller, Jaume; Gutierrez-Berraondo, José

2017-12-01

In this paper we put forward a proposal for the design and evaluation of teaching and learning sequences in upper secondary school and university. We will connect our proposal with relevant contributions on the design of teaching sequences, ground it on the design-based research methodology, and discuss how teaching and learning sequences designed according to our proposal relate to learning progressions. An iterative methodology for evaluating and redesigning the teaching and learning sequence (TLS) is presented. The proposed assessment strategy focuses on three aspects: (a) evaluation of the activities of the TLS, (b) evaluation of learning achieved by students in relation to the intended objectives, and (c) a document for gathering the difficulties found when implementing the TLS to serve as a guide to teachers. Discussion of this guide with external teachers provides feedback used for the TLS redesign. The context of our implementation and evaluation is an innovative calculus-based physics course for first-year engineering and science degree students at the University of the Basque Country.

Saúde coletiva: história de uma idéia e de um conceito

Directory of Open Access Journals (Sweden)

Everardo Duarte Nunes

1994-12-01

Full Text Available O presente trabalho procura resgatar de forma sintética a trajetória histórica e conceitual da "Saúde Coletiva", evidenciando as suas raízes nos projetos preventivistas e da medicina social. Estes projetos, que se estenderam a partir dos anos 50 e que culminam com a idéia da chamada "Saúde Coletiva", apresentam aspectos que os diferenciam na apreensão do social e do coletivo. Ao tratar especificamente da idéia de uma Saúde Coletiva, o texto aponta para a sua tríplice dimensão: como corrente de pensamento, como movimento social e como prática teórica.

Table of 3D organ model IDs and organ names (PART-OF Tree) - BodyParts3D | LSDB Archive [Life Science Database Archive metadata

Lifescience Database Archive (English)

Full Text Available List Contact us BodyParts3D Table of 3D organ model IDs and organ names (PART-OF Tree) Data detail Data name Table of 3D org...an model IDs and organ names (PART-OF Tree) DOI 10.18908/lsdba.nbdc00837-002 Description of ...data contents List of downloadable 3D organ models in a tab-delimited text file format, describing the correspondence between 3D org...an model IDs and organ names available in PART-OF Tree. D...atabase Site Policy | Contact Us Table of 3D organ model IDs and organ names (PART-OF Tree) - BodyParts3D | LSDB Archive ...

Dicty_cDB: VHP253 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHP253 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHP253Z 355 - - - - Show VHP253 Library VH (Link to library) Clone ID VHP253 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...CTTGGGTACCAAGAACTGACCGTCAATTTGCTGGTTCATGGTTTGC sequence update 2002. 9.10 Translated Amino Acid sequence ---MQLFAGIKSICT...VPIMRMYFHTGILDYILFKSWVPRTDRQFAGSWF Translated Amino Acid sequence (All Frames) Frame A: ---MQLFAGIKSICTEMAMD

Validez y fiabilidad del Researcher ID y de «Web of Science Production of Spanish Psychology»

Directory of Open Access Journals (Sweden)

José Alonso Olivas-Ávila

2014-01-01

Full Text Available La creación de sistemas integradores de productos de investigación, como el Researcher ID de Thomson Reuters, ha sido una necesidad emergente debido a lo complejo que es para los investigadores demostrar de manera periódica el impacto y difusión de su investigación. Sin embargo, estos sistemas se alimentan de información proveniente de las diversas bases de datos y cada vez son más inclusivos para captar productos de investigación. Varios estudios bibliométricos han demostrado que las bases de datos contienen imprecisiones de varios tipos, que afectan directamente a los sistemas integradores. Como consecuencia, se plantea este estudio descriptivo con el fin de analizar la precisión de los registros del Researcher ID de los miembros del consejo de www.psy-wos.es y de una muestra de usuarios de esta página para cotejar los registros con los contenidos en la base de datos Web of Science, diferenciándolos de contenidos ajenos a esta base de datos. Los resultados reflejan que existen imprecisiones y errores considerables en los Researcher ID de la muestra analizada, tales como duplicidad de registros y la inclusión de registros ajenos a la Web of Science. Se concluye que los Resercher ID así como el www.psy-wos.es no son válidos ni fiables.

Purification, crystallization and preliminary crystallographic study of an IDS-epimerase from Agrobacterium tumefaciens BY6

Energy Technology Data Exchange (ETDEWEB)

Bäuerle, Bettina [Institute of Microbiology, University of Stuttgart, 70569 Stuttgart (Germany); Sandalova, Tatyana; Schneider, Gunter [Department of Medical Biochemistry and Biophysics, Karolinska Institutet, 17177 Stockholm (Sweden); Rieger, Paul-Gerhard, E-mail: pg.rieger@imb.uni-stuttgart.de [Institute of Microbiology, University of Stuttgart, 70569 Stuttgart (Germany)

2006-08-01

This is the first report of the crystallization of an IDS-epimerase from A. tumefaciens BY6 and its l-selenomethionine derivative. The initial degradation of all stereoisomers of the complexing agent iminodisuccinate (IDS) is enabled by an epimerase in the bacterial strain Agrobacterium tumefaciens BY6. This protein was produced in Escherichia coli, purified and crystallized by the hanging-drop vapour-diffusion method. Crystals of IDS-epimerase were obtained under several conditions. The best diffracting crystals were grown in 22% PEG 3350, 0.2 M (NH{sub 4}){sub 2}SO{sub 4} and 0.1 M bis-Tris propane pH 7.2 at 293 K. These crystals belong to the monoclinic space group P2{sub 1}, with unit-cell parameters a = 55.4, b = 104.2, c = 78.6 Å, β = 103.3°, and diffracted to 1.7 Å resolution. They contain two protein molecules per asymmetric unit. In order to solve the structure using the MAD phasing method, crystals of the l-selenomethionine-substituted epimerase were grown in the presence of 20% PEG 3350, 0.2 M Na{sub 2}SO{sub 4} and 0.1 M bis-Tris propane pH 8.5.

A study on the association between Angiotensin-I converting enzyme I/D dimorphism and type-2 diabetes mellitus

Directory of Open Access Journals (Sweden)

Chmaisse Hania

2009-01-01

Full Text Available Type-2 diabetes mellitus (T2DM is a chronic disorder characterized by a varying range of predominant insulin resistance with relative insulin deficiency, to predominant insulin secretory defect with or without insulin resistance. Familial clustering as well as epidemiological studies has shown that genetic factors play a role in the development and progression of the disease. Among the genetic factors found to be associated with development of T2DM is the angiotensin-I converting enzyme (ACE gene, which is located on chromosome 17q23. This study was conducted to study the association between ACE gene insertion/deletion (I/D polymorphism and T2DM in a Lebanese diabetic cohort. Fifty-one patients with T2DM and 40 control subjects from different parts of Lebanon underwent genotyping for the ACE I/D, which was performed by PCR using specific primers. Chi-square and analysis of variance (ANOVA were used for asso-ciation studies and to assess the differences in the values among the groups. The distribution of the genotypes in the patients was as follows: 15/51 (29.4% were homozygous for deletion allele (DD genotype, 24/51 (47.1% were heterozygous (ID genotype, and 12/51 (23.5% were homo-zygous for insertion allele (II genotype. Among the control subjects, 16/40 (40% were homo-zygous for deletion (DD genotype, 13/40 (32.5% were heterozygous (ID genotype, and 11/40 (27.5% were homozygous for insertion (II genotype. The prevalence of the D-allele in T2DM patients (52.9% was not significantly different from that in the controls (56.3%. Thus, ACE I/D dimorphism cannot be considered a risk factor for T2DM in the Lebanese population.

The structure and dimensionality of the Inventory of Depressive Symptomatology Self Report (IDS-SR) in patients with depressive disorders and healthy controls

NARCIS (Netherlands)

Wardenaar, Klaas J.; van Veen, Tineke; Giltay, Erik J.; den Hollander-Gijsman, Margien; Penninx, Brenda W. J. H.; Zitman, Frans G.

Background: The Inventory of Depressive Symptomatology Self Report (IDS-SR) is a widely used but heterogeneous measure of depression severity. Insight in its factor structure and dimensionality could help to develop more homogeneous IDS-SR subscales. However previous factoranalytical studies have

Karikaturist Aivar Juhanson näitab KuKu klubis oma töid

Index Scriptorium Estoniae

2009-01-01

Loit Jõekalda kureeritud joonistustriennaali raames eksponeerivad oma töid Ave Avalo, Kärt Hammer, Eero Ijavoinen, Kristjan Kittus, Mari-Liis Laanemaa, Triinu Lille, Valli Lember-Bogatkina jpt. kunstnikud. Ajalehe "Eesti Ekspress" karikaturisti Aivar Juhansoni tööde näitus Tallinnas KuKu klubis

Dicty_cDB: SHI251 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SH (Link to library) SHI251 (Link to dictyBase) - - - Contig-U11819-1 - (Link to Or...iginal site) SHI251F 125 - - - - - - Show SHI251 Library SH (Link to library) Clone ID SHI251 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11819-1 Original site URL http://dictycdb.b...XX sequence update 2002.10.25 Translated Amino Acid sequence ilfqilkistnk**IKNYYVNRVYEIIIIINICT...YKKK--- Translated Amino Acid sequence (All Frames) Frame A: ilfqilkistnk**IKNYYVNRVYEIIIIINICT

Cardiovascular Risk Factors (Diabetes, Hypertension, Hypercholesterolemia and Metabolic Syndrome) in Older People with Intellectual Disability: Results of the HA-ID Study

Science.gov (United States)

de Winter, C. F.; Bastiaanse, L. P.; Hilgenkamp, T. I. M.; Evenhuis, H. M.; Echteld, M. A.

2012-01-01

Hypertension, diabetes, hypercholesterolemia and the metabolic syndrome are important risk factors for cardiovascular disease (CVD). In older people with intellectual disability (ID), CVD is a substantial morbidity risk. The aims of the present study, which was part of the Healthy Ageing in Intellectual Disability (HA-ID) study, were (1) to…

Identification of similar regions of protein structures using integrated sequence and structure analysis tools

Directory of Open Access Journals (Sweden)

Heiland Randy

2006-03-01

Full Text Available Abstract Background Understanding protein function from its structure is a challenging problem. Sequence based approaches for finding homology have broad use for annotation of both structure and function. 3D structural information of protein domains and their interactions provide a complementary view to structure function relationships to sequence information. We have developed a web site http://www.sblest.org/ and an API of web services that enables users to submit protein structures and identify statistically significant neighbors and the underlying structural environments that make that match using a suite of sequence and structure analysis tools. To do this, we have integrated S-BLEST, PSI-BLAST and HMMer based superfamily predictions to give a unique integrated view to prediction of SCOP superfamilies, EC number, and GO term, as well as identification of the protein structural environments that are associated with that prediction. Additionally, we have extended UCSF Chimera and PyMOL to support our web services, so that users can characterize their own proteins of interest. Results Users are able to submit their own queries or use a structure already in the PDB. Currently the databases that a user can query include the popular structural datasets ASTRAL 40 v1.69, ASTRAL 95 v1.69, CLUSTER50, CLUSTER70 and CLUSTER90 and PDBSELECT25. The results can be downloaded directly from the site and include function prediction, analysis of the most conserved environments and automated annotation of query proteins. These results reflect both the hits found with PSI-BLAST, HMMer and with S-BLEST. We have evaluated how well annotation transfer can be performed on SCOP ID's, Gene Ontology (GO ID's and EC Numbers. The method is very efficient and totally automated, generally taking around fifteen minutes for a 400 residue protein. Conclusion With structural genomics initiatives determining structures with little, if any, functional characterization

Method and apparatus for biological sequence comparison

Science.gov (United States)

Marr, T.G.; Chang, W.I.

1997-12-23

A method and apparatus are disclosed for comparing biological sequences from a known source of sequences, with a subject (query) sequence. The apparatus takes as input a set of target similarity levels (such as evolutionary distances in units of PAM), and finds all fragments of known sequences that are similar to the subject sequence at each target similarity level, and are long enough to be statistically significant. The invention device filters out fragments from the known sequences that are too short, or have a lower average similarity to the subject sequence than is required by each target similarity level. The subject sequence is then compared only to the remaining known sequences to find the best matches. The filtering member divides the subject sequence into overlapping blocks, each block being sufficiently large to contain a minimum-length alignment from a known sequence. For each block, the filter member compares the block with every possible short fragment in the known sequences and determines a best match for each comparison. The determined set of short fragment best matches for the block provide an upper threshold on alignment values. Regions of a certain length from the known sequences that have a mean alignment value upper threshold greater than a target unit score are concatenated to form a union. The current block is compared to the union and provides an indication of best local alignment with the subject sequence. 5 figs.

Detection of mitochondrial COII DNA sequences in ant guts as a method for assessing termite predation by ants

Czech Academy of Sciences Publication Activity Database

Fayle, Tom Maurice; Scholtz, O.; Dumbrell, A. J.; Russell, S.; Segar, Simon Tristram; Eggleton, P.

2015-01-01

Roč. 10, č. 4 (2015), e0122533 E-ISSN 1932-6203 R&D Projects: GA ČR GA14-32302S Grant - others:European Social Fund(CZ) CZ1.07/2.3.00/20.0064; European Social Fund(CZ) CZ.1.07/2.3.00/30.0006 Institutional support: RVO:60077344 Keywords : mitochondrial COII DNA sequences Subject RIV: EH - Ecology, Behaviour Impact factor: 3.057, year: 2015 http://journals.plos.org/plosone/article?id=10.1371/journal.pone.0122533

Different Somatic Hypermutation Levels among Antibody Subclasses Disclosed by a New Next-Generation Sequencing-Based Antibody Repertoire Analysis

Directory of Open Access Journals (Sweden)

Kazutaka Kitaura

2017-05-01

Full Text Available A diverse antibody repertoire is primarily generated by the rearrangement of V, D, and J genes and subsequent somatic hypermutation (SHM. Class-switch recombination (CSR produces various isotypes and subclasses with different functional properties. Although antibody isotypes and subclasses are considered to be produced by both direct and sequential CSR, it is still not fully understood how SHMs accumulate during the process in which antibody subclasses are generated. Here, we developed a new next-generation sequencing (NGS-based antibody repertoire analysis capable of identifying all antibody isotype and subclass genes and used it to examine the peripheral blood mononuclear cells of 12 healthy individuals. Using a total of 5,480,040 sequences, we compared percentage frequency of variable (V, junctional (J sequence, and a combination of V and J, diversity, length, and amino acid compositions of CDR3, SHM, and shared clones in the IgM, IgD, IgG3, IgG1, IgG2, IgG4, IgA1, IgE, and IgA2 genes. The usage and diversity were similar among the immunoglobulin (Ig subclasses. Clonally related sequences sharing identical V, D, J, and CDR3 amino acid sequences were frequently found within multiple Ig subclasses, especially between IgG1 and IgG2 or IgA1 and IgA2. SHM occurred most frequently in IgG4, while IgG3 genes were the least mutated among all IgG subclasses. The shared clones had almost the same SHM levels among Ig subclasses, while subclass-specific clones had different levels of SHM dependent on the genomic location. Given the sequential CSR, these results suggest that CSR occurs sequentially over multiple subclasses in the order corresponding to the genomic location of IGHCs, but CSR is likely to occur more quickly than SHMs accumulate within Ig genes under physiological conditions. NGS-based antibody repertoire analysis should provide critical information on how various antibodies are generated in the immune system.

Gclust Server: 93636 [Gclust Server

Lifescience Database Archive (English)

Full Text Available 93636 OSA_Os02g0125100 Cluster Sequences Related Sequences(236) 514 no annotation 1... 1.00e-28 14.29 0.0 0.0 0.0 0.0 0.0 Show 93636 Cluster ID 93636 Sequence ID OSA_Os02g0125100 Link to cluster... sequences Cluster Sequences Link to related sequences Related Sequences(236) Sequence length 514 Representa

Tidying up international nucleotide sequence databases: ecological, geographical and sequence quality annotation of its sequences of mycorrhizal fungi.

Science.gov (United States)

Tedersoo, Leho; Abarenkov, Kessy; Nilsson, R Henrik; Schüssler, Arthur; Grelet, Gwen-Aëlle; Kohout, Petr; Oja, Jane; Bonito, Gregory M; Veldre, Vilmar; Jairus, Teele; Ryberg, Martin; Larsson, Karl-Henrik; Kõljalg, Urmas

2011-01-01

Sequence analysis of the ribosomal RNA operon, particularly the internal transcribed spacer (ITS) region, provides a powerful tool for identification of mycorrhizal fungi. The sequence data deposited in the International Nucleotide Sequence Databases (INSD) are, however, unfiltered for quality and are often poorly annotated with metadata. To detect chimeric and low-quality sequences and assign the ectomycorrhizal fungi to phylogenetic lineages, fungal ITS sequences were downloaded from INSD, aligned within family-level groups, and examined through phylogenetic analyses and BLAST searches. By combining the fungal sequence database UNITE and the annotation and search tool PlutoF, we also added metadata from the literature to these accessions. Altogether 35,632 sequences belonged to mycorrhizal fungi or originated from ericoid and orchid mycorrhizal roots. Of these sequences, 677 were considered chimeric and 2,174 of low read quality. Information detailing country of collection, geographical coordinates, interacting taxon and isolation source were supplemented to cover 78.0%, 33.0%, 41.7% and 96.4% of the sequences, respectively. These annotated sequences are publicly available via UNITE (http://unite.ut.ee/) for downstream biogeographic, ecological and taxonomic analyses. In European Nucleotide Archive (ENA; http://www.ebi.ac.uk/ena/), the annotated sequences have a special link-out to UNITE. We intend to expand the data annotation to additional genes and all taxonomic groups and functional guilds of fungi.

Low Levels of Physical Activity and Sedentary Behavior in Adults with Intellectual Disabilities

Directory of Open Access Journals (Sweden)

Kelly Hsieh

2017-12-01

Full Text Available Adults with intellectual disabilities (ID are more likely to lead sedentary lifestyles and have low levels of physical activity (LLPA. The present study investigated the prevalence of reported LLPA and time spent watching TV in adults with ID and identified the associated factors for these behaviors. The proxy informants of 1618 adults with ID completed the surveys regarding their health behaviors. Multiple logistic regressions were employed for LLPA and multiple linear regressions for time spent watching TV. About 60% of adults with ID had LLPA and average time spent watching TV was 3.4 h a day. Some characteristics and health and function variables were identified as associated factors. While engaging in community activities and involvement in Special Olympics were inversely associated with LLPA, they were not associated with time spent watching TV. Attending day/educational programs or being employed were associated with spending less time watching TV. Findings highlight differential factors associated with LLPA versus TV-watching behavior in adults with ID. Hence, a key strategy aimed at increasing physical activity includes promoting participation in social and community activities, while targeted activities for reducing sedentary behavior might focus on providing day programs or employment opportunities for adults with ID.

Id-1 is induced in MDCK epithelial cells by activated Erk/MAPK pathway in response to expression of the Snail and E47 transcription factors

International Nuclear Information System (INIS)

Jorda, Mireia; Vinyals, Antonia; Marazuela, Anna; Cubillo, Eva; Olmeda, David; Valero, Eva; Cano, Amparo; Fabra, Angels

2007-01-01

Id-1, a member of the helix-loop-helix transcription factor family has been shown to be involved in cell proliferation, angiogenesis and invasion of many types of human cancers. We have previously shown that stable expression of E47 and Snail repressors of the E-cadherin promoter in MDCK epithelial cell line triggers epithelial mesenchymal transition (EMT) concomitantly with changes in gene expression. We show here that both factors activate the Id-1 gene promoter and induce Id-1 mRNA and protein. The upregulation of the Id-1 gene occurs through the transactivation of the promoter by the Erk/MAPK signaling pathway. Moreover, oncogenic Ras is also able to activate Id-1 promoter in MDCK cells in the absence of both E47 and Snail transcription factors. Several transcriptionally active regulatory elements have been identified in the proximal promoter, including AP-1, Sp1 and four putative E-boxes. By EMSA, we only detected an increased binding to Sp1 and AP-1 elements in E47- and Snail-expressing cells. Binding is affected by the treatment of cells with PD 98059 MEK inhibitor, suggesting that MAPK/Erk contributes to the recruitment or assembly of proteins to Id-1 promoter. Small interfering RNA directed against Sp1 reduced Id-1 expression and the upregulation of the promoter, indicating that Sp1 is required for Id-1 induction in E47- and Snail-expressing cells. Our results provide new insights into how some target genes are activated during and/or as a consequence of the EMT triggered by both E47 and Snail transcription factors

Hizbollah lubab : "Me tahame ameeriklastega häid suhteid" / Mohamad Afif ; interv. Ivar Soopan

Index Scriptorium Estoniae

Afif, Mohamad

2005-01-01

Liibanoni shiiitide organisatsiooni Hizbollah meediasuhete direktor ütleb, et Hizbollah ei ole terroriorganisatsioon. Religioosse ja poliitilise grupina tahab Hizbollah häid suhteid teistega kõikjal maailmas, kuid probleem on poliitikas, selles, kuidas USA suhtub nende regiooni, tõekspidamistesse

The impact of clinical pharmacist and ID intervention in rationalization of antimicrobial use.

Science.gov (United States)

Al-Somai, Niaz; Al-Muhur, Mohammed; Quteimat, Osama; Hamzah, Nashaat

2014-12-01

There is little research on the impact of implementing and monitoring antimicrobial policy in Saudi hospitals. The purpose of this study is to measure the impact of the clinical pharmacist (CP) and infectious disease consultant (ID) interventions on the use of three antimicrobials (caspofungin, imipenem, meropenem) in hospitalized patients in the King Abdullah Medical City hospital. The study was carried out in the King Abdullah Medical City, in Mekkah, Saudi Arabia. The hospital is a tertiary center that provides CCU, CSICU, Cardiac, Hematology, ICU, Medical, Neuroscience, Oncology, and specialized surgery services. The use of three antimicrobials (caspofungin, imipenem, meropenem) was reviewed by the clinical pharmacist for four periods, pre and post implementation of policy. Relevant data were collected in four periods. In the first period, before policy implementation, data were collected retrospectively to be used as baseline status reference, and in the three remaining periods that followed data were collected prospectively, and compared to baseline data, to evaluate the role of clinical pharmacist and ID interventions in optimizing antimicrobial therapy. Caspofungin duration of therapy was not affected significantly by the intervention. Statistically significant reduction in antimicrobial therapy duration was observed in imipenem (37%) and meropenem (37%) from baseline, which indicate a better control on antimicrobial use and reduction in antimicrobial resistance. The impact of the clinical pharmacist and ID interventions, in reducing antimicrobial therapy duration using imipenem and meropenem, is clear from the result presented above. However, lack of restriction and follow up in the antimicrobial policy in case of negative culture makes antimicrobial use uncontrollable in these cases. Establishing good and accepted policy may help reduce consumption and total cost of therapy.

Brain activation in motor sequence learning is related to the level of native cortical excitability.

Directory of Open Access Journals (Sweden)

Silke Lissek

Full Text Available Cortical excitability may be subject to changes through training and learning. Motor training can increase cortical excitability in motor cortex, and facilitation of motor cortical excitability has been shown to be positively correlated with improvements in performance in simple motor tasks. Thus cortical excitability may tentatively be considered as a marker of learning and use-dependent plasticity. Previous studies focused on changes in cortical excitability brought about by learning processes, however, the relation between native levels of cortical excitability on the one hand and brain activation and behavioral parameters on the other is as yet unknown. In the present study we investigated the role of differential native motor cortical excitability for learning a motor sequencing task with regard to post-training changes in excitability, behavioral performance and involvement of brain regions. Our motor task required our participants to reproduce and improvise over a pre-learned motor sequence. Over both task conditions, participants with low cortical excitability (CElo showed significantly higher BOLD activation in task-relevant brain regions than participants with high cortical excitability (CEhi. In contrast, CElo and CEhi groups did not exhibit differences in percentage of correct responses and improvisation level. Moreover, cortical excitability did not change significantly after learning and training in either group, with the exception of a significant decrease in facilitatory excitability in the CEhi group. The present data suggest that the native, unmanipulated level of cortical excitability is related to brain activation intensity, but not to performance quality. The higher BOLD mean signal intensity during the motor task might reflect a compensatory mechanism in CElo participants.

Gclust Server: 44200 [Gclust Server

Lifescience Database Archive (English)

Full Text Available 44200 CRE_177005 Cluster Sequences Related Sequences(76) 519 no annotation 2 1.00e-...40 14.29 0.0 0.0 0.0 0.0 0.0 Show 44200 Cluster ID 44200 Sequence ID CRE_177005 Link to cluster sequences Cl

Gclust Server: 106703 [Gclust Server

Lifescience Database Archive (English)

Full Text Available 106703 CRE_180873 Cluster Sequences - 663 no annotation 1 1.00e+00 14.29 0.0 0.0 0.0 0.0 0.0 Show 106703... Cluster ID 106703 Sequence ID CRE_180873 Link to cluster sequences Cluster Sequences L

Dicty_cDB: SHA393 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SH (Link to library) SHA393 (Link to dictyBase) - - - Contig-U11503-1 SHA393E (Link... Clone ID SHA393 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dict...lated Amino Acid sequence ekqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCG FNNXPICTSLKDAVXRAFLLI...yhcysyfg Translated Amino Acid sequence (All Frames) Frame A: ekqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCG FNNXPICT...Homology vs Protein Score E Sequences producing significant alignments: (bits) Value AF020283_1( AF020283 |pid:none) Dict

Rapid and high-throughput detection of highly pathogenic bacteria by Ibis PLEX-ID technology.

Directory of Open Access Journals (Sweden)

Daniela Jacob

Full Text Available In this manuscript, we describe the identification of highly pathogenic bacteria using an assay coupling biothreat group-specific PCR with electrospray ionization mass spectrometry (PCR/ESI-MS run on an Ibis PLEX-ID high-throughput platform. The biothreat cluster assay identifies most of the potential bioterrorism-relevant microorganisms including Bacillus anthracis, Francisella tularensis, Yersinia pestis, Burkholderia mallei and pseudomallei, Brucella species, and Coxiella burnetii. DNA from 45 different reference materials with different formulations and different concentrations were chosen and sent to a service screening laboratory that uses the PCR/ESI-MS platform to provide a microbial identification service. The standard reference materials were produced out of a repository built up in the framework of the EU funded project "Establishment of Quality Assurances for Detection of Highly Pathogenic Bacteria of Potential Bioterrorism Risk" (EQADeBa. All samples were correctly identified at least to the genus level.

PEMBELAJARAN METODE KOOPERATIF TIPE JIGSAW DALAM MENINGKATKAN HASIL BELAJAR BAHASA ARAB (QOWA’ID MAHASISWA PERBANKAN SYARI’AH IAIM NU METRO LAMPUNG TAHUN 2017

Directory of Open Access Journals (Sweden)

Muhammad Syaifullah

2017-11-01

Full Text Available Learning Arabic qowa'id student Syari'ah Banking Second semester Ma'arif Institute of Islamic NU Metro Lampung still not maximized. Students have difficulties to understand Arabic qowa'id material. Student learning motivation is also low. This is what makes researchers want to do research in that class. Problems to be expressed in this research are: (1 How is the application of Arabic qowa'id learning with cooperative model of jigsaw method in class A, second semester of Syari'ah Banking, (2 How to improve learning qowa'id after getting learning with cooperative learning model of jigsaw method, (3 What are the advantages and disadvantages of implementing cooperative Arabic qawaid in class A with jigsaw method. This research is a classroom action research conducted in two cycles. Each cycle is done in a cycle consisting of four stages: planning, execution, observation and reflection. The results of this study indicate an increase from cycle I of cycle II. The average class cycle I is 60.83 and the average of cycle II is 71. The students also show behavior change in the positive direction. Student activity is increasing. The improvement of test result is also followed by behavioral and motivational change based on research which has been done by the researcher that through cooperative learning with jigsaw method, Arabic qowa'id learning becomes more fun and easier for students in learning qowa'id. Suggestions that can be given is a lecturer of Arabic language should be more creative in using techniques and learning methods that involve the active role of student learning so that the learning process to get the maximum value. One alternative of learning Arabic qowa'id is by using cooperative learning jigsaw model.

Extracellular DNA amplicon sequencing reveals high levels of benthic eukaryotic diversity in the central Red Sea

KAUST Repository

Pearman, John K.

2015-11-01

The present study aims to characterize the benthic eukaryotic biodiversity patterns at a coarse taxonomic level in three areas of the central Red Sea (a lagoon, an offshore area in Thuwal and a shallow coastal area near Jeddah) based on extracellular DNA. High-throughput amplicon sequencing targeting the V9 region of the 18S rRNA gene was undertaken for 32 sediment samples. High levels of alpha-diversity were detected with 16,089 operational taxonomic units (OTUs) being identified. The majority of the OTUs were assigned to Metazoa (29.2%), Alveolata (22.4%) and Stramenopiles (17.8%). Stramenopiles (Diatomea) and Alveolata (Ciliophora) were frequent in a lagoon and in shallower coastal stations, whereas metazoans (Arthropoda: Maxillopoda) were dominant in deeper offshore stations. Only 24.6% of total OTUs were shared among all areas. Beta-diversity was generally lower between the lagoon and Jeddah (nearshore) than between either of those and the offshore area, suggesting a nearshore–offshore biodiversity gradient. The current approach allowed for a broad-range of benthic eukaryotic biodiversity to be analysed with significantly less labour than would be required by other traditional taxonomic approaches. Our findings suggest that next generation sequencing techniques have the potential to provide a fast and standardised screening of benthic biodiversity at large spatial and temporal scales.

Phylogenetic diversity of insecticolous fusaria inferred from multilocus DNA sequence data and their molecular identification via FUSARIUM-ID and Fusarium MLST

NARCIS (Netherlands)

O'Donnell, K.; Humber, R.A.; Geiser, D.M.; Kang, S.; Robert, V.; Park, B.; Crous, P.W.; Johnston, P.; Aoki, T.; Rooney, A.P.; Rehner, S.A.

2012-01-01

We constructed several multilocus DNA sequence datasets to assess the phylogenetic diversity of insecticolous fusaria, especially focusing on those housed at the Agricultural Research Service Collection of Entomopathogenic Fungi (ARSEF), and to aid molecular identifications of unknowns via the

Blood group genotyping: the power and limitations of the Hemo ID Panel and MassARRAY platform.

Science.gov (United States)

McBean, Rhiannon S; Hyland, Catherine A; Flower, Robert L

2015-01-01

Matrix-assisted laser desorption/ionization, time-of-flight mass spectrometry (MALDI-TOF MS), is a sensitive analytical method capable of resolving DNA fragments varying in mass by a single nucleotide. MALDI-TOF MS is applicable to blood group genotyping, as the majority of blood group antigens are encoded by single nucleotide polymorphisms. Blood group genotyping by MALDI-TOF MS can be performed using a panel (Hemo ID Blood Group Genotyping Panel, Agena Bioscience Inc., San Diego, CA) that is a set of genotyping assays that predict the phenotype for 101 antigens from 16 blood group systems. These assays involve three fundamental stages: multiplex target-specific polymerase chain reaction amplification, allele-specific single base primer extension, and MALDI-TOFMS analysis using the MassARRAY system. MALDI-TOF MS-based genotyping has many advantages over alternative methods including high throughput, high multiplex capability, flexibility and adaptability, and the high level of accuracy based on the direct detection method. Currently available platforms for MALDI-TOF MS-based genotyping are not without limitations, including high upfront instrumentation costs and the number of non-automated steps. The Hemo ID Blood Group Genotyping Panel, developed and optimized in a collaboration between the vendor and the Blood Transfusion Service of the Swiss Red Cross in Zurich, Switzerland, is not yet widely utilized, although several laboratories are currently evaluating the MassARRAY system for blood group genotyping. Based on the accuracy and other advantages offered by MALDITOF MS analysis, in the future, this method is likely to become widely adopted for blood group genotyping, in particular, for population screening.

Influência do polimorfismo I/D do gene da eca na HPE de jovens normotensos

Directory of Open Access Journals (Sweden)

Manuella de Oliveira Fernandes

2015-08-01

Full Text Available INTRODUÇÃO: A hipotensão pós-exercício (HPE é considerada uma estratégia não farmacológica adotada para redução da pressão arterial (PA. Ademais, sabe-se que a presença de alguns polimorfismos genéticos influencia a resposta pressórica, como o I/D do gene da enzima conversora da angiotensina (ECA. Objetivo: Analisar a influência do polimorfismo I/D da ECA sobre a HPE após três diferentes intensidades de exercício em jovens normotensos e fisicamente ativos.MÉTODOS: Vinte e seis jovens saudáveis (DD = 11; ID/II = 15 realizaram uma sessão máxima de 1.600 metros, na pista de atletismo e outras três sessões experimentais (Sessão Moderada: 6% abaixo do limiar anaeróbio, Sessão Intensa: 6% acima do limiar anaeróbio e Sessão de Controle, com aferições prévias da PA, por 20 minutos e posteriores ao exercício por 60 minutos.RESULTADOS: Observou-se que o exercício moderado ocasionou HPE independentemente do grupo genotípico, sendo mais evidente para a pressão arterial sistólica nos momentos 45 minutos e 60 minutos (p ≤ 0,05. Verificou-se também que a característica gênica exerceu influência sobre a área abaixo da curva pressórica (p ≤ 0,005 sobre a pressão arterial diastólica, formada 1 hora após o exercício.CONCLUSÃO: Conclui-se que o exercício moderado ocasiona HPE em jovens normotensos e fisicamente ativos, independentemente do polimorfismo I/D no gene da ECA, sendo que esse polimorfismo exerce influência sobre a hipotensão diastólica, e os indivíduos portadores do alelo I apresentam maior decaimento da PA diastólica (PAD.

76 FR 36896 - Salmon-Challis National Forest, ID; Forestwide Invasive Plant Treatment Environmental Impact...

Science.gov (United States)

2011-06-23

... DEPARTMENT OF AGRICULTURE Forest Service Salmon-Challis National Forest, ID; Forestwide Invasive... to the biological diversity and ecological integrity within and outside the Salmon-Challis National... loss of recreational opportunities. Within the 3,108,904 acres of the of the Salmon-Challis National...

Didactical suggestion for a Dynamic Hybrid Intelligent e-Learning Environment (DHILE) applying the PENTHA ID Model

Science.gov (United States)

dall'Acqua, Luisa

2011-08-01

The teleology of our research is to propose a solution to the request of "innovative, creative teaching", proposing a methodology to educate creative Students in a society characterized by multiple reference points and hyper dynamic knowledge, continuously subject to reviews and discussions. We apply a multi-prospective Instructional Design Model (PENTHA ID Model), defined and developed by our research group, which adopts a hybrid pedagogical approach, consisting of elements of didactical connectivism intertwined with aspects of social constructivism and enactivism. The contribution proposes an e-course structure and approach, applying the theoretical design principles of the above mentioned ID Model, describing methods, techniques, technologies and assessment criteria for the definition of lesson modes in an e-course.

Developments in time-resolved x-ray research at APS beamline 7ID

Energy Technology Data Exchange (ETDEWEB)

Walko, D. A., E-mail: d-walko@anl.gov; Adams, B. W.; Doumy, G.; Dufresne, E. M.; Li, Yuelin; March, A. M.; Sandy, A. R.; Wang, Jin; Wen, Haidan; Zhu, Yi [Advanced Photon Source, Argonne National Laboratory, Argonne, IL 60439 (United States)

2016-07-27

The 7ID beamline of the Advanced Photon Source (APS) is dedicated to time-resolved research using x-ray imaging, scattering, and spectroscopy techniques. Time resolution is achieved via gated detectors and/or mechanical choppers in conjunction with the time structure of the x-ray beam. Three experimental hutches allow for a wide variety of experimental setups. Major areas of research include atomic, molecular, and optical physics; chemistry; condensed matter physics in the bulk, thin film, and surface regimes; and fluid-spray dynamics. Recent developments in facilities at 7ID include a high-power, high-repetition-rate picosecond laser to complement the 1 kHz ultrafast laser. For the ultrafast laser, a newly commissioned optical parametric amplifier provides pump wavelength from 0.2 to 15 µm with energy per pulse up to 200 µJ. A nanodiffraction station has also been commissioned, using Fresnel zone-plate optics to achieve a focused x-ray spot of 300 nm. This nanoprobe is not only used to spatially resolve the evolution of small features in samples after optical excitation, but also has been combined with an intense THz source to study material response under ultrafast electric fields.

Support and Self-Efficacy among Latino and White Parents of Children with ID

Science.gov (United States)

Cohen, Shana R.; Holloway, Susan D.; Dominguez-Pareto, Irenka; Kuppermann, Miriam

2015-01-01

Research indicates that mothers of children with ID who receive familial support experience less stress than those who receive less support. Less is known about the relation of support to mothers' evaluation of parenting self-efficacy, particularly in Latino families. We examined the relationship of different types of family support to life…

Oversættelsesperspektiver på idéers møde med praksis

DEFF Research Database (Denmark)

Scheuer, John Damm

-netværksteoriens oversættelsesbegreb blevet søgt indarbejdet i ny-institutionel oversættelsesteori ? 2. Hvordan kan forståelsen af oversættelsesprocessen udvikles videre på et empirisk grundlag ? Det konstateres, at Latours definition og idémodellens socialkonstruktivistiske teoretisering af oversættelsesprocessen er blevet taget...

The Sphagnome Project: enabling ecological and evolutionary insights through a genus-level sequencing project.

Science.gov (United States)

Weston, David J; Turetsky, Merritt R; Johnson, Matthew G; Granath, Gustaf; Lindo, Zoë; Belyea, Lisa R; Rice, Steven K; Hanson, David T; Engelhardt, Katharina A M; Schmutz, Jeremy; Dorrepaal, Ellen; Euskirchen, Eugénie S; Stenøien, Hans K; Szövényi, Péter; Jackson, Michelle; Piatkowski, Bryan T; Muchero, Wellington; Norby, Richard J; Kostka, Joel E; Glass, Jennifer B; Rydin, Håkan; Limpens, Juul; Tuittila, Eeva-Stiina; Ullrich, Kristian K; Carrell, Alyssa; Benscoter, Brian W; Chen, Jin-Gui; Oke, Tobi A; Nilsson, Mats B; Ranjan, Priya; Jacobson, Daniel; Lilleskov, Erik A; Clymo, R S; Shaw, A Jonathan

2018-01-01

Considerable progress has been made in ecological and evolutionary genetics with studies demonstrating how genes underlying plant and microbial traits can influence adaptation and even 'extend' to influence community structure and ecosystem level processes. Progress in this area is limited to model systems with deep genetic and genomic resources that often have negligible ecological impact or interest. Thus, important linkages between genetic adaptations and their consequences at organismal and ecological scales are often lacking. Here we introduce the Sphagnome Project, which incorporates genomics into a long-running history of Sphagnum research that has documented unparalleled contributions to peatland ecology, carbon sequestration, biogeochemistry, microbiome research, niche construction, and ecosystem engineering. The Sphagnome Project encompasses a genus-level sequencing effort that represents a new type of model system driven not only by genetic tractability, but by ecologically relevant questions and hypotheses. © 2017 UT-Battelle New Phytologist © 2017 New Phytologist Trust.

Short sequence motifs, overrepresented in mammalian conservednon-coding sequences

Energy Technology Data Exchange (ETDEWEB)

Minovitsky, Simon; Stegmaier, Philip; Kel, Alexander; Kondrashov,Alexey S.; Dubchak, Inna

2007-02-21

Background: A substantial fraction of non-coding DNAsequences of multicellular eukaryotes is under selective constraint. Inparticular, ~;5 percent of the human genome consists of conservednon-coding sequences (CNSs). CNSs differ from other genomic sequences intheir nucleotide composition and must play important functional roles,which mostly remain obscure.Results: We investigated relative abundancesof short sequence motifs in all human CNSs present in the human/mousewhole-genome alignments vs. three background sets of sequences: (i)weakly conserved or unconserved non-coding sequences (non-CNSs); (ii)near-promoter sequences (located between nucleotides -500 and -1500,relative to a start of transcription); and (iii) random sequences withthe same nucleotide composition as that of CNSs. When compared tonon-CNSs and near-promoter sequences, CNSs possess an excess of AT-richmotifs, often containing runs of identical nucleotides. In contrast, whencompared to random sequences, CNSs contain an excess of GC-rich motifswhich, however, lack CpG dinucleotides. Thus, abundance of short sequencemotifs in human CNSs, taken as a whole, is mostly determined by theiroverall compositional properties and not by overrepresentation of anyspecific short motifs. These properties are: (i) high AT-content of CNSs,(ii) a tendency, probably due to context-dependent mutation, of A's andT's to clump, (iii) presence of short GC-rich regions, and (iv) avoidanceof CpG contexts, due to their hypermutability. Only a small number ofshort motifs, overrepresented in all human CNSs are similar to bindingsites of transcription factors from the FOX family.Conclusion: Human CNSsas a whole appear to be too broad a class of sequences to possess strongfootprints of any short sequence-specific functions. Such footprintsshould be studied at the level of functional subclasses of CNSs, such asthose which flank genes with a particular pattern of expression. Overallproperties of CNSs are affected by

Using Efficient TRNGs for PSEUDO Profile in National eID Card

OpenAIRE

Blerim Rexha; Dren Imeraj; Isak Shabani

2018-01-01

Applications that requires true random number generator (TRNG), which uses raw analog data generated from any noise source in nature, must convert the source normal distribution to uniform distribution. Many up to date implementations convert the raw analog data into digital data by employing a comparator or a Schmitt trigger. This method wastes a large amount of random input data, lowering the throughput of the TRNG. In new national electronic identity card (eID) beyond the true identity of ...

Replication and Comparison of the Newly Proposed ADOS-2, Module 4 Algorithm in ASD without ID: A Multi-site Study

OpenAIRE

Pugliese, Cara E.; Kenworthy, Lauren; Bal, Vanessa Hus; Wallace, Gregory L; Yerys, Benjamin E; Maddox, Brenna B.; White, Susan W.; Popal, Haroon; Armour, Anna Chelsea; Miller, Judith; Herrington, John D.; Schultz, Robert T.; Martin, Alex; Anthony, Laura Gutermuth

2015-01-01

Recent updates have been proposed to the Autism Diagnostic Observation Schedule-2 Module 4 diagnostic algorithm. This new algorithm, however, has not yet been validated in an independent sample without intellectual disability (ID). This multi-site study compared the original and revised algorithms in individuals with ASD without ID. The revised algorithm demonstrated increased sensitivity, but lower specificity in the overall sample. Estimates were highest for females, individuals with a verb...

Quasirandom geometric networks from low-discrepancy sequences

Science.gov (United States)

Estrada, Ernesto

2017-08-01

We define quasirandom geometric networks using low-discrepancy sequences, such as Halton, Sobol, and Niederreiter. The networks are built in d dimensions by considering the d -tuples of digits generated by these sequences as the coordinates of the vertices of the networks in a d -dimensional Id unit hypercube. Then, two vertices are connected by an edge if they are at a distance smaller than a connection radius. We investigate computationally 11 network-theoretic properties of two-dimensional quasirandom networks and compare them with analogous random geometric networks. We also study their degree distribution and their spectral density distributions. We conclude from this intensive computational study that in terms of the uniformity of the distribution of the vertices in the unit square, the quasirandom networks look more random than the random geometric networks. We include an analysis of potential strategies for generating higher-dimensional quasirandom networks, where it is know that some of the low-discrepancy sequences are highly correlated. In this respect, we conclude that up to dimension 20, the use of scrambling, skipping and leaping strategies generate quasirandom networks with the desired properties of uniformity. Finally, we consider a diffusive process taking place on the nodes and edges of the quasirandom and random geometric graphs. We show that the diffusion time is shorter in the quasirandom graphs as a consequence of their larger structural homogeneity. In the random geometric graphs the diffusion produces clusters of concentration that make the process more slow. Such clusters are a direct consequence of the heterogeneous and irregular distribution of the nodes in the unit square in which the generation of random geometric graphs is based on.

The effect of adjuvants on the immune response induced by a DBL4e-ID4 VAR2CSA based Plasmodium falciparum vaccine against placental malaria

DEFF Research Database (Denmark)

Pinto, V V; Salanti, A; Joergensen, L M

2012-01-01

720, Alhydrogel(®) and CAF01. Antibodies induced against DBL4¿-ID4 in combination with these adjuvants inhibited parasite binding to CSA from 82% to 99%. Although, different epitope recognition patterns were obtained for the different formulations, all adjuvant combinations induced strong Th1 and Th2......¿-ID4 to induce binding-inhibitory antibodies when formulated with adjuvants approved for human use. We have characterized the immune response of DBL4¿-ID4 in combination with Freund's complete and incomplete adjuvant and with three adjuvants currently being used in clinical trials: Montanide(®) ISA...... type responses, resulting in IgG with similar binding strength, with to the DBL4¿-ID4 antigen. These results demonstrate that the DBL4¿-ID4 antigen is highly immunogenic and that binding inhibitory antibodies are induced when formulated with any of the tested adjuvants....

Comparative evaluation of the drug interaction screening programs MediQ and ID PHARMA CHECK in neurological inpatients.

Science.gov (United States)

Zorina, Olesya I; Haueis, Patrick; Semmler, Alexander; Marti, Isabelle; Gonzenbach, Roman R; Guzek, Markus; Kullak-Ublick, Gerd A; Weller, Michael; Russmann, Stefan

2012-08-01

The comparative evaluation of clinical decision support software (CDSS) programs regarding their sensitivity and positive predictive value for the identification of clinically relevant drug interactions. In this research, we used a cross-sectional study that identified potential drug interactions using the CDSS MediQ and the ID PHARMA CHECK in 484 neurological inpatients. Interactions were reclassified according to the Zurich Interaction System, a multidimensional classification that incorporates the Operational Classification of Drug Interactions. In 484 patients with 2812 prescriptions, MediQ and ID PHARMA CHECK generated a total of 1759 and 1082 alerts, respectively. MediQ identified 658 unique potentially interacting combinations, 8 classified as "high danger," 164 as "average danger," and 486 as "low danger." ID PHARMA CHECK detected 336 combinations assigned to one or several of 12 risk and management categories. Altogether, both CDSS issued alerts relating to 808 unique potentially interacting combinations. According to the Zurich Interaction System, 6 of these were contraindicated, 25 were provisionally contraindicated, 190 carried a conditional risk, and 587 had a minimal risk of adverse events. The positive predictive value for alerts having at least a conditional risk was 0.24 for MediQ and 0.48 for ID PHARMA CHECK. CDSS showed major differences in the identification and grading of interactions, and many interactions were only identified by one of the two CDSS. For both programs, only a small proportion of all identified interactions appeared clinically relevant, and the selected display of alerts that imply management changes is a key issue in the further development and local setup of such programs. Copyright © 2012 John Wiley & Sons, Ltd.

Smoking has no impact on survival and it is not associated with ACE gene I/D polymorphism in hemodialysis patients.

Science.gov (United States)

Kiss, István; Kiss, Zoltán; Kerkovits, Lóránt; Paksy, András; Ambrus, Csaba

2017-01-01

The relationship between smoking and mortality in patients on hemodialysis is controversial. Earlier studies showed that the insertion/deletion (I/D) polymorphism of the ACE gene might have an effect on mortality. The aim of this study was to test the impact of smoking on survival and whether this association was influenced by ACE gene I/D polymorphism in patients on maintenance hemodialysis. In this prospective, multicenter cohort study we analyzed 709 prevalent patients on maintenance hemodialysis. Patients were allocated into groups based on their smoking habit. Outcome data were collected during the 144-month follow-up period. Outcomes of current smokers and lifelong non-smokers were compared. In order to control for interactions between predictor variables, we also identified 160 matched pairs for further sub-analysis. The vast majority of patients (67%) were non-smokers, followed by current smokers (22.2%) and ex-smokers (9.8%). Smoking had no impact on survival in the matched pair analysis ( p = 0.99). After adjustment for ACE I/D polymorphism and other co-variates, smoking had no effect on survival. Our data suggest that smoking has no impact on survival; neither is it associated with ACE gene I/D polymorphism in hemodialysis patients.

Two-Level Adaptive Algebraic Multigrid for a Sequence of Problems with Slowly Varying Random Coefficients [Adaptive Algebraic Multigrid for Sequence of Problems with Slowly Varying Random Coefficients

Energy Technology Data Exchange (ETDEWEB)

Kalchev, D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Ketelsen, C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Vassilevski, P. S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2013-11-07

Our paper proposes an adaptive strategy for reusing a previously constructed coarse space by algebraic multigrid to construct a two-level solver for a problem with nearby characteristics. Furthermore, a main target application is the solution of the linear problems that appear throughout a sequence of Markov chain Monte Carlo simulations of subsurface flow with uncertain permeability field. We demonstrate the efficacy of the method with extensive set of numerical experiments.

Effects of beamline components (undulator, monochromator, focusing device) on the beam intensity at ID18F (ESRF)

Energy Technology Data Exchange (ETDEWEB)

Somogyi, A. E-mail: somogyia@esrf.fr; Drakopoulos, M.; Vekemans, B.; Vincze, L.; Simionovici, A.; Adams, F

2003-01-01

The ID18F microprobe end-station of the European Synchrotron Radiation Facility (ESRF) is dedicated to precise and reproducible quantitative X-ray fluorescence analysis in the ppm level with {<=}5% accuracy for elements of Z{>=}19 and micron-size spatial resolution. In order to fulfill this requirement the precise monitoring and normalization of the intensity variation of the focused micro-beam is necessary. The various effects influencing the intensity variation, hence the stability of the {mu}-beam, were investigated by placing different detectors (miniature ionization chamber, photodiodes) into the monochromatic beam. The theoretical statistical error of the measured signal in each detector was estimated on the basis of the absorption and e{sup -}-ion-pair production processes and was compared with the measured statistical errors.

Effects of beamline components (undulator, monochromator, focusing device) on the beam intensity at ID18F (ESRF)

International Nuclear Information System (INIS)

Somogyi, A.; Drakopoulos, M.; Vekemans, B.; Vincze, L.; Simionovici, A.; Adams, F.

2003-01-01

The ID18F microprobe end-station of the European Synchrotron Radiation Facility (ESRF) is dedicated to precise and reproducible quantitative X-ray fluorescence analysis in the ppm level with ≤5% accuracy for elements of Z≥19 and micron-size spatial resolution. In order to fulfill this requirement the precise monitoring and normalization of the intensity variation of the focused micro-beam is necessary. The various effects influencing the intensity variation, hence the stability of the μ-beam, were investigated by placing different detectors (miniature ionization chamber, photodiodes) into the monochromatic beam. The theoretical statistical error of the measured signal in each detector was estimated on the basis of the absorption and e - -ion-pair production processes and was compared with the measured statistical errors

Effects of beamline components (undulator, monochromator, focusing device) on the beam intensity at ID18F (ESRF)

CERN Document Server

Somogyi, A; Vekemans, B; Vincze, L; Simionovici, A; Adams, F

2003-01-01

The ID18F microprobe end-station of the European Synchrotron Radiation Facility (ESRF) is dedicated to precise and reproducible quantitative X-ray fluorescence analysis in the ppm level with =19 and micron-size spatial resolution. In order to fulfill this requirement the precise monitoring and normalization of the intensity variation of the focused micro-beam is necessary. The various effects influencing the intensity variation, hence the stability of the mu-beam, were investigated by placing different detectors (miniature ionization chamber, photodiodes) into the monochromatic beam. The theoretical statistical error of the measured signal in each detector was estimated on the basis of the absorption and e sup - -ion-pair production processes and was compared with the measured statistical errors.

Confinement margins for ignition and driven operation in Iter Eda ID

International Nuclear Information System (INIS)

Johner, J.

1995-09-01

Preliminary calculations for ITER EDA ID have been performed using the 1/2D thermal equilibrium code HELIOS. It is found that: - The maximum ignition margin for ITER ID (29%) is 6% less than for ITER OD (35%) and 5% less than for ITER CDA (34%). - Decreasing the ration τ * He /τ E from the nominal value 10 to a value of 5 gives a 12% gain in the maximum ignition margin. Increasing the ration from 10 to 15 causes a 22% loss in the margin. Furthermore, ignited equilibria non longer exist for τ * He /τ E ≥ 17.6. - Operation in driven mode with 50 MW of external power increases the confinement capability by 13%. With 100 MW, the improvement is 24%. - Lowering the fusion power from 1500 to 1000 MW slightly improves the maximum ignition margin (+5%) and allows operation below the Greenwald density limit. - A 10% reduction of the toroidal magnetic field with a correlative diminution of the plasma current for constant safety factor operation, causes a dramatic reduction (-18%) of the maximum ignition margin. - A fraction of neon of 0.68% would completely suppress the ignition margin. Furthermore, ignited equilibria, with the nominal fusion power and τ * He /τ E , no longer exist when the neon fraction exceeds 0.75%. (Author). 2 refs., 10 figs

External validity of the Indonesian Wechsler Adult Intelligence Scale - Fourth edition (WAIS-IV-ID)

NARCIS (Netherlands)

Suwartono, C.; Hidajat, L.L.; Halim, M.S.; Hendriks, M.P.H.; Kessels, R.P.C.

2016-01-01

The Wechsler Adult Intelligence Scale-Fourth Edition (WAIS-IV-ID) has been adapted and proved to be valid for its internal structure for Indonesian population. The same structure found as in the American WAIS-IV (WAIS-IV-US; Suwartono, Hendriks, Hidajat, Halim, & Kessels, 2015). Despite its strong

High resolution sea-level curve for the latest Frasnian and earliest Famennian derived for high frequency sequences in the Appalachian Basin

Energy Technology Data Exchange (ETDEWEB)

Filer, J.K. (Washington and Lee Univ., Lexington, VA (United States). Dept. of Geology)

1992-01-01

Siliciclastic sequences have been mapped in the subsurface and outcrop of much of the Appalachian basin in facies ranging from shale in the basin plain to shelf sandstone. Eleven transgressive/regressive cycles have been defined in an estimated 1.5 to 2.0 Ma period in the latest Frasnian and earliest Famennian, and range in duration from about 75,000 to 400,000 years. Lithofacies maps, covering most of the basin, were prepared for each sequence. These maps show both the area of basinal black shale deposition, which defines the base of each cycle, and the areal extent of subsequent clinoform siltstone and shelf sandstone deposition in the upper portion of each cycle. The stratigraphic patterns show two stacked sets of progradational basinwide sequences. Geographic scale of the study precludes autocyclic controls of cycles. Sea-level/climate cycles, probably superimposed on longer term tectonic cycles, are the proposed cause of these observed depositional patterns. Removal of the long-term progradational trend of Upper Devonian basin filling results in a proposed eustatic sea-level curve (Johnson and others (1985)) reveals correspondence of three regressive maxima in both models. The curve presented here reveals that an ongoing process of higher frequency sea-level modification was active at this time. Higher frequency sea-level events, nested within previously interpreted lower frequency global events, are inferred to also be eustatic. Models of a biotic crises which occurs at this time should consider the implications of these high frequency sea-level cycles. The patterns observed are consistent with latest Frasnian initiation of glaciation in South America. This would be somewhat earlier than has generally been accepted.

Visible and NIR spectral band combination to produce high security ID tags for automatic identification

Science.gov (United States)

Pérez-Cabré, Elisabet; Millán, María S.; Javidi, Bahram

2006-09-01

Verification of a piece of information and/or authentication of a given object or person are common operations carried out by automatic security systems that can be applied, for instance, to control the entrance to restricted areas, access to public buildings, identification of cardholders, etc. Vulnerability of such security systems may depend on the ease of counterfeiting the information used as a piece of identification for verification and authentication. To protect data against tampering, the signature that identifies an object is usually encrypted to avoid an easy recognition at human sight and an easy reproduction using conventional devices for imaging or scanning. To make counterfeiting even more difficult, we propose to combine data from visible and near infrared (NIR) spectral bands. By doing this, neither the visible content nor the NIR data by theirselves are sufficient to allow the signature recognition and thus, the identification of a given object. Only the appropriate combination of both signals permits a satisfactory authentication. In addition, the resulting signature is encrypted following a fully-phase encryption technique and the obtained complex-amplitude distribution is encoded on an ID tag. Spatial multiplexing of the encrypted signature allows us to build a distortion-invariant ID tag, so that remote authentication can be achieved even if the tag is captured under rotation or at different distances. We also explore the possibility of using partial information of the encrypted signature to simplify the ID tag design.

Inspection of cup-shaped steel parts from the I.D. side using eddy current

Science.gov (United States)

Griffiths, Erick W.; Pearson, Lee H.

2018-04-01

An eddy current method was developed to inspect cup-shaped steel parts from the I.D. side. During the manufacturing process of these parts, a thin Al tape foil is applied to the I.D. side of the part. One of the critical process parameters is that only one foil layer can be applied. An eddy current inspection system was developed to reject parts with more than one foil layer. The Al tape foil is cut to length to fit the inner diameter, however, after application of the foil there is a gap created between the beginning and end of the foil. It was found that this gap interfered with the eddy current inspection causing a false positive indication. To solve this problem a sensor design and data analysis process were developed to overcome the effects of these gaps. The developed system incorporates simultaneous measurements from multiple eddy current sensors and signal processing to achieve a reliable inspection.

Using the Δ3 statistic to test for missed levels in mixed sequence neutron resonance data

International Nuclear Information System (INIS)

Mulhall, Declan

2009-01-01

The Δ 3 (L) statistic is studied as a tool to detect missing levels in the neutron resonance data where two sequences are present. These systems are problematic because there is no level repulsion, and the resonances can be too close to resolve. Δ 3 (L) is a measure of the fluctuations in the number of levels in an interval of length L on the energy axis. The method used is tested on ensembles of mixed Gaussian orthogonal ensemble spectra, with a known fraction of levels (x%) randomly depleted, and can accurately return x. The accuracy of the method as a function of spectrum size is established. The method is used on neutron resonance data for 11 isotopes with either s-wave neutrons on odd-A isotopes, or p-wave neutrons on even-A isotopes. The method compares favorably with a maximum likelihood method applied to the level spacing distribution. Nuclear data ensembles were made from 20 isotopes in total, and their Δ 3 (L) statistics are discussed in the context of random matrix theory.

Human CD5+ Innate Lymphoid Cells Are Functionally Immature and Their Development from CD34+ Progenitor Cells Is Regulated by Id2

Directory of Open Access Journals (Sweden)

Maho Nagasawa

2017-08-01

Full Text Available Innate lymphoid cells (ILCs have emerged as a key cell type involved in surveillance and maintenance of mucosal tissues. Mouse ILCs rely on the transcriptional regulator Inhibitor of DNA-binding protein 2 (Id2 for their development. Here, we show that Id2 also drives development of human ILC because forced expression of Id2 in human thymic progenitors blocked T cell commitment, upregulated CD161 and promyelocytic leukemia zinc finger (PLZF, and maintained CD127 expression, markers that are characteristic for human ILCs. Surprisingly CD5 was also expressed on these in vitro generated ILCs. This was not an in vitro artifact because CD5 was also found on ex vivo isolated ILCs from thymus and from umbilical cord blood. CD5 was also expressed on small proportions of ILC2 and ILC3. CD5+ ILCs were functionally immature, but could further differentiate into mature CD5− cytokine-secreting ILCs. Our data show that Id2 governs human ILC development from thymic progenitor cells toward immature CD5+ ILCs.

DeID – A Data Sharing Tool for Neuroimaging Studies

Directory of Open Access Journals (Sweden)

Xuebo eSong

2015-09-01

Full Text Available Funding institutions and researchers increasingly expect that data will be shared to increase scientific integrity and provide other scientists with the opportunity to use the data with novel methods that may advance understanding in a particular field of study. In practice, sharing human subject data can be complicated because data must be de-identified prior to sharing. Moreover, integrating varied data types collected in a study can be challenging and time consuming. For example, sharing data from structural imaging studies of a complex disorder requires the integration of imaging, demographic and/or behavioral data in a way that no subject identifiers are included in the de-identified dataset and with new subject labels or identification values that cannot be tracked back to the original ones. We have developed a Java program that users can use to remove identifying information in neuroimaging datasets, while still maintaining the association among different data types from the same subject for further studies. This software provides a series of user interaction wizards to allow users to select data variables to be de-identified, implements functions for auditing and validation of de-identified data, and enables the user to share the de-identified data in a single compressed package through various communication protocols, such as FTPS and SFTP. DeID runs with Windows, Linux, and Mac operating systems and its open architecture allows it to be easily adapted to support a broader array of data types, with the goal of facilitating data sharing. DeID can be obtained at http://www.nitrc.org/projects/deid.

Aberrant Expression of ID2 protein and its correlation with EBV-LMP1 and P16(INK4A) in Classical Hodgkin Lymphoma in China

International Nuclear Information System (INIS)

Zhao, Po; Lu, Yali; Liu, Lin; Zhong, Mei

2008-01-01

The relationships between the expression of ID2, EBV-LMP1 and P16(INK4A) in Chinese classical Hodgkin lymphoma are unknown and need exploring. Samples of classical Hodgkin lymphoma from 60 Chinese patients were analyzed for the expression of ID2, EBV-LMP1 and p16(INK4A) proteins by immunohistochemistry. ID2 protein was expressed in 83.3% of this group of classical Hodgkin lymphoma, staining strongly in both cytoplasm and nucleus of the Hodgkin and Reed-Sternberg (HRS) cells. EBV-LMP1 and P16(INK4A) were overexpressed in 85.0% and 71.7% of Hodgkin lymphoma, respectively. EBV-LMP1 was noted in the cytoplasm, membrane and nucleus of HRS cells; P16(INK4A) was in the nucleus and cytoplasm. Microscopically, ID2, EBV-LMP1 and P16(INK4A) staining distinguished the HRS cells from the complex background of lymphocytes. ID2 was positively correlated with EBV-LMP1(P < 0.01), but P16(INK4A) was inversely related to EBV-LMP1 (P < 0.05). It is suggested that ID2, EBV-LMP1 and P16(INK4A) could play an important role in the evolution of classical Hodgkin lymphoma, and be considered as potential adjunct markers to identify HRS cells in diagnosis

Applying Open Researchers and Contributors ID in scholarly journals

Directory of Open Access Journals (Sweden)

Jeonghee Im

2015-02-01

Full Text Available Open Researchers and Contributors ID (ORCID launched its registry services in October 2012. Consequently, adding personal information to the ORCID registry became routine work for researchers. To add ORCID to an online article, the tag needs to be included in the Journal Article Tag Suite extensible markup language file, if such a file has been produced by the publisher. Subsequently, all co-authors’ ORCID can be easily and conveniently collected and then integrated into the manuscript management system. In the current age of information and the Internet, journals need to keep pace with the surge of new standards and technologies. Editors should be able to accept and apply these new systems rapidly.

Detection of auto-anti-idiotypic antibodies to Lol p I (rye I) IgE antibodies in human sera by the use of murine idiotypes: levels in atopic and non-atopic subjects and effects of immunotherapy.

Science.gov (United States)

Hébert, J; Bernier, D; Mourad, W

1990-06-01

Anti-idiotypic antibodies (anti-Id Abs) are involved in the regulation of a number of immune responses including the IgE antibody production. In atopic patients, the increased synthesis of IgE antibodies could be related to a defective production of regulatory anti-Id Abs. In the present study, we first developed a sensitive assay for measuring the levels of anti-Id Abs directed against antibodies specific for Lol p I, the major allergenic determinant of Lolium perenne (rye grass). In this assay, we used previously described murine monoclonal anti-Lol p I antibodies that were shown to share epitopic specificities with human anti-Lol p I IgE and IgG antibodies, thus short-cutting the need for purification of F(ab')2 fragments of human IgG Abs and insuring optimal specificity and sensitivity. Levels of anti-Id Abs against two anti-Lol p I monoclonal antibodies (290A-167, 348A-6) were higher in normal volunteers than in untreated atopic patients. Specific immunotherapy increased the levels of anti-Id Abs to those of normal volunteers. These observations suggest a role for the Id-anti-Id network in the regulation of IgE antibody production.

Real-time flow - determination of vena cava inferior on two different levels via 'RACE' pulse sequence in MR

International Nuclear Information System (INIS)

Helzel, M.V.; Mueller, E.

1993-01-01

A new and simple parameter for quantiative evaluation of liver perfusion is outlined: Post-sinusoidal quantitative measurement of the entire liver venous flow: This is a result of the differences in evaluated flow volumes at two different levels in the inferior V.cava. The first level is the height of diaphragm, and the second is situated just cranial of the renal vessels. Normal values obtained from a group of healthy volunteers are presented. A gradient-echo pulse sequence called RACE, enabling flow measurements in real-time, is outlined. (orig.) [de

77 FR 13072 - Salmon-Challis National Forest, Butte, Custer and Lemhi Counties, ID, Supplemental Environmental...

Science.gov (United States)

2012-03-05

... DEPARTMENT OF AGRICULTURE Forest Service Salmon-Challis National Forest, Butte, Custer and Lemhi Counties, ID, Supplemental Environmental Impact Statement to the 2009 Salmon- Challis National Forest... of intent to prepare a supplemental environmental impact statement. SUMMARY: The Salmon-Challis...

Automated pose estimation of objects using multiple ID devices for handling and maintenance task in nuclear fusion reactor

International Nuclear Information System (INIS)

Umetani, Tomohiro; Morioka, Jun-ichi; Tamura, Yuichi; Inoue, Kenji; Arai, Tatsuo; Mae, Yasusi

2011-01-01

This paper describes a method for the automated estimation of three-dimensional pose (position and orientation) of objects by autonomous robots, using multiple identification (ID) devices. Our goal is to estimate the object pose for assembly or maintenance tasks in a real nuclear fusion reactor system, with autonomous robots cooperating in a virtual assembly system. The method estimates the three-dimensional pose for autonomous robots. This paper discusses a method of motion generation for ID acquisition using the sensory data acquired by the measurement system attached to the robots and from the environment. Experimental results show the feasibility of the proposed method. (author)

78 FR 23952 - Notice of Temporary Closure on Public Lands in Elmore County, ID

Science.gov (United States)

2013-04-23

...] Notice of Temporary Closure on Public Lands in Elmore County, ID AGENCY: Bureau of Land Management, Interior. ACTION: Notice of temporary closure. SUMMARY: Notice is hereby given that the Stout Fire closure to motorized vehicle use is in effect on public lands administered by the Four Rivers Field Office...

Transcriptome sequencing of the Microarray Quality Control (MAQC RNA reference samples using next generation sequencing

Directory of Open Access Journals (Sweden)

Thierry-Mieg Danielle

2009-06-01

Full Text Available Abstract Background Transcriptome sequencing using next-generation sequencing platforms will soon be competing with DNA microarray technologies for global gene expression analysis. As a preliminary evaluation of these promising technologies, we performed deep sequencing of cDNA synthesized from the Microarray Quality Control (MAQC reference RNA samples using Roche's 454 Genome Sequencer FLX. Results We generated more that 3.6 million sequence reads of average length 250 bp for the MAQC A and B samples and introduced a data analysis pipeline for translating cDNA read counts into gene expression levels. Using BLAST, 90% of the reads mapped to the human genome and 64% of the reads mapped to the RefSeq database of well annotated genes with e-values ≤ 10-20. We measured gene expression levels in the A and B samples by counting the numbers of reads that mapped to individual RefSeq genes in multiple sequencing runs to evaluate the MAQC quality metrics for reproducibility, sensitivity, specificity, and accuracy and compared the results with DNA microarrays and Quantitative RT-PCR (QRTPCR from the MAQC studies. In addition, 88% of the reads were successfully aligned directly to the human genome using the AceView alignment programs with an average 90% sequence similarity to identify 137,899 unique exon junctions, including 22,193 new exon junctions not yet contained in the RefSeq database. Conclusion Using the MAQC metrics for evaluating the performance of gene expression platforms, the ExpressSeq results for gene expression levels showed excellent reproducibility, sensitivity, and specificity that improved systematically with increasing shotgun sequencing depth, and quantitative accuracy that was comparable to DNA microarrays and QRTPCR. In addition, a careful mapping of the reads to the genome using the AceView alignment programs shed new light on the complexity of the human transcriptome including the discovery of thousands of new splice variants.

Gclust Server: 39739 [Gclust Server

Lifescience Database Archive (English)

Full Text Available 39739 PHRA_96515 Cluster Sequences Related Sequences(163) 249 C_scaffold_82000018; ...no annotation 2 1.00e-25 0.0 22.22 0.0 0.0 0.0 0.0 Show 39739 Cluster ID 39739 Sequence ID PHRA_96515 Link t

Gclust Server: 203939 [Gclust Server

Lifescience Database Archive (English)

Full Text Available 203939 Bja_blr7450 Cluster Sequences - 342 hypothetical protein 1 1.00e-99 0.0 0.0 ...0.0 0.0 3.23 0.0 Show 203939 Cluster ID 203939 Sequence ID Bja_blr7450 Link to cluster sequences Cluster Seq

Gclust Server: 36367 [Gclust Server

Lifescience Database Archive (English)

Full Text Available 36367 DPTM_GSPATP00021401001 Cluster Sequences - 382 no annotation 3 1.00e-50 0.0 1...1.11 0.0 0.0 0.0 0.0 Show 36367 Cluster ID 36367 Sequence ID DPTM_GSPATP00021401001 Link to cluster sequence

Genetic diversity in breonadia salicina based on intra-species sequence variation of chloroplast dna spacer sequence

International Nuclear Information System (INIS)

Qurainy, F.A.; Gaafar, A.R.Z.

2014-01-01

Assessment and knowledge of the genetic diversity and variation within and between populations of rare and endangered plants is very important for effective conservation. Intergenic spacer sequences variation of psbA-trnH locus of chloroplast genome was assessed within Breonadia salicina (Rubiaceae), a critically endangered and endemic plant species to South western part of Kingdom of Saudi Arabia. The obtained sequence data from 19 individuals in three populations revealed nine haplotypes. The aligned sequences obtained from the overall Saudi accessions extended to 355 bp, revealing nine haplotypes. A high level of haplotype diversity (Hd = 0.842) and low level of nucleotide diversity (Pi = 0.0058) were detected. Consistently, both hierarchical analysis of molecular variance (AMOVA) and constructed neighbor-joining tree indicated null genetic differentiation among populations. This level of differentiation between populations or between regions in psbA-trnH sequences may be due to effects of the abundance of ancestral haplotype sharing and the presence of private haplotypes fixed for each population. Furthermore, the results revealed almost the same level of genetic diversity in comparison with Yemeni accessions, in which Saudi accessions were sharing three haplotypes from the four haplotypes found in Yemeni accessions. (author)

Nestor Capdevila, Le concept d’idéologie, Paris, PUF, 2004, 326 pages, 25 euros.

Directory of Open Access Journals (Sweden)

Marie GAILLE-NIKODIMOV

2005-09-01

Full Text Available Que la philosophie puisse se pratiquer dans toute sa rigueur conceptuelle en s’appliquant à des notions politiques, voilà qui n’a pas été et n’est pas toujours évident pour tous. Le concept d’idéologie de Nestor Capdevila est une lecture tout indiquée pour les sceptiques. Le pari n’est pourtant pas gagné a priori : ce terme, forgé en 1798 par Destutt de Tracy pour désigner la science des idées prises au sens général de perceptions, est on ne peut plus fuyant. S’il n’a pas, à l’origine, la con...

78 FR 20135 - Notice of Temporary Closure on Public Lands in Boise County, ID

Science.gov (United States)

2013-04-03

...] Notice of Temporary Closure on Public Lands in Boise County, ID AGENCY: Bureau of Land Management, Interior. ACTION: Notice of Temporary Closure SUMMARY: Notice is hereby given that the Springs Fire closure to all human use is in effect on public lands administered by the Four Rivers Field Office, Bureau of...

International Decommissioning Symposium 2000 (IDS 2000). Final Report

International Nuclear Information System (INIS)

Ebadian, M.A.

2001-01-01

The purpose of IDS 2000 was to deliver a world-class conference on applicable global environmental issues. The objective of this conference was to publicize environmental progress of individual countries, to provide a forum for technology developer and problem-holder interaction, to facilitate environmental and technology discussions between the commercial and financial communities, and to accommodate information and education exchange between governments, industries, universities, and scientists. The scope of this project included the planning and execution of an international conference on the decommissioning of nuclear facilities, and the providing of a business forum for vendors and participants sufficient to attract service providers, technology developers, and the business and financial communities. These groups, when working together with attendees from regulatory organizations and government decision-maker groups, provide an opportunity to more effectively and efficiently expedite the decommissioning projects

Happening'id ja disain - visioon kunsti ja elu terviklikkusest / Mari Laanemets

Index Scriptorium Estoniae

Laanemets, Mari, 1975-

2010-01-01

Analüüsitakse kunsti ja disaini vahelist suhet 1970. aastatel esile kerkinud uue kunstikäsitluse ja kunstilise tegevuse ümbermõtestamise kontekstis. Mõlemad pidid lepitama inimest reaalsusega - disain elukeskkonda ülendades, õilistades ja happening'id - elu formaalseid struktuure lõhkudes. Ka almanahhi "Kunst ja Kodu" erilisest positsioonist lääne kaasaegse kunsti ja disaini tuvustamisel (toimetajaks 1973. aastast Andres Tolts) ning rühmitusest SOUP 1969 ja nende ideoloogide - Ando Keskküla, Andres Toltsi ja Leonhard Lapini tegevusest ja mõjust

Dynamic changes in Id3 and E-protein activity orchestrate germinal center and plasma cell development

Science.gov (United States)

Gloury, Renee; Zotos, Dimitra; Zuidscherwoude, Malou; Masson, Frederick; Liao, Yang; Hasbold, Jhaguaral; Corcoran, Lynn M.; Hodgkin, Phil D.; Belz, Gabrielle T.; Shi, Wei; Nutt, Stephen L.; Tarlinton, David M.

2016-01-01

The generation of high-affinity antibodies requires germinal center (GC) development and differentiation of long-lived plasma cells in a multilayered process that is tightly controlled by the activity of multiple transcription factors. Here, we reveal a new layer of complexity by demonstrating that dynamic changes in Id3 and E-protein activity govern both GC and plasma cell differentiation. We show that down-regulation of Id3 in B cells is essential for releasing E2A and E2-2, which in a redundant manner are required for antigen-induced B cell differentiation. We demonstrate that this pathway controls the expression of multiple key factors, including Blimp1, Xbp1, and CXCR4, and is therefore critical for establishing the transcriptional network that controls GC B cell and plasma cell differentiation. PMID:27217539

Download - Budding yeast cDNA sequencing project | LSDB Archive [Life Science Database Archive metadata

Lifescience Database Archive (English)

Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.

Dicty_cDB: VHA365 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHA365 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHA365Z 352 - - - - Show VHA365 Library VH (Link to library) Clone ID VHA365 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...TTGGGTACCAAGAACTGACCGTCAATTTGCTGGTTCATGGTTT sequence update 2002. 9.10 Translated Amino Acid sequence ---QLFAGIKSICT...wfmv Frame C: ---QLFAGIKSICTEMAMDGCEKCSGNSPTTTCDVLPVYSSLCMAMPDMSQCANWTKMCS SSGQLY

Dicty_cDB: VHC263 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHC263 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHC263Z 429 - - - - Show VHC263 Library VH (Link to library) Clone ID VHC263 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...ATGG ACTCCCAAC sequence update 2002. 9.10 Translated Amino Acid sequence ---QLFAGIKSICT...kyfrkkmdsq Frame B: ---QLFAGIKSICTXMAMDGCEKCSGNSPTTTCDVLPVYSSLCMAMPDMSQCANWTKMCS

Gclust Server: 139390 [Gclust Server

Lifescience Database Archive (English)

Full Text Available 139390 Mac_MA0860 Cluster Sequences - 160 hypothetical protein 1 1.00e-80 0.0 0.0 0.0 0.0 3.23 0.0 Show 139...390 Cluster ID 139390 Sequence ID Mac_MA0860 Link to cluster sequences Cluster Seque

Gclust Server: 103939 [Gclust Server

Lifescience Database Archive (English)

Full Text Available 103939 PoTR_594761 Cluster Sequences Related Sequences(127) 273 eugene3.66280001 1 ...1.00e-60 14.29 0.0 0.0 0.0 0.0 0.0 Show 103939 Cluster ID 103939 Sequence ID PoTR_594761 Link to cluster seq

Gclust Server: 139239 [Gclust Server

Lifescience Database Archive (English)

Full Text Available 139239 Pho_PH0321 Cluster Sequences - 255 hypothetical protein 1 1.00e-99 0.0 0.0 0.0 0.0 3.23 0.0 Show 139...239 Cluster ID 139239 Sequence ID Pho_PH0321 Link to cluster sequences Cluster Seque

Gclust Server: 39939 [Gclust Server

Lifescience Database Archive (English)

Full Text Available 39939 PHRA_81983 Cluster Sequences Related Sequences(369) 366 fgenesh1_pg.C_scaffol...d_66000060; no annotation 2 1.00e-28 0.0 22.22 0.0 0.0 0.0 0.0 Show 39939 Cluster ID 39939 Sequence ID PHRA_

Gclust Server: 36360 [Gclust Server

Lifescience Database Archive (English)

Full Text Available 36360 Rpa2_RPD_1584 Cluster Sequences - 195 hypothetical protein 3 1.00e-50 0.0 0.0... 0.0 20.0 0.0 0.0 Show 36360 Cluster ID 36360 Sequence ID Rpa2_RPD_1584 Link to cluster sequences Cluster Se

Gclust Server: 121212 [Gclust Server

Lifescience Database Archive (English)

Full Text Available 121212 Neq_NEQ344 Cluster Sequences Related Sequences(20) 136 hypothetical protein ...1 1.00e-70 0.0 0.0 0.0 0.0 3.23 0.0 Show 121212 Cluster ID 121212 Sequence ID Neq_NEQ344 Link to cluster seq

Gclust Server: 201448 [Gclust Server

Lifescience Database Archive (English)

Full Text Available 201448 Pho_PH1528 Cluster Sequences - 388 hypothetical protein 1 1.00e-99 0.0 0.0 0.0 0.0 3.23 0.0 Show 2014...48 Cluster ID 201448 Sequence ID Pho_PH1528 Link to cluster sequences Cluster Seque

Gclust Server: 201402 [Gclust Server

Lifescience Database Archive (English)

Full Text Available 201402 Bms_BR1331 Cluster Sequences - 61 hypothetical protein 1 1.00e-28 0.0 0.0 0.0 0.0 3.23 0.0 Show 2014...02 Cluster ID 201402 Sequence ID Bms_BR1331 Link to cluster sequences Cluster Sequen

Gclust Server: 201450 [Gclust Server

Lifescience Database Archive (English)

Full Text Available 201450 Bms_BR1937 Cluster Sequences - 163 hypothetical protein 1 1.00e-80 0.0 0.0 0.0 0.0 3.23 0.0 Show 2014...50 Cluster ID 201450 Sequence ID Bms_BR1937 Link to cluster sequences Cluster Seque

Gclust Server: 201459 [Gclust Server

Lifescience Database Archive (English)

Full Text Available 201459 Bpe_BP2567 Cluster Sequences - 127 hypothetical protein 1 1.00e-70 0.0 0.0 0.0 0.0 3.23 0.0 Show 2014...59 Cluster ID 201459 Sequence ID Bpe_BP2567 Link to cluster sequences Cluster Seque

Gclust Server: 201463 [Gclust Server

Lifescience Database Archive (English)

Full Text Available 201463 Bja_bll1754 Cluster Sequences - 239 hypothetical protein 1 1.00e-99 0.0 0.0 0.0 0.0 3.23 0.0 Show 201...463 Cluster ID 201463 Sequence ID Bja_bll1754 Link to cluster sequences Cluster Seq

Gclust Server: 201424 [Gclust Server

Lifescience Database Archive (English)

Full Text Available 201424 Bms_BR1355 Cluster Sequences - 58 hypothetical protein 1 1.00e-28 0.0 0.0 0.0 0.0 3.23 0.0 Show 2014...24 Cluster ID 201424 Sequence ID Bms_BR1355 Link to cluster sequences Cluster Sequen