WorldWideScience

Sample records for level agreement sla

  1. Privacy Management Contracts And Economics, Using Service Level Agreements (Sla)

    NARCIS (Netherlands)

    L-F. Pau (Louis-François)

    2005-01-01

    textabstractRecognizing the importance of privacy management as a business process and a business support process, this paper proposes the use of service level agreements around privacy features, including qualitative and quantitative ones. It also casts privacy management into a business

  2. Research Challenges in Managing and Using Service Level Agreements

    Science.gov (United States)

    Rana, Omer; Ziegler, Wolfgang

    A Service Level Agreement (SLA) represents an agreement between a service user and a provider in the context of a particular service provision. SLAs contain Quality of Service properties that must be maintained by a provider, and as agreed between a provider and a user/client. These are generally defined as a set of Service Level Objectives (SLOs). These properties need to be measurable and must be monitored during the provision of the service that has been agreed in the SLA. The SLA must also contain a set of penalty clauses specifying what happens when service providers fail to deliver the pre-agreed quality. Hence, an SLA may be used by both a user and a provider - from a user perspective, an SLA defines what is required - often defined using non-functional attributes of service provision. From a providers perspective, an SLA may be used to support capacity planning - especially if a provider is making it's capability available to multiple users. An SLA may be used by a client and provider to manage their behaviour over time - for instance, to optimise their long running revenue (cost) or QoS attributes (such as execution time), for instance. The lifecycle of an SLA is outlined, along with various uses of SLAs to support infrastructure management. A discussion about WS-Agreement - the emerging standard for specifying SLAs - is also provided.

  3. IT Performance Dashboard: Service Level Agreement (SLA) Dashboard

    Data.gov (United States)

    Department of Veterans Affairs — The IT Performance Dashboard is a trusted source for IT performance information across VA. This is available only on the VA intranet. The dashboard is a collection...

  4. Distributed Trust Management for Validating SLA Choreographies

    Science.gov (United States)

    Haq, Irfan Ul; Alnemr, Rehab; Paschke, Adrian; Schikuta, Erich; Boley, Harold; Meinel, Christoph

    For business workflow automation in a service-enriched environment such as a grid or a cloud, services scattered across heterogeneous Virtual Organizations (VOs) can be aggregated in a producer-consumer manner, building hierarchical structures of added value. In order to preserve the supply chain, the Service Level Agreements (SLAs) corresponding to the underlying choreography of services should also be incrementally aggregated. This cross-VO hierarchical SLA aggregation requires validation, for which a distributed trust system becomes a prerequisite. Elaborating our previous work on rule-based SLA validation, we propose a hybrid distributed trust model. This new model is based on Public Key Infrastructure (PKI) and reputation-based trust systems. It helps preventing SLA violations by identifying violation-prone services at service selection stage and actively contributes in breach management at the time of penalty enforcement.

  5. VieSLAF Framework: Enabling Adaptive and Versatile SLA-Management

    Science.gov (United States)

    Brandic, Ivona; Music, Dejan; Leitner, Philipp; Dustdar, Schahram

    Novel computing paradigms like Grid and Cloud computing demand guarantees on non-functional requirements such as application execution time or price. Such requirements are usually negotiated following a specific Quality of Service (QoS) model and are expressed using Service Level Agreements (SLAs). Currently available QoS models assume either that service provider and consumer have matching SLA templates and common understanding of the negotiated terms or provide public templates, which can be downloaded and utilized by the end users. On the one hand, matching SLA templates represent an unrealistic assumption in systems where service consumer and provider meet dynamically and on demand. On the other hand, handling of public templates seems to be a rather challenging issue, especially if the templates do not reflect users’ needs. In this paper we present VieSLAF, a novel framework for the specification and management of SLA mappings. Using VieSLAF users may specify, manage, and apply SLA mapping bridging the gap between non-matching SLA templates. Moreover, based on the predefined learning functions and considering accumulated SLA mappings, domain specific public SLA templates can be derived reflecting users’ needs.

  6. Towards Cloud Computing SLA Risk Management: Issues and Challenges

    OpenAIRE

    Morin, Jean-Henry; Aubert, Jocelyn; Gateau, Benjamin

    2012-01-01

    Cloud Computing has become mainstream technology offering a commoditized approach to software, platform and infrastructure as a service over the Internet on a global scale. This raises important new security issues beyond traditional perimeter based approaches. This paper attempts to identify these issues and their corresponding challenges, proposing to use risk and Service Level Agreement (SLA) management as the basis for a service level framework to improve governance, risk and compliance i...

  7. SecSLA: A Proactive and Secure Service Level Agreement Framework for Cloud Services

    OpenAIRE

    Fahad F. Alruwaili; T. Aaron Gulliver

    2014-01-01

    Cloud customers migrate to cloud services to reduce the operational costs of information technology (IT) and increase organization efficiency. However, ensuring cloud security is very challenging. As a consequence, cloud service providers find it difficult to persuade customers to acquire their services due to security concerns. In terms of outsourcing applications, software, and/or infrastructure services to the cloud, customers are concerned about the availability, integrity, privacy...

  8. Negotiation and Monitoring of Service Level Agreements

    Science.gov (United States)

    Quillinan, Thomas B.; Clark, Kassidy P.; Warnier, Martijn; Brazier, Frances M. T.; Rana, Omer

    Service level agreements (SLAs) provide a means to define specific Quality of Service (QoS) guarantees between providers and consumers of services. Negotiation and definition of these QoS characteristics is an area of significant research. However, defining the actions that take place when an agreement is violated is a topic of more recent focus. This paper discusses recent advances in this field and propose some additional features that can help both consumers and producers during the enactment of services. These features include the ability to (re)negotiate penalties in an agreement, and specifically focuses on the renegotiation of penalties during enactment to reflect ongoing violations.

  9. SLA Looks Globally.

    Science.gov (United States)

    Mark, Linda

    1992-01-01

    Summarizes the 1992 Special Libraries Association (SLA) Annual Conference. Topics discussed include emphasizing internationalism; competing in a global economy; the competitive importance of information; downsizing because of financial constraints; Internet and NREN (National Research and Education Network); recruitment; ethics; standards; and the…

  10. GreenIT Service Level Agreements

    Science.gov (United States)

    von Laszewski, Gregor; Wang, Lizhe

    In this paper we are introducing a framework towards the inclusion of Green IT metrics as part of service level agreements for future Grids and Clouds. As part of this effort we need to revisit Green IT metrics and proxies that we consider optimizing against in order to develop GreenIT as a Services (GaaS) that can be reused as part of a Software as a Service (SaaS) and Infrastructure Infrastructureas a service (IaaS) framework. We report on some of our ongoing efforts and demonstrate how we already achieve impact on the environment with our services.

  11. The cost for meeting SLA dependability requirements; implications for customers and providers

    International Nuclear Information System (INIS)

    Følstad, Eirik L.; Helvik, Bjarne E.

    2016-01-01

    A Service Level Agreement (SLA) describes the service, the service-level objectives (SLOs), the price the customer should pay and the compensation if the SLOs are not met. There is a trade-off for the provider between the costs for improving the deployed service quality vs. probability of paying compensation. We propose how to estimate the provider's optimal service deployment. We show that the optimal deployed service quality is dependent on the SLOs, deployment cost, compensation and observation interval. A service deployment based on cost optimization results in targeted dependability objective values that are significantly better than stated in the SLOs. The proposed approach provides valuable insight for an aggregator, who buys services from other providers, to negotiate adequate SLOs, price and compensation from the providers to make a valuable offer for its own customers. - Highlights: • SLA with availability, number of failures, down time criteria and observation period. • Analysis of compound service delivery in the SLA context by a semi-Markov model. • SLA non-conformance risk dependent on the inherent/steady state system parameters. • Cost optimal service operation under non-conformance penalties (the safety margin).

  12. SLA-aware differentiated QoS in elastic optical networks

    Science.gov (United States)

    Agrawal, Anuj; Vyas, Upama; Bhatia, Vimal; Prakash, Shashi

    2017-07-01

    The quality of service (QoS) offered by optical networks can be improved by accurate provisioning of service level specifications (SLSs) included in the service level agreement (SLA). A large number of users coexisting in the network require different services. Thus, a pragmatic network needs to offer a differentiated QoS to a variety of users according to the SLA contracted for different services at varying costs. In conventional wavelength division multiplexed (WDM) optical networks, service differentiation is feasible only for a limited number of users because of its fixed-grid structure. Newly introduced flex-grid based elastic optical networks (EONs) are more adaptive to traffic requirements as compared to the WDM networks because of the flexibility in their grid structure. Thus, we propose an efficient SLA provisioning algorithm with improved QoS for these flex-grid EONs empowered by optical orthogonal frequency division multiplexing (O-OFDM). The proposed algorithm, called SLA-aware differentiated QoS (SADQ), employs differentiation at the level of routing, spectrum allocation, and connection survivability. The proposed SADQ aims to accurately provision the SLA using such multilevel differentiation with an objective to improve the spectrum utilization from the network operator's perspective. SADQ is evaluated for three different CoSs under various traffic demand patterns and for different ratios of the number of requests belonging to the three considered CoSs. We propose two new SLA metrics for the improvement of functional QoS requirements, namely, security, confidentiality and survivability of high class of service (CoS) traffic. Since, to the best of our knowledge, the proposed SADQ is the first scheme in optical networks to employ exhaustive differentiation at the levels of routing, spectrum allocation, and survivability in a single algorithm, we first compare the performance of SADQ in EON and currently deployed WDM networks to assess the

  13. Service level agreements a legal and practical guide

    CERN Document Server

    Desai, Jimmy

    2010-01-01

    By reading this a short, legal and practical guide to SLAs, you should be able to quickly come up to speed with some of the legal and practical issues that might arise. Negotiating the SLA and putting the SLA into action are also discussed in the pocket guide. Whilst short and easy to digest, case references and weblinks have been provided in the text so readers can find out more information about SLAs.  

  14. An Investigation into Specifying Service Level Agreements for Provisioning Cloud Computing Services

    Science.gov (United States)

    2012-12-01

    IT .................................................................................................... Information Technology KPI ...the service delivery be measured? 3. Key Performance Indicators ( KPIs ): Describe the KPIs and the responsible party for producing the KPIs . 4...level objectives (SLOs) that are evaluated according to measurable Key Performance Indicators ( KPIs ). Automatic SLA protection enables further

  15. Optimizing virtual machine placement for energy and SLA in clouds using utility functions

    Directory of Open Access Journals (Sweden)

    Abdelkhalik Mosa

    2016-10-01

    Full Text Available Abstract Cloud computing provides on-demand access to a shared pool of computing resources, which enables organizations to outsource their IT infrastructure. Cloud providers are building data centers to handle the continuous increase in cloud users’ demands. Consequently, these cloud data centers consume, and have the potential to waste, substantial amounts of energy. This energy consumption increases the operational cost and the CO2 emissions. The goal of this paper is to develop an optimized energy and SLA-aware virtual machine (VM placement strategy that dynamically assigns VMs to Physical Machines (PMs in cloud data centers. This placement strategy co-optimizes energy consumption and service level agreement (SLA violations. The proposed solution adopts utility functions to formulate the VM placement problem. A genetic algorithm searches the possible VMs-to-PMs assignments with a view to finding an assignment that maximizes utility. Simulation results using CloudSim show that the proposed utility-based approach reduced the average energy consumption by approximately 6 % and the overall SLA violations by more than 38 %, using fewer VM migrations and PM shutdowns, compared to a well-known heuristics-based approach.

  16. Introducing Positive Psychology to SLA

    Science.gov (United States)

    MacIntyre, Peter D.; Mercer, Sarah

    2014-01-01

    Positive psychology is a rapidly expanding subfield in psychology that has important implications for the field of second language acquisition (SLA). This paper introduces positive psychology to the study of language by describing its key tenets. The potential contributions of positive psychology are contextualized with reference to prior work,…

  17. Signalling in international environmental agreements. Using pre-agreement emission level as a signalling device

    Energy Technology Data Exchange (ETDEWEB)

    Steiner, U.

    1997-12-31

    This paper addresses the question about strategic incentives in international environmental agreements and tries to give a positive description of how the design of the agreement influences the strategic behaviour of potential participants before they enter the treaty. A common feature of the design of agreements is that the reduction obligations (RO) are made contingent on a pre-agreement or baseline emission. As it is assumed that countries posses better information about their reduction costs than does the international body in charge of deciding the RO, countries might have incentives to signal higher costs by increasing their baseline emission, and thereby reducing the costs of entering the agreement. The appropriate analytical framework is to use a signalling game approach, where the pre-agreement emission level conveys information about the privately informed country`s reduction cost. In this paper two types of agreement design are considered, one with uniform obligations, and one with differentiated obligations. This enables us to make a comparison between two different reduction regimes. The result is that the predicted outcomes vary with regard to both the environmental effectiveness and the associated expected costs for the participating countries. This means that when private information is considered, the anticipation of a given institutional framework has significant impact on the resulting distortion of the total emission level, highlighting the necessity of taking this into consideration when future designs are proposed. (au)

  18. Signalling in international environmental agreements: Using pre-agreement emission level as a signalling device

    International Nuclear Information System (INIS)

    Steiner, U.

    1997-01-01

    This paper addresses the question about strategic incentives in international environmental agreements and tries to give a positive description of how the design of the agreement influences the strategic behaviour of potential participants before they enter the treaty. A common feature of the design of agreements is that the reduction obligations (RO) are made contingent on a pre-agreement or baseline emission. As it is assumed that countries posses better information about their reduction costs than does the international body in charge of deciding the RO, countries might have incentives to signal higher costs by increasing their baseline emission, and thereby reducing the costs of entering the agreement. The appropriate analytical framework is to use a signalling game approach, where the pre-agreement emission level conveys information about the privately informed country's reduction cost. In this paper two types of agreement design are considered, one with uniform obligations, and one with differentiated obligations. This enables us to make a comparison between two different reduction regimes. The result is that the predicted outcomes vary with regard to both the environmental effectiveness and the associated expected costs for the participating countries. This means that when private information is considered, the anticipation of a given institutional framework has significant impact on the resulting distortion of the total emission level, highlighting the necessity of taking this into consideration when future designs are proposed. (au)

  19. Introducing positive psychology to SLA

    Directory of Open Access Journals (Sweden)

    Sarah Mercer

    2014-01-01

    Full Text Available Positive psychology is a rapidly expanding subfield in psychology that has important implications for the field of second language acquisition (SLA. This paper introduces positive psychology to the study of language by describing its key tenets. The potential contributions of positive psychology are contextualized with reference to prior work, including the humanistic movement in language teaching, models of motivation, the concept of an affective filter, studies of the good language learner, and the concepts related to the self. There are reasons for both encouragement and caution as studies inspired by positive psychology are undertaken. Papers in this special issue of SSLLT cover a range of quantitative and qualitative methods with implications for theory, research, and teaching practice. The special issue serves as a springboard for future research in SLA under the umbrella of positive psychology.

  20. Dynamic SLA Negotiation in Autonomic Federated Environments

    Science.gov (United States)

    Rubach, Pawel; Sobolewski, Michael

    Federated computing environments offer requestors the ability to dynamically invoke services offered by collaborating providers in the virtual service network. Without an efficient resource management that includes Dynamic SLA Negotiation, however, the assignment of providers to customer's requests cannot be optimized and cannot offer high reliability without relevant SLA guarantees. We propose a new SLA-based SERViceable Metacomputing Environment (SERVME) capable of matching providers based on QoS requirements and performing autonomic provisioning and deprovisioning of services according to dynamic requestor needs. This paper presents the SLA negotiation process that includes on-demand provisioning and uses an object-oriented SLA model for large-scale service-oriented systems supported by SERVME. An initial reference implementation in the SORCER environment is also described.

  1. Agreements

    International Nuclear Information System (INIS)

    2001-01-01

    These columns summarize the different bilateral and multilateral agreements concluded recently between the different OECD countries and concerning the nuclear energy domain: Argentina - Australia: Agreement concerning Co-operation in the Peaceful Uses of Nuclear Energy (2001). Argentina - Brazil: Joint Declaration regarding the Creation of the Argentinean-Brazilian Agency for Nuclear Energy Applications (2001). Australia - Czech Republic / Australia - Hungary: Agreements on Co-operation in Peaceful Uses of Nuclear Energy and the Transfer of Nuclear Material (2001). Australia - Indonesia: Arrangement Concerning Co-operation on Nuclear Safeguards and Related Matters (2001). Austria - Switzerland: Agreement on the Early Exchange of Information in the Field of Nuclear Safety and Radiation. Brazil - United States: Extension of the Agreement concerning Research and Development in Nuclear Material Control, Accountancy, Verification, Physical Protection, and Advanced Containment and Surveillance Technologies for International Safeguards Applications (2001). Czech Republic - Republic of Korea: Agreement for Co-operation in the Peaceful Uses of Nuclear Energy (2001). European Union- Russian Federation: Agreements on Nuclear Safety and Controlled Nuclear Fusion (2001). France - United States: Agreement for Co-operation in Advanced Nuclear Reactor Science and Technology (2001). Japan - United Kingdom: Co-operation Agreement on Advanced Nuclear Fuel Cycle, Fast Breeder Reactor and Other Related Technologies (2001). Republic OF Korea - United States: Annex IV Joint Project on Cintichem Technology (2000). Morocco - United States: Protocol amending the Co-operation Agreement on the Peaceful Uses of Nuclear Energy (2001). Multilateral Agreements: Agreement for Information Exchange on Radiological Surveillance in Northern Europe (2001). Status of Conventions in the Field of Nuclear Energy. (author)

  2. Security in Service Level Agreements for Cloud Computing

    OpenAIRE

    Bernsmed, Karin; JAATUN, Martin Gilje; Undheim, Astrid

    2011-01-01

    The Cloud computing paradigm promises reliable services, accessible from anywhere in the world, in an on-demand manner. Insufficient security has been identified as a major obstacle to adopting Cloud services. To deal with the risks associated with outsourcing data and applications to the Cloud, new methods for security assurance are urgently needed. This paper presents a framework for security in Service Level Agreements for Cloud computing. The purpose is twofold; to help potential Cloud cu...

  3. TeSLA e-assessment workshop

    NARCIS (Netherlands)

    Janssen, José

    2016-01-01

    Presentatie ten behoeve van de e-assessment workshop voor docenten van de Open Universiteit Nederland betrokken in de eerste TeSLA pilot. Topics: toetsfraude, toetsdesign, technologie voor authenticatie en verificatie van auteurschap.

  4. TeSLA workshop betrouwbaar toetsen op afstand

    NARCIS (Netherlands)

    Brouns, Francis; Janssen, José

    2017-01-01

    Presentatie ten behoeve van workshop betrouwbaar toetsen op afstand voor docenten van de Open Universiteit Nederland betrokken in de derde TeSLA pilot. Topics: toetsfraude, toetsdesign, technologie voor authenticatie en verificatie van auteurschap, TeSLA instrumenten.

  5. TeSLA e-assessment workshop pilot 2

    OpenAIRE

    Janssen, José

    2017-01-01

    Presentatie ten behoeve van de e-assessment workshop voor docenten van de Open Universiteit Nederland betrokken in de tweede TeSLA pilot. Topics: toetsfraude, toetsdesign, technologie voor authenticatie en verificatie van auteurschap, TeSLA instrument.

  6. Dicty_cDB: SLA117 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLA117 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Or...iginal site) - - SLA117Z 649 - - - - Show SLA117 Library SL (Link to library) Clone ID SLA117 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dictycdb.b...--EPMHRNYYQPIQFKLPSFPDTSLPITQIDDKTGIFDSQRFLAFNNPQAMSKYESYRI YIHPSLGYSGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTE...SYRI YIHPSLGYSGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTEYYQTKSYFSANP HAKGKVLLVKNNILTRVKDGGFTLSLKPMCCSGHNSHIPLYF

  7. Relating SLA Research to Language Teaching Materials

    Directory of Open Access Journals (Sweden)

    Vivian J. Cook

    1998-12-01

    Full Text Available Abstract This article discusses applications of Second Language Acquisition (SLA research to the preparation of language coursebooks. The author suggests a number of ways in which SLA research findings can help improve coursebooks and thereby enhance the learning of large numbers of students. Research leads us to consider learners as genuine speakers of the L2, as bilinguals who still have an L1 present in their minds and who do not all go about learning the L2 in the same way. Few coursebooks take into account these and other findings of SLA research, for example: that the acquisition of basic syntax precedes the acquisition of inflectional morphology, that most of the syntax to be learned is really part of the lexicon, or that vocabulary needs to be encountered in a structural and semantic context in order to be effectively acquired. Coursebook authors also need to bear in mind that pronunciation is necessary not only for communication but also for the actual learning of L2 forms, and that some aspects of the L2 writing system need to be explicitly taught. The author provides two sample lessons to illustrate how these research findings might be applied to the writing of a coursebook.

  8. Pembuatan Service Level Requirement, Service Level Agreement dan Operational Level Agreement pada layanan help desk SAP berdasarkan kerangka kerja ITIL versi 2011 (Studi Kasus : Pupuk Indonesia Holding Company

    Directory of Open Access Journals (Sweden)

    Nur Shabrina Prameswari

    2017-01-01

    Full Text Available PT. Pupuk Indonesia Holding Company baru saja melakukan implementasi SAP pada tahun 2014. Dalam penerapannya, perusahaan merasa perlu membuat help desk SAP sebagai pusat penanganan masalah bagi perusahaan dan 7 anak perusahaannya yang kemudian dapat berfungsi juga sebagai knowledge base yang berguna apabila ada masalah yang berulang diwaktu selanjutnya. Untuk merancang layanan help desk yang baik, perlu didefinisikannya target layanan dalam sebuah kontrak perjanjian antara pengguna layanan dan penyedia layanan. Selain itu,Perjanjian layanan tersebut diperlukan juga sebagai jaminan kualitas help desk yang dapat disepakati oleh penyedia layanan dan pengguna layanan yang merupakan pengguna SAP pada PT. Pupuk Indonesia dan anak perusahaannya. Hal tersebut bertujuan untuk menyelaraskan bisnis dengan kualitas layanan serta menentukan kebutuhan dan harapan pelanggan dalam sebuah perjanjian antara penyedia layanan dan pengguna layanan. Dari permasalahan tersebut, maka diperlukan pembuatan dokumen Service Level Requirement, Service Level Agreement dan juga Operational Level Agreement pada help desk SAP, dengan dilakukan observasi dokumen dan wawancara pada pihak pengguna layanan dan penyedia layanan, maka setelah itu dibuatlah dokumen Service Level management tersebut berdasarkan ITIL Versi 2011.

  9. Dicty_cDB: SLA340 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLA340 (Link to dictyBase) - - - Contig-U16510-1 - (Link to Or...iginal site) - - SLA340Z 466 - - - - Show SLA340 Library SL (Link to library) Clone ID SLA340 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16510-1 Original site URL http://dictycdb.b.... 2 Translated Amino Acid sequence ---CGKPSPIPTCTRKLSPISICIIKLCPIFICITKLCSIYICTISICIIFICIICSNYS CNYNCNYSCNYN...qpqlqlqlqlqpqpqlqpqlqpq lplkfnqktffikyhynnffnnnsikk*y*kspffl Frame C: ---CGKPSPIPTCTRKLSPISICIIKLCPIFICITKLCSIYICT

  10. SlaVaComp Fonts Converter

    Directory of Open Access Journals (Sweden)

    Simon Skilevic

    2013-12-01

    Full Text Available This paper presents a fonts converter that was developed as a part of the Freiburg project on historical corpus linguistics. The tool named SlaVaComp-Konvertierer converts Church Slavonic texts digitized with non-Unicode fonts into the Unicode format without any loss of information contained in the original file and without damage to the original formatting. It is suitable for the conversion of all idiosyncratic fonts—not only Church Slavonic—and therefore can be used not only in Palaeoslavistic, but also in all historical and philological studies.

  11. Current Issues in the Teaching of Grammar: An SLA Perspective

    Science.gov (United States)

    Ellis, Rod

    2006-01-01

    The study of how learners acquire a second language (SLA) has helped to shape thinking about how to teach the grammar of a second language. There remain, however, a number of controversial issues. This paper considers eight key questions relating to grammar pedagogy in the light of findings from SLA. As such, this article complements…

  12. On the Nature of Interaction in SLA: A Philosophical Stream

    Science.gov (United States)

    Maftoon, Parviz; Shakouri, Nima

    2013-01-01

    Researchers have long grappled with situating the stance of interaction in SLA, but it is only recently that interaction has begun to receive consideration from SLA quarters. Delving into the nature of interaction and the prerequisite of interaction in real world, in general, and in classroom, in particular, the authors hold that based on…

  13. TeSLA pilot 2 pedagogical & quality aspects

    OpenAIRE

    Janssen, José

    2018-01-01

    Presentation given at the TeSLA project meeting at the Open University of the Netherlands, addressing pedagogical aspects of pilot 2 and clarification of the scope and limitations of the TeSLA instruments with respect to pedagogy, assessment activity and type of academic dishonesty.

  14. Dicty_cDB: SLA529 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLA529 (Link to dictyBase) - - - Contig-U13922-1 SLA529F (Link... to Original site) SLA529F 670 - - - - - - Show SLA529 Library SL (Link to library) Clone ID SLA529 (Link to dic...1247( FM992688 |pid:none) Candida dubliniensis CD36 chrom... 35 2.6 EU565733_1( EU565733 |pid:none) Uncult...009385_2728( AP009385 |pid:none) Burkholderia multivorans ATCC 1... 33 5.8 AM260479_1383( AM260479 |pid:none...letal 8.0 %: mitochondrial 4.0 %: Golgi 4.0 %: vesicles of secretory system 4.0 %: endoplasmic reticul

  15. MeReg: Managing Energy-SLA Tradeoff for Green Mobile Cloud Computing

    Directory of Open Access Journals (Sweden)

    Rahul Yadav

    2017-01-01

    Full Text Available Mobile cloud computing (MCC provides various cloud computing services to mobile users. The rapid growth of MCC users requires large-scale MCC data centers to provide them with data processing and storage services. The growth of these data centers directly impacts electrical energy consumption, which affects businesses as well as the environment through carbon dioxide (CO2 emissions. Moreover, large amount of energy is wasted to maintain the servers running during low workload. To reduce the energy consumption of mobile cloud data centers, energy-aware host overload detection algorithm and virtual machines (VMs selection algorithms for VM consolidation are required during detected host underload and overload. After allocating resources to all VMs, underloaded hosts are required to assume energy-saving mode in order to minimize power consumption. To address this issue, we proposed an adaptive heuristics energy-aware algorithm, which creates an upper CPU utilization threshold using recent CPU utilization history to detect overloaded hosts and dynamic VM selection algorithms to consolidate the VMs from overloaded or underloaded host. The goal is to minimize total energy consumption and maximize Quality of Service, including the reduction of service level agreement (SLA violations. CloudSim simulator is used to validate the algorithm and simulations are conducted on real workload traces in 10 different days, as provided by PlanetLab.

  16. The Importance of Input and Interaction in SLA

    Institute of Scientific and Technical Information of China (English)

    党春花

    2009-01-01

    As is known to us, input and interaction play the crucial roles in second language acquisition (SLA). Different linguistic schools have different explanations to input and interaction Behaviorist theories hold a view that input is composed of stimuli and response, putting more emphasis on the importance of input, while mentalist theories find input is a necessary condition to SLA, not a sufficient condition. At present, social interaction theories, which is one type of cognitive linguistics, suggests that besides input, interaction is also essential to language acquisition. Then, this essay will discuss how input and interaction result in SLA.

  17. The optimal design of service level agreement in IAAS based on BDIM

    Science.gov (United States)

    Liu, Xiaochen; Zhan, Zhiqiang

    2013-03-01

    Cloud Computing has become more and more prevalent over the past few years, and we have seen the importance of Infrastructure-as-a-service (IaaS). This kind of service enables scaling of bandwidth, memory, computing power and storage. But the SLA in IaaS also faces complexity and variety. Users also consider the business of the service. To meet the most users requirements, a methodology for designing optimal SLA in IaaS from the business perspectives is proposed. This method is different from the conventional SLA design method, It not only focuses on service provider perspective, also from the customer to carry on the design. This methodology better captures the linkage between service provider and service client by considering minimizing the business loss originated from performance degradation and IT infrastructure failures and maximizing profits for service provider and clients. An optimal design in an IaaS model is provided and an example are analyzed to show this approach obtain higher profit.

  18. The biocompatibility of SLA-treated titanium implants

    International Nuclear Information System (INIS)

    Kim, Hyeongil; Choi, Seong-Ho; Ryu, Jae-Jun; Koh, Seung-Yong; Park, Ju-Han; Lee, In-Seop

    2008-01-01

    The titanium implant surface was sandblasted with large grits and acid etched (SLA) to increase the implant surface for osseointegration. The topography of the titanium surface was investigated with scanning electron microscopy (SEM) and a profilometer. The SLA implant demonstrated uniform small micro pits (1-2 μm in diameter). The values of average roughness (R a ) and maximum height (R t ) were 1.19 μm and 10.53 μm respectively after sandblasting and the acid-etching treatment. In the cell-surface interaction study, the human osteoblast cells grew well in vitro. The in vivo evaluation of the SLA implant placed in rabbit tibia showed good bone-to-implant contact (BIC) with a mean value of 29% in total length of the implant. In the short-term clinical study, SLA implants demonstrated good clinical performance, maintaining good crestal bone height

  19. Impact of SLA assimilation in the Sicily Channel Regional Model: model skills and mesoscale features

    Directory of Open Access Journals (Sweden)

    A. Olita

    2012-07-01

    Full Text Available The impact of the assimilation of MyOcean sea level anomalies along-track data on the analyses of the Sicily Channel Regional Model was studied. The numerical model has a resolution of 1/32° degrees and is capable to reproduce mesoscale and sub-mesoscale features. The impact of the SLA assimilation is studied by comparing a simulation (SIM, which does not assimilate data with an analysis (AN assimilating SLA along-track multi-mission data produced in the framework of MyOcean project. The quality of the analysis was evaluated by computing RMSE of the misfits between analysis background and observations (sea level before assimilation. A qualitative evaluation of the ability of the analyses to reproduce mesoscale structures is accomplished by comparing model results with ocean colour and SST satellite data, able to detect such features on the ocean surface. CTD profiles allowed to evaluate the impact of the SLA assimilation along the water column. We found a significant improvement for AN solution in terms of SLA RMSE with respect to SIM (the averaged RMSE of AN SLA misfits over 2 years is about 0.5 cm smaller than SIM. Comparison with CTD data shows a questionable improvement produced by the assimilation process in terms of vertical features: AN is better in temperature while for salinity it gets worse than SIM at the surface. This suggests that a better a-priori description of the vertical error covariances would be desirable. The qualitative comparison of simulation and analyses with synoptic satellite independent data proves that SLA assimilation allows to correctly reproduce some dynamical features (above all the circulation in the Ionian portion of the domain and mesoscale structures otherwise misplaced or neglected by SIM. Such mesoscale changes also infer that the eddy momentum fluxes (i.e. Reynolds stresses show major changes in the Ionian area. Changes in Reynolds stresses reflect a different pumping of eastward momentum from the eddy to

  20. SlaVaComp: Konvertierungstool (= SlaVaComp Fonts Converter

    Directory of Open Access Journals (Sweden)

    Simon Skilevic

    2013-12-01

    Full Text Available Der vorliegende Beitrag informiert über ein Tool, das im Rahmen eines Freiburger Projekts zur historischen Korpuslinguistik entwickelt wurde und dazu dient, kirchenslavische Texte, die ohne Einsatz von Unicode digitalisiert wurden, ohne Verlust von Information bzw. Formatierung ins Unicode-Format zu überführen. Das Tool heißt SlaVaComp-Konvertierer. Es eignet sich für die Konvertierung aller idiosynkratischen Fonts und kann somit nicht nur in der Paläoslavistik, sondern in allen historisch arbeitenden Philologien eingesetzt werden. ____________________ This paper presents a fonts converter that was developed as a part of the Freiburg project on historical corpus linguistics. The tool named SlaVaComp-Konvertierer converts Church Slavonic texts digitized with non-Unicode fonts into the Unicode format without any loss of information contained in the original file and without damage to the original formatting. It is suitable for the conversion of all idiosyncratic fonts—not only Church Slavonic—and therefore can be used not only in Palaeoslavistic, but also in all historical and philological studies.

  1. The Determination of Jurisdiction in Grid and Cloud Service Level Agreements

    Science.gov (United States)

    Parrilli, Davide Maria

    Service Level Agreements in Grid and Cloud scenarios can be a source of disputes particularly in case of breach of the obligations arising under them. It is then important to determine where parties can litigate in relation with such agreements. The paper deals with this question in the peculiar context of the European Union, and so taking into consideration Regulation 44/2001. According to the rules on jurisdiction provided by the Regulation, two general distinctions are drawn in order to determine which (European) courts are competent to adjudicate disputes arising out of a Service Level Agreement. The former is between B2B and B2C transactions, and the latter regards contracts which provide a jurisdiction clause and contracts which do not.

  2. Marginal Bone Loss Around Early-Loaded SLA and SLActive Implants: Radiological Follow-Up Evaluation Up to 6.5 Years.

    Science.gov (United States)

    Şener-Yamaner, Işil Damla; Yamaner, Gökhan; Sertgöz, Atilla; Çanakçi, Cenk Fatih; Özcan, Mutlu

    2017-08-01

    The aim of this study was to compare marginal bone loss around early-loaded SLA and SLActive tissue-level implants (Straumann Dental Implants; Institut Straumann AG, Basel, Switzerland) after a mean of 81-month follow-up period. One hundred seven SLA and 68 SLActive implants were placed in 55 patients and loaded with final restoration after 8 and 3 weeks of healing time, respectively. Marginal bone loss around implants was determined radiographically at initial and after a mean observation time ranging between 20 and 81 months. The effect of location (mandible vs maxilla), smoking habit, sex, implant length and diameter, and the type of prosthesis on the marginal bone loss was evaluated. The overall cumulative survival rate was 98.2% being 99% for SLA implants and 97% for SLActive implants. After 20-month follow-up period, mean marginal bone loss values for the SLA and SLActive implants were 0.24 and 0.17 mm, respectively. After 81 months, mean marginal bone loss for the SLA and SLActive implants reached 0.71 and 0.53 mm, respectively. Marginal bone loss was affected by the length and type of implant and patients' smoking habit after a mean observation time of 20 months. However, none of the parameters had any significant effect on the marginal bone loss after a follow-up period of 81 months. With both SLA and SLActive implants, successful clinical results could be achieved up to 6.5 years of follow-up period.

  3. Predictors of Shared Decision Making and Level of Agreement between Consumers and Providers in Psychiatric Care

    Science.gov (United States)

    Fukui, Sadaaki; Salyers, Michelle P.; Matthias, Marianne S.; Collins, Linda; Thompson, John; Coffman, Melinda; Torrey, William C.

    2014-01-01

    The purpose of this study was to quantitatively examine elements of shared decision making (SDM), and to establish empirical evidence for factors correlated with SDM and the level of agreement between consumer and provider in psychiatric care. Transcripts containing 128 audio-recorded medication check-up visits with eight providers at three community mental health centers were rated using the Shared Decision Making scale, adapted from Braddock’s Informed Decision Making Scale (Braddock et al., 1997; 1999; 2008). Multilevel regression analyses revealed that greater consumer activity in the session and greater decision complexity significantly predicted the SDM score. The best predictor of agreement between consumer and provider was “exploration of consumer preference,” with a four-fold increase in full agreement when consumer preferences were discussed more completely. Enhancing active consumer participation, particularly by incorporating consumer preferences in the decision making process appears to be an important factor in SDM. PMID:23299226

  4. Mitosis Counting in Breast Cancer: Object-Level Interobserver Agreement and Comparison to an Automatic Method.

    Science.gov (United States)

    Veta, Mitko; van Diest, Paul J; Jiwa, Mehdi; Al-Janabi, Shaimaa; Pluim, Josien P W

    2016-01-01

    Tumor proliferation speed, most commonly assessed by counting of mitotic figures in histological slide preparations, is an important biomarker for breast cancer. Although mitosis counting is routinely performed by pathologists, it is a tedious and subjective task with poor reproducibility, particularly among non-experts. Inter- and intraobserver reproducibility of mitosis counting can be improved when a strict protocol is defined and followed. Previous studies have examined only the agreement in terms of the mitotic count or the mitotic activity score. Studies of the observer agreement at the level of individual objects, which can provide more insight into the procedure, have not been performed thus far. The development of automatic mitosis detection methods has received large interest in recent years. Automatic image analysis is viewed as a solution for the problem of subjectivity of mitosis counting by pathologists. In this paper we describe the results from an interobserver agreement study between three human observers and an automatic method, and make two unique contributions. For the first time, we present an analysis of the object-level interobserver agreement on mitosis counting. Furthermore, we train an automatic mitosis detection method that is robust with respect to staining appearance variability and compare it with the performance of expert observers on an "external" dataset, i.e. on histopathology images that originate from pathology labs other than the pathology lab that provided the training data for the automatic method. The object-level interobserver study revealed that pathologists often do not agree on individual objects, even if this is not reflected in the mitotic count. The disagreement is larger for objects from smaller size, which suggests that adding a size constraint in the mitosis counting protocol can improve reproducibility. The automatic mitosis detection method can perform mitosis counting in an unbiased way, with substantial

  5. Modeling the Structural Response of Reinforced Glass Beams using an SLA Scheme

    NARCIS (Netherlands)

    Louter, P.C.; Graaf, van de Anne; Rots, J.G.; Bos, Freek; Louter, Pieter Christiaan; Veer, Fred

    2010-01-01

    This paper investigates whether a novel computational sequentially linear analysis (SLA) technique, which is especially developed for modeling brittle material response, is applicable for modeling the structural response of metal reinforced glass beams. To do so, computational SLA results are

  6. Evaluation of Service Level Agreement Approaches for Portfolio Management in the Financial Industry

    Science.gov (United States)

    Pontz, Tobias; Grauer, Manfred; Kuebert, Roland; Tenschert, Axel; Koller, Bastian

    The idea of service-oriented Grid computing seems to have the potential for fundamental paradigm change and a new architectural alignment concerning the design of IT infrastructures. There is a wide range of technical approaches from scientific communities which describe basic infrastructures and middlewares for integrating Grid resources in order that by now Grid applications are technically realizable. Hence, Grid computing needs viable business models and enhanced infrastructures to move from academic application right up to commercial application. For a commercial usage of these evolutions service level agreements are needed. The developed approaches are primary of academic interest and mostly have not been put into practice. Based on a business use case of the financial industry, five service level agreement approaches have been evaluated in this paper. Based on the evaluation, a management architecture has been designed and implemented as a prototype.

  7. Epistemological Diversity and Moral Ends of Research in Instructed SLA

    Science.gov (United States)

    Ortega, Lourdes

    2012-01-01

    In this article I explore epistemological diversity in the field of second language acquisition (SLA) from the perspective that obtains if we examine the moral ends of research, and we ask: In what ways does epistemological diversity relate to enhancing the social value and educational relevance of the research generated by the instructed SLA…

  8. Effectiviteit van middelen tegen Rhizoctonia in sla en radijs

    NARCIS (Netherlands)

    Hofland-Zijlstra, J.D.; Paternotte, S.J.; Janse, J.; Slooten, van M.A.

    2008-01-01

    Rhizoctonia is een veelvoorkomend probleem in sla en radijs en kan veel opbrengstverlies geven. Uit eerder onderzoek van Wageningen UR Glastuinbouw in radijs werd gevonden dat het enige toegelaten fungicide tegen Rhizoctonia in de praktijk niet voldoende werkt. Door het kleine middelenpakket in de

  9. Classification and Implication of Motivation Research in SLA

    Institute of Scientific and Technical Information of China (English)

    温泉

    2015-01-01

    <正>Introduction The author of this essay does not intend to clarify the controversy about motivation in Second Language Acquisition(SLA)as a critical social-psychological element in the field,because the research of motivation is such a complex process which requires some degree of expertise in three scholarly

  10. TeSLA presentatie voor medewerkers van AMN

    NARCIS (Netherlands)

    Janssen, José

    2017-01-01

    Presentatie over Online toetsen voor medewerkers van AMN (www.amn.nl). Topics: assessment onderzoek Welten-instituut en meer in het bijzonder het TeSLA project waarin instrumenten voor authenticatie en auteurschap verificatie worden gecombineerd om betrouwbaar toetsen op afstand mogelijk te maken.

  11. A combined prediction strategy increases identification of peptides bound with high affinity and stability to porcine MHC class I molecules SLA-1*04:01, SLA-2*04:01, and SLA-3*04:01

    DEFF Research Database (Denmark)

    Pedersen, Lasse Eggers; Rasmussen, Michael; Harndahl, Mikkel

    2016-01-01

    constitute an attractive protocol to select target peptides from the vast pool of viral proteome peptides. We have earlier reported the peptide binding motif of the porcine MHC-I molecules SLA-1*04:01 and SLA-2*04:01, identified by an ELISA affinity-based positional scanning combinatorial peptide library...

  12. Committed sea-level rise under the Paris Agreement and the legacy of delayed mitigation action.

    Science.gov (United States)

    Mengel, Matthias; Nauels, Alexander; Rogelj, Joeri; Schleussner, Carl-Friedrich

    2018-02-20

    Sea-level rise is a major consequence of climate change that will continue long after emissions of greenhouse gases have stopped. The 2015 Paris Agreement aims at reducing climate-related risks by reducing greenhouse gas emissions to net zero and limiting global-mean temperature increase. Here we quantify the effect of these constraints on global sea-level rise until 2300, including Antarctic ice-sheet instabilities. We estimate median sea-level rise between 0.7 and 1.2 m, if net-zero greenhouse gas emissions are sustained until 2300, varying with the pathway of emissions during this century. Temperature stabilization below 2 °C is insufficient to hold median sea-level rise until 2300 below 1.5 m. We find that each 5-year delay in near-term peaking of CO 2 emissions increases median year 2300 sea-level rise estimates by ca. 0.2 m, and extreme sea-level rise estimates at the 95th percentile by up to 1 m. Our results underline the importance of near-term mitigation action for limiting long-term sea-level rise risks.

  13. An Analysis on the Contextual Factors Affecting Motivation in SLA

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    <正>For us Chinese,a foreign language is something to be acquired as a kind of communicative tool,so we can infer that an effective way in SLA(Second Language Acquisition) must be learning the target language in a communicative context.A communicative context certainly concerns not only the interactional classroom activities designed in accordance with some stated curriculum tasks to lead the L2 students to learning swimming by swimming,but also other relevant elements which have a lot to do with all the situational,interactional and cultural contexts.In order to lessen some potential sources of conflict between L2 teacher and L2 learner,this article is an attempt to urge a careful study on the contextual factors affecting motivation in SLA.

  14. Comparison of satellite altimetry sea level anomalies and hydrographic observations in the Mediterranean Sea

    Directory of Open Access Journals (Sweden)

    Francisco Mir Calafat

    2012-08-01

    Full Text Available Steric sea level (SSL computed from hydrographic observations in the Mediterranean Sea is compared against altimetric sea level anomalies (SLA at seasonal and inter-annual time scales for the period 1993-2008. SSL (referenced to 300 m is computed using two data sets: in situ profiles and gridded products obtained from interpolated observations. The impact of expendable/mechanical bathythermograph (XBT/MBT biases affecting some of the in situ profiles is investigated by comparing both corrected and uncorrected data. For the period 2003-2008 the mass component is estimated from GRACE observations and subtracted from SLA. The analysis of the spatio-temporal distribution of profiles shows that the number of profiles with data below 300 m is a small percentage of the total and that their spatial coverage of the Mediterranean basin is very limited. This is an important handicap for regions where the contribution of the deep layers to SSL is significant. Overall, SSL and SLA are shown to be consistent in the Mediterranean at seasonal time scales, although the annual amplitude of the SSL from in situ profiles and interpolated data is considerably smaller than that of the SLA. The agreement at inter-annual time scales is less good. At some particular locations SSL computed from individual profiles is more correlated with SLA than the gridded products. At basin and sub-basin scales, however, interpolated and in situ observations provide similar results in terms of their correlation with observed SLA. The XBT/MBT bias corrections have little effect on the SSL at the time scales considered in this study.

  15. Voluntary agreements, implementation and efficiency. European relevance of case study results. Reflections on transferability to voluntary agreement schemes at the European level

    Energy Technology Data Exchange (ETDEWEB)

    Helby, Peter

    2000-04-01

    As a policy instrument, voluntary agreements often fascinate policy-makers.This is fuelled by a number of assumed advantages, such as the opportunity for co-operation rather than confrontation, speed and flexibility and the cost-effectiveness. Some advantages might even be accentuated at the European level: Co-operation has added advantage at the European level where the culture of consensus decision is strong. Flexibility is extra attractive for policy makers dealing with an economy less homogeneous than the average national economy. Speed is certainly welcomed by policy-makers otherwise faced with the slow-winding European legislative process. Cost-effectiveness is eagerly sought by European policy makers facing tight administrative budgets and staff limits. This report examines lessons from the VAIE case studies that may be useful to policy makers engaged in the development of voluntary approaches at the European level. These case studies are about voluntary agreement schemes for industrial energy efficiency deployed in Denmark, France, Germany, Netherlands, and Sweden. For a summary of these case studies, please refer to the the VAIE final report. More detailed information is available in the VAIE national reports. It needs to be emphasised that the empirical base is very narrow. The 'lessons' presented can only be hypotheses, based on an inductive leap from a very narrow experience. The reader will need to check these hypotheses against her own broader experience and personal judgement. According to the principle of subsidiarity, voluntary agreements should be implemented at the European level only if that would have significant advantage over national action. Action at the European level, rather than the national level, would have these potential advantages: Being more consistent with the development of the single market; Allowing higher demands on energy efficiency without negative effect on competitiveness and employment; Stimulating company

  16. ITIL Based Service Level Management if SLAs Cover Security

    Directory of Open Access Journals (Sweden)

    Tomas Feglar

    2005-08-01

    Full Text Available Current level of information technology creates new perspectives for more IT service oriented market. Quality of these services requires slightly different approach then was applied for products including software. No IT services are delivered and supported in risk free environment. Risks would be considered consistently with IT services quality gaps from Service Level Management (SLM perspective. SLM is one of ITIL modules that are widely used within the IT service industry. We identified some weaknesses in how SLM is developed in ITIL environment if service level agreement (SLA has cover Security. We argue that in such cases Architecture modeling and risk assessment approach let us effectively control analytical effort that relates to risks identification and understanding. Risk driven countermeasures designed in a next step (Risk treatment have significant impact to the SLM especially from responsibility perspective. To demonstrate SLM's importance in real practice we analyze SLA synthesize process in CCI (Cyber Critical Infrastructure environment.

  17. Nationwide individual record linkage study showed poor agreement of causes of death and hospital diagnoses at individual level but reasonable agreement at population level

    NARCIS (Netherlands)

    Klijs, Bart; Nusselder, Wilma J.; Mackenbach, Johan P.

    Objectives: To investigate to what extent underlying and multiple causes of death represent end-of-life morbidity in individuals and at population level. Study Design and Setting: Cause of death and national hospital data were individually linked for all deaths at the age of 50-84 years, in 2005 in

  18. Level of agreement among Latin American glaucoma subspecialists on the diagnosis and treatment of glaucoma: results of an online survey

    OpenAIRE

    Daniel E. Grigera; Paulo Augusto Arruda Mello; Wilma Lelis Barbosa; Javier Fernando Casiraghi; Rodolfo Perez Grossmann; Alejo Peyret

    2013-01-01

    PURPOSE: The aim of this research was to assess the level of agreement among glaucoma experts in Latin America on key practices related to treatment and diagnosis of glaucoma. METHODS: An online questionnaire was sent to a multinational panel of glaucoma experts. The questionnaire contained 107 statements on the medical treatment (Part 1) and diagnosis (Part 2) of glaucoma, and was developed in Spanish and translated into English. Agreement was defined as >70% of respondents. RESULTS: Fifty p...

  19. Second Language Writing Research and Written Corrective Feedback in SLA: Intersections and Practical Applications

    Science.gov (United States)

    Ferris, Dana R.

    2010-01-01

    For more than a decade now, a great deal of research has been done on the topic of written corrective feedback (CF) in SLA and second language (L2) writing. Nonetheless, what those research efforts really have shown as well as the possible implications for practice remain in dispute. Although L2 writing and SLA researchers often examine similar…

  20. Analytical Review of Universal Grammar (UG) Approach on Second Language Acquisition (SLA)

    Science.gov (United States)

    Irwandy

    2015-01-01

    The aim of this paper is to explore the analysis of Universal Grammar (UG) approach on Second Language Acquisition (SLA). This paper is significant as the sources for teacher or researcher of the second language since this elaboration is deeply focusing on the use of UG on SLA. The method used in this academic writing is inductive method of…

  1. 77 FR 38884 - Sisseton Milbank Railroad Company-Acquisition and Operation Exemption-SLA Property Management...

    Science.gov (United States)

    2012-06-29

    ... DEPARTMENT OF TRANSPORTATION Surface Transportation Board [Docket No. FD 35641] Sisseton Milbank Railroad Company--Acquisition and Operation Exemption--SLA Property Management Limited Partnership and... verified notice of exemption under 49 CFR 1150.31 to acquire from SLA Property Management Limited...

  2. Q methodology for post-social-turn research in SLA

    Directory of Open Access Journals (Sweden)

    Kay Irie

    2014-01-01

    Full Text Available Q methodology, an approach to inquiry on the subjective views about a complex phenomenon/issue which has been increasingly employed in a wide range of social science fields has not yet been applied in language learning and teaching research. It is a unique approach that has characteristics of both qualitative and quantitative research methods. The purpose of the present paper is to introduce Q methodology as an alternative approach and demonstrate its potential to respond to the needs of the field that has been expanding in its epistemological diversity since the social turn (Block, 2003; Ortega, 2012. The relevance of the methodology for SLA research will be discussed with a particular focus on the parallels between the development of the methodology in the 1930s and current criticisms towards the traditional cognitive approach in SLA. Using a published study (Irie & Ryan, 2014, the author explains how the focus on the holistic understanding of subjectivity is built into the procedure. Suggestions for possible areas of research and teaching in which Q methodology could be applied are discussed.

  3. Resource-level QoS metric for CPU-based guarantees in cloud providers

    OpenAIRE

    Goiri Presa, Íñigo; Julià Massó, Ferran; Fitó, Josep Oriol; Macías Lloret, Mario; Guitart Fernández, Jordi

    2010-01-01

    Success of Cloud computing requires that both customers and providers can be confident that signed Service Level Agreements (SLA) are supporting their respective business activities to their best extent. Currently used SLAs fail in providing such confidence, especially when providers outsource resources to other providers. These resource providers typically support very simple metrics, or metrics that hinder an efficient exploitation of their resources. In this paper, we propose a re...

  4. Level of agreement between physician and patient assessment of non-medical health factors.

    Science.gov (United States)

    Ludovic, Casanova; Virginie, Ringa; Sophia, Chatelard; Sylvain, Paquet; Isabelle, Pendola-Luchel; Henri, Panjo; Camille, Bideau; Eric, Deflesselle; Raphaëlle, Delpech; Géraldine, Bloy; Laurent, Rigal

    2018-01-29

    GPs need to consider assorted relevant non-medical factors, such as family or work situations or health insurance coverage, to determine appropriate patient care. If GPs' knowledge of these factors varies according to patients' social position, less advantaged patients might receive poorer care, resulting in the perpetuation of social inequalities in health. To assess social disparities in GPs' knowledge of non-medical factors relevant to patient care. Observational survey of GPs who supervise internships in the Paris metropolitan area. Each of the 52 enrolled GPs randomly selected 70 patients from their patient list. Their knowledge of five relevant factors (coverage by publicly funded free health insurance, or by supplementary health insurance, living with a partner, social support and employment status) was analysed as the agreement between the patients' and GPs' answers to matching questions. Occupational, educational and financial disparities were estimated with multilevel models adjusted for age, sex, chronic disease and GP-patient relationship. Agreement varied according to the factor considered from 66% to 91%. The global agreement score (percentage of agreement for all five factors) was 72%. Social disparities and often gradients, disfavouring the less well-off patients, were observed for each factor considered. Social gradients were most marked according to perceived financial situation and for health insurance coverage. GPs must be particularly attentive toward their least advantaged patients, to be aware of the relevant non-medical factors that affect these patients' health and care, and thus provide management adapted to each individual's personal situation. © The Author(s) 2018. Published by Oxford University Press. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  5. A Two-level-games Analysis of AFTA Agreements: What Caused ASEAN States to Move towards Economic Integration?

    Directory of Open Access Journals (Sweden)

    Yi-hung Chiou

    2010-04-01

    Full Text Available The goal of this article is to investigate the conditions under which ASEAN states are more likely to pursue regional economic integration, namely, a series of ASEAN Free Trade Area (AFTA agreements/ protocols. Adopting Putnam’s two-level-games model, this article examines the influences of domestic politics, political elites’ preferences, economic performance, and external impacts. Through the construction of a set of hypotheses, this article investigates five AFTA agreements/ protocols and the conditions of ASEAN states during the 1992–2003 period. The findings indicate that political leaders’ preferences have played a pivotal role in the development of the AFTA. Economic performance and domestic support in individual states has also affected the AFTA. The close link between AFTA agreements and external impacts reveals that the AFTA’s inherent nature is defensive.

  6. PRESENT CONDITION AND MEASURES TO EXPAND OF VOLUNTARY AGREEMENT ON PLASTIC SHOPPING BAGS REDUCTION AT THE PREFECTURAL LEVEL

    Science.gov (United States)

    Mori, Mayuka; Kanaya, Ken

    Purpose of this research is to clear present condition and measures to expand of voluntary agreement on plastic shopping bags reduction at the prefectural level. Methods of this research are questionnaire survey to prefectures implementing the agreement and survey by i town page to the number of stores of companies and the number of companies in the prefectures. Findings of this research are as follows: 1. The refusal rate of plastic shopping bags was 10-40% before the implementation of voluntary agreements. And the rate is approximately 70-90% after the implementation. Therefore, before and after the implementation of voluntary agreements, the refusal rate of plastic shopping bags is approximately 40-70% less. 2. It is suggested that the time and number of meetings from proposal to conclusion of the agreement are related in some way, to the ratio of stores participating. On the participation of administration, the ratio of stores participating in the case in which prefecture and cities participate is higher than in the case in which prefecture participates.

  7. Level of Agreement and Factors Associated With Discrepancies Between Nationwide Medical History Questionnaires and Hospital Claims Data

    Directory of Open Access Journals (Sweden)

    Yeon-Yong Kim

    2017-09-01

    Full Text Available Objectives The objectives of this study were to investigate the agreement between medical history questionnaire data and claims data and to identify the factors that were associated with discrepancies between these data types. Methods Data from self-reported questionnaires that assessed an individual’s history of hypertension, diabetes mellitus, dyslipidemia, stroke, heart disease, and pulmonary tuberculosis were collected from a general health screening database for 2014. Data for these diseases were collected from a healthcare utilization claims database between 2009 and 2014. Overall agreement, sensitivity, specificity, and kappa values were calculated. Multiple logistic regression analysis was performed to identify factors associated with discrepancies and was adjusted for age, gender, insurance type, insurance contribution, residential area, and comorbidities. Results Agreement was highest between questionnaire data and claims data based on primary codes up to 1 year before the completion of self-reported questionnaires and was lowest for claims data based on primary and secondary codes up to 5 years before the completion of self-reported questionnaires. When comparing data based on primary codes up to 1 year before the completion of self-reported questionnaires, the overall agreement, sensitivity, specificity, and kappa values ranged from 93.2 to 98.8%, 26.2 to 84.3%, 95.7 to 99.6%, and 0.09 to 0.78, respectively. Agreement was excellent for hypertension and diabetes, fair to good for stroke and heart disease, and poor for pulmonary tuberculosis and dyslipidemia. Women, younger individuals, and employed individuals were most likely to under-report disease. Conclusions Detailed patient characteristics that had an impact on information bias were identified through the differing levels of agreement.

  8. Level of Agreement and Factors Associated With Discrepancies Between Nationwide Medical History Questionnaires and Hospital Claims Data.

    Science.gov (United States)

    Kim, Yeon-Yong; Park, Jong Heon; Kang, Hee-Jin; Lee, Eun Joo; Ha, Seongjun; Shin, Soon-Ae

    2017-09-01

    The objectives of this study were to investigate the agreement between medical history questionnaire data and claims data and to identify the factors that were associated with discrepancies between these data types. Data from self-reported questionnaires that assessed an individual's history of hypertension, diabetes mellitus, dyslipidemia, stroke, heart disease, and pulmonary tuberculosis were collected from a general health screening database for 2014. Data for these diseases were collected from a healthcare utilization claims database between 2009 and 2014. Overall agreement, sensitivity, specificity, and kappa values were calculated. Multiple logistic regression analysis was performed to identify factors associated with discrepancies and was adjusted for age, gender, insurance type, insurance contribution, residential area, and comorbidities. Agreement was highest between questionnaire data and claims data based on primary codes up to 1 year before the completion of self-reported questionnaires and was lowest for claims data based on primary and secondary codes up to 5 years before the completion of self-reported questionnaires. When comparing data based on primary codes up to 1 year before the completion of self-reported questionnaires, the overall agreement, sensitivity, specificity, and kappa values ranged from 93.2 to 98.8%, 26.2 to 84.3%, 95.7 to 99.6%, and 0.09 to 0.78, respectively. Agreement was excellent for hypertension and diabetes, fair to good for stroke and heart disease, and poor for pulmonary tuberculosis and dyslipidemia. Women, younger individuals, and employed individuals were most likely to under-report disease. Detailed patient characteristics that had an impact on information bias were identified through the differing levels of agreement.

  9. The state-level approach: moving beyond integrated safeguards

    International Nuclear Information System (INIS)

    Tape, James W.

    2008-01-01

    The concept of a State-Level Approach (SLA) for international safeguards planning, implementation, and evaluation was contained in the Conceptual Framework for Integrated Safeguards (IS) agreed in 2002. This paper describes briefly the key elements of the SLA, including State-level factors and high-level safeguards objectives, and considers different cases in which application of the SLA methodology could address safeguards for 'suspect' States, 'good' States, and Nuclear Weapons States hosting fuel cycle centers. The continued use and further development of the SLA to customize safeguards for each State, including for States already under IS, is seen as central to effective and efficient safeguards for an expanding nuclear world.

  10. Agreement between Two Methods of Dietary Data Collection in Male Adolescent Academy-Level Soccer Players

    Directory of Open Access Journals (Sweden)

    Marc A. Briggs

    2015-07-01

    Full Text Available Collecting accurate and reliable nutritional data from adolescent populations is challenging, with current methods providing significant under-reporting. Therefore, the aim of the study was to determine the accuracy of a combined dietary data collection method (self-reported weighed food diary, supplemented with a 24-h recall when compared to researcher observed energy intake in male adolescent soccer players. Twelve Academy players from an English Football League club participated in the study. Players attended a 12 h period in the laboratory (08:00 h–20:00 h, during which food and drink items were available and were consumed ad libitum. Food was also provided to consume at home between 20:00 h and 08:00 h the following morning under free-living conditions. To calculate the participant reported energy intake, food and drink items were weighed and recorded in a food diary by each participant, which was supplemented with information provided through a 24-h recall interview the following morning. Linear regression, limits of agreement (LOA and typical error (coefficient of variation; CV were used to quantify agreement between observer and participant reported 24-h energy intake. Difference between methods was assessed using a paired samples t-test. Participants systematically under-reported energy intake in comparison to that observed (p < 0.01 but the magnitude of this bias was small and consistent (mean bias = −88 kcal·day−1, 95% CI for bias = −146 to −29 kcal·day−1. For random error, the 95% LOA between methods ranged between −1.11 to 0.37 MJ·day−1 (−256 to 88 kcal·day−1. The standard error of the estimate was low, with a typical error between measurements of 3.1%. These data suggest that the combined dietary data collection method could be used interchangeably with the gold standard observed food intake technique in the population studied providing that appropriate adjustment is made for the systematic under

  11. Agreement between Two Methods of Dietary Data Collection in Male Adolescent Academy-Level Soccer Players

    Science.gov (United States)

    Briggs, Marc A.; Rumbold, Penny L. S.; Cockburn, Emma; Russell, Mark; Stevenson, Emma J.

    2015-01-01

    Collecting accurate and reliable nutritional data from adolescent populations is challenging, with current methods providing significant under-reporting. Therefore, the aim of the study was to determine the accuracy of a combined dietary data collection method (self-reported weighed food diary, supplemented with a 24-h recall) when compared to researcher observed energy intake in male adolescent soccer players. Twelve Academy players from an English Football League club participated in the study. Players attended a 12 h period in the laboratory (08:00 h–20:00 h), during which food and drink items were available and were consumed ad libitum. Food was also provided to consume at home between 20:00 h and 08:00 h the following morning under free-living conditions. To calculate the participant reported energy intake, food and drink items were weighed and recorded in a food diary by each participant, which was supplemented with information provided through a 24-h recall interview the following morning. Linear regression, limits of agreement (LOA) and typical error (coefficient of variation; CV) were used to quantify agreement between observer and participant reported 24-h energy intake. Difference between methods was assessed using a paired samples t-test. Participants systematically under-reported energy intake in comparison to that observed (p < 0.01) but the magnitude of this bias was small and consistent (mean bias = −88 kcal·day−1, 95% CI for bias = −146 to −29 kcal·day−1). For random error, the 95% LOA between methods ranged between −1.11 to 0.37 MJ·day−1 (−256 to 88 kcal·day−1). The standard error of the estimate was low, with a typical error between measurements of 3.1%. These data suggest that the combined dietary data collection method could be used interchangeably with the gold standard observed food intake technique in the population studied providing that appropriate adjustment is made for the systematic under-reporting common to such

  12. The OPG/Kincardine hosting agreement for a deep geologic repository for OPG's low- and intermediate-level waste

    International Nuclear Information System (INIS)

    Castellan, A.G.; Barker, D.E.

    2006-01-01

    A Hosting Agreement has been reached between Ontario Power Generation and the Municipality of Kincardine for the purpose of siting a long-term management facility for low- and intermediate-level radioactive waste at the Western Waste Management Facility. Following an independent review of the feasibility of three options for a long-term facility at the site, including a review of the safety, geotechnical feasibility, social and economic effects and potential environmental effects, Kincardine passed a resolution indicating their preference for a Deep Geologic Repository. A Host Community Agreement has been negotiated based on this preference, and on information that had been gathered from municipal authorities at other locations that have hosted similar facilities. The Hosting Agreement includes financial compensation, totalling $35.7 million (Canadian 2004) to the Municipality of Kincardine and to four surrounding municipalities. The financial aspects include lump sum payments based on achieving specific project milestones as well as annual payments to each of the municipalities. The payments are indexed to inflation, and are also contingent on the municipalities acting reasonably and in good faith during the licencing process of the proposed facility. In addition to the fees, the Agreement includes provision for a Property Value Protection Plan that would provide residents with compensation in the event that there is depreciation in property value shown to directly result from a release from the proposed facility. New permanent OPG jobs supporting the project would be located at the site. OPG and Kincardine will support a centre of nuclear excellence. (author)

  13. 10-year survival rate and the incidence of peri-implant disease of 374 titanium dental implants with a SLA surface: a prospective cohort study in 177 fully and partially edentulous patients

    NARCIS (Netherlands)

    van Velzen, F.J.J.; Ofec, R.; Schulten, E.A.J.M.; ten Bruggenkate, C.M.

    2015-01-01

    Purpose This prospective cohort study evaluates the 10-year survival and incidence of peri-implant disease at implant and patient level of sandblasted, large grid, and acid-etched titanium dental implants (Straumann, soft tissue level, SLA surface) in fully and partially edentulous patients.

  14. Measuring the Level of Agreement Between Cloacal Gram's Stains and Bacterial Cultures in Hispaniolan Amazon Parrots ( Amazona ventralis ).

    Science.gov (United States)

    Evans, Erika E; Mitchell, Mark A; Whittington, Julia K; Roy, Alma; Tully, Thomas N

    2014-12-01

    Cloacal or fecal Gram's stains and bacterial cultures are routinely performed during avian physical examinations to assess the microbial flora of the gastrointestinal tract. Although cloacal or fecal Gram's stains and bacterial cultures are considered routine diagnostic procedures, the level of agreement between the individual tests has not been determined. To investigate the level of agreement between results from Gram's stain and bacterial culture when used to assess cloacal or fecal samples from psittacine birds, samples were taken from 21 clinically healthy Hispaniolan Amazon parrots ( Amazona ventralis ) and tested by Gram's stain cytology and bacterial culture. Most bacteria (97.2%) identified by Gram's stain were gram positive. However, gram-negative organisms were identified in 7 of 21 (33.3%; 95% confidence interval: 13.3%-53.3%) birds. Escherichia coli was the only gram-negative organism identified on culture. Agreement between results of Gram's stain and culture was fair (weighted κ = 0.27). The results of this study suggest that Gram's stains and bacterial culture may need to be performed with a parallel testing strategy to limit the likelihood of misclassifying the microbial flora of psittacine patients.

  15. High construal level can help negotiators to reach integrative agreements: The role of information exchange and judgement accuracy.

    Science.gov (United States)

    Wening, Stefanie; Keith, Nina; Abele, Andrea E

    2016-06-01

    In negotiations, a focus on interests (why negotiators want something) is key to integrative agreements. Yet, many negotiators spontaneously focus on positions (what they want), with suboptimal outcomes. Our research applies construal-level theory to negotiations and proposes that a high construal level instigates a focus on interests during negotiations which, in turn, positively affects outcomes. In particular, we tested the notion that the effect of construal level on outcomes was mediated by information exchange and judgement accuracy. Finally, we expected the mere mode of presentation of task material to affect construal levels and manipulated construal levels using concrete versus abstract negotiation tasks. In two experiments, participants negotiated in dyads in either a high- or low-construal-level condition. In Study 1, high-construal-level dyads outperformed dyads in the low-construal-level condition; this main effect was mediated by information exchange. Study 2 replicated both the main and mediation effects using judgement accuracy as mediator and additionally yielded a positive effect of a high construal level on a second, more complex negotiation task. These results not only provide empirical evidence for the theoretically proposed link between construal levels and negotiation outcomes but also shed light on the processes underlying this effect. © 2015 The British Psychological Society.

  16. Integrating policy-based management and SLA performance monitoring

    Science.gov (United States)

    Liu, Tzong-Jye; Lin, Chin-Yi; Chang, Shu-Hsin; Yen, Meng-Tzu

    2001-10-01

    Policy-based management system provides the configuration capability for the system administrators to focus on the requirements of customers. The service level agreement performance monitoring mechanism helps system administrators to verify the correctness of policies. However, it is difficult for a device to process the policies directly because the policies are the management concept. This paper proposes a mechanism to decompose a policy into rules that can be efficiently processed by a device. Thus, the device may process the rule and collect the performance statistics information efficiently; and the policy-based management system may collect these performance statistics information and report the service-level agreement performance monitoring information to the system administrator. The proposed policy-based management system achieves both the policy configuration and service-level agreement performance monitoring requirements. A policy consists of a condition part and an action part. The condition part is a Boolean expression of a source host IP group, a destination host IP group, etc. The action part is the parameters of services. We say that an address group is compact if it only consists of a range of IP address that can be denoted by a pair of IP address and corresponding IP mask. If the condition part of a policy only consists of the compact address group, we say that the policy is a rule. Since a device can efficiently process a compact address and a system administrator prefers to define a range of IP address, the policy-based management system has to translate policy into rules and supplements the gaps between policy and rules. The proposed policy-based management system builds the relationships between VPN and policies, policy and rules. Since the system administrator wants to monitor the system performance information of VPNs and policies, the proposed policy-based management system downloads the relationships among VPNs, policies and rules to the

  17. Assessment of the level of agreement in the interpretation of plain radiographs of lumbar spondylosis among clinical physiotherapists in Ghana.

    Science.gov (United States)

    Bello, Ajediran I; Ofori, Eric K; Alabi, Oluwasegun J; Adjei, David N

    2014-03-29

    Objective physical assessment of patients with lumbar spondylosis involves plain film radiographs (PFR) viewing and interpretation by the radiologists. Physiotherapists also routinely assess PFR within the scope of their practice. However, studies appraising the level of agreement of physiotherapists' PFR interpretation with radiologists are not common in Ghana. Forty-one (41) physiotherapists took part in the cross-sectional survey. An assessment guide was developed from findings of the interpretation of three PFR of patients with lumbar spondylosis by a radiologist. The three PFR were selected from a pool of different radiographs based on clarity, common visible pathological features, coverage body segments and short post production period. Physiotherapists were required to view the same PFR after which they were assessed with the assessment guide according to the number of features identified correctly or incorrectly. The score range on the assessment form was 0-24, interpreted as follow: 0-8 points (low), 9-16 points (moderate) and 17-24 points (high) levels of agreement. Data were analyzed using one sample t-test and fisher's exact test at α = 0.05. The mean score of interpretation for the physiotherapists was 12.7 ± 2.6 points compared to the radiologist's interpretation of 24 points (assessment guide). The physiotherapists' levels were found to be significantly associated with their academic qualification (p = 0.006) and sex (p = 0.001). However, their levels of agreement were not significantly associated with their age group (p = 0.098), work settings (p = 0.171), experience (p = 0.666), preferred PFR view (p = 0.088) and continuing education (p = 0.069). The physiotherapists' skills fall short of expectation for interpreting PFR of patients with lumbar spondylosis. The levels of agreement with radiologist's interpretation have no link with year of clinial practice, age, work settings and continuing education. Thus

  18. Assessment of the level of agreement in the interpretation of plain radiographs of lumbar spondylosis among clinical physiotherapists in Ghana

    International Nuclear Information System (INIS)

    Bello, Ajediran I; Ofori, Eric K; Alabi, Oluwasegun J; Adjei, David N

    2014-01-01

    Objective physical assessment of patients with lumbar spondylosis involves plain film radiographs (PFR) viewing and interpretation by the radiologists. Physiotherapists also routinely assess PFR within the scope of their practice. However, studies appraising the level of agreement of physiotherapists’ PFR interpretation with radiologists are not common in Ghana. Forty-one (41) physiotherapists took part in the cross-sectional survey. An assessment guide was developed from findings of the interpretation of three PFR of patients with lumbar spondylosis by a radiologist. The three PFR were selected from a pool of different radiographs based on clarity, common visible pathological features, coverage body segments and short post production period. Physiotherapists were required to view the same PFR after which they were assessed with the assessment guide according to the number of features identified correctly or incorrectly. The score range on the assessment form was 0–24, interpreted as follow: 0–8 points (low), 9–16 points (moderate) and 17–24 points (high) levels of agreement. Data were analyzed using one sample t-test and fisher’s exact test at α = 0.05. The mean score of interpretation for the physiotherapists was 12.7 ± 2.6 points compared to the radiologist’s interpretation of 24 points (assessment guide). The physiotherapists’ levels were found to be significantly associated with their academic qualification (p = 0.006) and sex (p = 0.001). However, their levels of agreement were not significantly associated with their age group (p = 0.098), work settings (p = 0.171), experience (p = 0.666), preferred PFR view (p = 0.088) and continuing education (p = 0.069). The physiotherapists’ skills fall short of expectation for interpreting PFR of patients with lumbar spondylosis. The levels of agreement with radiologist’s interpretation have no link with year of clinial practice, age, work settings and continuing education. Thus, routine PFR viewing

  19. Level of Agreement Between Forearm and Upper Arm Blood Pressure Measurements in Patients With Large Arm Circumference.

    Science.gov (United States)

    Watson, Sheri; Aguas, Marita; Colegrove, Pat; Foisy, Nancy; Jondahl, Bonnie; Anastas, Zoe

    2017-02-01

    The purpose of the study was to determine if forearm blood pressures (BPs) measured in three different locations agree with the recommended upper arm location for noninvasive BP measurement. A method-comparison design was used. In a convenience sample of postanesthesia care unit patients with large upper arm circumference, BP's were obtained in three different forearm locations (lower forearm, middle forearm, and upper forearm) and compared to upper arm BP using an automated BP measuring device. The level of agreement (bias ± precision) between each forearm location and the upper arm BP was calculated using standard formulas. Acceptable levels of agreement based on expert opinion were set a priori at bias and precision values of less than ±5 mm Hg (bias) and ±8 mm Hg (precision). Forty-eight postanesthesia patients participated in the study. Bias and precision values were found to exceed the acceptable level of agreement for all but one of the systolic and diastolic BP comparisons in the three forearm BP locations. Fifty-six percent of all patients studied had one or more BP difference of at least 10 mm Hg in each of the three forearm locations, with 10% having one or more differences of at least 20 mm Hg. The differences in forearm BP measurements observed in this study indicate that the clinical practice of using a forearm BP with a regular-sized BP cuff in place of a larger sized BP cuff placed on the upper arm in postanesthesia care unit patients with large arm circumferences is inappropriate. The BPs obtained at the forearm location are not equivalent to the BPs obtained at the upper arm location. Copyright © 2015 American Society of PeriAnesthesia Nurses. Published by Elsevier Inc. All rights reserved.

  20. Resident self-other assessor agreement: influence of assessor, competency, and performance level.

    Science.gov (United States)

    Lipsett, Pamela A; Harris, Ilene; Downing, Steven

    2011-08-01

    To review the literature on self-assessment in the context of resident performance and to determine the correlation between self-assessment across competencies in high- and low-performing residents and assessments performed by raters from a variety of professional roles (peers, nurses, and faculty). Retrospective analysis of prospectively collected anonymous self-assessment and multiprofessional (360) performance assessments by competency and overall. University-based academic general surgical program. Sixty-two residents rotating in general surgery. Mean difference for each self-assessment dyad (self-peer, self-nurse, and self-attending physician) by resident performance quartile, adjusted for measurement error, correlation coefficients, and summed differences across all competencies. Irrespective of self-other dyad, residents asked to rate their global performance overestimated their skills. Residents in the upper quartile underestimated their specific skills while those in the lowest-performing quartile overestimated their abilities when compared with faculty, peers, and especially nurse raters. Moreover, overestimation was greatest in competencies related to interpersonal skills, communication, teamwork, and professionalism. Rater, level of performance, and the competency being assessed all influence the comparison of the resident's self-assessment and those of other raters. Self-assessment of competencies related to behavior may be inaccurate when compared with raters from various professions. Residents in the lowest-performing quartile are least able to identify their weakness. These data have important implications for residents, program directors, and the public and suggest that strategies that help the lowest-performing residents recognize areas in need of improvement are needed.

  1. Level of agreement among Latin American glaucoma subspecialists on the diagnosis and treatment of glaucoma: results of an online survey

    Directory of Open Access Journals (Sweden)

    Daniel E. Grigera

    2013-06-01

    Full Text Available PURPOSE: The aim of this research was to assess the level of agreement among glaucoma experts in Latin America on key practices related to treatment and diagnosis of glaucoma. METHODS: An online questionnaire was sent to a multinational panel of glaucoma experts. The questionnaire contained 107 statements on the medical treatment (Part 1 and diagnosis (Part 2 of glaucoma, and was developed in Spanish and translated into English. Agreement was defined as >70% of respondents. RESULTS: Fifty participants from 14 countries completed the questionnaire. For the medical treatment of glaucoma, nearly all respondents (98% or greater confirmed that medical treatment as first-line therapy is preferred to surgery, prostaglandin analogs are the medication of first choice for primary open-angle glaucoma (POAG, longitudinal monitoring of efficacy should include intraocular pressure, structural and functional status, as well as if patients' quality of life is impaired by the high cost of medication. For the diagnosis of glaucoma section, all respondents confirmed that, after initial examination, gonioscopy should be repeated over time, standard automated perimetry is the most important functional examination for diagnosis and monitoring of primary open-angle glaucoma, central corneal thickness is important in assessment of glaucoma, and computerized imaging tests help in clinical evaluation of optic disc. CONCLUSIONS: This survey shows a high level of agreement on most aspects of glaucoma diagnosis and treatment among Latin American glaucoma experts. Areas of disagreement highlight the need for further evidence or education. These findings will be useful for guiding future efforts to optimize glaucoma practice by clinicians in Latin America.

  2. Level of agreement among Latin American glaucoma subspecialists on the diagnosis and treatment of glaucoma: results of an online survey.

    Science.gov (United States)

    Grigera, Daniel E; Mello, Paulo Augusto Arruda; Barbosa, Wilma Lelis; Casiraghi, Javier Fernando; Grossmann, Rodolfo Perez; Peyret, Alejo

    2013-01-01

    The aim of this research was to assess the level of agreement among glaucoma experts in Latin America on key practices related to treatment and diagnosis of glaucoma. An online questionnaire was sent to a multinational panel of glaucoma experts. The questionnaire contained 107 statements on the medical treatment (Part 1) and diagnosis (Part 2) of glaucoma, and was developed in Spanish and translated into English. Agreement was defined as >70% of respondents. Fifty participants from 14 countries completed the questionnaire. For the medical treatment of glaucoma, nearly all respondents (98% or greater) confirmed that medical treatment as first-line therapy is preferred to surgery, prostaglandin analogs are the medication of first choice for primary open-angle glaucoma (POAG), longitudinal monitoring of efficacy should include intraocular pressure, structural and functional status, as well as if patients' quality of life is impaired by the high cost of medication. For the diagnosis of glaucoma section, all respondents confirmed that, after initial examination, gonioscopy should be repeated over time, standard automated perimetry is the most important functional examination for diagnosis and monitoring of primary open-angle glaucoma, central corneal thickness is important in assessment of glaucoma, and computerized imaging tests help in clinical evaluation of optic disc. This survey shows a high level of agreement on most aspects of glaucoma diagnosis and treatment among Latin American glaucoma experts. Areas of disagreement highlight the need for further evidence or education. These findings will be useful for guiding future efforts to optimize glaucoma practice by clinicians in Latin America.

  3. Anti-soluble liver antigen (SLA) antibodies in chronic HCV infection.

    Science.gov (United States)

    Vitozzi, Susana; Lapierre, Pascal; Djilali-Saiah, Idriss; Marceau, Gabriel; Beland, Kathie; Alvarez, Fernando

    2004-05-01

    Hepatitis C infection is associated with autoimmune disorders, such as the production of autoantibodies. Anti-LKM1 and anti-LC1, immunomarkers of type 2 autoimmune hepatitis, have been previously associated with a HCV infection. Anti-Soluble-Liver-Antigen autoantibodies (SLA) are specifically associated with type 1 and type 2 autoimmune hepatitis and more closely related to patients who relapse after steroid therapy. The recent molecular cloning of the soluble liver antigen provides the opportunity to develop more specific tests for the detection of antibodies against it. The aim of this work is to characterize anti-soluble-liver autoantibodies in sera from patients chronically infected by HCV. A recombinant cDNA from activated Jurkat cells coding for the full length tRNP(Ser)Sec/SLA antigen was obtained. ELISA, Western Blot and immunoprecipitation tests were developed and used to search for linear and conformational epitopes recognized by anti-SLA antibodies in sera from patients chronically infected by HCV. Anti-soluble liver antigen antibodies were found in sera from 10.4% of HCV-infected patients. The prevalence was significantly increased to 27% when anti-LKM1 was also present. Most anti-SLA reactivity was directed against conformational epitopes on the antigen. The means titers by ELISA were lower than those obtained in type 2 AIH. The result of autoantibody isotyping showed a subclass restriction to IgG1 and also IgG4. This study shows the presence of anti-SLA antibodies in approximately 10% of HCV infected patients. The prevalence of SLA autoantibodies in HCV infected patients increases when LKM1 autoantibodies are also present. The relationship between the prevalence of this characteristic autoimmune hepatitis autoantibody and the implication of an autoimmune phenomenon in the liver injury of patients chronically infected by HCV needs further investigation.

  4. An Adaptive Tradeoff Algorithm for Multi-issue SLA Negotiation

    Science.gov (United States)

    Son, Seokho; Sim, Kwang Mong

    Since participants in a Cloud may be independent bodies, mechanisms are necessary for resolving different preferences in leasing Cloud services. Whereas there are currently mechanisms that support service-level agreement negotiation, there is little or no negotiation support for concurrent price and timeslot for Cloud service reservations. For the concurrent price and timeslot negotiation, a tradeoff algorithm to generate and evaluate a proposal which consists of price and timeslot proposal is necessary. The contribution of this work is thus to design an adaptive tradeoff algorithm for multi-issue negotiation mechanism. The tradeoff algorithm referred to as "adaptive burst mode" is especially designed to increase negotiation speed and total utility and to reduce computational load by adaptively generating concurrent set of proposals. The empirical results obtained from simulations carried out using a testbed suggest that due to the concurrent price and timeslot negotiation mechanism with adaptive tradeoff algorithm: 1) both agents achieve the best performance in terms of negotiation speed and utility; 2) the number of evaluations of each proposal is comparatively lower than previous scheme (burst-N).

  5. Specificity Characterization of SLA Class I Molecules Binding to Swine-Origin Viral Cytotoxic T Lymphocyte Epitope Peptides in Vitro

    Directory of Open Access Journals (Sweden)

    Caixia Gao

    2017-12-01

    Full Text Available Swine leukocyte antigen (SLA class I molecules play a crucial role in generating specific cellular immune responses against viruses and other intracellular pathogens. They mainly bind and present antigens of intracellular origin to circulating MHC I-restricted cytotoxic T lymphocytes (CTLs. Binding of an appropriate epitope to an SLA class I molecule is the single most selective event in antigen presentation and the first step in the killing of infected cells by CD8+ CTLs. Moreover, the antigen epitopes are strictly restricted to specific SLA molecules. In this study, we constructed SLA class I complexes in vitro comprising viral epitope peptides, the extracellular region of the SLA-1 molecules, and β2-microglobulin (β2m using splicing overlap extension polymerase chain reaction (SOE-PCR. The protein complexes were induced and expressed in an Escherichia coli prokaryotic expression system and subsequently purified and refolded. Specific binding of seven SLA-1 proteins to one classical swine fever virus (CSFV and four porcine reproductive and respiratory syndrome virus (PRRSV epitope peptides was detected by enzyme-linked immunosorbent assay (ELISA-based method. The SLA-1∗13:01, SLA-1∗11:10, and SLA-1∗11:01:02 proteins were able to bind specifically to different CTL epitopes of CSFV and PRRSV and the MHC restrictions of the five epitopes were identified. The fixed combination of Asn151Val152 residues was identified as the potentially key amino acid residues influencing the binding of viral several CTL epitope peptides to SLA-1∗13:01 and SLA-1∗04:01:01 proteins. The more flexible pocket E in the SLA-1∗13:01 protein might have fewer steric limitations and therefore be able to accommodate more residues of viral CTL epitope peptides, and may thus play a critical biochemical role in determining the peptide-binding motif of SLA-1∗13:01. Characterization of the binding specificity of peptides to SLA class I molecules provides an

  6. SLA mechanism in wireless Mesh network%无线Mesh网络环境下的SLA机制

    Institute of Scientific and Technical Information of China (English)

    赵耀培; 杨扬

    2015-01-01

    SLA mechanism in wireless Mesh network was studied .A collision avoidance mechanism based on different service levels in wireless network was presented .The collision avoidance algorithm based on multiple service levels in MAC was de‐signed ,named as multipriority collision avoidance (MPCA) .Considering the data stream with different strategies of SLA ,MP‐CA adopted different retreating algorithms .M PCA supported the transmission of sudden business flow ,and assured the instan‐taneity of business with high service level .The simulation results show that MPCA can effectively improve service quality of cus‐tomers’ perception ,service reliability ,usability and stability .%对无线Mesh网络环境中SLA机制进行研究,建立一套无线Mesh环境下基于不同服务等级的冲突避免机制,在M AC层设计基于多服务等级的冲突避免算法(multipriority collision avoidance , M PCA ),针对不同SLA策略的数据流采用不同退避算法。该算法支持突发业务流传输,能够保证高服务等级业务的实时性。仿真结果表明, M PC A能有效提高用户感知服务质量、服务可靠性以及可用性和稳定性。

  7. Assessing agreement between salivary alpha amylase levels collected by passive drool and eluted filter paper in adolescents with cancer.

    Science.gov (United States)

    Ameringer, Suzanne; Munro, Cindy; Elswick, R K

    2012-07-01

    To assess the validity of filter paper (FP) against the gold standard of passive drool (PD) for collecting salivary alpha amylase as a surrogate biomarker of psychological stress in adolescents with cancer. Part of a longitudinal, descriptive study of symptoms in adolescents with cancer during chemotherapy. A pediatric hematology/oncology treatment center. 33 saliva sample pairs from nine adolescents with cancer, aged 13-18 years. Salivary alpha amylase was collected by PD and FP at four time points during a cycle of chemotherapy: days 1 (time 1) and 2 (time 2) of chemotherapy, day 7-10 (time 3), and day 1 of the next cycle (time 4). A random effects regression was used to assess the correlation between PD and FP values, and a Bland Altman analysis was conducted to assess agreement between the values. Salivary alpha amylase. The estimated correlation between PD and FP values was r = 0.91, p < 0.001. Regression results were also used to rescale FP values to the levels of the PD values because the FP values were on a different scale than the PD values. The Bland Altman analysis revealed that the agreement between the rescaled FP values and PD values was not satisfactory. Eluted FP may not be a valid method for collecting salivary alpha amylase in adolescents with cancer. Psychological stress in adolescents with cancer may be linked to negative outcomes, such as greater symptom severity and post-traumatic stress disorder. Nurses need valid, efficient, biobehavioral measures to assess psychological stress in the clinical setting.

  8. An investigation into the strength of the association and agreement levels between subjective and objective sleep duration in adolescents.

    Directory of Open Access Journals (Sweden)

    Teresa Arora

    Full Text Available The majority of adolescent sleep research has utilized self-reported sleep duration and some have based information on a solitary question. Whilst some have claimed to have validated sleep survey data with objective actigraphy measures in adolescents, the statistical approach applied only demonstrates the strength of the association between subjective and objective sleep duration data and does not reflect if these different methods actually agree.Data were collected as part of the Midlands Adolescents Schools Sleep Education Study (MASSES. Adolescents (n=225 aged 11-13 years provided estimates for weekday, weekend and combined sleep duration based on self-reported survey data, a 7-day sleep diary, and wrist-worn actigraphy.We assessed the strength of the relationship as well as agreement levels between subjective and objectively determined sleep duration (weekday, weekend and combined. Subjective diary sleep duration was significantly correlated with actigraphy estimates for weekday and weekend sleep duration r=0.30, p ≤ 0.001 and r=0.31, p ≤ 0.001 respectively. Pitman's test demonstrated no significant difference in the variance between weekend sleep duration (r=0.09, p=0.16 and combined sleep duration (r=0.12, p=0.08 indicating acceptable agreement between actigraphy and sleep diary sleep duration only. Self-reported sleep duration estimates (weekday, weekend and combined did not agree with actigraphy determined sleep duration.Sleep diaries are a cost-effective alternative to survey/questionnaire data. Self-reported measures of sleep duration in adolescents do not agree with actigraphy measures and should be avoided where possible. Previous adolescent sleep studies that have utilized self-reported survey data may not provide a complete representation of sleep on the outcome measure of interest.

  9. The association between team-level social capital and individual-level work engagement: Differences between subtypes of social capital and the impact of intra-team agreement.

    Science.gov (United States)

    Meng, Annette; Clausen, Thomas; Borg, Vilhelm

    2018-04-01

    The study explored the association between team-level social capital and individual-level work engagement. Questionnaire data were collected from six companies in the dairy industry. Seven hundred seventy-two participants divided into 65 teams were included. In confirmatory factor analyses, we found a superior model fit to a four dimensional model of social capital: bonding social capital, bridging social capital and two types of linking social capital. The results showed a positive association between all subtypes of social capital at the team level and work engagement at the individual level. However, this association only remained significant for linking social capital in relation the workplace as a whole when we adjusted for psychosocial working conditions. The level of intra-team agreement in social capital score did not moderate the association between social capital and work engagement. In conclusion, the results provide further support for previous findings suggesting a positive association between social capital and work engagement. They add to the existing knowledge by suggesting that linking social capital in relation to the workplace is the most important explanatory variable for work engagement, thus emphasizing the need to distinguish between subtypes of social capital in research and practice. © 2018 The Authors. Scandinavian Journal of Psychology published by Scandinavian Psychological Associations and John Wiley & Sons Ltd.

  10. New CALL-SLA Research Interfaces for the 21st Century: Towards Equitable Multilingualism

    Science.gov (United States)

    Ortega, Lourdes

    2017-01-01

    The majority of the world is multilingual, but inequitably multilingual, and much of the world is also technologized, but inequitably so. Thus, researchers in the fields of computer-assisted language learning (CALL) and second language acquisition (SLA) would profit from considering multilingualism and social justice when envisioning new CALL-SLA…

  11. Positive Psychology in SLA: An Agenda for Learner and Teacher Wellbeing

    Science.gov (United States)

    Mercer, Sarah

    2017-01-01

    This article begins with an outline of the developments in Positive Psychology (PP) generally and specifically within SLA focusing on theoretical, empirical and practical developments. It moves on to consider PP's potential contribution to language teaching focusing on how it can help promote emotional, social and psychological wellbeing for…

  12. Enhancing Information Security in Cloud Computing Services using SLA based metrics

    OpenAIRE

    , Nia; Mganga, Ramadianti Putri;; Charles, Medard

    2011-01-01

    Context: Cloud computing is a prospering technology that most organizations are considering for adoption as a cost effective strategy for managing IT. However, organizations also still consider the technology to be associated with many business risks that are not yet resolved. Such issues include security, privacy as well as legal and regulatory risks. As an initiative to address such risks, organizations can develop and implement SLA to establish common expectations and goals between the clo...

  13. Level of agreement between patient and proxy responses to the EQ-5D health questionnaire 12 months after injury.

    Science.gov (United States)

    Gabbe, Belinda J; Lyons, Ronan A; Sutherland, Ann M; Hart, Melissa J; Cameron, Peter A

    2012-04-01

    Health-related quality of life represents a patient's experiences and expectations and should be collected from the patient. In trauma, collection of information from the patient can be challenging, particularly for subgroups where cognitive impairment is prevalent, increasing reliance on proxy reporting. This study assessed the agreement between patient and proxy reporting of health-related quality of life 12 months after injury. The Victorian State Trauma Registry and Victorian Orthopaedic Trauma Outcomes Registry collect EQ-5D data at 12 months after injury. Cases where data were collected from the patient and proxy were extracted. Agreement between patient and proxy responses was compared using kappa (K) coefficients for the individual EQ-5D items, and Bland-Altman plots and Wilcoxon signed-rank tests for the EQ-5D summary score and visual analog scale (VAS). Agreement between patient and proxy respondents was substantial for the mobility (K = 0.61) and personal care items (K = 0.67) and moderate for the usual activities (K = 0.50), pain/discomfort (K = 0.42), and anxiety/depression items (K = 0.47). The mean difference between proxy and patient-reported scores for the VAS (0.74, 95% confidence interval: -2.73, 4.21) and the EQ-5D summary score (-0.02, 95% confidence interval: -0.07, 0.03) was small, but the limits of agreement were wide (-34.22 to 35.71 for VAS and -0.55 to 0.51 for summary score), suggesting no systematic bias. Although proxy and patient responses for the EQ-5D VAS may differ, the differences show random variability rather than systematic bias. Group comparisons using proxy responses are unlikely to be biased, but proxy responses should be used with caution when assessing individual patient recovery.

  14. Bilateral agreements

    International Nuclear Information System (INIS)

    1998-01-01

    Ten bilateral agreements are presented. These are: 1) Co-operation agreement relating to the peaceful uses of nuclear energy between Argentina and EURATOM (1996); 2) Agreement on co-operation in the peaceful uses of nuclear energy between Argentina and Greece (1997); 3) Implementing arrangement for technical exchange and co-operation in the area of peaceful uses of nuclear energy between Argentina and the United States (1997); 4) Agreement concerning co-operation in nuclear science and technology between Australia and Indonesia (1997); 5) Implementation of the 1985 Agreement for co-operation concerning the peaceful uses of nuclear energy between the People's Republic of China and the United States (1998); 6) Protocol of co-operation between France and Lithuania (1997); 7) Agreement on co-operation in energy research, science and technology, and development between Germany and the United States (1998); 8) Agreement on early notification of a nuclear accident and exchange of information on nuclear facilities between Greece and Romania (1997); 9) Agreement on early notification of nuclear accidents and co-operation in the field of nuclear safety between Hungary and the Ukraine (1997); 10) Agreement in the field of radioactive waste management between Switzerland and the United States (1997). (K.A.)

  15. iTESOL: Analogous Practices in the SLA Classroom

    Science.gov (United States)

    McDonald, Lisa

    2010-01-01

    Recent studies of emerging technologies have shown that mobile phone production now exceeds one billion devices globally per year (Johnson, Levine & Smith, 2008). With a level of production that signifies a shift in the ownership of "networked machines" from institutions to individuals, the broad appeal of portable technologies now offers…

  16. Shareholders' agreements in Denmark

    DEFF Research Database (Denmark)

    Werlauff, Erik

    2010-01-01

    ’ agreements”) cannot bind the company within the sense of company law under the new state of law, and voting rights agreements, agreements on right of pre-emption etc. will therefore only apply at the level of contract law between the parties to the agreement. This article for European Business Law Review......The article warns that with effect from 1 March 2010, the new Danish Companies Act (on public and private limited companies) has seriously weakened the effect of shareholders’ agreements which have been entered into on Danish companies. These agreements (in the act’s new terminology: “owners...... analyses the consequences of this. Rights and duties in the owners’ agreements must now be reiterated to the greatest possible extent in the company’s articles of association so that the precepts become binding on the company and its management. Whether the parties to the owners’ agreement can be required...

  17. Bilateral agreements

    International Nuclear Information System (INIS)

    Anon.

    2004-01-01

    The bilateral agreements concern Brazil with United States relative to the co operation in nuclear energy, Germany with Russian Federation relative to the elimination and disposal of nuclear weapons; The multilateral agreements concerns the signature of the Protocols to amend the Paris and Brussels Conventions, the multilateral nuclear environmental programme in the Russian Federation, the status of Conventions in the field of nuclear energy. (N.C.)

  18. Measuring the level of agreement between a veterinary and a human point-of-care glucometer and a laboratory blood analyzer in Hispaniolan Amazon parrots (Amazona ventralis).

    Science.gov (United States)

    Acierno, Mark J; Schnellbacher, Rodney; Tully, Thomas N

    2012-12-01

    Although abnormalities in blood glucose concentrations in avian species are not as common as they are in mammals, the inability to provide point-of-care glucose measurement likely results in underreporting and missed treatment opportunities. A veterinary glucometer that uses different optimization codes for specific groups of animals has been produced. To obtain data for a psittacine bird-specific optimization code, as well as to calculate agreement between the veterinary glucometer, a standard human glucometer, and a laboratory analyzer, blood samples were obtained from 25 Hispaniolan Amazon parrots (Amazona ventralis) in a 2-phase study. In the initial phase, blood samples were obtained from 20 parrots twice at a 2-week interval. For each sample, the packed cell volume was determined, and the blood glucose concentration was measured by the veterinary glucometer. The rest of each sample was placed into a lithium heparin microtainer tube and centrifuged, and plasma was removed and frozen at -30 degrees C. Within 5 days, tubes were thawed, and blood glucose concentrations were measured with a laboratory analyzer. The data from both procedures were used to develop a psittacine bird-specific code. For the second phase of the study, the same procedure was repeated twice at a 2-week interval in 25 birds to determine agreement between the veterinary glucometer, a standard human glucometer, and a laboratory analyzer. Neither glucometer was in good agreement with the laboratory analyzer (veterinary glucometer bias, 9.0; level of agreement, -38.1 to 56.2; standard glucometer bias, 69.4; level of agreement -17.8 to 156.7). Based on these results, the use of handheld glucometers in the diagnostic testing of Hispaniolan Amazon parrots and other psittacine birds cannot be recommended.

  19. Variability in and agreement between modeled and personal continuously measured black carbon levels using novel smartphone and sensor technologies.

    Science.gov (United States)

    Nieuwenhuijsen, Mark J; Donaire-Gonzalez, David; Rivas, Ioar; de Castro, Montserrat; Cirach, Marta; Hoek, Gerard; Seto, Edmund; Jerrett, Michael; Sunyer, Jordi

    2015-03-03

    Novel technologies, such as smartphones and small personal continuous air pollution sensors, can now facilitate better personal estimates of air pollution in relation to location. Such information can provide us with a better understanding about whether and how personal exposures relate to residential air pollution estimates, which are normally used in epidemiological studies. The aims of this study were to examine (1) the variability in personal air pollution levels during the day and (2) the relationship between modeled home and school estimates and continuously measured personal air pollution exposure levels in different microenvironments (e.g., home, school, and commute). We focused on black carbon as an indicator of traffic-related air pollution. We recruited 54 school children (aged 7-11) from 29 different schools around Barcelona as part of the BREATHE study, an epidemiological study of the relation between air pollution and brain development. For 2 typical week days during 2012-2013, the children were given a smartphone with CalFit software to obtain information on their location and physical activity level and a small sensor, the micro-aethalometer model AE51, to measure their black carbon levels simultaneously and continuously. We estimated their home and school exposure to PM2.5 filter absorbance, which is well-correlated with black carbon, using a temporally adjusted PM2.5 absorbance land use regression (LUR) model. We found considerable variation in the black carbon levels during the day, with the highest levels measured during commuting periods (geometric mean = 2.8 μg/m(3)) and the lowest levels at home (geometric mean = 1.3 μg/m(3)). Hourly temporally adjusted LUR model estimates for the home and school showed moderate to good correlation with measured personal black carbon levels at home and school (r = 0.59 and 0.68, respectively) and lower correlation with commuting trips (r = 0.32 and 0.21, respectively). The correlation between modeled home

  20. Level of agreement between methods for measuring moderate to vigorous physical activity and sedentary time in people with obstructive sleep apnea and obesity.

    Science.gov (United States)

    Igelström, Helena; Emtner, Margareta; Lindberg, Eva; Asenlöf, Pernilla

    2013-01-01

    There is ambiguity about what measures to use to best identify physical activity and sedentary behavior, and agreement between methods for measuring physical activity and sedentary behavior in people with obstructive sleep apnea syndrome (OSAS) and obesity has not been evaluated. The objective of this study was to examine the level of agreement between an accelerometer and a self-report questionnaire (International Physical Activity Questionnaire [IPAQ]) or a logbook for measuring time spent on moderate to vigorous physical activity and time spent sedentary in people with OSAS and obesity. This prospective study was a psychometric evaluation of agreement between measurement methods. Thirty-nine people who were obese (body mass index: X=36.1 kg/m², SD=4.35) and had moderate to severe OSAS (apnea-hypopnea index of ≥15) were consecutively recruited from a sleep clinic in Sweden. All were treated with continuous positive airway pressure and were waiting for a follow-up sleep evaluation. Agreement between the measurement methods was limited. For physical activity, the mean difference between the accelerometer and the IPAQ was 47 minutes, and the mean difference between the accelerometer and the logbook was 32 minutes. Agreement was limited for sedentary time as well; the mean difference between the accelerometer and the IPAQ was 114 minutes, and the mean difference between the accelerometer and the logbook was 86 minutes. The small sample size may affect the interpretation and generalizability of the results. The results imply that the methods cannot be used interchangeably. A combination of an accelerometer and a daily logbook seems to provide a detailed description of physical activity and sedentary behavior.

  1. Describing and verifying monitoring capabilities for SLA-driven service-based systems

    NARCIS (Netherlands)

    Comuzzi, M.; Spanoudakis, G.; Yu, E.; Eder, J.

    2009-01-01

    Monitoring the operation of Service Based Systems (SBS) to ensure compliance with a set of service level agreements (SLAs) for example cannot always rely on a pre-specified monitoring infrastructure, where all the information and components required for monitoring are a priori known and available.

  2. Anti-soluble liver antigen/liver-pancreas (SLA/LP) antibodies in pediatric patients with autoimmune hepatitis.

    Science.gov (United States)

    Vitozzi, Susana; Djilali-Saiah, Idriss; Lapierre, Pascal; Alvarez, Fernando

    2002-12-01

    Antibodies against soluble liver antigen/liver-pancreas (SLA/LP) have been associated with severe autoimmune hepatitis (AIH) and poor outcome, but most of these reports have focused on adult patients. The aim of this study was to assess the prevalence and clinical significance of anti-SLA/LP antibodies in a pediatric population with AIH. We developed a quantitative enzyme-linked immunoassay (ELISA), a Western blot (WB) and an immunoprecipitation assay (IPA) based on recombinant cDNA from activated Jurkat cells. The specificity of these tests was validated by testing 200 serum samples from healthy subjects, and from patients with liver and non-liver diseases. Anti-SLA/LP antibodies were found in patients with type 1 and type 2 AIH. The prevalence of these antibodies in patients with type 1 AIH was: 42% when tested by ELISA, 15% by WB and 50% by IPA. In patients with type 2 AIH, the prevalence rates were 42% by ELISA, 18% by WB and 44% by IPA. The mean titer values for anti-SLA/LP antibodies was significantly higher in type 2 AIH (1:1,300 +/- 339) than in type 1 AIH (1:600 +/- 71; p LKM1) and anti-liver cytosol type 1 (LC1) antibodies in sera. The presence of anti-SLA/LP showed a significant female preponderance in type 1 and 2 AIH patients (p = 0.0003 and p = 0.003, respectively), and was significantly correlated with a lower age at diagnosis (p = 0.05) in type 1 AIH patients. In conclusion, anti-SLA/LP antibodies in pediatric patients are associated with both type 1 and 2 AIH.

  3. On the Relationship Between Input and Interaction Psycholinguistic, Cognitive, and Ecological Perspectives in SLA

    Directory of Open Access Journals (Sweden)

    Parisa Daftarifard

    2010-09-01

    Full Text Available Input is one of the most important elements in the process of second language acquisition (SLA. As Gass (1997 points out, second language learning simply cannot take place without input of some sort. Since then, specific issues have been actively debated in SLA on the nature of input and input processing, such as the amount of input that is necessary for language acquisition, various attributes of input and how they may facilitate or hinder acquisition, and instructional method that may enhance input. In this paper, four hypotheses and paradigms of input processing have been described. It is delineated that although the three paradigms of triggering, input hypothesis, and interaction hypothesis have been widely used and accepted, they lack the ability to account for the dynamic nature of language. Affordance, on the other hand, can account for such a nature of language.
    Therefore, affordance replaces fixed-eye vision by mobile-eye vision; an active learner establishes relationships with and within the environment. The learner can directly perceive and act on the ambient language without having to route everything through a pre-existing mental apparatus of schemata and representation, while this is not true in the fixed-code theory. In the fixed-eye theory of communication it is assumed that ready-made messages are coded at one end, transmitted,
    and then decoded in identical form at the other end. We need in its place a constructivist theory of message construction and interpretation.

  4. Implementation Plan for Liquid Low-Level Radioactive Waste tank systems at Oak Ridge National Laboratory under the Federal Facility Agreement, Oak Ridge, Tennessee

    International Nuclear Information System (INIS)

    1994-09-01

    This document summarizes the progress that has been made to date in implementing the plans and schedules for meeting the Federal Facility Agreement (FFA) commitments for the Liquid Low-Level Waste (LLLW) System at Oak Ridge National Laboratory (ORNL). These commitments were initially submitted in ES/ER-17 ampersand Dl, Federal Facility Agreement Plans and Schedules for Liquid Low-Level Radioactive Waste Tank Systems at Oak Ridge National Laboratory, Oak Ridge, Tennessee. Information presented in this document provides a comprehensive summary to facilitate understanding of the FFA compliance program for LLLW tank systems and to present plans and schedules associated with remediation, through the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) process, of LLLW tank systems that have been removed from service. ORNL has a comprehensive program underway to upgrade the LLLW system as necessary to meet the FFA requirements. The tank systems that are removed from service are being investigated and remediated through the CERCLA process. Waste and risk characterizations have been submitted. Additional data will be prepared and submitted to EPA/TDEC as tanks are taken out of service and as required by the remedial investigation/feasibility study (RI/FS) process. The plans and schedules for implementing the FFA compliance program that were submitted in ES/ER-17 ampersand Dl, Federal Facility Agreement Plans and Schedules for Liquid Low-Level Radioactive Waste tanks Systems at Oak Ridge National Laboratory, Oak Ridge, Tennessee, are updated in this document. Chapter 1 provides general background information and philosophies that lead to the plans and schedules that appear in Chaps. 2 through 5

  5. Implementation plan for Liquid Low-Level Radioactive Waste Tank Systems at Oak Ridge National Laboratory under the Federal Facility Agreement, Oak Ridge, Tennessee

    International Nuclear Information System (INIS)

    1994-06-01

    Plans and schedules for meeting the Federal Facility Agreement (FFA) commitments for the Liquid Low-Level Waste (LLLW) System at Oak Ridge National Laboratory (ORNL) were initially submitted in ES/ER-17 ampersand D1, Federal Facility Agreement Plans and Schedules for Liquid Low-Level Radioactive Waste Tank Systems at Oak Ridge National Laboratory, Oak Ridge, Tennessee. The information presented in the current document summarizes the progress that has been made to date and provides a comprehensive summary to facilitate understanding of the FFA compliance program for LLLW tank systems and to present the plans and schedules associated with the remediation, through the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) process, of LLLW tank systems that have been removed from service. A comprehensive program is under way at ORNL to upgrade the LLLW system as necessary to meet the FFA requirements. The tank systems that are removed from service are being investigated and remediated through the CERCLA process. Waste and risk characterizations have been submitted. Additional data will be submitted to the US Environmental Protection Agency and the Tennessee Department of Environment and Conservation (EPA/TDEC) as tanks are taken out of service and as required by the remedial investigation/feasibility study (RI/FS) process. The plans and schedules for implementing the FFA compliance program that were originally submitted in ES/ER-17 ampersand D 1, Federal Facility Agreement Plans and Schedules for Liquid Low-Level Radioactive Waste tanks Systems at Oak Ridge National Laboratory, Oak Ridge, Tennessee, are updated in the present document. Chapter I provides general background information and philosophies that lead to the plans and schedules that appear in Chaps. 2 through 5

  6. A Measure of Proficiency or Short-Term Memory? Validation of an Elicited Imitation Test for SLA Research

    Science.gov (United States)

    Kim, Youjin; Tracy-Ventura, Nicole; Jung, Yeonjoo

    2016-01-01

    Elicited imitation requires listeners to listen and repeat sentences as accurately as possible. In second language acquisition (SLA) research it has been used for a variety of purposes. Recently, versions of the same elicited imitation test (EIT) have been created in 6 languages with the purpose of measuring second language proficiency (Ortega…

  7. On the Danger of Exogenous Theory in CA-for-SLA: A Response to Hellermann and Cole (2009)

    Science.gov (United States)

    Hauser, Eric

    2011-01-01

    Within the growing body of work that is sometimes labeled CA-for-SLA, there is a need for more research with longitudinal data. Hellermann and Cole (2009) provide a valuable contribution in this area. However, in doing so, they also make use of an exogenous theory of learning, situated learning theory (Lave and Wenger 1991), and its associated…

  8. In vitro and in vivo evaluation of SLA titanium surfaces with further alkali or hydrogen peroxide and heat treatment

    International Nuclear Information System (INIS)

    Zhang, E W; Wang, Y B; Zheng, Y F; Shuai, K G; Gao, F; Bai, Y J; Cheng, Y; Xiong, X L; Wei, S C

    2011-01-01

    The present study aimed to evaluate the bioactivity of titanium surfaces sandblasted with large-grit corundum and acid etched (SLA) plus further alkali or hydrogen peroxide and heat treatment for dental implant application. Pure titanium disks were mechanically polished as control surface (Ti-control) and then sandblasted with large-grit corundum and acid etched (SLA). Further chemical modifications were conducted using alkali and heat treatment (ASLA) and hydrogen peroxide and heat treatment (HSLA) alternatively. The surface properties were characterized by scanning electron microscopy (SEM), x-ray photoelectron spectroscopy (XPS), and contact angle and roughness measurements. Further evaluation of surface bioactivity was conducted by MC3T3-E1 cell attachment, proliferation, morphology, alkaline phosphatase (ALP) activity and calcium deposition on the sample surfaces. After insertion in the beagle's mandibula for a specific period, cylindrical implant samples underwent micro-CT examination and then histological examination. It was found that ASLA and HSLA surfaces significantly increased the surface wettability and MC3T3-E1 cell attachment percentage, ALP activity and the quality of calcium deposition in comparison with simple SLA and Ti-control surfaces. Animal studies showed good osseointegration of ASLA and HSLA surfaces with host bone. In conclusion, ASLA and HSLA surfaces enhanced the bioactivity of the traditional SLA surface by integrating the advantages of surface topography, composition and wettability.

  9. In vitro and in vivo evaluation of SLA titanium surfaces with further alkali or hydrogen peroxide and heat treatment

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, E W; Wang, Y B; Zheng, Y F [State Key Laboratory for Turbulence and Complex System, Department of Advanced Materials and Nanotechnology, College of Engineering, Peking University, Beijing 100871 (China); Shuai, K G; Gao, F; Bai, Y J; Cheng, Y; Xiong, X L [Center for Biomedical Materials and Tissue Engineering, Academy for Advanced Interdisciplinary Studies, Peking University, Beijing 100871 (China); Wei, S C, E-mail: enwei@pku.edu.cn, E-mail: yanbo.pku@pku.edu.cn, E-mail: shuaikegang@gmail.com, E-mail: soarfgoal@gmail.com, E-mail: norice86@163.com, E-mail: chengyan@pku.edu.cn, E-mail: xxiaoling11@hotmail.com, E-mail: yfzheng@pku.edu.cn, E-mail: weishicheng99@163.com [Department of Oral and Maxillofacial Surgery, School of Stomatology, Peking University, Beijing 100081 (China)

    2011-04-15

    The present study aimed to evaluate the bioactivity of titanium surfaces sandblasted with large-grit corundum and acid etched (SLA) plus further alkali or hydrogen peroxide and heat treatment for dental implant application. Pure titanium disks were mechanically polished as control surface (Ti-control) and then sandblasted with large-grit corundum and acid etched (SLA). Further chemical modifications were conducted using alkali and heat treatment (ASLA) and hydrogen peroxide and heat treatment (HSLA) alternatively. The surface properties were characterized by scanning electron microscopy (SEM), x-ray photoelectron spectroscopy (XPS), and contact angle and roughness measurements. Further evaluation of surface bioactivity was conducted by MC3T3-E1 cell attachment, proliferation, morphology, alkaline phosphatase (ALP) activity and calcium deposition on the sample surfaces. After insertion in the beagle's mandibula for a specific period, cylindrical implant samples underwent micro-CT examination and then histological examination. It was found that ASLA and HSLA surfaces significantly increased the surface wettability and MC3T3-E1 cell attachment percentage, ALP activity and the quality of calcium deposition in comparison with simple SLA and Ti-control surfaces. Animal studies showed good osseointegration of ASLA and HSLA surfaces with host bone. In conclusion, ASLA and HSLA surfaces enhanced the bioactivity of the traditional SLA surface by integrating the advantages of surface topography, composition and wettability.

  10. Evaluation of an advanced-practice physiotherapist in triaging patients with lumbar spine pain: surgeon-physiotherapist level of agreement and patient satisfaction.

    Science.gov (United States)

    Robarts, Susan; Stratford, Paul; Kennedy, Deborah; Malcolm, Barry; Finkelstein, Joel

    2017-08-01

    Surgery for lumbar spine pain is indicated for specific etiologies. Given the majority of individuals referred to spine surgeons are not surgical candidates, care delivery is inefficient, with consultations being of limited value for most. Using specially trained physiotherapists in triage is a human resource strategy that may optimize surgeons' time and the patient experience. An advanced-practice physiotherapist (APP) and a surgeon assessed consecutive patients with lumbar spine pain presenting at an academic health centre's spine surgery clinic. The second assessor was blinded to the outcome of the first. We used the κ statistic to evaluate surgeon-APP level of chance-corrected agreement concerning patients' need for a surgical consultation. To assess satisfaction with the APP, patients completed a modified version of the validated Visit-specific Questionnaire. The sample included 102 participants (54 women) with a mean age of 54.3 ± 14.3 years and a mean Oswestry Disability Index score of 35.4 ± 16.6. The assessors' overall agreement was 86%. The κ coefficient for the need for a surgical consultation was 0.69 (95% confidence interval 0.54-0.84). The APP identified that 77% of patients did not require a surgical consultation. Twenty-one patients underwent surgery. Satisfaction scores for the APP were very high (mean score 92 out of 100). In triaging patients with lumbar spine pain, the APP and surgeon had a high level of agreement. An APP performing triage at a surgical centre can effectively reduce wait lists by 70%, reserving surgical consultations for those patients in whom they are indicated.

  11. Implementation plan for liquid low-level radioactive waste tank systems for fiscal year 1995 at Oak Ridge National Laboratory under the Federal Facility Agreement, Oak Ridge, Tennessee

    International Nuclear Information System (INIS)

    1995-06-01

    This document is the third annual revision of the plans and schedules for implementing the Federal Facility Agreement (FFA) compliance program, originally submitted in 1992 as ES/ER-17 ampersand D1, Federal Facility Agreement Plans and Schedules for Liquid Low-Level Radioactive Waste Tank Systems at Oak Ridge National Laboratory, Oak Ridge, Tennessee. This document summarizes the progress that has been made to date in implementing the plans and schedules for meeting the FFA commitments for the Liquid Low-Level Waste (LLLW) System at Oak Ridge National Laboratory (ORNL). Information presented in this document provides a comprehensive summary to facilitate understanding of the FFA compliance program for LLLW tank systems and to present plans and schedules associated with remediation, through the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) process, of LLLW tank systems that have been removed from service. ORNL has a comprehensive program underway to upgrade the LLLW System as necessary to meet the FFA requirements. The tank systems that are removed from service are being investigated and remediated through the CERCLA process. Waste and risk characterizations have been submitted. Additional data will be prepared and submitted to EPA/TDEC as tanks are taken out of service and as required by the remedial investigation/feasibility study (RI/FS) process. Chapter 1 provides general background information and philosophies that led to the plans and schedules that appear in Chaps. 2 through 5

  12. Implementation plan for liquid low-level radioactive waste tank systems at Oak Ridge National Laboratory under the Federal Facility Agreement, Oak Ridge, Tennessee

    International Nuclear Information System (INIS)

    1995-06-01

    This document is an annual revision of the plans and schedules for implementing the Federal Facility Agreement (FFA) compliance program, originally submitted in ES/ER-17 ampersand D1, Federal Facility Agreement Plans and Schedules for Liquid Low-Level Radioactive Waste Tank Systems at Oak Ridge National Laboratory, Oak Ridge, Tennessee. This document summarizes the progress that has been made to date in implementing the plans and schedules for meeting the FFA commitments for the Liquid Low-Level Waste (LLLW) System at Oak Ridge National Laboratory (ORNL). Information presented in this document provides a comprehensive summary to facilitate understanding of the FFA compliance program for LLLW tank systems and to present plans and schedules associated with remediation, through the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) process, of LLLW tank systems that have been removed from service. ORNL has a comprehensive program underway to upgrade the LLLW system as necessary to meet the FFA requirements. The tank systems that are removed from service are being investigated and remediated through the CERCLA process. Waste and risk characterizations have been submitted. Additional data will be prepared and submitted to EPA/TDEC as tanks are taken out of service and as required by the remedial investigation/feasibility study (RI/FS) process. Chapter 1 provides general background information and philosophies that lead to the plans and schedules that appear in Chapters 2 through 5

  13. Federal Facility Agreement plans and schedules for liquid low-level radioactive waste tank systems at Oak Ridge National Laboratory, Oak Ridge, Tennessee

    International Nuclear Information System (INIS)

    1993-06-01

    The Superfund Amendments and Reauthorization Act of the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) requires a Federal Facility Agreement (FFA) for federal facilities placed on the National Priorities List. The Oak Ridge Reservation was placed on that list on December 21, 1989, and the agreement was signed in November 1991 by the Department of Energy Oak Ridge Field Office (DOE-OR), the US Environmental Protection Agency (EPA)-Region IV, and the Tennessee Department of Environment and Conservation (TDEC). The effective date of the FFA was January 1, 1992. Section 9 and Appendix F of the agreement impose design and operating requirements on the Oak Ridge National Laboratory (ORNL) liquid low-level radioactive waste (LLLW) tank systems and identify several plans, schedules, and assessments that must be submitted to EPA/TDEC for review or approval. The initial issue of this document in March 1992 transmitted to EPA/TDEC those plans and schedules that were required within 60 to 90 days of the FFA effective date. The current revision of this document updates the plans, schedules, and strategy for achieving compliance with the FFA, and it summarizes the progress that has been made over the past year. Chapter 1 describes the history and operation of the ORNL LLLW System, the objectives of the FFA, the organization that has been established to bring the system into compliance, and the plans for achieving compliance. Chapters 2 through 7 of this report contain the updated plans and schedules for meeting FFA requirements. This document will continue to be periodically reassessed and refined to reflect newly developed information and progress

  14. Federal Facility Agreement plans and schedules for liquid low-level radioactive waste tank systems at Oak Ridge National Laboratory, Oak Ridge, Tennessee

    International Nuclear Information System (INIS)

    1992-03-01

    Although the Federal Facility Agreement (FFA) addresses the entire Oak Ridge Reservation, specific requirements are set forth for the liquid low-level radioactive waste (LLLW) storage tanks and their associated piping and equipment, tank systems, at ORNL. The stated objected of the FFA as it relates to these tank systems is to ensure that structural integrity, containment and detection of releases, and source control are maintained pending final remedial action at the site. The FFA requires that leaking LLLW tank systems be immediately removed from service. It also requires the LLLW tank systems that do not meet the design and performance requirements established for secondary containment and leak detection be either upgraded or replaced. The FFA establishes a procedural framework for implementing the environmental laws. For the LLLW tank systems, this framework requires the specified plans and schedules be submitted to EPA and TDEC for approval within 60 days, or in some cases, within 90 days, of the effective date of the agreement

  15. The Potential of Open Source Information in Supporting Acquisition Pathway Analysis to Design IAEA State Level Approaches

    International Nuclear Information System (INIS)

    Renda, G.; Kim, L.; Jungwirth, R.; Pabian, F.; Wolfart, E.; Cojazzi, G.G.M.; )

    2015-01-01

    International Atomic Energy Agency (IAEA) safeguards designed to deter nuclear proliferation are constantly evolving to respond to new challenges. Within its State Level Concept, the IAEA envisions an objective-based and information-driven approach for designing and implementing State Level Approaches (SLAs), using all available measures to improve the effectiveness and efficiency of safeguards. The main Objectives of a SLA are a) to detect undeclared nuclear material or activities in the State, b) to detect undeclared production or processing of nuclear materials in declared facilities or locations outside facilities (LOFs), c) to detect diversion of declared nuclear material in declared facilities or LOFs. Under the SLA, States will be differentiated based upon objective State-Specific Factors that influence the design, planning, conduct and evaluation of safeguards activities. Proposed categories of factors include both technical and legal aspects, spanning from the deployed fuel cycle and the related state's technical capability to the type of safeguards agreements in force and the IAEA experience in implementing safeguards in that state. To design a SLA, the IAEA foresees the use of Acquisition Path Analysis (APA) to identify the plausible routes for acquiring weapons-usable material and to assess their safeguards significance. In order to achieve this goal, APA will have to identify possible acquisition paths, characterize them and eventually prioritize them. This paper will provide an overview of how the use of open source information (here loosely defined as any type of non-classified or proprietary information and including, but not limited to, media sources, government and non-governmental reports and analyzes, commercial data, satellite imagery, scientific/ technical literature, trade data) can support this activity in the various aspects of a typical APA approach. (author)

  16. Paleoclimatological context and reference level of the 2°C and 1.5°C Paris Agreement long-term temperature limits

    Science.gov (United States)

    Lüning, Sebastian; Vahrenholt, Fritz

    2017-12-01

    The Paris Agreement adopted in December 2015 during the COP21 conference stipulates that the increase in the global average temperature is to be kept well below 2°C above “pre-industrial levels” and that efforts are pursued to limit the temperature increase to 1.5°C above “pre-industrial levels”. In order to further increase public acceptance of these limits it is important to transparently place the target levels and their baselines in a paleoclimatic context of the past 150,000 years (Last Interglacial, LIG) and in particular of the last 10,000 years (Holocene; Present Interglacial, PIG). Intense paleoclimatological research of the past decade has firmed up that pre-industrial temperatures have been highly variable which needs to be reflected in the pre-industrial climate baseline definitions. The currently used reference level 1850-1900 represents the end of the Little Ice Age (LIA).The LIA represents the coldest phase of the last 10,000 years when mean temperatures deviated strongly negatively from the Holocene average and which therefore are hard to justify as a representative pre-industrial baseline. The temperature level reached during the interval 1940-1970 may serve as a better reference level as it appears to roughly correspond to the average pre-industrial temperature of the past two millennia. Placing the climate limits in an enlarged paleoclimatic context will help to demonstrate that the chosen climate targets are valid and represent dangerous extremes of the known natural range of Holocene temperature variability.

  17. (RE CONSTRUCTING GENDER IN A NEW VOICE: THE ROLE OF GENDER IDENTITY IN SLA, THE CASE OF MALAYSIA

    Directory of Open Access Journals (Sweden)

    Karen Kow Yip Cheng

    2004-01-01

    Full Text Available This study is a qualitative study of Malaysian children aged between four and six years engaged in a story-telling task. The question posed in this piece of research then: Is the role played by gender in SLA? If it does play a role, what then is the nature of this role? The path taken by this study is to analyze discourse in story-telling.

  18. Mg ion implantation on SLA-treated titanium surface and its effects on the behavior of mesenchymal stem cell

    International Nuclear Information System (INIS)

    Kim, Beom-Su; Kim, Jin Seong; Park, Young Min; Choi, Bo-Young; Lee, Jun

    2013-01-01

    Magnesium (Mg) is one of the most important ions associated with bone osseointegration. The aim of this study was to evaluate the cellular effects of Mg implantation in titanium (Ti) surfaces treated with sand blast using large grit and acid etching (SLA). Mg ions were implanted into the surface via vacuum arc source ion implantation. The surface morphology, chemical properties, and the amount of Mg ion release were evaluated by scanning electron microscopy (SEM), Auger electron spectroscopy (AES), Rutherford backscattering spectroscopy (RBS), and inductively coupled plasma-optical emission spectrometer (ICP-OES). Human mesenchymal stem cells (hMSCs) were used to evaluate cellular parameters such as proliferation, cytotoxicity, and adhesion morphology by MTS assay, live/dead assay, and SEM. Furthermore, osteoblast differentiation was determined on the basis of alkaline phosphatase (ALP) activity and the degree of calcium accumulation. In the Mg ion-implanted disk, 2.3 × 10 16 ions/cm 2 was retained. However, after Mg ion implantation, the surface morphology did not change. Implanted Mg ions were rapidly released during the first 7 days in vitro. The MTS assay, live/dead assay, and SEM demonstrated increased cell attachment and growth on the Mg ion-implanted surface. In particular, Mg ion implantation increased the initial cell adhesion, and in an osteoblast differentiation assay, ALP activity and calcium accumulation. These findings suggest that Mg ion implantation using the plasma source ion implantation (PSII) technique may be useful for SLA-treated Ti dental implants to improve their osseointegration capacity. - Highlights: ► Mg ion was coated onto surface of SLA treated titanium via vacuum arc source ion implantation method. ► The morphological characteristics did not change after Mg ion implantation. ► Mg ion implanted SLA Ti is highly cytocompatible. ► Initial cell adhesion of MSCs is improved by Mg ion implantation. ► Mg ion implantation improved

  19. (Re) Constructing Gender in a New Voice: the Role of Gender Identity in Sla, the Case of Malaysia

    OpenAIRE

    Cheng, Karen Kow Yip

    2004-01-01

    This study is a qualitative study of Malaysian children aged between four and six years engaged in a story-telling task. The question posed in this piece of research then: Is the role played by gender in SLA? If it does play a role, what then is the nature of this role? The path taken by this study is to analyze discourse in story-telling.

  20. The role of MPL and imiquimod adjuvants in enhancement of immune response and protection in BALB/c mice immunized with soluble Leishmania antigen (SLA) encapsulated in nanoliposome.

    Science.gov (United States)

    Emami, Tara; Rezayat, Seyed Mahdi; Khamesipour, Ali; Madani, Rasool; Habibi, Gholamreza; Hojatizade, Mansure; Jaafari, Mahmoud Reza

    2018-04-01

    Adjuvants play an essential role in the induction of immunity against leishmaniasis. In this study, monophosphoryl lipid A (MPL) and imiquimod (IMQ) were used as TLR ligands adjuvants to enhance immunogenicity and rate of protection against leishmaniasis. Nanoliposomes containing soluble Leishmania antigens (SLA) and adjuvants were consisted of DSPC, DSPG and Chol prepared by using lipid film method followed by bath sonication. The size of nanoliposomes was around 95 nm and their zeta potential was negative. BALB/c mice were immunized by liposomal formulations of lip/SLA, lip/MPL/SLA, lip/IMQ/SLA, lip/MPL/IMQ/SLA, lip/SLA + lip/IMQ, lip/SLA + lip/MPL, lip/SLA + lip/MPL/IMQ and five controls of SLA, lip/MPL, lip/IMQ, lip/MPL/IMQ and buffer by subcutaneously (SC) injections, three times in 2 weeks intervals. The synergic effect of two adjuvants when they are used in one formulation showed significantly (p MPL and IMQ adjuvants and antigen in nanoliposome carrier could be an appropriate delivery system to induce cellular immunity pathway against leishmaniasis.

  1. International environmental agreements

    NARCIS (Netherlands)

    de Zeeuw, Aart

    2015-01-01

    The regulation of environmental externalities at the global level requires international agreements between sovereign states. Game theory provides an appropriate theoretical tool for analysis. However, game theory can result in a wide range of outcomes, and therefore it is important to discuss the

  2. A Hybrid Multiobjective Discrete Particle Swarm Optimization Algorithm for a SLA-Aware Service Composition Problem

    Directory of Open Access Journals (Sweden)

    Hao Yin

    2014-01-01

    Full Text Available For SLA-aware service composition problem (SSC, an optimization model for this algorithm is built, and a hybrid multiobjective discrete particle swarm optimization algorithm (HMDPSO is also proposed in this paper. According to the characteristic of this problem, a particle updating strategy is designed by introducing crossover operator. In order to restrain particle swarm’s premature convergence and increase its global search capacity, the swarm diversity indicator is introduced and a particle mutation strategy is proposed to increase the swarm diversity. To accelerate the process of obtaining the feasible particle position, a local search strategy based on constraint domination is proposed and incorporated into the proposed algorithm. At last, some parameters in the algorithm HMDPSO are analyzed and set with relative proper values, and then the algorithm HMDPSO and the algorithm HMDPSO+ incorporated by local search strategy are compared with the recently proposed related algorithms on different scale cases. The results show that algorithm HMDPSO+ can solve the SSC problem more effectively.

  3. Bone marrow transplantation in miniature swine: I. Autologous and SLA matched allografts

    International Nuclear Information System (INIS)

    Pennington, L.R.; Pescovitz, M.D.; Popitz, F.; Sachs, D.H.; Sakamoto, K.

    1986-01-01

    We developed a successful bone marrow transplant protocol in MHC-inbred miniature swine (MS). Three groups of MS were studied: irradiation controls, autologous bone marrow transplants and SLA matched bone marrow allografts. One day prior to irradiation, all animals underwent Hickman catheter placement via the external jugular vein. Bone marrow was harvested by direct mechanical removal of marrow from four long bones in Groups 2 and 3 one day prior to irradiation. All animals received 900 rads of midline body radiation from a Cobalt-60 source, were treated 1 g of cephalothin IV bid from day 1 to 14, 20 mg of genetamicin IV bid, from day 4 through 14 and 250 to 350 ml of fresh, irradiated whole blood from blood group identical donors on days 7, 11 and 14. Bone marrow was filtered, washed, stored overnight at 4 C and reinfused one to six hr after irradiation. Engraftment was defined by return of the peripheral WBC to 1000/mm 3 . All six animals in Group 1 died of aplasia between days 7 and 12. Marrow engrafted in eight of 12 animals in Group 2 and 7 of 10 animals in Group 3. This model provides a means to study the biological characteristics of bone marrow transplantation in immunologically well characterized large animals and should prove useful as a model for bone marrow transplants in man

  4. Multilateral agreements

    International Nuclear Information System (INIS)

    Anon.

    2004-01-01

    The first review meeting of the joint convention on the safety of spent fuel management and on the safety of radioactive waste management resulted in the assembly of the most comprehensive information yet available on the status of these ones in the world. The review process has prompted improvements in others. The discussions in the two week meeting addressed all of the important issues confronting countries in managing spent fuel and radioactive waste safely. It revealed areas for improvement at both the national and international levels. he joint convention review process is designed principally for the review of the National reports of contracting parties. However, there are also global issues in the area of spent fuel and radioactive waste management and issues of special interest, to groups of countries to consider. The future development of the convention may therefore have to include suitable additional mechanisms to allow these aspects to be addressed. (N.C.)

  5. Project management plan for low-level mixed waste and greater-than-category 3 waste per tri-party agreement M-91-10

    Energy Technology Data Exchange (ETDEWEB)

    BOUNINI, L.

    1999-05-20

    The objective of this project management plan is to define the tasks and deliverables that will support the treatment, storage, and disposal of remote-handled and large container contact-handled low-level mixed waste, and the storage of Greater-thaw category 3 waste. The plan is submitted to fulfill the requirements of the Hanford Federal Facility Agreement and Consent Order Milestone M-91-10, The plan was developed in four steps: (1) the volumes of the applicable waste streams and the physical, dangerous, and radioactive characteristics were established using existing databases and forecasts; (2) required treatment was identified for each waste stream based on land disposal restriction treatment standards and waste characterization data; (3) alternatives for providing the required treatment were evaluated and the preferred options were selected; (4) an acquisition plan was developed to establish the technical, schedule, and cost baselines for providing the required treatment capabilities. The major waste streams are tabulated, along with the required treatment for disposal.

  6. Project management plan for low-level mixed waste and greater-than-category 3 waste per tri-party agreement M-91-10

    International Nuclear Information System (INIS)

    BOUNINI, L.

    1999-01-01

    The objective of this project management plan is to define the tasks and deliverables that will support the treatment, storage, and disposal of remote-handled and large container contact-handled low-level mixed waste, and the storage of Greater-thaw category 3 waste. The plan is submitted to fulfill the requirements of the Hanford Federal Facility Agreement and Consent Order Milestone M-91-10, The plan was developed in four steps: (1) the volumes of the applicable waste streams and the physical, dangerous, and radioactive characteristics were established using existing databases and forecasts; (2) required treatment was identified for each waste stream based on land disposal restriction treatment standards and waste characterization data; (3) alternatives for providing the required treatment were evaluated and the preferred options were selected; (4) an acquisition plan was developed to establish the technical, schedule, and cost baselines for providing the required treatment capabilities. The major waste streams are tabulated, along with the required treatment for disposal

  7. F/H Area high level waste removal plan ampersand schedule as required by the Federal Facility Agreement for the Savannah River Site

    International Nuclear Information System (INIS)

    Hunter, M.A.

    1993-11-01

    The F and H-area HLW Tank Farms are one component of a larger integrated waste treatment system consisting of facilities designed for the overall processing of several radioactive waste streams resulting from nuclear material processing. Section IX.E of the SRS Federal Facility Agreement requires the DOE to submit to the EPA and SCDHEC for review and approval, a plan(s) and schedule(s) for the removal from service of waste tank systems(s)/component(s) that do not meet secondary containment standards, or that leak or have leaked. The Plan and Schedule for removal from service of these waste tanks is shown in Appendices A and B, respectively. Other portions of this package which include schedule dates are provided for information only. The SRS intends to remove systems from service as opposed to providing secondary containment for non-compliant systems. The systems that do not meet secondary containment requirements or that have leaked (as determined by tank assessment reports) include High Level Waste Tanks No. 1--24 along with corresponding ancillary equipment

  8. FFTF Authorization Agreement

    International Nuclear Information System (INIS)

    DAUTEL, W.A.

    2000-01-01

    The purpose of the Authorization Agreement is to serve as a mechanism whereby the U.S. Department of Energy, Richland Operations Office (RL) and Fluor Hanford (FH) jointly clarify and agree to key conditions for conducting work safely and efficiently in the Fast Flux Test Facility (FFTF). Work must be accomplished in a manner that achieves high levels of quality while protecting the environment and the safety and health of workers and the public, and complying with applicable contractual and regulatory requirements. It is the intent of this Agreement to address those items of significant importance in establishing and supporting the FFTF Authorization Envelope, but this Agreement in no way alters the terms and conditions of the Project Hanford Management Contract (PHMC), Contract Number DE-AC06-96RL13200

  9. Spirometry, questionnaire and electronic medical record based COPD in a population survey: Comparing prevalence, level of agreement and associations with potential risk factors.

    Science.gov (United States)

    Borlée, Floor; Yzermans, C Joris; Krop, Esmeralda; Aalders, Bernadette; Rooijackers, Jos; Zock, Jan-Paul; van Dijk, Christel E; Maassen, Catharina B M; Schellevis, François; Heederik, Dick; Smit, Lidwien A M

    2017-01-01

    COPD-diagnosis is confirmed by post-bronchodilator (BD) spirometry. However, epidemiological studies often rely on pre-BD spirometry, self-reports, or medical records. This population-based study aims to determine COPD-prevalence based on four different operational definitions and their level of agreement, and to compare associations between COPD-definitions and risk factors. COPD-prevalence in 1,793 adults from the general Dutch population (aged 18-70 years) was assessed based on self-reported data, Electronic Medical Records (EMR), and post-BD spirometry: using the FEV1/FVC below the lower limit of normal (LLN) and GOLD fixed cut-off (FEV1/FVC spirometry as a reference, sensitivity was calculated for self-reported and EMR-based COPD. Associations between COPD and known risk factors were assessed with logistic regression. Data were collected as part of the cross-sectional VGO study (Livestock Farming and Neighboring Residents' Health Study). The highest prevalence was found based on spirometry (GOLD: 10.9%, LLN: 5.9%), followed by self-report (4.6%) and EMR (2.9%). Self-reported or EMR-based COPD identified less than 30% of all COPD-cases based on spirometry. The direction of association between known risk factors and COPD was similar across the four definitions, however, magnitude and significance varied. Especially indicators of allergy were more strongly associated with self-reported COPD compared to the other definitions. COPD-prevalence varied depending on the used definition. A substantial number of subjects with spirometry-based COPD cannot be identified with questionnaires or medical records which can cause underestimation of COPD-prevalence. The influence of the different COPD-definitions on associations with known risk factors was limited.

  10. Towards understanding the impact of assimilating along-track SLA data on simulated eddy characteristics in the Agulhas System

    CSIR Research Space (South Africa)

    De Vos, M

    2016-10-01

    Full Text Available understanding the impact of assimilating along-track SLA data on simulated eddy characteristics in the Agulhas System Marc de Vos1, 3, Björn Backeberg2, 3, 4 and François Counillon4 Marine Research Unit, South African Weather Service, South Africa1 Coastal... and 1 Tel: +27 21 935 5764; Email: marc.devos@weathersa.co.za dipoles reach the Agulhas Current frequently and on occasion propagate all the way to the retroflection, influencing its position and modulating ring shedding events there (Schouten et al...

  11. Evaluation of osseous integration of titanium orthopedic screws with novel SLA treatment in porcine model.

    Directory of Open Access Journals (Sweden)

    Tzu-Hsiang Lin

    Full Text Available The success of many endosseous implants in orthopaedic and dental applications depends on the surface characteristics, as they affect osseous integration. Previous investigations indicated that a novel large-grit sand-blasted and acid-etched (SLA titanium (denoted as SLAffinity-Ti implant had better bone integration than that of a comparably shaped implant with a plasma-sprayed titanium surface. The purpose of the present investigation was to create a SLAffinity surface on pedicle screws and trauma screws and to compare it with the surfaces of a sand-blasted-only implant and commercial implants in terms of bone integration. The cortical bone and spine of twelve minipigs were implanted with 3 and 4 implants, respectively, and the bone integration was evaluated using micro-computed tomography (micro-CT, mechanical tests (pull-out strength and stripping torque, and histological analysis (toluidine blue and hematoxylin and eosin staining one and three months after implantation. The micro-CT images showed that the gap between the bone and implant was consistently higher in the sand-blasted-only and commercial groups compared to that in the SLAffinity group 1 and 3 months after implantation. Moreover, the bone volume of implant inserted into bone and the percentage of implant inside bone tissue were greater in the SLAffinity screws 1 and 3 months after implantation, as compared to the sand-blasted and commercial screws. In the mechanical tests, the removal torque and pull-out strength (p < 0.05 were higher in the SLAffinity group at 1 and 3 months. The histological results were consistent with mechanical testing, showing that the SLAffinity group had the most mineralized matrix, the most bone formation around the screws, and the most bone cells in bone tissue. These findings indicate that a SLAffinity surface can effectively enhance the holding strength and integration of pedicle screws and cortical screws, promoting early healing and improving

  12. Sea level variability at Adriatic coast and its relationship to atmospheric forcing

    Energy Technology Data Exchange (ETDEWEB)

    Bergant, K. [Centre for Atmospheric Research, Nova Gorica Polytechnic, Nova Gorica (Slovenia); Susnik, M.; Strojan, I. [Dept. of Hydrology, Environmental Agency of the Republic of Slovenia, Ljubljana (Slovenia); Shaw, A.G.P. [James Rennel Div., National Oceanography Centre, Empress Dock, Southampton (United Kingdom)

    2005-07-01

    Sea level (SLH) variability at the Adriatic coast was investigated for the period 1872-2001 using monthly average values of observations at 13 tide gauge stations. Linear trends and seasonal cycles were investigated first and removed afterwards from the data. Empirical orthogonal functions (EOF) analysis was used further on remaining anomalies (SLA) to extract the regional intermonthly variability of SLH. It was found that the leading EOF and its principal component (PC) explain a major part of SLA variability (92%). The correlation between the reconstructed SLA, based on leading EOF and its PC, and overlapping observed SLA values for selected tide gauge stations is between 0.93 and 0.99. Actual SLH values at tide gauge stations can be reconstructed and some gaps in the data can be filled in on the basis of estimated SLA values if reasonable estimates of long-term trends and seasonal cycles are also available. A strong, seasonally dependent relationship between SLA at the Adriatic coast and atmospheric forcing, represented by sea level pressure (SLP) fields, was also found. Comparing the time series of leading PC and gridded SLP data for the period 1948-2001, the highest correlation coefficients (r) of -0.92 in winter, -0.84 in spring, -0.66 in summer, and -0.91 in autumn were estimated for a SLP grid point located in northern Italy. The SLP variability on this grid point contains information about the isostatic response of the sea level at the Adriatic coast, but can also be treated as a sort of teleconnection index representing the large-scale SLP variability across central and southern Europe. To some extent the large-scale SLP variability that affects the SLA at the Adriatic coast can be related to the North Atlantic Oscillation (NAO), because significant correlations were found between the NAO index and the first PC of SLA (r{sub winter}=-0.56, r{sub spring}=-0.45, r{sub summer}=-0.48, and r{sub autumn}=-0.43) for the period 1872-2001. The use of partial least

  13. Swine Leukocyte Antigen (SLA) class I allele typing of Danish swine herds and identification of commonly occurring haplotypes using sequence specific low and high resolution primers

    DEFF Research Database (Denmark)

    Pedersen, Lasse Eggers; Jungersen, Gregers; Sørensen, Maria Rathmann

    2014-01-01

    of such peptide-MHC complexes (pMHC) naïve T cells can become activated and respond to a given pathogen leading to its elimination and the generation of memory cells. Hence SLA plays a crucial role in maintaining overall adaptive immunologic resistance to pathogens. Knowing which SLA alleles that are commonly...... occurring can be of great importance in regard to future vaccine development and the establishment of immune protection in swine through broad coverage, highly specific, subunit based vaccination against viruses such as swine influenza, porcine reproductive and respiratory syndrome virus, vesicular...

  14. Voluntary agreements in environmental policy

    International Nuclear Information System (INIS)

    Torvanger, Asbjoern

    2001-01-01

    A typically voluntary agreement is signed between the authorities and an industrial sector in order to reduce the emission of environmentally harmful substances. There are many different types of agreements. Voluntary agreements are not strictly voluntary, since in the background there is often some kind of ''threat'' about taxation or fees if the industry is unwilling to cooperate. This type of agreements has become popular in many OECD countries during the last decades. In Norway there are only a few agreements of this type. Experience with the use of voluntary agreements as well as research show that they are less cost-effective than market-based instruments such as taxes and quota systems. If there are great restrictions on the use of taxes and quota systems because of information- or measurement problems, or because these instruments are not politically acceptable, then voluntary agreements may be an interesting alternative. Thus, voluntary agreements are best used as a supplement to other instruments in some niche areas of the environmental policy. In some cases, voluntary agreements may be used between two countries or at a regional level, for example within the EU

  15. Agreement Workflow Tool (AWT)

    Data.gov (United States)

    Social Security Administration — The Agreement Workflow Tool (AWT) is a role-based Intranet application used for processing SSA's Reimbursable Agreements according to SSA's standards. AWT provides...

  16. Development of a rapid in vitro protein refolding assay which discriminates between peptide-bound and peptide-free forms of recombinant porcine major histocompatibility class I complex (SLA-I)

    DEFF Research Database (Denmark)

    Oleksiewicz, M.B.; Kristensen, B.; Ladekjaer-Mikkelsen, A.S.

    2002-01-01

    The extracellular domains of swine leukocyte antigen class I (SLA-I, major histocompatibility complex protein class 1) were cloned and sequenced for two haplotypes (114 and H7) which do not share any alleles based on serological typing, and which are the most important in Danish farmed pigs....... The extracellular domain of SLA-I was connected to porcine beta2 microglobulin by glycine-rich linkers. The engineered sin.-le-chain proteins, consisting of fused SLA-I and beta2 microglobulin, were overexpressed as inclusion bodies in Escherichia coli. Also, variants were made of the single-chain proteins......, by linking them through glycine-rich linkers to peptides representing T-cell epitopes from classical swine fever virus (CSFV) and foot-and-mouth disease virus (FMDV). An in vitro refold assay was developed, using a monoclonal anti-SLA antibody (PT85A) to gauge refolding. The single best-defined, SLA...

  17. 10-year survival rate and the incidence of peri-implant disease of 374 titanium dental implants with a SLA surface: a prospective cohort study in 177 fully and partially edentulous patients.

    Science.gov (United States)

    van Velzen, Frank J J; Ofec, Ronen; Schulten, Engelbert A J M; Ten Bruggenkate, Christiaan M

    2015-10-01

    This prospective cohort study evaluates the 10-year survival and incidence of peri-implant disease at implant and patient level of sandblasted, large grid, and acid-etched titanium dental implants (Straumann, soft tissue level, SLA surface) in fully and partially edentulous patients. Patients who had dental implant surgery in the period between November 1997 and June 2001, with a follow-up of at least 10 years, were investigated for clinical and radiological examination. Among the 506 inserted dental implants in 250 patients, 10-year data regarding the outcome of implants were available for 374 dental implants in 177 patients. In the current study, peri-implantitis was defined as advanced bone loss (≧1.5 mm. postloading) in combination with bleeding on probing. At 10-year follow-up, only one implant was lost (0.3%) 2 months after implant surgery due to insufficient osseointegration. The average bone loss at 10 year postloading was 0.52 mm. Advanced bone loss at 10-year follow-up was present in 35 dental implants (9.8%). Seven percent of the observed dental implants showed bleeding on probing in combination with advanced bone loss and 4.2% when setting the threshold for advanced bone loss at 2.0 mm. Advanced bone loss without bleeding on probing was present in 2.8% of all implants. In this prospective study, the 10-year survival rate at implant and patient level was 99.7% and 99.4%, respectively. Peri-implantitis was present in 7% of the observed dental implants according to the above-mentioned definition of peri-implantitis. This study shows that SLA implants offer predictable long-term results as support in the treatment of fully and partially edentulous patients. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  18. License agreement, employee work

    OpenAIRE

    Poncová, Veronika

    2012-01-01

    The rigorous thesis is focused on license agreement and employee work. The aim of the thesis is not only an analysis of the use of a copyrighted work by a person different from the author of the work, but also an analysis of the performance of copyright by a person different from the author of the work. The thesis consists of five chapters. The opening chapter provides a summary of the notion of copyright, its sources at the national and international levels, but also the European Union legis...

  19. Exploring rater agreement: configurations of agreement and disagreement

    Directory of Open Access Journals (Sweden)

    ALEXANDER VON EYE

    2006-03-01

    Full Text Available At the level of manifest categorical variables, a large number of coefficients and models for the examination of rater agreement has been proposed and used for descriptive and explanatory purposes. This article focuses on exploring rater agreement. Configural Frequency Analysis (CFA is proposed as a method of exploration of cross-classifications of raters’ judgements. CFA allows researchers to (1 examine individual cells and sets of cells in agreement tables; (2 examine cells that indicate disagreement; and (3 explore agreement and disagreement among three or more raters. Four CFA base models are discussed. The first is the model of rater agreement that is also used for Cohen’s (1960  (kappa. This model proposes independence of raters’ judgements. Deviations from this model suggest agreement or disagreement beyond chance. The second CFA model is based on a log-linear null model. This model is also used for Brennan and Prediger’s (1981 n. It proposes a uniform distribution of ratings. The third model is that of Tanner and Young (1985. This model proposes equal weights for agreement cases and independence otherwise. The fourth model is the quasi-independence model. This model allows one to blank out agreement cells and thus to focus solely on patterns of disagreement. Examples use data from applicant selection.

  20. Technology Partnership Agreements | NREL

    Science.gov (United States)

    Partnership Agreements Technology Partnership Agreements Looking for Funding? We do not fund any projects under a technology partnership agreement. The partner provides the necessary resources and, in using technology partnership agreements. See a summary of our Fiscal Year 2017 technology partnership

  1. Annual status report on Federal Facility Agreement compliance for the Liquid Low-Level Waste tank systems at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    1994-09-01

    This annual report summarizes the status of Federal Facility Agreement (FFA) compliance activities at Oak Ridge National Laboratory (ORNL) and describes the progress made over the past fiscal year. In fiscal 1994, ORNL issued the final submittal of the risk characterization data for the inactive tanks, the secondary containment design demonstration report for Category B piping, and the FFA Implementation Plan. In addition, two new LLLW tanks serving Building 2026 and the Transported Waste Receiving Facility were installed; leak testing was initiated for all active, singly contained tanks and piping; sources of inflow to inactive tanks were investigated and diversion to process waste was begun; and the W-12 tank system was repaired and a request to allow its temporary use was approved by EPA/TDEC. Programmatic improvements were also made during the year: a system for improved communication of FFA plans and activities was implemented in October 1993, a survey was conducted to ensure that all inactive drains are identified and sealed, and two meetings of the ORNL FFA Technical Advisory Group were held

  2. Nuclear cooperation agreements

    International Nuclear Information System (INIS)

    Nuclear cooperation agreements are reviewed in tabular form, especially agreements with developing countries. The reporting countries are the USA, the Federal Republic of Germany, Canada, Australia, Japan, and France. A separate EURATOM list is annexed

  3. The status of the safeguards implementation under the State-Level Approach at the HANARO

    International Nuclear Information System (INIS)

    Kim, H. S.; Lee, B. D.; Kim, I. C.; Kim, H. J.; Jung, J. A.; Lee, S. H.

    2016-01-01

    The IAEA developed the SLA(State-Level Approach) for the States in order to maximize effectiveness of safeguards in an environment of constrained resources. The SLA has been implemented at KAERI-Daejeon site in the ROK since 2015. The ten nuclear facilities and one LOF(Location Outsides Facility) of the KAERI-Daejeon site are grouped into three categories under the SLA. The HANARO(High flux Advanced Neutron Application ReactOr) and PIEF(Post Irradiation Examination Facility) are involved in the category I “self-contained capability” facilities that have at least one significant quantity of suitable nuclear material and which could support undeclared plutonium production/separation activities without other supporting infrastructures. This paper described the status of the safeguards implementation at the HANARO involved in the category I under the SLA. The status of a model inventory management system for a research reactor developed in 2013 was also investigated. In this paper, the features and status of the safeguards implementation of the HANARO under the SLA were analyzed. Under the SLA, the monthly, quarterly and annual advanced facility operational information for the HANARO has been submitted to the IAEA in a timely manner. The IAEA inspection at HANARO has been successfully performed under the SLA. It is expected that the safeguards implementation work at HANARO under the SLA has the similar level with that under IS. Under the SLA, the data occurred from the surveillance cameras and other equipment installed at HANARO enables to transmit remotely to the IAEA. The IAEA is targeting 2017~2018 to upgrade them. In addition, the development status of a model inventory management system for a research reactor was investigated. It aims at controlling the material inventory for the nuclear material accounting work and the convenient facility operation. The major functions of it are to trace the transfer history of the nuclear materials and non-nuclear materials

  4. The status of the safeguards implementation under the State-Level Approach at the HANARO

    Energy Technology Data Exchange (ETDEWEB)

    Kim, H. S.; Lee, B. D.; Kim, I. C.; Kim, H. J.; Jung, J. A.; Lee, S. H. [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2016-10-15

    The IAEA developed the SLA(State-Level Approach) for the States in order to maximize effectiveness of safeguards in an environment of constrained resources. The SLA has been implemented at KAERI-Daejeon site in the ROK since 2015. The ten nuclear facilities and one LOF(Location Outsides Facility) of the KAERI-Daejeon site are grouped into three categories under the SLA. The HANARO(High flux Advanced Neutron Application ReactOr) and PIEF(Post Irradiation Examination Facility) are involved in the category I “self-contained capability” facilities that have at least one significant quantity of suitable nuclear material and which could support undeclared plutonium production/separation activities without other supporting infrastructures. This paper described the status of the safeguards implementation at the HANARO involved in the category I under the SLA. The status of a model inventory management system for a research reactor developed in 2013 was also investigated. In this paper, the features and status of the safeguards implementation of the HANARO under the SLA were analyzed. Under the SLA, the monthly, quarterly and annual advanced facility operational information for the HANARO has been submitted to the IAEA in a timely manner. The IAEA inspection at HANARO has been successfully performed under the SLA. It is expected that the safeguards implementation work at HANARO under the SLA has the similar level with that under IS. Under the SLA, the data occurred from the surveillance cameras and other equipment installed at HANARO enables to transmit remotely to the IAEA. The IAEA is targeting 2017~2018 to upgrade them. In addition, the development status of a model inventory management system for a research reactor was investigated. It aims at controlling the material inventory for the nuclear material accounting work and the convenient facility operation. The major functions of it are to trace the transfer history of the nuclear materials and non-nuclear materials

  5. Communication dated 10 September 2008 received from the Permanent Mission of Egypt to the Agency concerning the High Level Policy Review Seminar of African Regional Cooperative Agreement for Research, Development and Training related to Nuclear Science and Technology (AFRA)

    International Nuclear Information System (INIS)

    2008-01-01

    The Secretariat has received a communication dated 10 September 2008 from the Permanent Mission of Egypt enclosing the documents of the High Level Policy Review Seminar of the African Regional Cooperative Agreement for Research, Development and Training related to Nuclear Science and Technology (AFRA) held in Aswan, Egypt on 28-29 November 2007. The communication, and as requested therein, the enclosures containing the Declaration of Aswan, the Aswan Action Plan and the Profile of the Regional Strategic Cooperative Framework (2008-2013) are circulated herewith for information

  6. Financing petroleum agreements

    International Nuclear Information System (INIS)

    Robson, C.J.V.

    1994-01-01

    This chapter describes the typical type of financing agreements which are currently used to finance North Sea petroleum projects whether they are in the cause of development or have been developed and are producing. It deals with the agreements which are entered into to finance borrowings for petroleum projects on a non-resource or limited resource basis. (UK)

  7. Competition for Assistance Agreements

    Science.gov (United States)

    It is EPA policy to promote competition in the award of assistance agreements to the maximum extent practicable.When assistance agreements are awarded competitively, it is EPA policy that the competitive process be fair and open & that no applicant receive

  8. Comparison of the Accuracy of 3D Printed Prototypes Using the Stereolithography (SLA Method with the Digital CAD Models

    Directory of Open Access Journals (Sweden)

    Yankov Emil

    2017-01-01

    Full Text Available Each printing method and the materials used for prototype construction have distinct advantages and drawbacks. A large part of the 3D printer producers indicates high printing accuracy (positioning accuracies from 100 μm up to 1 μm and layer thickness from 100 μm tо 5 μm. In the process of layers deposition, the material is softened, melted or irradiated with a certain light source to polymerize. Thus, during the printing process, the volume of the materials is changing causing shrinking or expansion which often leads to the occurrence of precision errors in the prototype as opposed to the digital model. This phenomenon leads to distortions of the printed object known as a curling effect. Certain chemical compounds are added by the producers to multiple materials in order to enhance their mechanical and technological properties. However, this often results in changes of some printing parameters influencing the precision and quality of the manufactured object. The aim of the particular study is to establish the allowances with regard to the accuracy during manufacturing precise objects used in micro technologies as well as the necessary adjustments in dimensions because of the shrinkage and the positioning of the SLA 3D printed parts from photopolymer material.

  9. International Fisheries Agreements

    DEFF Research Database (Denmark)

    Pintassilgo, Pedro; Kronbak, Lone Grønbæk; Lindroos, Marko

    2015-01-01

    This paper surveys the application of game theory to the economic analysis of international fisheries agreements. The relevance of this study comes not only from the existence of a vast literature on the topic but especially from the specific features of these agreements. The emphasis of the survey...... is on coalition games, an approach that has become prominent in the fisheries economics literature over the last decade. It is shown that coalition games were first applied to international fisheries agreements in the late 1990s addressing cooperative issues under the framework of characteristic function games...... and stability of international fisheries agreements. A key message that emerges from this literature strand is that self-enforcing cooperative management of internationally shared fish stocks is generally difficult to achieve. Hence, the international legal framework and regulations play a decisive role...

  10. Trade Agreements PTI

    Data.gov (United States)

    Department of Homeland Security — The objective of the Trade Agreements PTI is to advance CBP’s mission by working with internal and external stakeholders to facilitate legitimate trade and address...

  11. Production sharing agreements

    International Nuclear Information System (INIS)

    1994-01-01

    This paper, which was presented at the Production Sharing Agreement seminar, discusses economic rent, negotiations, trends in fiscal system development, and concessionary systems. Production sharing contracts, risk service contracts, joint ventures and the global market are examined. (UK)

  12. Multilateral and bilateral agreements

    International Nuclear Information System (INIS)

    Koponen, H.

    1993-01-01

    Finland has made both multilateral and bilateral agreements on the exchange of information related to radiation safety. The first arrangements for international agreements and exchange of information were made after the Chernobyl accident. In 1987, Finland joined the convention on early notification of a nuclear power accident coordinated by International Atomic Energy Agency. The convention is applied to accidents that cause of may cause emissions of radioactive substances that might affect the radiation safety of another country. Besides the convention on early notification, some other individual agreements have also been made. These include the International Nuclear Event Scale (INES) system and power companies own information exchange systems. Finland has conducted bilateral agreements with the Nordic countries and the Soviet Union on the notification of accidents and exchange of nuclear power plant information. Today, Russia answers for the Soviet Union's contractual obligations. (orig.)

  13. SLA-based optimisation of virtualised resource for multi-tier web applications in cloud data centres

    Science.gov (United States)

    Bi, Jing; Yuan, Haitao; Tie, Ming; Tan, Wei

    2015-10-01

    Dynamic virtualised resource allocation is the key to quality of service assurance for multi-tier web application services in cloud data centre. In this paper, we develop a self-management architecture of cloud data centres with virtualisation mechanism for multi-tier web application services. Based on this architecture, we establish a flexible hybrid queueing model to determine the amount of virtual machines for each tier of virtualised application service environments. Besides, we propose a non-linear constrained optimisation problem with restrictions defined in service level agreement. Furthermore, we develop a heuristic mixed optimisation algorithm to maximise the profit of cloud infrastructure providers, and to meet performance requirements from different clients as well. Finally, we compare the effectiveness of our dynamic allocation strategy with two other allocation strategies. The simulation results show that the proposed resource allocation method is efficient in improving the overall performance and reducing the resource energy cost.

  14. Calculation of 125Te NMR Chemical Shifts at the Full Four-Component Relativistic Level with Taking into Account Solvent and Vibrational Corrections: A Gateway to Better Agreement with Experiment.

    Science.gov (United States)

    Rusakova, Irina L; Rusakov, Yuriy Yu; Krivdin, Leonid B

    2017-06-29

    Four-component relativistic calculations of 125 Te NMR chemical shifts were performed in the series of 13 organotellurium compounds, potential precursors of the biologically active species, at the density functional theory level under the nonrelativistic and four-component fully relativistic conditions using locally dense basis set scheme derived from relativistic Dyall's basis sets. The relativistic effects in tellurium chemical shifts were found to be of as much as 20-25% of the total calculated values. The vibrational and solvent corrections to 125 Te NMR chemical shifts are about, accordingly, 6 and 8% of their total values. The PBE0 exchange-correlation functional turned out to give the best agreement of calculated tellurium shifts with their experimental values giving the mean absolute percentage error of 4% in the range of ∼1000 ppm, provided all corrections are taken into account.

  15. Design of a prospective clinical study on the agreement between the Continuous GlucoseMonitor, a novel device for CONTinuous ASSessment of blood GLUcose levels, and the RAPIDLab® 1265 blood gas analyser: The CONTASSGLU study.

    Science.gov (United States)

    Zimmermann, Johannes B; Lehmann, Monika; Hofer, Stefan; Hüsing, Johannes; Alles, Catharina; Werner, Jens; Stiller, Jürgen; Künnecke, Wolfgang; Luntz, Steffen; Motsch, Johann; Weigand, Markus A

    2012-09-22

    Although a device is needed to continuously measure blood glucose levels within an intensive care setting, and several large-scale prospective studies have shown that patients might benefit from intensive insulin, potassium, or glucose therapy during intensive care, no devices are currently available to continuously assess blood glucose levels in critically ill patients. We conceived the study described here to evaluate the clinical use of the Continuous Glucose Monitor (CGM) performed via a central vein, and to determine the impact of phenomena, such as drift and shift, on the agreement between the CGM and a RAPIDLab® 1265 blood gas analyser (BGA). In the CONTinuous ASSessment of blood GLUcose (CONTASSGLU) study, up to 130 patients under intensive care will be fitted with the CGM, an ex vivo device that continuously measures blood glucose and lactate levels. Readings from the device taken 8 h after initial placement and calibration will be compared with values measured by a BGA. For this study, we chose the BGA as it is an established standard point-of-care device, instead of the devices used in certified central laboratories. Nevertheless, we will also independently compare the results from the point-of-care BGA with those determined by a central laboratory-based device. Blood samples will be collected from each patient from the same site in which the CGM will measure blood glucose. Consequently, each participant will serve as their own control, and no randomisation is necessary. The 95% limits of agreement and the corresponding confidence intervals will be calculated and compared with a prespecified clinically acceptable relative difference of 20%. Several attempts have been made to develop a device to continuously measure blood glucose levels within an intensive care setting or to use the devices that were originally designed for diabetes management, as several of these devices are already available. However, none of these devices were successful in

  16. Design of a prospective clinical study on the agreement between the Continuous GlucoseMonitor, a novel device for CONTinuous ASSessment of blood GLUcose levels, and the RAPIDLab® 1265 blood gas analyser: The CONTASSGLU study

    Directory of Open Access Journals (Sweden)

    Zimmermann Johannes B

    2012-09-01

    Full Text Available Abstract Background Although a device is needed to continuously measure blood glucose levels within an intensive care setting, and several large-scale prospective studies have shown that patients might benefit from intensive insulin, potassium, or glucose therapy during intensive care, no devices are currently available to continuously assess blood glucose levels in critically ill patients. We conceived the study described here to evaluate the clinical use of the Continuous Glucose Monitor (CGM performed via a central vein, and to determine the impact of phenomena, such as drift and shift, on the agreement between the CGM and a RAPIDLab® 1265 blood gas analyser (BGA. Methods/design In the CONTinuous ASSessment of blood GLUcose (CONTASSGLU study, up to 130 patients under intensive care will be fitted with the CGM, an ex vivo device that continuously measures blood glucose and lactate levels. Readings from the device taken 8 h after initial placement and calibration will be compared with values measured by a BGA. For this study, we chose the BGA as it is an established standard point-of-care device, instead of the devices used in certified central laboratories. Nevertheless, we will also independently compare the results from the point-of-care BGA with those determined by a central laboratory-based device. Blood samples will be collected from each patient from the same site in which the CGM will measure blood glucose. Consequently, each participant will serve as their own control, and no randomisation is necessary. The 95% limits of agreement and the corresponding confidence intervals will be calculated and compared with a prespecified clinically acceptable relative difference of 20%. Discussion Several attempts have been made to develop a device to continuously measure blood glucose levels within an intensive care setting or to use the devices that were originally designed for diabetes management, as several of these devices are already

  17. Canadian seismic agreement

    International Nuclear Information System (INIS)

    Wetmiller, R.J.; Lyons, J.A.; Shannon, W.E.; Munro, P.S.; Thomas, J.T.; Andrew, M.D.; Lamontagne, M.; Wong, C.; Anglin, F.M.; Plouffe, M.; Lapointe, S.P.; Adams, J.; Drysdale, J.A.

    1990-04-01

    This is the twenty-first progress report under the agreement entitled Canadian Seismic Agreement between the US Nuclear Regulatory Commission (NRC) and the Canadian Commercial Corporation. Activities undertaken by the Geophysics Division of the Geological Survey of Canada (GD/GSC) during the period from July 01, 1988 to June 30, 1989 and supported in part by the NRC agreement are described below under four headings; Eastern Canada Telemetred Network and local network developments, Datalab developments, strong motion network developments and earthquake activity. In this time period eastern Canada experienced its largest earthquake in over 50 years. This earthquake, which has been christened the Saguenay earthquake, has provided a wealth of new data pertinent to earthquake engineering studies in eastern North America and is the subject of many continuing studies, which are presently being carried out at GD and elsewhere. 41 refs., 21 figs., 7 tabs

  18. FFTF Authorization Agreement

    International Nuclear Information System (INIS)

    DAUTEL, W.A.

    2000-01-01

    The purpose of the Authorization Agreement is to serve as a mechanism whereby the U.S. Department of Energy, Richland Operations Office (RL) and Fluor Hanford (FH) jointly clarify and agree to key conditions for conducting work safely and efficiently

  19. The Sicomines Agreement

    DEFF Research Database (Denmark)

    Jansson, Johanna

    of the global political economy have shifted, and that China’s position as a foreign policy actor is now consolidated. Continuity, since the 2009 amendment of the agreement, which came about partly as a result of China’s ambitions to take up an active role in the International Monetary Fund (IMF......), was to the benefit of the policy preferences of the IMF and the World Bank. This case thus indicates that since China’s own aspirations are changeable, its emergence as an alternative development partner may not bring about any substantive change of direction for the DRC’s international relations. Furthermore......The Sicomines multibillion minerals-for-infrastructure deal was struck in 2007 between the Democratic Republic of Congo (DRC) and China. The paper investigates the drivers behind the original conception of the agreement, outlines the structure of the contract, analyses the dynamics at play during...

  20. Agreements in Virtual Organizations

    Science.gov (United States)

    Pankowska, Malgorzata

    This chapter is an attempt to explain the important impact that contract theory delivers with respect to the concept of virtual organization. The author believes that not enough research has been conducted in order to transfer theoretical foundations for networking to the phenomena of virtual organizations and open autonomic computing environment to ensure the controllability and management of them. The main research problem of this chapter is to explain the significance of agreements for virtual organizations governance. The first part of this chapter comprises explanations of differences among virtual machines and virtual organizations for further descriptions of the significance of the first ones to the development of the second. Next, the virtual organization development tendencies are presented and problems of IT governance in highly distributed organizational environment are discussed. The last part of this chapter covers analysis of contracts and agreements management for governance in open computing environments.

  1. REAL ESTATE PURCHASE AGREEMENTS

    Directory of Open Access Journals (Sweden)

    Bujorel FLOREA

    2016-12-01

    Full Text Available The study presented herein represents a field with good present and future perspectives, especially because real estate property is not under the incidence of a single normative act regarding the sale-purchase agreement of such goods, and given the fact that there are specific legal provisions with respect to various real estate categories and the localization of such property. The article deals with the sale-purchase agreement of various real estate categories, such as fields, buildings, the correspondent lots, urban area, farm, and forests fields, focusing on some particularities. A special care is attributed to examining the applicable laws with regard to the purchase agreements of field lands, the special conditions to be taken into account, the persons that may act as buyers, including foreigners, those without citizenship, and legal persons of a nationality other than Romanian. Finally, a special concern is given to the formalities required for legally exerting the pre-emptive right and the applicable sanctions in that respect.

  2. IT teenuste sisseostu leping / Kristjan Hiiemaa

    Index Scriptorium Estoniae

    Hiiemaa, Kristjan

    2005-01-01

    Teenustaseme lepingust (service level agreement) ettevõtte kui tellija ja IT tugifirma vahel. Lisad: Mõisteid; IT tugiteenuse osutamise põhilised tegevused; Service level agreement (SLA) - teenustaseme leping. Skeem

  3. Návrh slaďování pracovního a soukromého života ve vybrané organizaci

    OpenAIRE

    Majerčíková, Andrea

    2014-01-01

    Cílem diplomové práce je analyzovat strategii vybrané soukromé organizace v oblasti slaďování pracovního a osobního života a navrhnout opatření ke zlepšení stávajícího stavu. Práce specifikuje pojmy jako konflikt rolí v rámci pracovního a osobního života, gender a politika rovných příležitostí, koncept „flexicurity“ a dále nastiňuje různorodá opatření napomáhající slaďování pracovního a soukromého života. V rámci analýzy bylo využito dotazníkového šetření a rozhovoru s manažerkou vybrané orga...

  4. Metrical Phonology and SLA.

    Science.gov (United States)

    Tice, Bradley S.

    Metrical phonology, a linguistic process of phonological stress assessment and diagrammatic simplification of sentence and word stress, is discussed as it is found in the English language with the intention that it may be used in second language instruction. Stress is defined by its physical and acoustical correlates, and the principles of…

  5. Sociolinguistic Approaches to SLA.

    Science.gov (United States)

    Young, Richard

    1999-01-01

    Discusses two complementary traditions in the study of communication and social context and shows how one researcher's theory of context influences the methodologies he or she adopts. Reviews substantive findings of sociolinguistic researchers in four main areas of second-language acquisition and use: interlanguage variation, cross-cultural…

  6. Pragmatics and SLA.

    Science.gov (United States)

    Kasper, Gabriele; Rose, Kenneth R.

    1999-01-01

    Reviews interlanguage pragmatics studies with a focus on learning in a liberal sense; in addition to studies with an explicit focus on development, investigations that examine the effect of proficiency as an independent variable on pragmatic performance are also considered. Two lines of inquiry are suggested for further research. (Author/VWL)

  7. Prospects for regional safeguards systems - State-level Approach

    International Nuclear Information System (INIS)

    Peixoto, O.J.M.

    2013-01-01

    The increased co-operation with Regional Safeguard's System (RSAC) is a relevant tool for strengthening effectiveness and improving the efficiency of the international safeguard. The new safeguards system that emerges from the application of the Additional Protocol (INFCIRC/540) and the full use of State-level Concept is a challenge and an opportunity for effectively incorporate RSAC into the international safeguards scheme. The challenge is to determine how the co-operation and coordination will be implemented on this new safeguards scheme. This paper presents some discussions and prospects on the issues to be faced by RSAC and IAEA during the implementation of State-level Approach (SLA) using all information available. It is also discussed how different levels of co-operation could be achieved when SLA is applied by IAEA safeguards. The paper is followed by the slides of the presentation. (authors)

  8. International nuclear agreements

    International Nuclear Information System (INIS)

    Miatello, A.; Severino, R.

    1988-01-01

    This multilingual glossary, in the laborious compilation of which the authors have been greatly assisted by a group of professional translators and experts, presents for the first time a substantial number of entries in four languages (English, French, German and Italian), whose terminology and phraseology, all bearing the appropriate normative reference, has been drawn from the official text of the most relevant international agreements on nuclear policy. It is complemented by a thorough critical study on the status of nonproliferation by Lawrence Scheinman and Josef Pilat. Librarians, translators and interpreters as well as scholars and researchers in international law will find this volume a reference tool of specific interest

  9. Agreement in Persian

    Directory of Open Access Journals (Sweden)

    Lofti, Ahmad R.

    2006-01-01

    Full Text Available This article investigates agreement as a number marking mechanism in Persian. The mechanism differs from number marking on nominals in that with an inanimate plural subject, the SG verbal ending signals a collective conceptualization of the experience where the members of the group are considered together as a single unit. The PL ending, on the other hand, signals a distributive conceptualization where the entities are individuated; hence, they are considered to be dispersed over space, or distinct in sort or time. Autonomy - whether the entity is conceived of as governing the course of events or not - seems to underlie the choice between SG and PL.

  10. Diagnosis of regional cerebral blood flow abnormalities using SPECT: agreement between individualized statistical parametric maps and visual inspection by nuclear medicine physicians with different levels of expertise in nuclear neurology

    Energy Technology Data Exchange (ETDEWEB)

    Rocha, Euclides Timoteo da, E-mail: euclidestimoteo@uol.com.b [Fundacao Pio XII, Barretos, SP (Brazil). Hospital de Cancer. Dept. de Medicina Nuclear; Buchpiguel, Carlos Alberto [Hospital do Coracao, Sao Paulo, SP (Brazil). Dept. de Medicina Nuclear; Nitrini, Ricardo [Universidade de Sao Paulo (USP), SP (Brazil). Faculdade de Medicina. Dept. de Neurologia; Tazima, Sergio [Hospital Alemao Oswaldo Cruz (HAOC), Sao Paulo, SP (Brazil). Dept. de Medicina Nuclear; Peres, Stela Verzinhase [Fundacao Pio XII, Barretos, SP (Brazil). Hospital de Cancer; Busatto Filho, Geraldo [Universidade de Sao Paulo (USP), SP (Brazil). Faculdade de Medicina. Div. de Medicina Nuclear

    2009-07-01

    Introduction: visual analysis is widely used to interpret regional cerebral blood flow (rCBF) SPECT images in clinical practice despite its limitations. Automated methods are employed to investigate between-group rCBF differences in research studies but have rarely been explored in individual analyses. Objectives: to compare visual inspection by nuclear physicians with the automated statistical parametric mapping program using a SPECT dataset of patients with neurological disorders and normal control images. Methods: using statistical parametric mapping, 14 SPECT images from patients with various neurological disorders were compared individually with a databank of 32 normal images using a statistical threshold of p<0.05 (corrected for multiple comparisons at the level of individual voxels or clusters). Statistical parametric mapping results were compared with visual analyses by a nuclear physician highly experienced in neurology (A) as well as a nuclear physician with a general background of experience (B) who independently classified images as normal or altered, and determined the location of changes and the severity. Results: of the 32 images of the normal databank, 4 generated maps showing rCBF abnormalities (p<0.05, corrected). Among the 14 images from patients with neurological disorders, 13 showed rCBF alterations. Statistical parametric mapping and physician A completely agreed on 84.37% and 64.28% of cases from the normal databank and neurological disorders, respectively. The agreement between statistical parametric mapping and ratings of physician B were lower (71.18% and 35.71%, respectively). Conclusion: statistical parametric mapping replicated the findings described by the more experienced nuclear physician. This finding suggests that automated methods for individually analyzing rCBF SPECT images may be a valuable resource to complement visual inspection in clinical practice. (author)

  11. Historical mapping reveals causes and temporal patterns of woodland contraction in Austur-Skaftafellssýsla from the 12th century AD to present

    Science.gov (United States)

    Sigurmundsson, Friðþór S.; Gísladóttir, Guðrún; Erlendsson, Egill; Þorbjarnarson, Höskuldur

    2016-04-01

    Land-cover changes in Iceland over the last millennium encompass birch (Betula pubescens) woodland depletion and extensive soil erosion. Yet few studies have focused on spatial change of birch woodland coverage in Iceland over centuries and why and how the woodland depletion took place. The main objectives of this study are: (1) to map the woodland distribution today in Austur-Skaftafellssýsla (3041 km2) in southern Iceland; (2) to map woodland holdings over a period of 900 years from eleventh. AD 1100 to the early 20th century; (3) explain the relative impacts of socio-economic and natural forces on woodland cover over this period. We use a combined approach of historical reconstruction from diverse written archives, GIS techniques and field work. The woodland in Austur-Skaftafellssýsla now covers 73.2 km2 (2.5% of the study area). The woodland holdings, 44 in total, are regularly listed in the church inventories from 1179 to 1570 and are owned by the church. In the first complete register for the district in 1641 the woodland holdings were 73, owned and used by 58 estates, and distributed across Austur-Skaftafellssýsla. All the main patches of woodland remain today, with the exception of four minor woodlands which were exhausted near the end of the 19th century. The woodland was used for firewood and charcoal making as well as grazing during the study period but, crucially, in most cases only one estate had authority over each holding, none were commons. The main driving force behind the development of woodlands was socio-economic, rather than natural, where the form of ownership was fundamental for the fate of the woodland. Harsh climate and volcanism were not directly responsible for woodland depletion. The latter half of the 19th century was the period of greatest woodland loss. This period coincides with considerable expansion in livestock numbers, especially sheep and associated all year around grazing, at a time when the Little Ice Age culminated in

  12. Antibodies to P450IID6, SLA, PDH-E2 and BCKD-E2 in Japanese patients with chronic hepatitis.

    Science.gov (United States)

    Nishioka, M; Morshed, S A; Parveen, S; Kono, K; Matsuoka, H; Manns, M P

    1997-12-01

    Auto-antibodies specific to various antigens in chronic hepatitis (CH) have been detected but their specificities and implications were uncertain. The aims of the present study were to investigate the frequency and the significance of seropositivity of antibodies to P450IID6 or liver/kidney microsome 1 (LKM1), soluble liver antigen (SLA), pyruvate dehydrogenase (PDH) and branched-chain keto acid dehydrogenase (BCKD) in 188 Japanese patients with different forms of CH by western blot or enzyme immunoassay (EIA). Anti-LKM1 was also measured by indirect immunofluorescent test. Anti-P450IID6 was found in 6/188 (3.2%) CH patients including 5/104 (4.8%) with hepatitis C virus (C) infection and 1/12 (8.3%) CH-C patients with antibodies to nuclear and smooth muscle antigens and hypergammaglobulinaemia (> 2.5 g/dL). This patient was the only one diagnosed with autoimmune hepatitis (AIH). All CH patients with hepatitis B (B), hepatitis non-B non-C (NBNC) and AIH were seronegative for anti-LKM1. Antibodies to soluble liver antigen were found in two of 188 (1%) patients, one with AIH and one with CH-B. Anti-BCKD-E2 but not anti-PDH-E2 was found in four patients (2.5%), one with AIH, two with CH-C, and one with NBNC. There was no obvious difference in age, sex ratio and laboratory findings in patients with or without anti-SLA and anti-BCKD-E2. Antibodies to P450IID6, SLA, PDH-E2 and BCKD-E2 are uncommon in adult CH-C, CH-B, CH-NBNC and AIH patients in Japan. Some of these patients positive for auto-antibodies appear to have autoimmune features and might require a careful follow up. The heterogeneity of these antibodies in CH preclude further justification for subtyping of AIH by the presence of the distinct auto-antibodies.

  13. Development of a rapid in vitro protein refolding assay which discriminates between peptide-bound and peptide-free forms of recombinant porcine major histocompatibility class I complex (SLA-I)

    DEFF Research Database (Denmark)

    Oleksiewicz, M.B.; Kristensen, B.; Ladekjaer-Mikkelsen, A.S.

    2002-01-01

    The extracellular domains of swine leukocyte antigen class I (SLA-I, major histocompatibility complex protein class 1) were cloned and sequenced for two haplotypes (114 and H7) which do not share any alleles based on serological typing, and which are the most important in Danish farmed pigs...

  14. Návrh na slaďování pracovního a soukromého života ve vybraném podniku

    OpenAIRE

    Švejdíková, Romana

    2013-01-01

    Diplomová práce se zabývá problematikou slaďování práce a soukromého života ve zvolené organizaci. Detailně popisuje nástroje slaďování práce a soukromého života, srovnává teoretické poznatky se skutečností. Práce identifikuje možnosti a překážky slaďování práce a soukromého života u zaměstnanců zkoumané firmy. Na základě semistrukturovaného rozhovoru a dotazníkového šetření jsou navržena opatření pro optimální slaďování práce a života v organizaci. The diploma thesis deals with the issue ...

  15. VHA Data Sharing Agreement Repository

    Data.gov (United States)

    Department of Veterans Affairs — The VHA Data Sharing Agreement Repository serves as a centralized location to collect and report on agreements that share VHA data with entities outside of VA. It...

  16. Efficacy of standard (SLA) and modified sandblasted and acid-etched (SLActive) dental implants in promoting immediate and/or early occlusal loading protocols: a systematic review of prospective studies.

    Science.gov (United States)

    Chambrone, Leandro; Shibli, Jamil Awad; Mercúrio, Carlos Eduardo; Cardoso, Bruna; Preshaw, Philip M

    2015-04-01

    To assess the survival percentage, clinical and radiographic outcomes of sandblasted and acid-etched (SLA) dental implants and its modified surface (SLActive) in protocols involving immediate and early occlusal loading. MEDLINE, EMBASE and the Cochrane Oral Health Group's Trials Register CENTRAL were searched in duplicate up to, and including, June 2013 to include randomised controlled trials (RCTs) and prospective observational studies of at least 6-month duration published in all languages. Studies limited to patients treated with SLA and/or SLActive implants involving a treatment protocol describing immediate and early loading of these implants were eligible for inclusion. Data on clinical and/or radiographic outcomes following implant placement were considered for inclusion. Of the 447 potentially eligible publications identified by the search strategy, seven RCTs comprising a total of 853 implants (8% titanium plasma-sprayed, 41.5% SLA and 50.5% SLActive) and 12 prospective observational studies including 1394 SLA and 145 SLActive implants were included in this review. According to the Cochrane Collaboration's tool for assessing risk of bias, one of the studies was considered to be at a low risk of bias, whereas the remaining studies were considered to be at an unclear risk. Regarding the observational studies, all of them presented a medium methodological quality based on the Modified Newcastle-Ottawa scale. There were no significant differences reported in the studies in relation to implant loss or clinical parameters between the immediate/early loading and delayed loading protocols. Overall, 95% of SLA and 97% of SLActive implants still survive at the end of follow-up. Despite of the positive findings achieved by the included studies, few RCTs were available for analysis for SLActive implants. Study heterogeneity, scarcity of data and the lack of pooled estimates represent a limitation between studies' comparisons and should be considered when interpreting

  17. Systems management of facilities agreements

    International Nuclear Information System (INIS)

    Blundell, A.

    1998-01-01

    The various types of facilities agreements, the historical obstacles to implementation of agreement management systems and the new opportunities emerging as industry is beginning to make an effort to overcome these obstacles, are reviewed. Barriers to computerized agreement management systems (lack of consistency, lack of standards, scarcity of appropriate computer software) are discussed. Characteristic features of a model facilities agreement management system and the forces driving the changing attitudes towards such systems (e.g. mergers) are also described

  18. Why are Trade Agreements Regional?

    OpenAIRE

    Zissimos, Ben

    2007-01-01

    This paper shows how distance may be used to coordinate on a unique equilibrium in which trade agreements are regional. Trade agreement formation is modeled as coalition formation. In a standard trade model with no distance between countries, a familiar problem of coordination failure arises giving rise to multiple equilibria; any one of many possible trade agreements can form. With distance between countries, and through strategic interaction in tariff setting, regional trade agreements gene...

  19. Sea level anomaly on the Patagonian continental shelf: Trends, annual patterns and geostrophic flows

    Science.gov (United States)

    Saraceno, M.; Piola, A. R.; Strub, P. T.

    2016-01-01

    Abstract We study the annual patterns and linear trend of satellite sea level anomaly (SLA) over the southwest South Atlantic continental shelf (SWACS) between 54ºS and 36ºS. Results show that south of 42°S the thermal steric effect explains nearly 100% of the annual amplitude of the SLA, while north of 42°S it explains less than 60%. This difference is due to the halosteric contribution. The annual wind variability plays a minor role over the whole continental shelf. The temporal linear trend in SLA ranges between 1 and 5 mm/yr (95% confidence level). The largest linear trends are found north of 39°S, at 42°S and at 50°S. We propose that in the northern region the large positive linear trends are associated with local changes in the density field caused by advective effects in response to a southward displacement of the South Atlantic High. The causes of the relative large SLA trends in two southern coastal regions are discussed as a function meridional wind stress and river discharge. Finally, we combined the annual cycle of SLA with the mean dynamic topography to estimate the absolute geostrophic velocities. This approach provides the first comprehensive description of the seasonal component of SWACS circulation based on satellite observations. The general circulation of the SWACS is northeastward with stronger/weaker geostrophic currents in austral summer/winter. At all latitudes, geostrophic velocities are larger (up to 20 cm/s) close to the shelf‐break and decrease toward the coast. This spatio‐temporal pattern is more intense north of 45°S. PMID:27840784

  20. Seismic contracts and agreements

    International Nuclear Information System (INIS)

    Cooper, N.M.; Krause, V.

    1999-01-01

    Some points to consider regarding management of seismic projects within the Canadian petroleum industry were reviewed. Seismic projects involve the integration of many services. This paper focused on user-provider relationships, the project planning process, competitive bid considerations, the types of agreement used for seismic and their implications, and the impact that certain points of control may have on a company: (1) initial estimate versus actual cost, (2) liability, (3) safety and operational performance, and (4) quality of deliverables. The objective is to drive home the point that in today's environment where companies are forming, merging, or collapsing on a weekly basis , chain of command and accountability are issues that can no longer be dealt with casually. Companies must form business relationships with service providers with a full knowledge of benefits and liabilities of the style of relationship they choose. Diligent and proactive management tends to optimize cost, safety and liability issues, all of which have a bearing on the points of control available to the company

  1. Using a split luciferase assay (SLA) to measure the kinetics of cell-cell fusion mediated by herpes simplex virus glycoproteins.

    Science.gov (United States)

    Saw, Wan Ting; Matsuda, Zene; Eisenberg, Roselyn J; Cohen, Gary H; Atanasiu, Doina

    2015-11-15

    Herpes simplex virus (HSV) entry and cell-cell fusion require the envelope proteins gD, gH/gL and gB. We propose that receptor-activated conformational changes to gD activate gH/gL, which then triggers gB (the fusogen) into an active form. To study this dynamic process, we have adapted a dual split protein assay originally developed to study the kinetics of human immunodeficiency virus (HIV) mediated fusion. This assay uses a chimera of split forms of renilla luciferase (RL) and green fluorescent protein (GFP). Effector cells are co-transfected with the glycoproteins and one of the split reporters. Receptor-bearing target cells are transfected with the second reporter. Co-culture results in fusion and restoration of RL, which can convert a membrane permeable substrate into a luminescent product, thereby enabling one to monitor initiation and extent of fusion in live cells in real time. Restoration of GFP can also be studied by fluorescence microscopy. Two sets of split reporters have been developed: the original one allows one to measure fusion kinetics over hours whereas the more recent version was designed to enhance the sensitivity of RL activity allowing one to monitor both initiation and rates of fusion in minutes. Here, we provide a detailed, step-by-step protocol for the optimization of the assay (which we call the SLA for split luciferase assay) using the HSV system. We also show several examples of the power of this assay to examine both the initiation and kinetics of cell-cell fusion by wild type forms of gD, gB, gH/gL of both serotypes of HSV as well as the effect of mutations and antibodies that alter the kinetics of fusion. The SLA can be applied to other viral systems that carry out membrane fusion. Copyright © 2015 Elsevier Inc. All rights reserved.

  2. Guidelines for Reporting Reliability and Agreement Studies (GRRAS) were proposed

    DEFF Research Database (Denmark)

    Kottner, Jan; Audigé, Laurent; Brorson, Stig

    2011-01-01

    Results of reliability and agreement studies are intended to provide information about the amount of error inherent in any diagnosis, score, or measurement. The level of reliability and agreement among users of scales, instruments, or classifications is widely unknown. Therefore, there is a need ......, standards, or guidelines for reporting reliability and agreement in the health care and medical field are lacking. The objective was to develop guidelines for reporting reliability and agreement studies....

  3. Predicting word sense annotation agreement

    DEFF Research Database (Denmark)

    Martinez Alonso, Hector; Johannsen, Anders Trærup; Lopez de Lacalle, Oier

    2015-01-01

    High agreement is a common objective when annotating data for word senses. However, a number of factors make perfect agreement impossible, e.g. the limitations of the sense inventories, the difficulty of the examples or the interpretation preferences of the annotations. Estimating potential...... agreement is thus a relevant task to supplement the evaluation of sense annotations. In this article we propose two methods to predict agreement on word-annotation instances. We experiment with a continuous representation and a three-way discretization of observed agreement. In spite of the difficulty...

  4. Risk-sharing agreements in the EU

    DEFF Research Database (Denmark)

    Traulsen, Janine Marie; Traulsen, Janine Marie; Holm-Larsen, Tove

    2017-01-01

    Abstract Objective Our objectives were to explore the changes in the level of interest in risk-sharing agreements (RSAs) in the EU during the last 15 years and the underlying reasons for these changes. Methods A systematic literature review was conducted using PubMed, Scopus, Web of Science...

  5. Labor Agreement Information System (LAIRS)

    Data.gov (United States)

    Office of Personnel Management — The Labor Agreement Information Retrieval System (LAIRS) is a database containing historical information on labor-management relations in the Federal Government. It...

  6. Sea level anomaly in the North Atlantic and seas around Europe: Long-term variability and response to North Atlantic teleconnection patterns.

    Science.gov (United States)

    Iglesias, Isabel; Lorenzo, M Nieves; Lázaro, Clara; Fernandes, M Joana; Bastos, Luísa

    2017-12-31

    Sea level anomaly (SLA), provided globally by satellite altimetry, is considered a valuable proxy for detecting long-term changes of the global ocean, as well as short-term and annual variations. In this manuscript, monthly sea level anomaly grids for the period 1993-2013 are used to characterise the North Atlantic Ocean variability at inter-annual timescales and its response to the North Atlantic main patterns of atmospheric circulation variability (North Atlantic Oscillation, Eastern Atlantic, Eastern Atlantic/Western Russia, Scandinavian and Polar/Eurasia) and main driven factors as sea level pressure, sea surface temperature and wind fields. SLA variability and long-term trends are analysed for the North Atlantic Ocean and several sub-regions (North, Baltic and Mediterranean and Black seas, Bay of Biscay extended to the west coast of the Iberian Peninsula, and the northern North Atlantic Ocean), depicting the SLA fluctuations at basin and sub-basin scales, aiming at representing the regions of maximum sea level variability. A significant correlation between SLA and the different phases of the teleconnection patterns due to the generated winds, sea level pressure and sea surface temperature anomalies, with a strong variability on temporal and spatial scales, has been identified. Long-term analysis reveals the existence of non-stationary inter-annual SLA fluctuations in terms of the temporal scale. Spectral density analysis has shown the existence of long-period signals in the SLA inter-annual component, with periods of ~10, 5, 4 and 2years, depending on the analysed sub-region. Also, a non-uniform increase in sea level since 1993 is identified for all sub-regions, with trend values between 2.05mm/year, for the Bay of Biscay region, and 3.98mm/year for the Baltic Sea (no GIA correction considered). The obtained results demonstrated a strong link between the atmospheric patterns and SLA, as well as strong long-period fluctuations of this variable in spatial and

  7. International Environmental Agreements: Emissions Trade, Safety Valves and Escape Clauses

    International Nuclear Information System (INIS)

    Karp, Larry; Zhao, Jinhua

    2010-01-01

    We explain how the structure of multi-national or multi-regional environmental agreements affect their chance of success. Trade in emissions permits has ambiguous and in some cases surprising effects on both the equilibrium level of abatement, and on the ability to persuade nations or regions to participate in environmental agreements. An escape clause policy and a safety valve policy have essentially the same properties when membership in environmental agreement is pre-determined, but they create markedly different effects on the incentives to join such an agreement. The two policies lead to a qualitative difference in the leverage that a potential member of the agreement exercises on other members

  8. The myriad challenges of the Paris Agreement

    Science.gov (United States)

    Mitchell, Dann; Allen, Myles R.; Hall, Jim W.; Muller, Benito; Rajamani, Lavanya; Le Quéré, Corinne

    2018-05-01

    The much awaited and intensely negotiated Paris Agreement was adopted on 12 December 2015 by the Parties to the United Nations Framework Convention on Climate Change. The agreement set out a more ambitious long-term temperature goal than many had anticipated, implying more stringent emissions reductions that have been under-explored by the research community. By its very nature a multidisciplinary challenge, filling the knowledge gap requires not only climate scientists, but the whole Earth system science community, as well as economists, engineers, lawyers, philosophers, politicians, emergency planners and others to step up. To kick start cross-disciplinary discussions, the University of Oxford's Environmental Change Institute focused its 25th anniversary conference upon meeting the challenges of the Paris Agreement for science and society. This theme issue consists of review papers, opinion pieces and original research from some of the presentations within that meeting, covering a wide range of issues underpinning the Paris Agreement. This article is part of the theme issue `The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'.

  9. Analysis of swine leukocyte antigen class I gene profiles and porcine endogenous retrovirus viremia level in a transgenic porcine herd inbred for xenotransplantation research

    Science.gov (United States)

    Sypniewski, Daniel; Gałka, Sabina; Sołtysik, Dagna; Loch, Tomasz; Nowak, Ewa; Smorąg, Zdzisław; Bednarek, Ilona

    2018-01-01

    Molecular characterization of swine leukocyte antigen (SLA) genes is important for elucidating the immune responses between swine-donor and human-recipient in xenotransplantation. Examination of associations between alleles of SLA class I genes, type of pig genetic modification, porcine endogenous retrovirus (PERV) viral titer, and PERV subtypes may shed light on the nature of xenograft acceptance or rejection and the safety of xenotransplantation. No significant difference in PERV gag RNA level between transgenic and non-transgenic pigs was noted; likewise, the type of applied transgene had no impact on PERV viremia. SLA-1 gene profile type may correspond with PERV level in blood and thereby influence infectiveness. Screening of pigs should provide selection of animals with low PERV expression and exclusion of specimens with PERV-C in the genome due to possible recombination between A and C subtypes, which may lead to autoinfection. Presence of PERV-C integrated in the genome was detected in 31.25% of specimens, but statistically significant increased viremia in specimens with PERV-C was not observed. There is a need for multidirectional molecular characterization (SLA typing, viremia estimation, and PERV subtype screening) of animals intended for xenotransplantation research in the interest of xeno-recipient safety. PMID:29366300

  10. Federal Facility Agreement progress report

    Energy Technology Data Exchange (ETDEWEB)

    1993-10-01

    The (SRS) Federal Facility Agreement (FFA) was made effective by the US. Environmental Protection Agency Region IV (EPA) on August 16, 1993. To meet the reporting requirements in Section XXV of the Agreement, the FFA Progress Report was developed. The FFA Progress Report is the first of a series of quarterly progress reports to be prepared by the SRS. As such this report describes the information and action taken to September 30, 1993 on the SRS units identified for investigation and remediation in the Agreement. This includes; rubble pits, runoff basins, retention basin, seepage basin, burning pits, H-Area Tank 16, and spill areas.

  11. Federal Facility Agreement progress report

    International Nuclear Information System (INIS)

    1993-10-01

    The (SRS) Federal Facility Agreement (FFA) was made effective by the US. Environmental Protection Agency Region IV (EPA) on August 16, 1993. To meet the reporting requirements in Section XXV of the Agreement, the FFA Progress Report was developed. The FFA Progress Report is the first of a series of quarterly progress reports to be prepared by the SRS. As such this report describes the information and action taken to September 30, 1993 on the SRS units identified for investigation and remediation in the Agreement. This includes; rubble pits, runoff basins, retention basin, seepage basin, burning pits, H-Area Tank 16, and spill areas

  12. Can risk assessment predict suicide in secondary mental healthcare? Findings from the South London and Maudsley NHS Foundation Trust Biomedical Research Centre (SLaM BRC) Case Register.

    Science.gov (United States)

    Lopez-Morinigo, Javier-David; Fernandes, Andrea C; Shetty, Hitesh; Ayesa-Arriola, Rosa; Bari, Ashraful; Stewart, Robert; Dutta, Rina

    2018-06-02

    The predictive value of suicide risk assessment in secondary mental healthcare remains unclear. This study aimed to investigate the extent to which clinical risk assessment ratings can predict suicide among people receiving secondary mental healthcare. Retrospective inception cohort study (n = 13,758) from the South London and Maudsley NHS Foundation Trust (SLaM) (London, UK) linked with national mortality data (n = 81 suicides). Cox regression models assessed survival from the last suicide risk assessment and ROC curves evaluated the performance of risk assessment total scores. Hopelessness (RR = 2.24, 95% CI 1.05-4.80, p = 0.037) and having a significant loss (RR = 1.91, 95% CI 1.03-3.55, p = 0.041) were significantly associated with suicide in the multivariable Cox regression models. However, screening statistics for the best cut-off point (4-5) of the risk assessment total score were: sensitivity 0.65 (95% CI 0.54-0.76), specificity 0.62 (95% CI 0.62-0.63), positive predictive value 0.01 (95% CI 0.01-0.01) and negative predictive value 0.99 (95% CI 0.99-1.00). Although suicide was linked with hopelessness and having a significant loss, risk assessment performed poorly to predict such an uncommon outcome in a large case register of patients receiving secondary mental healthcare.

  13. CryoSat Processing Prototype, how to generate LRM like echoes with SAR data and a Comparison to DUACS SLA over high latitudes

    Science.gov (United States)

    Picot, N.; Boy, F.; Desjonqueres, J.

    2012-12-01

    Like CryoSat, Sentinel3 embarks a doppler altimeter. While there is a long experience of LRM processing, SAR nadir looking data are new and will need in depth validation. Thanks to CryoSat data, the processing of SAR data can be experienced in orbit. The continuity to current altimeter data set (based on LRM acquisitions) has also to be analysed with details. A Cryosat Processing Prototype (C2P) has been developed on CNES side to prepare the CNES SAR ocean retracking study. this prototype allows to process SAR data in order to generate LRM like echoes on ground. Those CryoSat ocean products are routinely processed on CNES side and ingested in the SALP/DUACS system. CryoSat data have proved to be very accurate and very valuable for the ocean user community in the past monthes. For example, it has allowed to largely reduce the impact of the lost of the ESA ENVISAT mission as well as the long non availability of Jason-1 data. This paper will describe the system set up in place early 2012 to feed CryoSat data in the SALP/DUACS products and will present the routine data analysis . C2P CryoSat products will be compared with DUACS SLA estimates and a specific focus will be given over high latitudes knowing that CryoSat is the oinly mission providing sea surface estimates over latitudes above 66 degrees since the lost of the ESA ENVISAT mission.

  14. Slaďování pracovního a osobního života pracovníků

    OpenAIRE

    Šauerová, Martina

    2017-01-01

    Diplomová práce se zabývá tématem slaďování pracovního a osobního života ve vybrané společnosti. Práce je rozdělena do tří části – na teoretickou, analytickou a závěrečnou část. Teoretická část vysvětluje atraktivitu a důležitost tohoto tématu, popisuje jednotlivé nástroje umožňující slazení profesního a osobního života a zároveň poukazuje na možné komplikace jednotlivých přístupů, a to jak z pohledu zaměstnavatele, tak i zaměstnance. Analytická část zkoumá a následně vyhodnocuje současný sta...

  15. Pesticide Worker Safety Cooperative Agreements

    Science.gov (United States)

    The worker safety program cooperative agreements fund projects to educate pesticide applicators, handlers, and farmworkers on working safely with, and around, pesticides. Read about pesticide related grant opportunities and reports from previous grants.

  16. Corporate Integrity Agreement (CIA) documents

    Data.gov (United States)

    U.S. Department of Health & Human Services — OIG negotiates corporate integrity agreements (CIA) with health care providers and other entities as part of the settlement of Federal health care program...

  17. Flexible climate agreements after 2012

    International Nuclear Information System (INIS)

    Vevatne, Jonas

    2004-01-01

    The Kyoto agreement is only a small step towards much stronger and broader commitments and new creativity is needed to further develop a really global climate policy. A flexible approach is necessary to obtain broad participation and substantial reduction of the emissions of greenhouse gases. Flexibility is also important to ease negotiations, to ensure cost-effectiveness and implement a global climate agreement. The US withdrawal from the Kyoto Protocol has rendered the agreement much less effective than the original goal of five per cent reduction of the emission from the industrialized countries. In addition the emissions are increasing much faster in countries that have not committed themselves to the agreement. The agreement runs out in 2012 and should be followed by a new agreement, the negotiations about which are to start up no later than 2005. Attempts by the European Union to begin a discussion about future commitments were very quickly wrecked by the G77 group with strong support from the U.S.A. To formulate a practical climate policy the general goal in the Climate Convention must be interpreted and specified. It may seem impossible to agree upon a long-term goal. But the clarity it provides will be very useful. It will be a guide for short-term goals and a reference for evaluation of success

  18. Rater agreement in lung scintigraphy

    International Nuclear Information System (INIS)

    Christiansen, F.; Andersson, T.; Rydman, H.; Qvarner, N.; Maare, K.

    1996-01-01

    Purpose: The PIOPED criteria in their original and revised forms are today's standards in the interpretation of ventilation-perfusion scintigraphy. When the PIOPED criteria are used by experienced raters with training in consensus interpretation, the agreement rates have been demonstrated to be excellent. Our purpose was to investigate the rates of agreement between 2 experienced raters from different hospitals who had no training in consensus interpretation. Material and Methods: The 2 raters investigated a population of 195 patients. This group included 72 patients from a previous study who had an intermediate probability of pulmonary embolism and who had also been examined by pulmonary angiography. Results: The results demonstrated moderate agreement rates with a kappa value of 0.54 (0.45-0.63 in a 95% confidence interval), which is similar to the kappa value of the PIOPED study but significantly lower than the kappa values of agreement rates among consensus-trained raters. There was a low consistency in the intermediate probability category, with a proportional agreement rate of 0.39 between the experienced raters. Conclusion: The moderate agreement rates between raters from different hospitals make it difficult to compare study populations of a certain scintigraphic category in different hospitals. Further investigations are mandatory for accurate diagnosis when the scintigrams are in the category of intermediate probability of pulmonary embolism. (orig.)

  19. Design of a prospective clinical study on the agreement between the Continuous GlucoseMonitor, a novel device for CONTinuous ASSessment of blood GLUcose levels, and the RAPIDLab® 1265 blood gas analyser: The CONTASSGLU study

    OpenAIRE

    Zimmermann Johannes B; Lehmann Monika; Hofer Stefan; Hüsing Johannes; Alles Catharina; Werner Jens; Stiller Jürgen; Künnecke Wolfgang; Luntz Steffen; Motsch Johann; Weigand Markus A

    2012-01-01

    Abstract Background Although a device is needed to continuously measure blood glucose levels within an intensive care setting, and several large-scale prospective studies have shown that patients might benefit from intensive insulin, potassium, or glucose therapy during intensive care, no devices are currently available to continuously assess blood glucose levels in critically ill patients. We conceived the study described here to evaluate the clinical use of the Continuous Glucose Monitor (C...

  20. Reliability and Agreement in Student Ratings of the Class Environment

    Science.gov (United States)

    Nelson, Peter M.; Christ, Theodore J.

    2016-01-01

    The current study estimated the reliability and agreement of student ratings of the classroom environment obtained using the Responsive Environmental Assessment for Classroom Teaching (REACT; Christ, Nelson, & Demers, 2012; Nelson, Demers, & Christ, 2014). Coefficient alpha, class-level reliability, and class agreement indices were…

  1. Doktor Kot, Doktor Sla - book doctors, plant doctors and the segmentation of the medical market place in Meghalaya, northeast India.

    Science.gov (United States)

    Albert, Sandra; Porter, John; Green, Judith

    2017-10-16

    Despite decades of research on India's plural health care market, the practices of many local health traditions outside the allopathic and codified traditions are under-studied. Drawing on interview and observational data, this paper explores the space in which indigenous traditional Khasi healers in Meghalaya state, northeast India, practice. Khasi indigenous healers describe themselves as doktor sla, plant doctors, to distinguish themselves from doktor kot, or book doctors. This distinction operates as a rhetorical resource, utilised to carve a distinct sphere of expertise in relation to the allopathic sector, and to mark claims for the specifically local appropriateness of traditional practices within a shifting market of state-sponsored provision. Khasi healers are a heterogeneous group who treat a wide variety of conditions, including physical ailments which have no obvious correlates in biomedical systems, and musculoskeletal disorders, with which they have recognised expertise. In addition to claiming these discrete strengths, healers also present themselves as accommodating deficiencies in biomedicine, including inherent generic weaknesses of allopathic care as well as specific local gaps in rural health care provision. Thus, the expertise niches of traditional healers have evolved through their interactions with, and the needs of, the community, but also through managing a shifting boundary with biomedical practitioners, who are explicitly sceptical of their efficacy, but tacitly accepting of the ways in which they manage the gaps in biomedical provision. While codified non-biomedical traditions in India have engaged in universalising professionalising projects, in this setting at least, non-codified practitioners have instead utilised discourses of localism.

  2. MRMC analysis of agreement studies

    Science.gov (United States)

    Gallas, Brandon D.; Anam, Amrita; Chen, Weijie; Wunderlich, Adam; Zhang, Zhiwei

    2016-03-01

    The purpose of this work is to present and evaluate methods based on U-statistics to compare intra- or inter-reader agreement across different imaging modalities. We apply these methods to multi-reader multi-case (MRMC) studies. We measure reader-averaged agreement and estimate its variance accounting for the variability from readers and cases (an MRMC analysis). In our application, pathologists (readers) evaluate patient tissue mounted on glass slides (cases) in two ways. They evaluate the slides on a microscope (reference modality) and they evaluate digital scans of the slides on a computer display (new modality). In the current work, we consider concordance as the agreement measure, but many of the concepts outlined here apply to other agreement measures. Concordance is the probability that two readers rank two cases in the same order. Concordance can be estimated with a U-statistic and thus it has some nice properties: it is unbiased, asymptotically normal, and its variance is given by an explicit formula. Another property of a U-statistic is that it is symmetric in its inputs; it doesn't matter which reader is listed first or which case is listed first, the result is the same. Using this property and a few tricks while building the U-statistic kernel for concordance, we get a mathematically tractable problem and efficient software. Simulations show that our variance and covariance estimates are unbiased.

  3. Between voluntary agreement and legislation

    DEFF Research Database (Denmark)

    Gwozdz, Wencke; Hedegaard, Liselotte; Reisch, Lucia

    2009-01-01

    Voluntary agreements and self-imposed standards are broadly applied to restrict the influence food advertising exerts on children’s food choices – yet their effects are unknown. The current project will therefore investigate whether and, if yes, how the Danish Code for Responsible Food Marketing...

  4. Form 6 - gas balancing agreement

    International Nuclear Information System (INIS)

    Anon.

    1990-01-01

    In 1988, a special Committee of the Rocky Mountain Mineral Law Foundation undertook a project to draft a model from gas balancing agreement. This project was initiated at the request of a number of Foundation members who felt that a model form gas balancing agreement would facilitate the negotiation of operating agreement, since gas balancing issues had become sticking points in the process. The Committee was composed of attorneys representing a wide cross-section of the oil and gas industry including both major and independent oil companies, production companies with interstate pipeline affiliates, and private practitioners. The Committee attempted to address the more controversial issues in gas balancing with optional provisions in the Form. To facilitate the negotiation process, the number of optional provisions was minimized. This form may be used as an Appendix to the new A.A.P.L. Form 610-1989 Model Form Operating Agreement. This book includes provision of this Form which are: Ownership of gas production; Balancing of production accounts; Cash balancing upon depletion; Deliverability tests; Nominations; Statements; Payment of taxes; Operating expenses; Overproducing allowable; Payment of leasehold burdens; Operator's liability; Successors and assigns; Audits; Arbitration; and Operator's fees

  5. Interjudge agreement in videofluoroscopic studies of swallowing.

    Science.gov (United States)

    Wilcox, F; Liss, J M; Siegel, G M

    1996-02-01

    Videofluoroscopic swallowing examinations of 3 patients with dysphagia were reviewed independently by 10 speech-language pathologists. Prior to viewing each video, clinicians were provided with information about the patient's history, the results of a bedside swallow examination, and oral-facial and oral motor control examinations. Clinicians completed a swallowing observation protocol as they viewed each video. They then recommended, from a list of treatment strategies, intervention techniques that would be most appropriate for each patient. Interjudge agreement was calculated by determining how many clinicians observed a given swallowing event or deficit, and how many recommended a given treatment strategy. Results suggest that the level of interjudge agreement for videofluoroscopic evaluations is not encouragingly high.

  6. Flexibility of the Paris Agreement on climate change

    International Nuclear Information System (INIS)

    Lemoine-Schonne, Marion

    2016-01-01

    The Paris agreement lays the foundation for a new international legal regime on climate change. To achieve a universal agreement, many compromises were made, reflected in the international agreement by signs of flexibility. Firstly, at the temporal level, a 'periodic review mechanism of the National Contributions' is set up. Concerning then the means of implementation of the agreement, a new 'mechanism for sustainable development' has been introduced. This mechanism aims to facilitate the implementation of international legal obligations with a logic of cost-effectiveness, reproducing in this sense the market mechanisms of the Kyoto Protocol. At least, at the normative level, flexibility of law is obvious in this agreement, in order to adapt norms to scientific knowledge evolution and political decisions

  7. 7 CFR 1405.7 - Uruguay Round Agreements Act.

    Science.gov (United States)

    2010-01-01

    ... Uruguay Round Agreements Act. In the event the outlays by the United States for domestic support measures... level of domestic support provided by the United States complies with the commitments of the United...

  8. Regulation of gas storages in Europe. The GGPSSO as an agreement in lieu of standard at EU level; Regulierung von Gasspeichern in Europa. Die GGPSSO als eine normersetzende Absprache auf der Ebene der Europaeischen Union

    Energy Technology Data Exchange (ETDEWEB)

    Barbknecht, Klaus-Dieter

    2012-07-01

    Since the enactment of the Gas Directive in 1998 demands have been raised at the European level for the regulation of privately owned installations used for the storage of natural gas (natural gas storages). In the time after 1998 regulatory codes both legislative and non-legislative governing the access of third parties to gas storages evolved at the European and, amongst others, German national level. The present study is dedicated to legal issues arising in this connection. It endeavours to provide an understanding of the GGPSSO, its legal nature and the significance of its regulations in the context of the European natural gas economy. For this purpose it briefly describes the economic and technical environment of this branch of industry as well as the legal framework within which it has evolved in the individual countries of the EU. It takes a close look at the necessity and possibilities of storing natural gas, the macroeconomic significance of this business for Europe, the products that result from the storage of natural gas and the private or public forms of organisation of the relevant corporations. These considerations provide indications regarding the special nature of certain regulations of the GGPSSO, particularly concerning the role of storage operators as administrators of private or public resources and the role of the regulatory authorities involved.

  9. 76 FR 16420 - Notice of Agreements Filed

    Science.gov (United States)

    2011-03-23

    .... Title: Hanjin and WHS Transpacific Vessel Sharing and Slot Allocation Agreement. Parties: Hanjin... amendment would add COSCON as a party to the Agreement and revise the name of the Agreement to Hanjin/WHS...

  10. 78 FR 35270 - Notice of Agreements Filed

    Science.gov (United States)

    2013-06-12

    ... Russia from the geographic scope of the agreement. Agreement No.: 012210. Title: Siem Car Carrier Pacific AS/Eukor Car Carriers Inc. Space Charter Agreement. Parties: Siem Car Carrier Pacific AS and Eukor...

  11. International agreements on nuclear weapons

    International Nuclear Information System (INIS)

    Dombey, N.

    1982-01-01

    The satellite detection of a nuclear explosion in the South Atlantic and Israel's destruction of a research reactor in Iraq make it essential to strengthen existing monitoring and enforcement programs to prevent proliferation. While there was no reliable evidence that either South Africa or Iraq was violating non-proliferation agreements, worst case scenarios can demonstrate to unfriendly countries that South Africa had diverted fuel to test a nuclear weapon and that Iraq is intending to produce weapons-grade plutonium 239. The situation can be improved by formulating better terms and conditions for internationalizing access to materials. Nuclear suppliers need to agree on terms that will assure their customers that contracts for civil programs will be honored. The International Atomic Energy Agency (IAEA), which includes both nuclear suppliers and customers, could achieve stronger agreements that take into account recent technological advances that will expand enrichment and reprocessing activities. 23 references, 1 figure

  12. Energy agreements in Italian foreign policy making

    International Nuclear Information System (INIS)

    Puri Purini, A.

    1992-01-01

    The growing complexity of international relations, involving nations with vastly diverse political and socio-economic frameworks, levels of technology, geography, and environmental policies, are necessitating new Italian government policies which favour multilateral as opposed to conventional bilateral cooperation, especially in that which regards energy agreements. This paper makes this point in examining Italy's vulnerable energy supply and demand situation, the current directions being taken in this nation's foreign policies, and in assessing the key political and socio-economic factors now influencing this nation's world competitiveness in light of pending European unification and the opening up, on a wide scale, of Russian markets to Western nations and Japan

  13. Apology and forgiveness evolve to resolve failures in cooperative agreements.

    Science.gov (United States)

    Martinez-Vaquero, Luis A; Han, The Anh; Pereira, Luís Moniz; Lenaerts, Tom

    2015-06-09

    Making agreements on how to behave has been shown to be an evolutionarily viable strategy in one-shot social dilemmas. However, in many situations agreements aim to establish long-term mutually beneficial interactions. Our analytical and numerical results reveal for the first time under which conditions revenge, apology and forgiveness can evolve and deal with mistakes within ongoing agreements in the context of the Iterated Prisoners Dilemma. We show that, when the agreement fails, participants prefer to take revenge by defecting in the subsisting encounters. Incorporating costly apology and forgiveness reveals that, even when mistakes are frequent, there exists a sincerity threshold for which mistakes will not lead to the destruction of the agreement, inducing even higher levels of cooperation. In short, even when to err is human, revenge, apology and forgiveness are evolutionarily viable strategies which play an important role in inducing cooperation in repeated dilemmas.

  14. 48 CFR 1642.7001 - Management agreement.

    Science.gov (United States)

    2010-10-01

    ... EMPLOYEES HEALTH BENEFITS ACQUISITION REGULATION CONTRACT MANAGEMENT CONTRACT ADMINISTRATION Management Agreement (in Lieu of Novation Agreement) 1642.7001 Management agreement. When it is in the best interest of... day-to-day performance of the contract. Examples of situations in which a Management Agreement may be...

  15. 76 FR 63618 - Notice of Agreements Filed

    Science.gov (United States)

    2011-10-13

    ...; Washington, DC 20036. Synopsis: The amendment removes Korea from the geographic scope of them agreement and... geographic scope of the Agreement to include Taiwan. The parties requested expedited review. Agreement No... and Korea, China, Taiwan, Thailand, Vietnam, and Singapore. Agreement No.: 012138. Title: CSAV/CCNI...

  16. 77 FR 42310 - Notice of Agreements Filed

    Science.gov (United States)

    2012-07-18

    ...; Washington, DC 20006-4007. Synopsis: The agreement would provide for delivery of data to the Port of Oakland... delivery. Agreement No.: 201217. Title: Port of Long Beach Data Services Agreement. Parties: Port of Long... 1100; Washington, DC 20006-4007. Synopsis: The agreement would provide for delivery of data to the Port...

  17. 76 FR 553 - Notice of Agreements Filed

    Science.gov (United States)

    2011-01-05

    ... obsolete language on the duration of Agreement, and changes the name and restates the Agreement. By Order... agreement's governing board and would update the corporate addresses of American President Lines, Ltd.; APL.... as a party to the agreement and updates the corporate addresses of American President Lines, Ltd...

  18. 29 CFR 1908.10 - Cooperative Agreements.

    Science.gov (United States)

    2010-07-01

    ... CONSULTATION AGREEMENTS § 1908.10 Cooperative Agreements. (a) Who may make Agreements. The Assistant Secretary... consultation services to private sector employers. (3) Renegotiation of existing Agreements funded under this part shall be initiated within 30 days of the effective date of these revisions. (c) Contents of...

  19. 48 CFR 2831.109 - Advance agreements.

    Science.gov (United States)

    2010-10-01

    ... proposed agreement. The approved determination will be placed in the contract file. (c) All advance... the agreements. Advance agreements will be signed by both the contractor and the contracting officer, and made a part of the contract file. Copies of executed advance agreements will be distributed to the...

  20. CEC/NRPB Association Agreement

    International Nuclear Information System (INIS)

    DeBeger, D.

    1993-01-01

    In January 1990 the National Radiological Protection Board signed an 'Agreement of Association' with the European Atomic Energy Community, represented by the Commission of the European Communities, to carry out research work in fields covered by the Radiation Protection Research Programme. Under the terms of the contract the Board assumed overall responsibility for the coordination of work involving a number of European organisations, 25 in total and covering 9 countries stretching from Greece to Sweden. The contract provided for funding of research work relating to the assessment of human exposure to natural, medical and occupational radiation and the associated risks. (Author)

  1. SLA Negotiation for VO Formation

    Science.gov (United States)

    Paurobally, Shamimabi

    Resource management systems are changing from localized resources and services towards virtual organizations (VOs) sharing millions of heterogeneous resources across multiple organizations and domains. The virtual organizations and usage models include a variety of owners and consumers with different usage, access policies, cost models, varying loads, requirements and availability. The stakeholders have private utility functions that must be satisfied and possibly maximized.

  2. Analysis of international negotiations and trade agreements

    OpenAIRE

    Górriz Gonzalo, Verónica

    2014-01-01

    This study aims to analyze international trade agreements and negotiations. For that purpose, two agreements made by the United States are chosen to be analyzed. In the first place, the North America Free Trade Agreement (NAFTA) agreement, that was signed by the United States, Canada and Mexico in 1994 in order to create a free trade area. In addition, the Transatlantic Trade and Investment Partnership (TTIP) will be analyze, an agreement that is still being negotiated between the United Stat...

  3. Deriving business processes with service level agreements from early requirements

    NARCIS (Netherlands)

    Frankova, Ganna; Seguran, Magali; Gilcher, Florian; Trabelsi, Slim; Doerflinger, Joerg; Aiello, Marco

    When designing a service-based business process employing loosely coupled services, one is not only interested in guaranteeing a certain flow of work, but also in how the work will be performed. This involves the consideration of non-functional properties which go from execution time and costs, to

  4. Prospective assessment of interobserver agreement for defecography in fecal incontinence.

    Science.gov (United States)

    Dobben, Annette C; Wiersma, Tjeerd G; Janssen, Lucas W M; de Vos, Rien; Terra, Maaike P; Baeten, Cor G; Stoker, Jaap

    2005-11-01

    The primary aim of our study was to determine the interobserver agreement of defecography in diagnosing enterocele, anterior rectocele, intussusception, and anismus in fecal-incontinent patients. The subsidiary aim was to evaluate the influence of level of experience on interpreting defecography. Defecography was performed in 105 consecutive fecal-incontinent patients. Observers were classified by level of experience and their findings were compared with the findings of an expert radiologist. The quality of the expert radiologist's findings was evaluated by an intraobserver agreement procedure. Intraobserver agreement was good to very good except for anismus: incomplete evacuation after 30 sec (kappa, 0.55) and puborectalis impression (kappa, 0.54). Interobserver agreement for enterocele and rectocele was good (kappa, 0.66 for both) and for intussusception, fair (kappa, 0.29). Interobserver agreement for anismus: incomplete evacuation after 30 sec was moderate (kappa, 0.47), and for anismus: puborectalis impression was fair (kappa, 0.24). Agreement in grading of enterocele and rectocele was good (kappa, 0.64 and 0.72, respectively) and for intussusception, fair (kappa, 0.39). Agreement separated by experience level was very good for rectocele (kappa, 0.83) and grading of rectoceles (kappa, 0.83) and moderate for intussusception (kappa, 0.44) at the most experienced level. For enterocele and grading, experience level did not influence the reproducibility. Reproducibility for enterocele, anterior rectocele, and severity grading is good, but for intussusception is fair to moderate. For anismus, the diagnosis of incomplete evacuation after 30 sec is more reproducible than puborectalis impression. The level of experience seems to play a role in diagnosing anterior rectocele and its grading and in diagnosing intussusception.

  5. The Brazil agreement - quo vadis

    International Nuclear Information System (INIS)

    Hossner, R.

    1981-01-01

    After an analysis of the power requirements of Brazil as well as of the options for covering these requirements an important nuclear power program for peaceful uses was decided. It is performed on the basis of a bilateral agreement between Brazil and the Federal Republic of Germany of 1975 by co-operation between the German and the Brazilian industry. German firms make their know-how available as well as experts for a limited period of time, in order to establish during about 20 years an independent Brazilian infrastructure for nuclear power plants and their requirements, and to realize the transfer of technology which at the same time shall transmit impulses to the industrial development of the country. (orig.) [de

  6. Implementation of nuclear reduction agreements

    International Nuclear Information System (INIS)

    Scheinman, L.

    1994-01-01

    The collapse of the Soviet Union not only created a new political environment conductive to arms control and disarmament. It also raised unique and unprecedent non-proliferation problems which bear on the implementation of Start I and even on the Non-proliferation treaty insofar as a failure to rein in Ukraine would create a case of instant proliferation and raise questions about whether somehow Russia as a successor of the Soviet Union failed to meet its Non-proliferation Treaty obligation not to 'assist' any other state in acquiring nuclear weapons. The significance of implementing the agreements concerned with non-proliferation, production of highly enriched uranium outside IAEA safeguards, transparency relevance to the international arena, particularly to nuclear issues are discussed as crucial to progress towards a more stable and secure world order. The importance of the Non-proliferation Treaty extension Conference is underlined

  7. Parent-Child Agreement on Parent-to-Child Maltreatment

    NARCIS (Netherlands)

    Compier-de Block, Laura H.C.G.; Alink, Lenneke R.A.; Linting, Mariëlle; van den Berg, Lisa J.M.; Elzinga, Bernet M.; Voorthuis, Alexandra; Tollenaar, Marieke S.; Bakermans-Kranenburg, Marian J.

    2017-01-01

    Parent-child agreement on child maltreatment was examined in a multigenerational study. Questionnaires on perpetrated and experienced child maltreatment were completed by 138 parent-child pairs. Multi-level analyses were conducted to explore whether parents and children agreed about levels of

  8. 48 CFR 225.403 - World Trade Organization Government Procurement Agreement and Free Trade Agreements.

    Science.gov (United States)

    2010-10-01

    ... Government Procurement Agreement and Free Trade Agreements. 225.403 Section 225.403 Federal Acquisition... FOREIGN ACQUISITION Trade Agreements 225.403 World Trade Organization Government Procurement Agreement and... Government Procurement Agreement, acquire only U.S.-made, qualifying country, or designated country end...

  9. Oil price movements and production agreements

    International Nuclear Information System (INIS)

    Mazraati, M.

    2004-01-01

    The purpose of this technical exercise is to apply econometric modelling to study the relationship between movements in the oil price and compliance by the Organization of the Petroleum Exporting Countries (OPEC) with its self-assigned production agreements, whose purpose is to bring order and stability to the international oil market. After introducing various methods of measurement of compliance, the study applies these methods to monthly data for 1995-2002 for OPEC. It then identifies the method ''over-production as a percentage of ceiling'' as the best-fitting and most accurate criterion for measuring OPEC compliance. The paper then elaborates on intervention analysis, explains the various types of intervention in detail and introduces a number of econometric models to monitor oil price movements resulting from OPEC's intervention in the oil market, along with the extent of its compliance with its agreements. On applying the models to a set of historical monthly data, the study finds that higher oil prices have been achieved when the effective level of compliance lies in the range of 94-99 per cent, and that lower oil prices have been experienced when there is less compliance and more volatility. The paper notes that the achievement of order and stability is the responsibility of all parties in an international market that is inherently volatile. (author)

  10. 23 CFR 635.115 - Agreement estimate.

    Science.gov (United States)

    2010-04-01

    ... CONSTRUCTION AND MAINTENANCE Contract Procedures § 635.115 Agreement estimate. (a) Following the award of contract, an agreement estimate based on the contract unit prices and estimated quantities shall be...

  11. 48 CFR 1542.1203 - Processing agreements.

    Science.gov (United States)

    2010-10-01

    ... MANAGEMENT CONTRACT ADMINISTRATION Novation and Change of Name Agreements 1542.1203 Processing agreements. (a... required documentary evidence. (2) Verify the accuracy of the list of contracts through the Contract...

  12. 76 FR 72408 - Notice of Agreements Filed

    Science.gov (United States)

    2011-11-23

    .... Synopsis: The amendment adds Korea to the geographic scope of the agreement and removes some historical... agreement authorizes the parties to exchange space in the trade between China, Singapore, Vietnam and the U...

  13. 75 FR 42445 - Notice of Agreement Filed

    Science.gov (United States)

    2010-07-21

    ...)-523-5793 or [email protected] . Agreement No.: 012105. Title: SCM Lines Transportes/CCNI Agreement. Parties: Compania Chilena de Navegacion Interoceanica S.A. and SCM Lines Transportes Maritimos Sociedade...

  14. 27 CFR 70.485 - Closing agreements.

    Science.gov (United States)

    2010-04-01

    ... Relating to Alcohol, Tobacco, Firearms, and Explosives Administrative Remedies § 70.485 Closing agreements... disadvantage through consummation of such an agreement. (b) Scope of closing agreement—(1) In general. A...

  15. 78 FR 6325 - Notice of Agreements Filed

    Science.gov (United States)

    2013-01-30

    ... Enterprises LLC. Agreement No.: 012193-000. Title: Siem Car Carrier Pacific AS/Compania Sud Americana de Vapores S.A. Space Charter Agreement. Parties: Siem Car Carrier Pacific AS and Compania Sud Americana de...

  16. 77 FR 71001 - Notice of Agreements Filed

    Science.gov (United States)

    2012-11-28

    .... Agreement No.: 012187-000. Title: Siem Car Carrier Pacific AS/Hoegh Autoliners, Inc. Space Charter Agreement. Parties: Siem Car Carrier Pacific AS and Hoegh Autoliners, Inc. Filing Party: Ashley W. Craig Esq...

  17. 77 FR 16838 - Notice of Agreements Filed

    Science.gov (United States)

    2012-03-22

    ... the U.S. Pacific Coast and the Middle East and Asia. Agreement No.: 012161. Title: Siem Car Carrier Pacific AS/Hyundai Glovis Co., Ltd. Space Charter Agreement. Parties: Siem Car Carrier Pacific AS; Hyundai...

  18. TRIPs Agreement, Important Multilateral WTO Treaty

    Directory of Open Access Journals (Sweden)

    Oana-Maria Florescu

    2006-08-01

    Full Text Available This article aims at presenting the content and the frame of the TRIPs. Agreement. It starts by introducing the reader to the terms that defined the world economical climate by the time of the Agreement negociation. Also, it explains the need of having an Agreement on intellectual property rights with impact on the business world. Moreover, the article reviews the main provisions of the Agreement and the most important intellectual property rights.

  19. Prioritizing Acquisition Pathways in the State Level Concept

    Energy Technology Data Exchange (ETDEWEB)

    Murphy, Chantell L. [Los Alamos National Laboratory; Budlong-Sylvester, Kory [Los Alamos National Laboratory; Pilat, Joseph F. [Los Alamos National Laboratory

    2012-06-27

    The International Atomic Energy Agency's (IAEA) Department of Safeguards has launched a project to further develop the State-level concept for the planning, implementation, and evaluation of safeguards activities. In order to further evolve the safeguards system an emphasis is placed on integrating inspection-related activities and the State evaluation process to draw safeguards conclusions in the most efficient way. The credible implementation of acquisition pathway analysis is central to the success of the IAEA's State-level concept. NNSA's Office of Nuclear Safeguards and Security (NA-241) The Next Generation Safeguards Initiative (NGSI) is sponsoring Los Alamos National Laboratory (LANL) to produce a study that will examine the use of acquisition pathway analysis in: (1) Developing a State-specific, State-level approach (SLA) and Annual Implementation Plan (AIP); (2) Maximizing the utility of the physical model; and (3) Supporting resource allocation decisions through a pathway prioritization. To deal with the challenge of developing an effective and efficient SLA, this study looks at: (1) Prioritizing proliferation pathways based on an assessment of a State's capabilities and assumed proliferation strategies; and (2) Relevant State behavior (e.g., transparency, cooperation, etc.) while avoiding subjective judgments about States themselves. The study makes use of case studies and concrete examples in order to illustrate how new concepts and approaches will be implemented, and how they may differ from more traditional safeguards approaches.

  20. Derogation clauses on wages in sectoral collective agreements in seven European countries

    NARCIS (Netherlands)

    Keune, M.

    2010-01-01

    This report looks at the specific case of company-level agreements deviating from (inter)sectoral wage agreements. The possibility to deviate from pay norms set under intersectoral or sectoral agreements has received growing attention in the policy debate since the present economic and financial

  1. 7 CFR 900.109 - Mediation agreement.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Mediation agreement. 900.109 Section 900.109 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing... Mediation agreement. An agreement arrived at by mediation shall not become effective until approved by the...

  2. 25 CFR 502.5 - Collateral agreement.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Collateral agreement. 502.5 Section 502.5 Indians NATIONAL INDIAN GAMING COMMISSION, DEPARTMENT OF THE INTERIOR GENERAL PROVISIONS DEFINITIONS OF THIS CHAPTER § 502.5 Collateral agreement. Collateral agreement means any contract, whether or not in writing...

  3. 40 CFR 35.3010 - Delegation agreement.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Delegation agreement. 35.3010 Section... STATE AND LOCAL ASSISTANCE Construction Grants Program Delegation to States § 35.3010 Delegation agreement. (a) Before execution of the delegation agreement, the Regional Administrator must determine that...

  4. 23 CFR 140.606 - Project agreements.

    Science.gov (United States)

    2010-04-01

    ... Reimbursement for Bond Issue Projects § 140.606 Project agreements. Project Agreements, Form PR-2, shall be... 23 Highways 1 2010-04-01 2010-04-01 false Project agreements. 140.606 Section 140.606 Highways... projects. 1 The text of FHWA Form PR-2 is found in 23 CFR part 630, subpart C, appendix A. ...

  5. 75 FR 78245 - Notice of Agreements Filed

    Science.gov (United States)

    2010-12-15

    ... Mexico, Panama, Jamaica, Colombia, and the Far East, including China, Hong Kong, and Korea. Agreement No.../CSAV Slot Swap Agreement. Parties: China Shipping Container Lines Co. Ltd., China Shipping Container... trade between United States ports and ports in China and Vietnam. Agreement No.: 201208-001. Title...

  6. 76 FR 67440 - Market Access Agreement

    Science.gov (United States)

    2011-11-01

    ... FARM CREDIT ADMINISTRATION Market Access Agreement AGENCY: Farm Credit Administration. ACTION: Notice of Draft Second Amended and Restated Market Access Agreement; request for comments. SUMMARY: The... Market Access Agreement (the ``Restated MAA'') is entered into among AgFirst Farm Credit Bank, AgriBank...

  7. 75 FR 76729 - Market Access Agreement

    Science.gov (United States)

    2010-12-09

    ... FARM CREDIT ADMINISTRATION Market Access Agreement AGENCY: Farm Credit Administration. ACTION: Notice of approval of the draft amendment to the amended and restated market access agreement. SUMMARY... Credit Bank of Wichita and the Western Farm Credit Bank under Section 7.12 of the Market Access Agreement...

  8. 50 CFR 81.3 - Cooperative Agreement.

    Science.gov (United States)

    2010-10-01

    ...) FINANCIAL ASSISTANCE-WILDLIFE SPORT FISH RESTORATION PROGRAM CONSERVATION OF ENDANGERED AND THREATENED SPECIES OF FISH, WILDLIFE, AND PLANTS-COOPERATION WITH THE STATES § 81.3 Cooperative Agreement. Upon... Project Agreement can be approved for endangered or threatened species projects. A cooperative agreement...

  9. 43 CFR 24.5 - International agreements.

    Science.gov (United States)

    2010-10-01

    ... WILDLIFE POLICY: STATE-FEDERAL RELATIONSHIPS § 24.5 International agreements. (a) International conventions... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false International agreements. 24.5 Section 24... shall be to recommend that the United States negotiate and accede to only those international agreements...

  10. 75 FR 14159 - Notice of Agreements Filed

    Science.gov (United States)

    2010-03-24

    ... parties to exchange slots in the trade between U.S. East Coast ports and ports in Turkey. Agreement No.: 201048-005. Title: Lease and Operating Agreement between Philadelphia Regional Port Authority and... FEDERAL MARITIME COMMISSION Notice of Agreements Filed The Commission hereby gives notice of the...

  11. 22 CFR 120.23 - Distribution agreement.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Distribution agreement. 120.23 Section 120.23... § 120.23 Distribution agreement. An agreement (e.g., a contract) to establish a warehouse or distribution point abroad for defense articles exported from the United States for subsequent distribution to...

  12. Intra-examiner repeatability and agreement in accommodative response measurements.

    Science.gov (United States)

    Antona, B; Sanchez, I; Barrio, A; Barra, F; Gonzalez, E

    2009-11-01

    Clinical measurement of the accommodative response (AR) identifies the focusing plane of a subject with respect to the accommodative target. To establish whether a significant change in AR has occurred, it is important to determine the repeatability of this measurement. This study had two aims: First, to determine the intraexaminer repeatability of AR measurements using four clinical methods: Nott retinoscopy, monocular estimate method (MEM) retinoscopy, binocular crossed cylinder test (BCC) and near autorefractometry. Second, to study the level of agreement between AR measurements obtained with the different methods. The AR of the right eye at one accommodative demand of 2.50 D (40 cm) was measured on two separate occasions in 61 visually normal subjects of mean age 19.7 years (range 18-32 years). The intraexaminer repeatability of the tests, and agreement between them, were estimated by the Bland-Altman method. We determined mean differences (MD) and the 95% limits of agreement [coefficient of repeatability (COR) and coefficient of agreement (COA)]. Nott retinoscopy and BCC offered the best repeatability, showing the lowest MD and narrowest 95% interval of agreement (Nott: -0.10 +/- 0.66 D, BCC: -0.05 +/- 0.75 D). The 95% limits of agreement for the four techniques were similar (COA = +/- 0.92 to +/-1.00 D) yet clinically significant, according to the expected values of the AR. The two dynamic retinoscopy techniques (Nott and MEM) had a better agreement (COA = +/-0.64 D) although this COA must be interpreted in the context of the low MEM repeatability (COR = +/-0.98 D). The best method of assessing AR was Nott retinoscopy. The BCC technique was also repeatable, and both are recommended as suitable methods for clinical use. Despite better agreement between MEM and Nott, agreement among the remaining methods was poor such that their interchangeable use in clinical practice is not recommended.

  13. Inter-Rater Agreement of Auscultation, Palpable Fremitus, and Ventilator Waveform Sawtooth Patterns Between Clinicians.

    Science.gov (United States)

    Berry, Marc P; Martí, Joan-Daniel; Ntoumenopoulos, George

    2016-10-01

    Clinicians often use numerous bedside assessments for secretion retention in participants who are receiving invasive mechanical ventilation. This study aimed to evaluate inter-rater agreement between clinicians when using standard clinical assessments of secretion retention and whether differences in clinician experience influenced inter-rater agreement. Seventy-one mechanically ventilated participants were assessed by a research clinician and by one of 13 ICU clinicians. Each clinician conducted a standardized assessment of lung auscultation, palpation for chest-wall (rhonchal) fremitus, and ventilator inspiratory/expiratory flow-time waveforms for the sawtooth pattern. On the presence of breath sounds, agreement ranged from absolute to moderate in the upper zones and the lower zones, respectively. Kappa values for abnormal and adventitious lung sounds achieved moderate agreement in the upper zones, less than chance agreement to substantial agreement in the middle zones, and moderate agreement to almost perfect agreement in the lower zones. Moderate to almost perfect agreement was established for palpable fremitus in the upper zones, moderate to substantial agreement in the middle zones, and less than chance to moderate agreement in the lower zones. Inter-rater agreement on the presence of expiratory sawtooth pattern identification showed moderate agreement. The level of percentage agreement between the research and ICU clinicians for each respiratory assessment studied did not relate directly to level of clinical experience. Inter-rater agreement for all assessments showed variability between lung regions but maintained reasonable percentage agreement in mechanically ventilated participants. The level of percentage agreement achieved between clinicians did not directly relate to clinical experience for all respiratory assessments. Therefore, these respiratory assessments should not necessarily be viewed in isolation but interpreted within the context of a full

  14. Unwrapping Court-Connected Mediation Agreements

    DEFF Research Database (Denmark)

    Adrian, Lin; Mykland, Solfrid

    2018-01-01

    Court-connected mediated agreements seem to both fulfil and fail the ideal of self-determination in mediation theory. In a study of 134 agreements from court-connected mediation, we found that the majority of agreements contain creative elements and display great variation in the provisions...... and understand them. The judicial language is well known for the drafters of the agreement but not the parties. Thus, court-connected mediation seems to fail aspects of self-determination when it comes to drafting agreements. We draw on new-institutional theory when we explore and explain this apparent...... they contain. These results indicate that the parties play an important role in crafting the substance of their agreements. However, we also found that the wording of the agreements is characterised by legal and bureaucratic language to the extent that people without legal training find it difficult to read...

  15. 48 CFR 25.403 - World Trade Organization Government Procurement Agreement and Free Trade Agreements.

    Science.gov (United States)

    2010-10-01

    ... Government Procurement Agreement and Free Trade Agreements. 25.403 Section 25.403 Federal Acquisition... 25.403 World Trade Organization Government Procurement Agreement and Free Trade Agreements. (a... in 25.402(a)(1). The WTO GPA and FTAs specify procurement procedures designed to ensure fairness (see...

  16. Analyzing rater agreement manifest variable methods

    CERN Document Server

    von Eye, Alexander

    2014-01-01

    Agreement among raters is of great importance in many domains. For example, in medicine, diagnoses are often provided by more than one doctor to make sure the proposed treatment is optimal. In criminal trials, sentencing depends, among other things, on the complete agreement among the jurors. In observational studies, researchers increase reliability by examining discrepant ratings. This book is intended to help researchers statistically examine rater agreement by reviewing four different approaches to the technique.The first approach introduces readers to calculating coefficients that allow one to summarize agreements in a single score. The second approach involves estimating log-linear models that allow one to test specific hypotheses about the structure of a cross-classification of two or more raters'' judgments. The third approach explores cross-classifications or raters'' agreement for indicators of agreement or disagreement, and for indicators of such characteristics as trends. The fourth approach compa...

  17. Seeing Eye to Eye: Predicting Teacher-Student Agreement on Classroom Social Networks

    Science.gov (United States)

    Neal, Jennifer Watling; Cappella, Elise; Wagner, Caroline; Atkins, Marc S.

    2010-01-01

    This study examines the association between classroom characteristics and teacher-student agreement in perceptions of students’ classroom peer networks. Social network, peer nomination, and observational data were collected from a sample of second through fourth grade teachers (N=33) and students (N=669) in 33 classrooms across five high poverty urban schools. Results demonstrate that variation in teacher-student agreement on the structure of students’ peer networks can be explained, in part, by developmental factors and classroom characteristics. Developmental increases in network density partially mediated the positive relationship between grade level and teacher-student agreement. Larger class sizes and higher levels of normative aggressive behavior resulted in lower levels of teacher-student agreement. Teachers’ levels of classroom organization had mixed influences, with behavior management negatively predicting agreement, and productivity positively predicting agreement. These results underscore the importance of the classroom context in shaping teacher and student perceptions of peer networks. PMID:21666768

  18. Safeguards agreements - Their legal and conceptual basis

    International Nuclear Information System (INIS)

    Sanders, B.; Rainer, R.H.

    1977-01-01

    The application of Agency safeguards requires treaty arrangements (Safeguards Agreements) between the State or States concerned and the Agency. The authority for the Agency to conclude such agreements and to implement them is provided for in the Agency's Statute. On the basis of the statutory provisions safeguards principles and procedures have been elaborated. These have been laid down in: The Agency's Safeguards System 1965, extended in 1966 and 1968; and the basis for negotiating safeguards agreements with NNWS pursuant to NPT. The verification of the undertaking by the State concerned not to use items subject to safeguards for purposes contrary to the terms of the agreement is ensured through the application of various safeguards measures. Containment and surveillance measures are expected to play an increasingly important role. One of the specific features of NPT Safeguards Agreements is the establishment of national systems of accounting and control of nuclear material. The majority of the agreements concluded under the non-NPT safeguards agreements implement obligations undertaken under co-operation agreements between States for peaceful uses of nuclear energy. These agreements naturally reflect approaches adopted by the parties, in particular regarding the circumstances under which safeguards should be applied. Thus, the concepts used in the non-NPT safeguards agreements and the Safeguards System document, which is incorporated in these agreements by reference, are in continuous evolution. The Agency's Safeguards System document (INFCIRC/66/Rev.2) continues to be supplemented in practical application and through explicit decision by the Board. The non-NPT safeguards agreements contain, besides technical safeguards provisions from this document, and further provision for notification, inventories and financial matters, legal and political provisions such as sanctions in the case of non-compliance, and privileges and immunities. The paper discusses the

  19. Science and policy characteristics of the Paris Agreement temperature goal

    NARCIS (Netherlands)

    Schleussner, Carl Friedrich; Rogelj, Joeri; Schaeffer, Michiel; Lissner, Tabea; Licker, Rachel; Fischer, Erich M.; Knutti, Reto; Levermann, Anders; Frieler, Katja; Hare, William

    2016-01-01

    The Paris Agreement sets a long-term temperature goal of holding the global average temperature increase to well below 2 °C, and pursuing efforts to limit this to 1.5 °C above pre-industrial levels. Here, we present an overview of science and policy aspects related to this goal and analyse the

  20. Prospective assessment of interobserver agreement for defecography in fecal incontinence

    NARCIS (Netherlands)

    Dobben, Annette C.; Wiersma, Tjeerd G.; Janssen, Lucas W. M.; de Vos, Rien; Terra, Maaike P.; Baeten, Cor G.; Stoker, Jaap

    2005-01-01

    OBJECTIVE. The primary aim of our study was to determine the interobserver agreement of defecography in diagnosing enterocele, anterior rectocele, intussusception, and anismus in fecal-incontinent patients. The subsidiary aim was to evaluate the influence of level of experience on interpreting

  1. Agreement among Classroom Observers of Children's Stylistic Learning Behaviors.

    Science.gov (United States)

    Buchanan, Helen Hamlet; McDermott, Paul A.; Schaefer, Barbara A.

    1998-01-01

    Investigates the interobserver agreement of the Learning Behavior Scale (LBS) by educators (n=16) observing students in special-education classes (n=72). No significant observer effect was found. Moreover, the LBS produced comparable levels of differential learning styles for assessments of individual children. (Author/MKA)

  2. A framework for nuclear agreement and verification

    International Nuclear Information System (INIS)

    Ali, A.

    1991-01-01

    This chapter assesses the prospects for a nuclear agreement between India and Pakistan. The chapter opens with a review of past and present political environments of the two countries. The discussion proceeds to describe the linkage of global arms control agreements, prospects for verification of a Comprehensive Test Ban Treaty, the role of nuclear power in any agreements, the intrusiveness of verification, and possible post-proliferation agreements. Various monitoring and verification technologies are described (mainly satellite oriented). The chapter concludes with an analysis of the likelihood of persuading India and Pakistan to agree to a nonproliferation arrangement

  3. Agreements on emission of greenhouse gases

    International Nuclear Information System (INIS)

    Aulstad, Johan Greger

    2001-01-01

    Agreements on emission of greenhouse gases is one of the instruments used by Norwegian authorities to meet their obligations with respect to the Climate Convention and the Kyoto Protocol. This book discusses the legal issues raised by these agreements. A main topic is how the industrial emissions conform to the Pollution Act. Does the Pollution Act apply to these emissions? What is the impact of the sanction rules in this act on the emissions? The book also deals with the following general questions that arise in connection with the application of public authority: (1) Can the administration grant concessions and permits in the form of agreements? (2) What commitments can be imposed on a private party by the administration by agreement? (3) Should the procedures set down in the Pollution Act and in the Public Administration Act be followed fully when the pollution authorities make agreements? Is the opportunity of the administration to reverse more restricted when they make agreements than when they make one-sided decisions? Although this discussion primarily deals with the emission of greenhouse gases, the reasoning and conclusions are relevant in many other types of agreements in which the public administration is one of the parties. The agreement that regulates the emissions of greenhouse gases from the Norwegian aluminium industry is described in a special section. The book also gives a brief account of how agreements are used in the Danish climate policy

  4. 75 FR 24702 - Notice of Agreements Filed

    Science.gov (United States)

    2010-05-05

    ... Bay International Terminals, Inc. Operating Agreement. Parties: Tampa Bay International Terminals, Inc. and Tampa Port Authority. Filing Parties: Greg Lovelace, Director Cargo & Cruise Marketing; Tampa Port...

  5. The General Agreement on Trade in Services

    Directory of Open Access Journals (Sweden)

    Francina Esteve García

    1995-07-01

    conceived as a progressive process which every Member must assume insofar as their possibilities allow them. The most negative aspects are linked to the non-conclusion of the negotiations in fundamental sectors of foreign trade in services and refer to the maintainance of considerable gaps which impede the observation of the immediate effects of the GATS, such as not having developed certain fundamental parts of the agreement with regard to areas such as public purchases, safeguards and subventions. In this way then, in spite of the limitations and ambiguities analysed in this article, the very existence of the agreement and that of the WTO imply a reaffirmation of the principles of cooperation and progress towards the free market principle at a multilateral level and this (together with other factors such as the development of the information highways will promote the development and the universalization of many other services.

  6. Cooperative monitoring of regional security agreements

    Energy Technology Data Exchange (ETDEWEB)

    Pregenzer, A.L.; Vannoni, M.; Biringer, K.L. [Sandia National Labs., Albuquerque, NM (United States). Nonproliferation and Arms Control Analysis Dept.

    1996-11-01

    This paper argues that cooperative monitoring plays a critical role in the implementation of regional security agreements and confidence building measures. A framework for developing cooperative monitoring options is proposed and several possibilities for relating bilateral and regional monitoring systems to international monitoring systems are discussed. Three bilateral or regional agreements are analyzed briefly to illustrate different possibilities. These examples illustrate that the relationship of regional or bilateral arms control or security agreements to international agreements depends on a number of factors: the overlap of provisions between regional and international agreements; the degree of interest in a regional agreement among the international community; efficiency in implementing the agreement; and numerous political considerations. Given the importance of regional security to the international community, regions should be encouraged to develop their own infrastructure for implementing regional arms control and other security agreements. A regional infrastructure need not preclude participation in an international regime. On the contrary, establishing regional institutions for arms control and nonproliferation could result in more proactive participation of regional parties in developing solutions for regional and international problems, thereby strengthening existing and future international regimes. Possible first steps for strengthening regional infrastructures are identified and potential technical requirements are discussed.

  7. 7 CFR 1424.5 - Agreement process.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Agreement process. 1424.5 Section 1424.5 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS BIOENERGY PROGRAM § 1424.5 Agreement process. (a) To...

  8. Rater Agreement Indexes for Performance Assessment.

    Science.gov (United States)

    Burry-Stock, Judith A.; And Others

    1996-01-01

    It is argued that interrater agreement is a psychometric property which is theoretically different from classic reliability. Formulas are presented to illustrate a set of algebraically equivalent rater agreement indices that are intended to provide educational and psychological researchers with a practical way to establish a measure of rater…

  9. 7 CFR 3021.620 - Cooperative agreement.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) OFFICE OF THE CHIEF FINANCIAL OFFICER, DEPARTMENT OF AGRICULTURE GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 3021.620 Cooperative agreement. Cooperative agreement means an award of financial assistance...

  10. 8 CFR 217.6 - Carrier agreements.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Carrier agreements. 217.6 Section 217.6 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS VISA WAIVER PROGRAM § 217... may notify a carrier of the existence of a basis for termination of a carrier agreement under this...

  11. 48 CFR 16.702 - Basic agreements.

    Science.gov (United States)

    2010-10-01

    ... attachment the required and applicable clauses agreed upon in the basic agreement. A basic agreement is not a... Government to place future contracts or orders with the contractor; or (3) Be used in any manner to restrict... (including reference to each amendment) or by attachment. (2) The contracting officer shall include clauses...

  12. 75 FR 40837 - Notice of Agreements Filed

    Science.gov (United States)

    2010-07-14

    ... filing of the following agreements under the Shipping Act of 1984. Interested parties may submit comments... & Construction Co., Ltd. and Discovery Sun Partnership Space Agreement. Parties: Discovery Sun Partnership and... Discovery Sun Partnership to provide space to Tropical Shipping & Construction Co., Ltd. in the trade...

  13. 77 FR 35680 - Notice of Agreement Filed

    Science.gov (United States)

    2012-06-14

    ... or [email protected] . Agreement No.: 201215. Title: Port of Los Angeles Data Delivery Agreement. Parties: Port of Los Angeles; PierPass Inc.; APM Terminals Pacific; California United Terminals, Inc... data to the Port of Los Angeles by the participating marine terminal operators and PierPass Inc., and...

  14. 76 FR 77998 - Market Access Agreement

    Science.gov (United States)

    2011-12-15

    ... FARM CREDIT ADMINISTRATION Market Access Agreement AGENCY: Farm Credit Administration. ACTION: Notice of approval of the Draft Second Amended and Restated Market Access Agreement. SUMMARY: The Farm Credit Administration (FCA) announces that it has approved the Draft Second Amended and Restated Market...

  15. 7 CFR 1290.8 - Grant agreements.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Grant agreements. 1290.8 Section 1290.8 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... minimum the following: (1) The projects in the approved State plan. (2) Total amount of Federal financial...

  16. 7 CFR 1291.8 - Grant agreements.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Grant agreements. 1291.8 Section 1291.8 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... minimum the following: (1) The projects in the approved State plan. (2) Total amount of Federal financial...

  17. Agreement Attraction in Comprehension: Representations and Processes

    Science.gov (United States)

    Wagers, Matthew W.; Lau, Ellen F.; Phillips, Colin

    2009-01-01

    Much work has demonstrated so-called attraction errors in the production of subject-verb agreement (e.g., "The key to the cabinets are on the table", [Bock, J. K., & Miller, C. A. (1991). "Broken agreement." "Cognitive Psychology, 23", 45-93]), in which a verb erroneously agrees with an intervening noun. Six self-paced reading experiments examined…

  18. 75 FR 69079 - Notice of Agreements Filed

    Science.gov (United States)

    2010-11-10

    ... World Liner Data Agreement. Parties: A.P. Moller-Maersk A/S; CMA CGM S.A.; Compania Chilena de... from ports in Mexico to the U.S. Atlantic ports. Agreement No.: 012110. Title: Trailer Bridge/HLUSA...

  19. 23 CFR 710.307 - Project agreement.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Project agreement. 710.307 Section 710.307 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RIGHT-OF-WAY AND ENVIRONMENT RIGHT-OF-WAY AND REAL ESTATE Project Development § 710.307 Project agreement. As a condition of Federal-aid, the STD...

  20. 5 CFR 1655.12 - Loan agreement.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Loan agreement. 1655.12 Section 1655.12 Administrative Personnel FEDERAL RETIREMENT THRIFT INVESTMENT BOARD LOAN PROGRAM § 1655.12 Loan agreement. (a) Upon determining that a loan application meets the requirements of this part, the TSP record keeper...

  1. 47 CFR 73.1650 - International agreements.

    Science.gov (United States)

    2010-10-01

    ... Agreements for the Broadcasting Service in Region 2: (i) MF Broadcasting 535-1605 kHz, Rio de Janeiro, 1981. (ii) MF Broadcasting 1605-1705 kHz, Rio de Janeiro, 1988. (3) Bi-lateral Agreements between the United...

  2. 48 CFR 18.118 - Trade agreements.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Trade agreements. 18.118 Section 18.118 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACTING METHODS AND CONTRACT TYPES EMERGENCY ACQUISITIONS Available Acquisition Flexibilities 18.118 Trade agreements...

  3. 48 CFR 2131.109 - Advance agreements.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Advance agreements. 2131... PRINCIPLES AND PROCEDURES Applicability 2131.109 Advance agreements. FAR 31.109 is applicable to FEGLI Program contracts, except that precontract costs and nonrecurring costs that exceed $100,000 will not be...

  4. Opening the Black Box of Trade Agreements

    NARCIS (Netherlands)

    Kohl, Tristan; De Lombaerde, Philippe; Saucedo Accosta, Edgar J.

    2017-01-01

    In this chapter the author presents a coding methodology to capture the heterogeneity of trade agreements and to facilitate quantitative analysis departing from qualitative legal differences in trade agreements. The coding is based on whether the provisions of the World Trade Organization (WTO) are

  5. Hubs and spokes in Regional Trade Agreements

    NARCIS (Netherlands)

    Vaal, A. de

    2017-01-01

    In the plethora of Regional Trade Agreements (RTAs) some countries are involved in much more RTAs than others. Furthermore, some countries take in a position as a hub: they have trade agreements with many other countries, while their partner countries are much less involved in RTA relations. Even

  6. Nuclear arbitration: Interpreting non-proliferation agreements

    International Nuclear Information System (INIS)

    Tzeng, Peter

    2015-01-01

    At the core of the nuclear non-proliferation regime lie international agreements. These agreements include, inter alia, the Nuclear Non-proliferation Treaty, nuclear co-operation agreements and nuclear export control agreements.1 States, however, do not always comply with their obligations under these agreements. In response, commentators have proposed various enforcement mechanisms to promote compliance. The inconvenient truth, however, is that states are generally unwilling to consent to enforcement mechanisms concerning issues as critical to national security as nuclear non-proliferation.3 This article suggests an alternative solution to the non-compliance problem: interpretation mechanisms. Although an interpretation mechanism does not have the teeth of an enforcement mechanism, it can induce compliance by providing an authoritative interpretation of a legal obligation. Interpretation mechanisms would help solve the non-compliance problem because, as this article shows, in many cases of alleged non-compliance with a non-proliferation agreement, the fundamental problem has been the lack of an authoritative interpretation of the agreement, not the lack of an enforcement mechanism. Specifically, this article proposes arbitration as the proper interpretation mechanism for non-proliferation agreements. It advocates the establishment of a 'Nuclear Arbitration Centre' as an independent branch of the International Atomic Energy Agency (IAEA), and recommends the gradual introduction of arbitration clauses into the texts of non-proliferation agreements. Section I begins with a discussion of international agreements in general and the importance of interpretation and enforcement mechanisms. Section II then discusses nuclear non-proliferation agreements and their lack of interpretation and enforcement mechanisms. Section III examines seven case studies of alleged non-compliance with non-proliferation agreements in order to show that the main problem in many cases

  7. Design/installation and structural integrity assessment under the Federal Facility Agreement for Bethel Valley Low-Level Waste Collection and Transfer System upgrade for Building 2026 (High Radiation Level Analytical Laboratory) and Building 2099 (Monitoring and Control Station) at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    1994-10-01

    This document presents a Design/Installation and Structural Integrity Assessment for a replacement tank system for portions of the Bethel Valley Low Level Waste (LLW) System, located at the Oak Ridge Reservation, Oak Ridge, Tennessee. This issue of the assessment covers the design aspects of the replacement tank system, and certifies that the design has sufficient structural integrity and is acceptable for the storing or treating of hazardous and/or radioactive substances. The present issue identifies specific activities that must be completed during the fabrication, installation, and testing of the replacement tank system in order to provide assurance that the final installation complies with governing requirements. Portions of the LLW system are several decades old, or older, and do not comply with current environmental protection regulations. Several subsystems of the LLW system have been designated to receive a state-of-the-art replacement and refurbishment. One such subsystem serves Building 2026, the High Radiation Level Analytical Laboratory. This assessment focuses on the scope of work for the Building 2026 replacement LLW Collection and Transfer System, including the provision of a new Monitoring and Control Station (Building 2099) to receive, store, and treat (adjust pH) low level radioactive waste

  8. New Danish Company Act on Shareholders' Agreements

    DEFF Research Database (Denmark)

    Werlauff, Erik

    2011-01-01

    ) organizational rights, (2) financial rights, and (3) rights of disposal, or in plainer words, the corporate (1) power, (2) money, and (3) exit. If a shareholders’ agreement is thoroughly kept and respected by all parties, both in the way they vote at general assemblies and in the way they act when wishing....... The substantial elements in many agreements are clauses on (1) voting for board candidates, (2) voting for dividends of certain proportions, and (3) first refusal rights, respectively, call options for shares in the company. Such clauses are at the very roots of corporate law, dealing with the shareholders’ (1......Section 82 of the Danish Company Act, in force from 1 March 2010, provides that ‘Shareholders’ agreements are neither binding on the company nor on decisions taken by the general assembly’. This has far-reaching consequences for shareholders’ agreements, also for already existing agreements...

  9. [Innovative medicines and market access agreements].

    Science.gov (United States)

    Toumi, M; Zard, J; Duvillard, R; Jommi, C

    2013-09-01

    Market Access Agreements (MAA) for drugs have emerged in response to the need to control health expenditures, as well as to the uncertainty about the true benefit of a drug. It is possible to group MAA in two types of agreements: financial agreements and outcome-based agreements. MAA is a growing trend and is shifting towards conditional access. However, the willingness to use these contracts and their implementation differ across countries, and some are still resistant to put them in place. The MAA challenges to overcome encompass the complexity of the schemes, the administrative burden and the difficulty of evaluating MAA. It is likely that these agreements might experience further evolution in the future to become a faster pathway for therapeutic innovations, at a fair price. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  10. Indices of agreement between neurosurgeons and a radiologist in interpreting tomography scans in an emergency department.

    Science.gov (United States)

    Dourado, Jules Carlos; Pereira, Júlio Leonardo Barbosa; Albuquerque, Lucas Alverne Freitas de; Carvalho, Gervásio Teles Cardos de; Dias, Patrícia; Dias, Laura; Bicalho, Marcos; Magalhães, Pollyana; Dellaretti, Marcos

    2015-08-01

    The power of interpretation in the analysis of cranial computed tomography (CCT) among neurosurgeons and radiologists has rarely been studied. This study aimed to assess the rate of agreement in the interpretation of CCTs between neurosurgeons and a radiologist in an emergency department. 227 CCT were independently analyzed by two neurosurgeons (NS1 and NS2) and a radiologist (RAD). The level of agreement in interpreting the examination was studied. The Kappa values obtained between NS1 and NS2 and RAD were considered nearly perfect and substantial agreement. The highest levels of agreement when evaluating abnormalities were observed in the identification of tumors, hydrocephalus and intracranial hematomas. The worst levels of agreement were observed for leukoaraiosis and reduced brain volume. For diseases in which the emergency room procedure must be determined, agreement in the interpretation of CCTs between the radiologist and neurosurgeons was satisfactory.

  11. Voluntary agreements in the industrial sector in China

    Energy Technology Data Exchange (ETDEWEB)

    Price, Lynn; Worrell, Ernst; Sinton, Jonathan

    2003-03-31

    China faces a significant challenge in the years ahead to continue to provide essential materials and products for a rapidly-growing economy while addressing pressing environmental concerns. China's industrial sector is heavily dependent on the country's abundant, yet polluting, coal resources. While tremendous energy conservation and environmental protection achievements were realized in the industrial sector in the past, there remains a great gulf between the China's level of energy efficiency and that of the advanced countries of the world. Internationally, significant energy efficiency improvement in the industrial sector has been realized in a number of countries using an innovative policy mechanism called Voluntary Agreements. This paper describes international experience with Voluntary Agreements in the industrial sector as well as the development of a pilot program to test the use of such agreements with two steel mills in Shandong Province, China.

  12. Cooperative monitoring of regional security agreements

    Energy Technology Data Exchange (ETDEWEB)

    Pregenzer, A.L.; Vannoni, M.; Biringer, K.L.

    1995-08-01

    This paper argues that cooperative monitoring plays a critical role in the implementation of regional security agreements and confidence building measures. A framework for developing cooperative monitoring options is proposed and several possibilities for relating bilateral and regional monitoring systems to international monitoring systems are discussed. Three bilateral or regional agreements are analyzed briefly to illustrate different possibilities: (1) the demilitarization of the Sinai region between Israel and Egypt in the 1970s; (2) the 1991 quadripartite agreement for monitoring nuclear facilities among Brazil, Argentina, The Argentine-Brazilian Agency for Accounting and Control of Nuclear Materials and the International Atomic Energy Agency; and (3) a bilateral Open Skies agreement between Hungary and Romania in 1991. These examples illustrate that the relationship of regional or bilateral arms control or security agreements to international agreements depends on a number of factors: the overlap of provisions between regional and international agreements; the degree of interest in a regional agreement among the international community; efficiency in implementing the agreement; and numerous political considerations.Given the importance of regional security to the international community, regions should be encouraged to develop their own infrastructure for implementing regional arms control and other security agreements. A regional infrastructure need not preclude participation in an international regime. On the contrary, establishing regional institutions for arms control and nonproliferation could result in more proactive participation of regional parties in developing solutions for regional and international problems, thereby strengthening existing and future international regimes. Possible first steps for strengthening regional infrastructures are identified and potential technical requirements are discussed.

  13. International trade agreements: a threat to tobacco control policy.

    Science.gov (United States)

    Shaffer, E R; Brenner, J E; Houston, T P

    2005-08-01

    International covenants establish a role for governments in ensuring the conditions for human health and wellbeing, which has been recognised as a central human right. International trade agreements, conversely, prioritize the rights of corporations over health and human rights. International trade agreements are threatening existing tobacco control policies and restrict the possibility of implementing new controls. This situation is unrecognised by many tobacco control advocates in signatory nations, especially those in developing countries. Recent agreements on eliminating various trade restrictions, including those on tobacco, have expanded far beyond simply international movement of goods to include internal tobacco distribution regulations and intellectual property rules regulating advertising and labelling. Our analysis shows that to the extent trade agreements protect the tobacco industry, in itself a deadly enterprise, they erode human rights principles and contribute to ill health. The tobacco industry has used trade policy to undermine effective barriers to tobacco importation. Trade negotiations provide an unwarranted opportunity for the tobacco industry to assert its interests without public scrutiny. Trade agreements provide the industry with additional tools to obstruct control policies in both developed and developing countries and at every level. The health community should become involved in reversing these trends, and help promote additional measures to protect public health.

  14. Safeguards agreements - their legal and conceptual basis

    International Nuclear Information System (INIS)

    Sanders, B.; Rainer, R.

    1977-01-01

    The application of Agency safeguards requires treaty arrangements (''Safeguards Agreements'') between the State or States concerned and the Agency. The authority for the Agency to conclude such agreements and to implement them is provided for in the Agency's Statute (Articles II, III A.5 and XII). On the basis of the statutory provisions safeguards principles and procedures have been elaborated. These have been laid down in: (a) The Agency's Safeguards System 1965, extended in 1966 and 1968 (INFCIRC/66/Rev.2); and (b) The basis for negotiating safeguards agreements with NNWS pursuant to NPT (INFCIRC/153). The verification of the undertaking by the State concerned not to use items subject to safeguards for purposes contrary to the terms of the agreement is verified through the application of various safeguards measures (design review, records, reports and inspection). Containment and surveillance measures are expected to play an increasingly important role. NPT Safeguards Agreements foresee as one of their specific features the establishment of national systems of accounting and control of nuclear material. The majority of the agreements concluded under document INFCIRC/66/Rev.2 - i.e. the non-NPT safeguards agreements - implement obligations undertaken under co-operation agreements between States for peaceful uses of nuclear energy. These agreements naturally reflect approaches adopted by the parties, in particular as to the circumstances under which safeguards should be applied. Thus, the concepts used in the non-NPT safeguards agreements and the safeguards system of document INFCIRC/66/Rev.2 which is incorporated in these agreements by reference are in continuous evolution. Document INFCIRC/66/Rev.2 continues to be supplemented in practical application and through explicit decision by the Board. The non-NPT safeguards agreements contain, besides technical safeguards provisions from document INFCIRC/66/Rev.2, and further provision for notification, inventories

  15. Intramodality and intermodality agreement in radiography and computed tomography of equine distal limb fractures.

    Science.gov (United States)

    Crijns, C P; Martens, A; Bergman, H-J; van der Veen, H; Duchateau, L; van Bree, H J J; Gielen, I M V L

    2014-01-01

    Computed tomography (CT) is increasingly accessible in equine referral hospitals. To document the level of agreement within and between radiography and CT in characterising equine distal limb fractures. Retrospective descriptive study. Images from horses that underwent radiographic and CT evaluation for suspected distal limb fractures were reviewed, including 27 horses and 3 negative controls. Using Cohen's kappa and weighted kappa analysis, the level of agreement among 4 observers for a predefined set of diagnostic characteristics for radiography and CT separately and for the level of agreement between the 2 imaging modalities were documented. Both CT and radiography had very good intramodality agreement in identifying fractures, but intermodality agreement was lower. There was good intermodality and intramodality agreement for anatomical localisation and the identification of fracture displacement. Agreement for articular involvement, fracture comminution and fracture fragment number was towards the lower limit of good agreement. There was poor to fair intermodality agreement regarding fracture orientation, fracture width and coalescing cracks; intramodality agreement was higher for CT than for radiography for these features. Further studies, including comparisons with surgical and/or post mortem findings, are required to determine the sensitivity and specificity of CT and radiography in the diagnosis and characterisation of equine distal limb fractures. © 2013 EVJ Ltd.

  16. Design/installation and structural integrity assessment under the Federal Facility Agreement for Bethel Valley low-level waste collection and transfer system upgrade for Building 2026 (High Radiation Level Analytical Laboratory) and Building 2099 (Monitoring and Control Station) at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    1994-11-01

    This document presents a Design/Installation and Structural Integrity Assessment for a replacement tank system for portions of the Bethel Valley Low-Level Waste (LLW) System, located at the Oak Ridge Reservation, Oak Ridge, Tennessee. This issue of the assessment covers the design aspects of the replacement tank system, and certifies that the design has sufficient structural integrity and is acceptable for the storing or treating of hazardous and/or radioactive substances. This document will be reissued at a future date and will then include the assessment of the installation of the replacement tank system. The present issue identifies specific activities that must be completed during the fabrication, installation, and testing of the replacement tank system in order to provide assurance that the final installation complies with governing requirements

  17. 12 CFR 533.5 - Related agreements considered a single agreement.

    Science.gov (United States)

    2010-01-01

    ... DISCLOSURE AND REPORTING OF CRA-RELATED AGREEMENTS § 533.5 Related agreements considered a single agreement... entered into within the same 12-month period; and (3) Are each in fulfillment of the CRA. (b... in fulfillment of the CRA, if the contracts were negotiated in a coordinated fashion and a NGEP is a...

  18. 12 CFR 35.5 - Related agreements considered a single agreement.

    Science.gov (United States)

    2010-01-01

    ... DISCLOSURE AND REPORTING OF CRA-RELATED AGREEMENTS § 35.5 Related agreements considered a single agreement... into within the same 12-month period; and (3) Are each in fulfillment of the CRA. (b) Substantively... the CRA, if the contracts were negotiated in a coordinated fashion and a NGEP is a party to each...

  19. 46 CFR 298.38 - Partnership agreements and limited liability company agreements.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Partnership agreements and limited liability company... liability company agreements. Partnership and limited liability company agreements must be in form and...) Duration of the entity; (b) Adequate partnership or limited liability company funding requirements and...

  20. Client/consultant model services agreement

    CERN Document Server

    International Federation of Consulting Engineers

    2006-01-01

    The terms of the Client Consultant Model Services agreement (The White Book) have been prepared by the Fédération Internationale des Ingénieurs-Conseils (FIDIC) and are recommended for general use for the purposes of pre-investment and feasibility studies, designs and administration of construction and project management, where proposals for such services are invited on an international basis. They are equally adaptable for domestic agreements. - See more at: http://fidic.org/books/clientconsultant-model-services-agreement-4th-ed-2006-white-book#sthash.3Uxy5qT3.dpuf

  1. Mortality of people with chronic fatigue syndrome: a retrospective cohort study in England and Wales from the South London and Maudsley NHS Foundation Trust Biomedical Research Centre (SLaM BRC) Clinical Record Interactive Search (CRIS) Register.

    Science.gov (United States)

    Roberts, Emmert; Wessely, Simon; Chalder, Trudie; Chang, Chin-Kuo; Hotopf, Matthew

    2016-04-16

    Mortality associated with chronic fatigue syndrome is uncertain. We investigated mortality in individuals diagnosed with chronic fatigue syndrome in secondary and tertiary care using data from the South London and Maudsley NHS Foundation Trust Biomedical Research Centre (SLaM BRC) Clinical Record Interactive Search (CRIS) register. We calculated standardised mortality ratios (SMRs) for all-cause, suicide-specific, and cancer-specific mortality for a 7-year observation period using the number of deaths observed in SLaM records compared with age-specific and sex-specific mortality statistics for England and Wales. Study participants were included if they had had contact with the chronic fatigue service (referral, discharge, or case note entry) and received a diagnosis of chronic fatigue syndrome. We identified 2147 cases of chronic fatigue syndrome from CRIS and 17 deaths from Jan 1, 2007, to Dec 31, 2013. 1533 patients were women of whom 11 died, and 614 were men of whom six died. There was no significant difference in age-standardised and sex-standardised mortality ratios (SMRs) for all-cause mortality (SMR 1·14, 95% CI 0·65-1·85; p=0·67) or cancer-specific mortality (1·39, 0·60-2·73; p=0·45) in patients with chronic fatigue syndrome when compared with the general population in England and Wales. This remained the case when deaths from suicide were removed from the analysis. There was a significant increase in suicide-specific mortality (SMR 6·85, 95% CI 2·22-15·98; p=0·002). We did not note increased all-cause mortality in people with chronic fatigue syndrome, but our findings show a substantial increase in mortality from suicide. This highlights the need for clinicians to be aware of the increased risk of completed suicide and to assess suicidality adequately in patients with chronic fatigue syndrome. National Institute for Health Research (NIHR) Biomedical Research Centre at South London and Maudsley NHS Foundation Trust and King's College London

  2. Innovative approaches to structuring the transaction agreement

    International Nuclear Information System (INIS)

    Droppo, D.L.

    1999-01-01

    Several issues regarding the negotiation and structuring of oil and gas property transactions are reviewed. They include: (1) areas of mutual exclusion covenants, (2) use of the short-form term sheet or letter agreement or the longer, more comprehensive formal offer or letter agreement, (3) coping with standard form purchase and sale agreements and property bid packages, (4) allocations of purchase price and their effect on ROFRs, (5) interim operations covenants, including maintaining insurance, contractual relationships and operational integrity, (6) structuring the transaction to facilitate unique financing requirements, (7) making effective use of adjustment clauses, (8) dealing with the cyclicity of commodity prices in the purchase and sale agreement, and (9) using escrow and trust arrangements to meet closure deadlines

  3. 76 FR 30360 - Notice of Agreements Filed

    Science.gov (United States)

    2011-05-25

    ... Agreement. Parties: BBC Chartering & Logistic GMBH & Co. KG; Industrial Maritime Carriers (U.S.A.) Inc.; and..., 1983 Concerning Assessments to Pay ILWU-PMA Employee Benefit Costs, As Amended, Through May 12, 2011...

  4. Benefits and costs of programmatic agreements

    Science.gov (United States)

    2015-02-01

    The performing organization, on behalf of the FHWA Office of Planning, Environment, and Realty, conducted a benefit-cost assessment of programmatic agreements and approaches. The assessment consisted of a case study approach that evaluated three agre...

  5. 78 FR 21364 - Notice of Agreements Filed

    Science.gov (United States)

    2013-04-10

    ... the trade between Vietnam, China (including Hong Kong), Singapore, Spain, and Sri Lanka, on the one... Line Space Charter, Sailing and Cooperative Working Agreement Asia to USEC and PNW-Suez/PNW & Panama...

  6. 76 FR 64944 - Notice of Agreements Filed

    Science.gov (United States)

    2011-10-19

    ..., DC 20006-4007. Synopsis: The amendment would delete Venezuela from the geographic scope of the... slots in the trades between Vietnam, China, and the United States. Agreement No.: 201165-001. Title...

  7. Cooperative Agreement on Pesticide Safety Education

    Science.gov (United States)

    EPA is awarding the eXtension Foundation with a cooperative agreement to establish a system to distribute EPA funds to Pesticide Safety Education Programs (PSEPs) in State Cooperative Extension Services at Land Grant Universities.

  8. Climate Justice and the Paris Agreement

    International Nuclear Information System (INIS)

    Michelot, Agnes

    2016-01-01

    The concept of climate justice has been, for the first time, used in an international agreement - namely, the Paris Agreement. But this recognition of the notion of climate justice is extremely restricted by the very way it is formulated. Preamble of the Paris Agreement 'notes' that climate justice is recognized by 'certain cultures'. Does it mean that particular and concrete stakes of climate justice of the pre-COP21 agenda have been recognized or, on the contrary, that the notion so introduced is actually an empty shell without any genuine legal perspective? Considering this uncertainty, it appears relevant to analyze the Paris Agreement through the claims of various groups and coalitions, which influenced the COP21 negotiations

  9. 7 CFR 1720.9 - Guarantee Agreement.

    Science.gov (United States)

    2010-01-01

    ... bonds. (b) The guaranteed bonds shall refer to the guarantee agreement as controlling the terms of the... the holder of the guaranteed bonds; (11) Claim procedures; (12) What constitutes a failure by the...

  10. 76 FR 2114 - Notice of Agreements Filed

    Science.gov (United States)

    2011-01-12

    ... corporate address of American President Line's corporate address. Agreement No.: 201207-002. Title: Terminal... Strategy to improve the air quality in the PONYNJ community. The parties have requested expedited review...

  11. 77 FR 1689 - Notice of Agreements Filed

    Science.gov (United States)

    2012-01-11

    .... West Coast ports and ports in China and Vietnam. Agreement No.: 012151. Title: Maersk Line/MSC WCCA... Angeles and ports in Mexico and Panama. Dated: January 6, 2012. By Order of the Federal Maritime...

  12. 7 CFR 1599.5 - Agreements.

    Science.gov (United States)

    2010-01-01

    ... designed to ensure that the participant is aware of, and has the capacity to complete, all required... provide donated commodities and FAS-provided funds under a multiyear agreement contingent upon the...

  13. 7 CFR 1499.5 - Agreements.

    Science.gov (United States)

    2010-01-01

    ... designed to ensure that the participant is aware of, and has the capacity to complete, all required... provide donated commodities and CCC-provided funds under a multiyear agreement contingent upon the...

  14. 75 FR 366 - Notice of Agreement Filed

    Science.gov (United States)

    2010-01-05

    ...) 523-5793 or [email protected] . Agreement No.: 012088. Title: Hanjin and WHS Transpacific Vessel... vessel space in the trade between the U.S. ports and ports in Malaysia, Vietnam, Japan, Korea, People's...

  15. 75 FR 6397 - Notice of Agreements Filed

    Science.gov (United States)

    2010-02-09

    ... manage a joint venture limited liability company to provide stevedoring and other services for the... Agreement. Parties: A.P. Moller-Maersk A/S; Maersk Line Limited; and Zim Integrated Shipping Services, Ltd...

  16. Effective construction of environmental protection agreements

    International Nuclear Information System (INIS)

    French, H.F.

    1995-01-01

    By now 170 international agreements are designed to protect air, ground, water and organisms from man-made hazards. Nevertheless are innovative approaches required for global conventions to make the Earth a sanctuary of life for good. (orig.) [de

  17. 49 CFR 212.105 - Agreements.

    Science.gov (United States)

    2010-10-01

    ... TRANSPORTATION STATE SAFETY PARTICIPATION REGULATIONS State/Federal Roles § 212.105 Agreements. (a) Scope. The... facilities, equipment, and operating practices through planned routine compliance inspections for all, or a...

  18. Material Transfer Agreement (MTA) | FNLCR Staging

    Science.gov (United States)

    Material Transfer Agreements are appropriate for exchange of materials into or out of the Frederick National Labfor research or testing purposes, with no collaborative research by parties involving the materials.

  19. 78 FR 35649 - Negotiated Service Agreement

    Science.gov (United States)

    2013-06-13

    ... whether the 2013 Agreement (1) Improves the net financial position of the Postal Service or enhances the... CFR 3015.5 (filed under seal); a public Excel file containing redacted versions of financial...

  20. 78 FR 17234 - Negotiated Service Agreement

    Science.gov (United States)

    2013-03-20

    ... (DFS) Negotiated Service Agreement (NSA) to the market dominant product list.\\1\\ After a [[Page 17235... dominant product list.\\2\\ On March 8, 2013, the Postal Service filed an amendment to the DFS NSA with the...

  1. Power sales contract/energy supply agreements

    International Nuclear Information System (INIS)

    Wallace, R.B.

    1999-01-01

    The factors involved in negotiating power purchase/sales arrangements in Ontario's newly deregulated electricity market are described, and the ways in which they will evolve in the future are predicted. Indications are that the trends that will govern the changes in the electric power industry will be the same as those that existed in the natural gas industry. For this reason, a comparative evaluation of purchase and sale agreements in the two industries was provided. Traditional power purchase arrangements, including requests for proposals, the seller's response, the memorandum of understanding, and the principal terms of a traditional bilateral power purchase agreement were examined. The author predicted that over time, and probably fairly fast in power pool jurisdictions, the traditional power purchase agreement will give way to the concept of energy as a pure commodity and to a standard form of agreement. 1 appendix

  2. The political economy of services trade agreements

    OpenAIRE

    FIORINI, Matteo; LEBRAND, Mathilde

    2016-01-01

    Why do governments sign services trade agreements? This paper focuses on the role of international agreements in the context of trade in services when services are used as intermediate inputs in downstream industries. Compared to goods, services inputs are mostly non-tradable and complementary to other factors of production. We build a theoretical trade policy framework in which firms use foreign investment to contest foreign markets in services sectors and governments can restrict the entry ...

  3. Statement of Agreements Registered With The Agency

    International Nuclear Information System (INIS)

    1960-01-01

    This document contains a statement of all the agreements which had been registered with the Agency by 30 June 1960 under the Regulations for the Registration of Agreements adopted by the Board of Governors in implementation of Article XXII. B of the Statute. In compliance with Article VI of the Regulations this statement is hereby transmitted to all Members of the Agency for their information. A copy is also being sent to the Secretary-General of the United Nations

  4. Statement of Agreements Registered With The Agency

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1960-09-23

    This document contains a statement of all the agreements which had been registered with the Agency by 30 June 1960 under the Regulations for the Registration of Agreements adopted by the Board of Governors in implementation of Article XXII. B of the Statute. In compliance with Article VI of the Regulations this statement is hereby transmitted to all Members of the Agency for their information. A copy is also being sent to the Secretary-General of the United Nations.

  5. The Paris Agreement to Ignore Reality

    OpenAIRE

    Spash, Clive L.

    2016-01-01

    At the 21st session of the Conference of the Parties to the United Nations Framework Convention on Climate Change held in Paris, France, 30 November to 11 December 2015, an Agreement was reached by the international community including 195 countries. The Agreement has been hailed, by participants and the media, as a major turning point for policy in the struggle to address human induced climate change. The following is a short critical commentary in which I briefly explain why ...

  6. Hermann agreement updates IRS guidelines for incentives.

    Science.gov (United States)

    Broccolo, B M; Peregrine, M W

    1995-01-01

    The October 1994 agreement between the Internal Revenue Service (IRS) and Hermann Hospital of Houston, Texas, elucidates current IRS policy on physician recruitment incentives. The IRS distinguishes between the recruiting and the retention of physicians and perimts incentives beyond reasonable compensation in the former but not the latter circumstance. This new agreement, while not legally precedential, nevertheless provides guidance for healthcare organizations seeking safe harbor protection.

  7. The administrative review of concession agreements

    Directory of Open Access Journals (Sweden)

    Fatmira Hajdari

    2014-01-01

    The practice of concessionary agreements in Albania is only in its early steps of development. Furthermore, the legislation that provides for the concession agreements has suffered changes to reflect the international legislation. All of which have led to the case law encountering various issues, which we have only humbly tried to reflect in this paper, while also providing our opinion with regard to addressing them.

  8. Agency Agreements Process Champion Support Intern

    Science.gov (United States)

    Miksa, Ember

    2018-01-01

    This document will provide information on the 2018 Spring semester NIFS Intern who represented the Office of Chief Financial Officer (OCFO) as a Reimbursable Accountant at Kennedy Space Center (KSC). This intern supported the Agency Agreements Process Champions and Team Lead, Susan Kroskey, Sandy Massey and Mecca Murphy, with major initiatives to advance the KSC OCFO's vision of creating and innovating healthy financial management practices that maximize the value of resources entrusted to NASA. These initiatives include, but are not limited to: updating the Agency Guidance and NASA Procedural Guidance 9090.1 Agreements, implementing a new budget structure to be utilized across all centers, submitting a Call Request (CRQ) to enhance non-federal customer reporting, initiating a discussion to incorporate a 3-year funding program for NASA agreements, and undertaking the Office of Inspector General (OIG) Audit. In support of these initiatives, this intern identified technical methods to enhance and reduce the workload of financial processes for reimbursable and non-reimbursable agreements, prepared reports in support of accounting functions, and performed administrative work and miscellaneous technical tasks in support of the OCFO as requested. In conclusion of the internship, the intern will become knowledgeable on reimbursable accounting, reimbursable policy, types of reimbursable agreements, the agreements process, estimated pricing reports, and the roles and responsibilities of the Financial Accounting and Financial Services offices.

  9. The practical outfall of DOE compliance agreements

    International Nuclear Information System (INIS)

    Smith, Leanne; Henrie, Gregory O.

    1992-01-01

    Perhaps the significant regulatory issue facing the Department of Energy (DOE or the Department) is the compliant treatment, storage, and disposal of mixed (radioactive and hazardous) waste. Since DOE'S By-Product Rulemaking in 1987, when the Department acknowledged that the Resource Conservation and Recovery Act (RCRA) applied to the hazardous component of mixed waste, DOE has repeatedly communicated to the Environmental Protection Agency (EPA) and host States that, for mixed waste, DOE is not always able to strictly comply with RCRA standards and that bringing treatment on-line in an expeditious manner is proving very difficult. One of the most effective methods used between DOE and its regulators to address mixed waste management issues is the negotiation of compliance agreements. These agreements establish formal mile stones for bringing DOE sites into compliance. The milestones are not completed without overcoming technical roadblocks and a struggle for funding. However, agreements can establish technically attainable compliance methods that take into account the special problems radiation introduces into RCRA waste management. Compliance agreements help promote a cooperative relationship within the Department and between DOE and its regulators in that all parties have reached agreement and have a stake in attaining the same goal. Where agreements exist, mixed waste compliance efforts can proceed in a situation where all parties have a full understanding of each other's needs and expectations. (author)

  10. Multilateralising TRIPs-Plus Agreements : is the US strategy a failure?

    OpenAIRE

    Morin, Jean-Frédéric

    2009-01-01

    This article examines the current wave of US bilateral agreements with respect to their strategic and political value at the plurilateral level. The US government has explicitly recognized its objective of leveraging bilateral agreements in order to influence regional and multilateral negotiations. Although it may be too early to assess the full effectiveness of this US strategy, the article argues that there are clear signs that the exploitation of bilateral agreements will not independently...

  11. Trade creation and trade diversion in the Canada - United States Free Trade Agreement

    OpenAIRE

    Kimberly A. Clausing

    2001-01-01

    In this paper the changes in trade patterns introduced by the Canada-United States Free Trade Agreement are examined. Variation in the extent of tariff liberalization under the agreement is used to identify the impact of tariff liberalization on the growth of trade both with member countries and non-member countries. Data at the commodity level are used, and the results indicate that the Canada-United States Free Trade Agreement had substantial trade creation effects, with little evidence of ...

  12. Observer agreement in pediatric semiquantitative vertebral fracture diagnosis

    International Nuclear Information System (INIS)

    Siminoski, Kerry; Lentle, Brian; Matzinger, Mary Ann; Shenouda, Nazih; Ward, Leanne M.

    2014-01-01

    The Genant semiquantitative (GSQ) method has been a standard procedure for diagnosis of vertebral fractures in adults but has only recently been shown to be of clinical utility in children. Observer agreement using the GSQ method in this age group has not been described. To evaluate observer agreement on vertebral readability and vertebral fracture diagnosis using the GSQ method in pediatric vertebral morphometry. Spine radiographs of 186 children with acute lymphoblastic leukemia were evaluated independently by three radiologists using the same GSQ methodology as in adults. A subset of 100 radiographs was evaluated on two occasions. An average of 4.7% of vertebrae were unreadable for the three radiologists. Intraobserver Cohen's kappa (κ) on readability ranged from 0.434 to 0.648 at the vertebral level and from 0.416 to 0.611 at the patient level, while interobserver κ for readability had a range of 0.330 to 0.504 at the vertebral level and 0.295 to 0.467 at the patient level. Intraobserver κ for the presence of vertebral fracture had a range of 0.529 to 0.726 at the vertebral level and was 0.528 to 0.767 at the patient level. Interobserver κ for fracture at the vertebral level ranged from 0.455 to 0.548 and from 0.433 to 0.486 at the patient level. Most κ values for both intra- and interobserver agreement in applying the GSQ method to pediatric spine radiographs were in the moderate to substantial range, comparable to the performance of the technique in adult studies. The GSQ method should be considered for use in pediatric research and clinical practice. (orig.)

  13. Observer agreement in pediatric semiquantitative vertebral fracture diagnosis

    Energy Technology Data Exchange (ETDEWEB)

    Siminoski, Kerry [University of Alberta, Department of Radiology and Diagnostic Imaging and Division of Endocrinology and Metabolism, Department of Medicine, Edmonton (Canada); Lentle, Brian [University of British Columbia, Department of Radiology, Vancouver (Canada); BC Children' s Hospital, Department of Radiology, Vancouver (Canada); Matzinger, Mary Ann; Shenouda, Nazih [University of Ottawa, Department of Diagnostic Imaging, Ottawa (Canada); Children' s Hospital of Eastern Ontario, Department of Medical Imaging, Ottawa (Canada); Ward, Leanne M. [University of Ottawa, Department of Pediatrics, Children' s Hospital of Eastern Ontario, Ottawa (Canada); Children' s Hospital of Eastern Ontario, Research Institute, Ottawa (Canada); Collaboration: The Canadian STOPP Consortium

    2014-04-15

    The Genant semiquantitative (GSQ) method has been a standard procedure for diagnosis of vertebral fractures in adults but has only recently been shown to be of clinical utility in children. Observer agreement using the GSQ method in this age group has not been described. To evaluate observer agreement on vertebral readability and vertebral fracture diagnosis using the GSQ method in pediatric vertebral morphometry. Spine radiographs of 186 children with acute lymphoblastic leukemia were evaluated independently by three radiologists using the same GSQ methodology as in adults. A subset of 100 radiographs was evaluated on two occasions. An average of 4.7% of vertebrae were unreadable for the three radiologists. Intraobserver Cohen's kappa (κ) on readability ranged from 0.434 to 0.648 at the vertebral level and from 0.416 to 0.611 at the patient level, while interobserver κ for readability had a range of 0.330 to 0.504 at the vertebral level and 0.295 to 0.467 at the patient level. Intraobserver κ for the presence of vertebral fracture had a range of 0.529 to 0.726 at the vertebral level and was 0.528 to 0.767 at the patient level. Interobserver κ for fracture at the vertebral level ranged from 0.455 to 0.548 and from 0.433 to 0.486 at the patient level. Most κ values for both intra- and interobserver agreement in applying the GSQ method to pediatric spine radiographs were in the moderate to substantial range, comparable to the performance of the technique in adult studies. The GSQ method should be considered for use in pediatric research and clinical practice. (orig.)

  14. THE URUGUAY ROUND AGREEMENT ON AGRICULTURE: AN EVALUATION

    OpenAIRE

    Josling, Timothy E.; Honma, Masayoshi; Lee, Jaeok; MacLaren, Donald; Miner, William M.; Sumner, Daniel A.; Tangermann, Stefan; Valdes, Alberto

    1994-01-01

    Contact for this paper: Laura Bipes/University of Minnesota/Department of Applied Economics/ 1994 Buford Avenue./ St. Paul, MN 55108 USA. From the start, agriculture played a central role in the Uruguay Round of GATT trade negotiations. The Punta del Este Declaration called for a solution to the problems facing agricultural trade through modified trade rules and an agreement to lower protection levels. It was recognized that such an improvement implied negotiations on the national farm polici...

  15. Challenges on preparing unitization agreements in Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Ribeiro, Marilda Rosado de Sa [Universidade do Estado do Rio de Janeiro (UERJ), RJ (Brazil). Faculdade de Direito; Appi, Valeria Tiriba [PETROBRAS, Rio de Janeiro, RJ (Brazil)

    2004-07-01

    As a further stage of the new oil and gas industry in Brazil, various challenges are now faced as an outcome from the O and G projects progress, under the legal framework in force in Brazil. Among all are the first unitization processes, which require a set of steps to be performed in order to achieve a unitization agreement. The paper aims at analyzing the legal, technical and drafting issues to be dealt with in such agreements. After a brief introduction to the general issues at stake in the unitization agreements the study shall encompass a follow up of the sequence of events to be complied with. One could mention the settlement of the criteria onto calculations to serve as guidelines for the negotiations will be based on. That, is usually based on concepts as oil in place, possible O and G in the reservoir, or reserve, which must be agreed by all involved parties. Another possible step to be considered is the creation of a common database, in order to permit fast decisions and optimise E and P operations in the unitized area. Other concerns should be addressed, depending on the amount of O and G to be produced from the unitized area, as: the avoidance of multiple redeterminations aiming to decrease unnecessary expenditures, which could jeopardize the arising project profitability; and the recalculations of Government take, royalties and other incumbencies, to be shared by all involved parties. The paper shall also mention the experience of other countries trying to adopt, where applicable and compatible with the best practices of the oil industry, solutions adopted where tradition in oil and gas is more mature. It should be considered that, in each bidding round the Brazilian Concession Agreement has undergone changes, therefore during an unitization process with two different versions of the Concession Agreement differences between corresponding clauses will have to be faced. Comments should also be made about satellite agreements, encompassing O and G buying

  16. A juridical review of partnership agreements that have the elements of work agreements in Indonesia

    Science.gov (United States)

    Nugroho, A.; Sulistyowati, E.; Hikmah, N.

    2018-01-01

    The Partnership Agreements place the parties in an equal position each party has something as the bargaining power. In some cases, employers prefer to use Partnership Agreements to some individuals to complete the work in their company than Work agreements. Practicality and the absence of obligations to fulfil workers’ rights such as the right to join a Union and to get social security are some of the reasons why employers use the Partnership Agreements. Sometimes Partnership Agreement contains jobs, wages and orders which is the characteristic of work agreement. Based on the fact above, the legal issues arise whether the Partnership Agreement can be considered as the Work Agreement or not and which court is authorized to hear in the event of a dispute. To analyze the above legal issues, this research uses normative legal research type with the statute approach. The technique of legal material analysis uses prescriptive techniques to assess the issue and make recommendations. Based on the analysis, it can be concluded that the Partnership Agreement, of which the elements are: wages and orders can be categorized as Work Agreement and therefore in the event of a dispute, the authorized court is Industrial Relations Court.

  17. Rocky Flats Cleanup Agreement implementation successes and challenges

    International Nuclear Information System (INIS)

    Shelton, D.C.

    1997-01-01

    On July 19, 1996 the US Department of Energy (DOE), State of Colorado (CDPHE), and US Environmental Protection Agency (EPA) entered into an agreement called the Rocky Flats Cleanup Agreement (RFCA) for the cleanup and closure of the Rocky Flats Environmental Technology Site (RFETS or Rocky Flats). Major elements of the agreement include: an Integrated Site-Wide Baseline; up to twelve significant enforceable milestones per year; agreed upon soil and water action levels and standards for cleanup; open space as the likely foreseeable land use; the plutonium and TRU waste removed by 2015; streamlined regulatory process; agreement with the Defense Nuclear Facilities Safety Board (DNFSB) to coordinate activities; and a risk reduction focus. Successful implementation of RFCA requires a substantial effort by the parties to change their way of thinking about RFETS and meet the deliverables and commitments. Substantial progress toward Site closure through the implementation of RFCA has been accomplished in the short time since the signing, yet much remains to be done. Much can be learned from the Rocky Flats experience by other facilities in similar situations

  18. India has got the best possible agreement

    International Nuclear Information System (INIS)

    Sreenivasan, T.P.

    2008-01-01

    The Indians wanted an agreement that will be acceptable to their people and the IAEA wanted to make sure that Uncle Sam was on board. The positions of both are reflected in the balanced document that has been emerged from negotiations. The terms of the proposed inspections have been set without compromising India's sovereign right to manage its nuclear facilities in its best interests in the spirit of the India-US Joint Statement of 2005. The non-proliferationists complain that India got away with too much and the liberationists complain that India gave away too much in the negotiations on the safeguards agreement. The fact that India has nuclear weapons make the inspections less stringent. The expectations is that as India switches to indigenous fuel, the inspections will cease altogether. Much has been said about the reference to the 'corrective measures' that India may take in the event of disruption of supplies. The non- proliferationists and the liberationists find this provision too vague. One windfall that has come in India's way, whether by design or as logical consequence of the new approach, is that the other safeguards agreements, which are applicable to facilities that use imported fuel, will be suspended as long as the new safeguards agreement is in force. The goodwill of the IAEA and its Director General, Mohammed ElBaradei, has played a major role in the accomplish of this agreement.

  19. Agreement and Anti-Agreement in Berber: A Multiple-Feature Inheritance Account

    Directory of Open Access Journals (Sweden)

    Saleem Abdelhady

    2017-10-01

    Full Text Available This study proposes understanding Agreement and Anti-Agreement in Berber from Multi-Feature Inheritance (MFI account following Branigan’s (2016 recent approach. The study aims to bridge a misunderstanding in the literature where it has been assumed that Feature Inheritance (FI can only account for Agreement relations while Anti-agreement relations can only be established by a direct Agree between C as a probe and its goal. Under MFI, it can be argued that FI can account for all aspects of Agreement/Anti-agreement. The study, therefore, presents a unification of the three mechanisms proposed by Ouali (2008. The new approach is tested on data from Berber.

  20. The Texts of The Agency's Agreements with the Republic of Austria. I. Headquarters Agreement. Amendments

    International Nuclear Information System (INIS)

    1970-01-01

    The text of the Agreement between the International Atomic Energy Agency and the Republic of Austria Amending the Agreement of 11 December 1957 Regarding the Headquarters of the International Atomic Energy Agency, which was signed on 4 June 1970, is reproduced in this document for the information of all Members. Members will be informed of the entry into force of the Amendments to the Headquarters Agreement

  1. The Texts of The Agency's Agreements with the Republic of Austria. I. Headquarters Agreement. Amendments

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1970-09-04

    The text of the Agreement between the International Atomic Energy Agency and the Republic of Austria Amending the Agreement of 11 December 1957 Regarding the Headquarters of the International Atomic Energy Agency, which was signed on 4 June 1970, is reproduced in this document for the information of all Members. Members will be informed of the entry into force of the Amendments to the Headquarters Agreement.

  2. Agreement Execution Process Study: CRADAs and NF-WFO Agreements and the Speed of Business

    Energy Technology Data Exchange (ETDEWEB)

    Harrer, Bruce J.; Cejka, Cheryl L.; Macklin, Richard; Miksovic, Ann

    2011-02-01

    This report summarizes the findings of a study on the execution of Cooperative Research and Development Agreements (CRADAs) and Non-Federal Work for Others (NF-WFO) agreements across the U.S. Department of Energy (DOE) laboratory complex. The study provides quantitiative estimates of times required to negotiate and execute these agreements across the DOE complex. It identifies factors impacting on cycle times and describes best practicies used at various laboratories and site offices that reduce cycle times.

  3. Vienna Agreement law 15.986 it approve Vienna Agreement for Protection ozone layer and annex

    International Nuclear Information System (INIS)

    1988-01-01

    The Agreement of Vienna is approved with respect to the protection of the Layer of Ozono, definitions,general duties, research and observations systematics, co-operation in the Spheres Scientific Juridical, and information, Technological Conference, transmission from the protocols, amends, secretariat, adoption to the agreement or the protocols, adoption and amendment of controversy, signing, ratify, approve annexes, solution or vote, relation approving, adhesion, rights between the present agreement and its protocols, entrance in vigor, reserves, retirement, deposition, exchange of information [es

  4. Preliminary investigation into the impacts of assimilating SST and SLA on the surface velocities in a HYCOM of the Agulhas Current

    CSIR Research Space (South Africa)

    Rapeti, T

    2016-10-01

    Full Text Available Data assimilative ocean models play crucial roles in furthering the understanding, and providing forecasts of the Agulhas Current system. This study investigates the impact that assimilating sea surface temperatures (SST) combined with sea level...

  5. Government Procurement Agreements and Telecommunications Business

    Directory of Open Access Journals (Sweden)

    Shin-Won Kang

    2001-12-01

    Full Text Available The opening of the telecommunications market is acceleration due to the world trends of deregulation and privatization under the WTO basic telecommunications agreements. Diversification of services and fast and efficient equipment procurement are becoming necessary conditions for the survival of telecommunications operators. However, the issue here is that telecommunications operators are still bound by the GPA (Government Procurement Agreement based on conditions of monopoly even though the procurement market in Korean is open substantially since 1997. Under such conditions, the continued application of the GPA on telecommunications operator who is highly competitive may result in a negative impact on the telecommunications business and quality of telecommunications service by undermining the autonomy of operator and decreasing operator’s procurement competitiveness. Therefore, this study examines the GPA and the issues raised by the agreement, and also attempts to suggest revisions or means of abrogating the unfair GPA with regards to the development and deregulation of the telecommunications business.

  6. International standards and agreements in food irradiation

    International Nuclear Information System (INIS)

    Cetinkaya, N.

    2004-01-01

    Full text: The economies of both developed and developing countries have been effected by their exported food and agricultural products. Trading policies of food and agricultural products are governed by international agreement as well as national regulations. Trade in food and agricultural commodities may be affected by both principal Agreements within the overall World Trade Organization (WTO) Agreement, though neither specifically refers to irradiation or irradiated foods. The principal Agreements are the Technical Barriers to Trade (TBT) Agreement and the Sanitary and Phyto sanitary (SPS) Agreement. The SPS of the WTO requires governments to harmonize their sanitary and phyto sanitary measures on as wide basis as possible. Related standards, guidelines and recommendations of international standard setting bodies such as the Codex Alimentarius Commission (food safety); the International Plant Protection Convention (IPPC) (plant health and quarantine); and International Office of Epizootic (animal health and zoo noses) should be used in such a harmonization. International Standards for Phyto sanitary Measures (ISPM) no.18 was published under the IPPC by FAO (April 2003, Rome-Italy). ISPM standard provides technical guidance on the specific procedure for the application of ionizing radiation as a phyto sanitary treatment for regulated pests or articles. Moreover, Codex Alimentarius Commission, Codex General Standard for Irradiated Foods (Stand 106-1983) and Recommended International Code of Practice were first published in 1983 and revised in March 2003. Scope of this standard applies to foods processed by ionizing radiation that is used in conjunction with applicable hygienic codes, food standards and transportation codes. It does not apply to foods exposed to doses imparted by measuring instruments used for inspection purposes. Codex documents on Principles and Guidelines for the Import/Export Inspection and Certification of Foods have been prepared to guide

  7. International standards and agreements in food irradiation

    International Nuclear Information System (INIS)

    Cetinkaya, N.

    2004-01-01

    The economies of both developed and developing countries have been effected by their exported food and agricultural products. Trading policies of food and agricultural products are governed by international agreement as well as national regulations. Trade in food and agricultural commodities may be affected by both principal Agreements within the overall World Trade Organization (WTO) Agreement, though neither specifically refers to irradiation or irradiated foods. The principal Agreements are the Technical Barriers to Trade (TBT) Agreement and the Sanitary and Phyto sanitary (SPS) Agreement. The SPS of the WTO requires governments to harmonize their sanitary and phyto sanitary measures on as wide basis as possible. Related standards, guidelines and recommendations of international standard setting bodies such as the Codex Alimentarius Commission (food safety); the International Plant Protection Convention (IPPC) (plant health and quarantine); and International Office of Epizootic (animal health and zoo noses) should be used in such a harmonization. International Standards for Phyto sanitary Measures (ISPM) no.18 was published under the IPPC by FAO (April 2003, Rome-Italy). ISPM standard provides technical guidance on the specific procedure for the application of ionizing radiation as a phyto sanitary treatment for regulated pests or articles. Moreover, Codex Alimentarius Commission, Codex General Standard for Irradiated Foods (Stand 106-1983) and Recommended International Code of Practice were first published in 1983 and revised in March 2003. Scope of this standard applies to foods processed by ionizing radiation that is used in conjunction with applicable hygienic codes, food standards and transportation codes. It does not apply to foods exposed to doses imparted by measuring instruments used for inspection purposes. Codex documents on Principles and Guidelines for the Import/Export Inspection and Certification of Foods have been prepared to guide international

  8. Dividends Provisions in Croatian Double Taxation Agreements

    Directory of Open Access Journals (Sweden)

    Marjeta Tomulić Vehovec

    2007-03-01

    Full Text Available This paper analyzes the provisions concerning dividends in the double taxation avoidance agreements concluded by the Republic of Croatia. Since the base for taxation is necessarily laid down in domestic law, Croatian legislation is examined as well. The author primarily discusses dividends provisions in four agreements signed with Germany, Austria, Switzerland and Slovenia, in addition to analyzing the differences from and similarities with the OECD Model Convention. Second, the paper briefly explains the methods for eliminating double taxation on income from dividends. Finally, it addresses the changes necessary for accession to the European Union.

  9. Iran and Russia signed nuclear agreement

    International Nuclear Information System (INIS)

    Anon

    2006-01-01

    This paper deals with signing of agreement between Russian Federation and Iran about nuclear fuel for nuclear power plant which is constructed. It was happened only three days after Bratislava Summit between presidents G. Bush and V. Putin. Supply of nuclear fuel should be started up to two months and the nuclear power plant with value eight hundred U. S. dollars should be commissioned next year. According to this agreement spent fuel will be sent back to Russia. After this manner it should be prevented the possibility that Iran will use spent fuel for producing of nuclear bomb

  10. AFRA. African Regional Co-operative Agreement

    International Nuclear Information System (INIS)

    1994-04-01

    This publication provides an outline of the African Regional Co-operation Agreement for research, development and training related to nuclear science and technology (AFRA). The agreement stems from an initiative of several African member states of the IAEA to get the agency to help establish an African regional arrangement which would be similar to arrangements which were already in place in the Asian and Latin American regions. Through this regional approach to development, AFRA seeks to accelerate moves toward self-sufficiency in scientific disciplines and appropriate technologies by coordinating intellectual and physical resources and disseminating innovative methods and practices in a cost-effective manner

  11. The Danish agreements on energy efficiency

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-05-01

    CO{sub 2}-taxes for industry were introduced in 1993. In 1996, the taxes were increased and an agreement system for energy-intensive companies was implemented. The main purpose of the agreement system has been to allow energy-intensive industry to pay a reduced tax rate, while at the same time improving energy efficiency. The evaluation of the energy tax system has shown that it has been possible to establish an energy tax that has led to a decrease in CO{sub 2}-emissions, without causing a decrease in the competitiveness of trade, industry and services. The agreement system has been a very important element in that it has improved energy efficiency in companies in which taxes would not have been a realistic instrument. In the case of companies with agreements, several studies suggest improvements of approximately 2.7% of the total energy use per agreement (three years). The three sources (concrete projects, special investigation and energy management) contribute approximately one third of this reduction each. The values for special investigation and energy management must be used with great care. It is also predicted that a continuation of the agreement system by 2005, relative to a situation without agreements, can lead to a decrease in CO{sub 2}-emissions corresponding to 6% of total emissions in industry and trade. Of this reduction, the highest amount is due to energy management. However, maintaining the positive effects of energy management systems will require that companies give higher priority to the managerial part of the system and not only focus on energy accounting. Some companies have argued that it is costly to carry out energy audits and to have to audits verified. Therefore, consideration should be given to possibilities for reducing the administrative costs of entering into an agreement, without this causing reduced efforts to save energy. A means of achieving these objectives could be to reduce the requirement for energy audits and verification

  12. DUACS: Toward High Resolution Sea Level Products

    Science.gov (United States)

    Faugere, Y.; Gerald, D.; Ubelmann, C.; Claire, D.; Pujol, M. I.; Antoine, D.; Desjonqueres, J. D.; Picot, N.

    2016-12-01

    The DUACS system produces, as part of the CNES/SALP project, and the Copernicus Marine Environment and Monitoring Service, high quality multimission altimetry Sea Level products for oceanographic applications, climate forecasting centers, geophysic and biology communities... These products consist in directly usable and easy to manipulate Level 3 (along-track cross-calibrated SLA) and Level 4 products (multiple sensors merged as maps or time series) and are available in global and regional version (Mediterranean Sea, Arctic, European Shelves …).The quality of the products is today limited by the altimeter technology "Low Resolution Mode" (LRM), and the lack of available observations. The launch of 2 new satellites in 2016, Jason-3 and Sentinel-3A, opens new perspectives. Using the global Synthetic Aperture Radar mode (SARM) coverage of S3A and optimizing the LRM altimeter processing (retracking, editing, ...) will allow us to fully exploit the fine-scale content of the altimetric missions. Thanks to this increase of real time altimetry observations we will also be able to improve Level-4 products by combining these new Level-3 products and new mapping methodology, such as dynamic interpolation. Finally these improvements will benefit to downstream products : geostrophic currents, Lagrangian products, eddy atlas… Overcoming all these challenges will provide major upgrades of Sea Level products to better fulfill user needs.

  13. Australian gay men's satisfaction with sexual agreements: the roles of relationship quality, jealousy, and monogamy attitudes.

    Science.gov (United States)

    Hosking, Warwick

    2014-05-01

    This study examined whether relationship quality, dispositional jealousy, and attitudes towards monogamy were associated with gay men's satisfaction with the agreements they have in their relationships about extra-dyadic sex. Three types of sexual agreement were examined: closed (no extra-dyadic sex is allowed), monogamish (extra-dyadic sex is allowed only when both members of the couple are present), and open (extra-dyadic sex is allowed). Results from a 2010 survey of 772 gay men in relationships indicated that sexual agreement satisfaction was positively associated with levels of intimacy and commitment for all three types of sexual agreement, but was differentially associated with sexual satisfaction within the relationship, jealousy, and monogamy attitudes as a function of sexual agreement type. Mean levels of sexual satisfaction, jealousy, and monogamy attitudes also differed between types of agreement. These findings provided preliminary evidence that sexual agreement satisfaction may be influenced by different factors depending on the type of agreement, which has useful implications for professionals with gay male clients experiencing dissatisfaction with their agreement or with their relationship more generally.

  14. Are physicians and patients in agreement? Exploring dyadic concordance.

    Science.gov (United States)

    Coran, Justin J; Koropeckyj-Cox, Tanya; Arnold, Christa L

    2013-10-01

    Dyadic concordance in physician-patient interactions can be defined as the extent of agreement between physicians and patients in their perceptions of the clinical encounter. The current research specifically examined two types of concordance: informational concordance-the extent of agreement in physician and patient responses regarding patient information (education, self-rated health, pain); and interactional concordance-the extent of physician-patient agreement regarding the patient's level of confidence and trust in the physician and the perceived quality of explanations concerning diagnosis and treatment. Using a convenience sample of physicians and patients (N = 50 dyads), a paired survey method was tested, which measured and compared physician and patient reports to identify informational and interactional concordances. Factors potentially related to dyadic concordance were also measured, including demographic characteristics (patient race, gender, age, and education) and clinical factors (whether this was a first visit and physician specialty in family medicine or oncology). The paired survey showed informational discordances, as physicians tended to underestimate patients' pain and overestimate patient education. Interactional discordances included overestimating patients' understanding of diagnosis and treatment explanations and patients' level of confidence and trust. Discordances were linked to patient dissatisfaction with physician listening, having unanswered questions, and feeling the physician had not spent enough time. The paired survey method effectively identified physician-patient discordances that may interfere with effective medical practice; this method may be used in various settings to identify potential areas of improvement in health communication and education.

  15. REGIONAL TRADE AGREEMENTS AND COMPETITION POLICY. CASE STUDY: EU, ASEAN AND NAFTA

    Directory of Open Access Journals (Sweden)

    Fora Andreea-Florina

    2014-07-01

    Full Text Available The large number of regional trade agreements notified to the World Trade Organization (WTO significantly influenced the flow of world trade. By April 2014 there had been notified 583 regional trade agreements to the WTO, of which only 379 are in force. The objective of this paper is to highlight the importance of regional trade agreements in world trade, especially the importance of establishing a regional competition policy in these agreements. The research methodology used is the analysis of legislation governing preferential trade agreements at the level of WTO, the collection and interpretation of statistical data provided by the WTO Secretariat, the case study, namely the study of literature. The paper is structured in three parts. The first part of the paper examines the basic laws based on which regional trade agreements are notified to the WTO and the evolution of these agreements in the period 1958-2013. The second part of the paper is devoted to the analysis of competition policy in regional trade agreements. In this part of the paper, to highlight the patterns of competition policy adopted under these agreements was analyzed by three case studies of competition policy in the EU, ASEAN and NAFTA. The three case studies have revealed that the three preferential trade agreements present regional competition policies with varying degrees of integration. The most complex form of competition policy is found in the European Union, because we are talking about a centralized model of competition policy. ASEAN presents a partially decentralized model, while NAFTA scrolls with a decentralized model of competition policy. The last part of the paper presents the characteristics of the four models of competition policy identified in the preferential trade agreements in force. It should be emphasized that if the initial preferential trade agreements have not put a great emphasis on the rules of competition policy, practice has shown the importance

  16. AO Distal Radius Fracture Classification: Global Perspective on Observer Agreement

    Science.gov (United States)

    Jayakumar, Prakash; Teunis, Teun; Giménez, Beatriz Bravo; Verstreken, Frederik; Di Mascio, Livio; Jupiter, Jesse B.

    2016-01-01

    Background The primary objective of this study was to test interobserver reliability when classifying fractures by consensus by AO types and groups among a large international group of surgeons. Secondarily, we assessed the difference in inter- and intraobserver agreement of the AO classification in relation to geographical location, level of training, and subspecialty. Methods A randomized set of radiographic and computed tomographic images from a consecutive series of 96 distal radius fractures (DRFs), treated between October 2010 and April 2013, was classified using an electronic web-based portal by an invited group of participants on two occasions. Results Interobserver reliability was substantial when classifying AO type A fractures but fair and moderate for type B and C fractures, respectively. No difference was observed by location, except for an apparent difference between participants from India and Australia classifying type B fractures. No statistically significant associations were observed comparing interobserver agreement by level of training and no differences were shown comparing subspecialties. Intra-rater reproducibility was “substantial” for fracture types and “fair” for fracture groups with no difference accounting for location, training level, or specialty. Conclusion Improved definition of reliability and reproducibility of this classification may be achieved using large international groups of raters, empowering decision making on which system to utilize. Level of Evidence Level III PMID:28119795

  17. 78 FR 68444 - Notice of Agreements Filed

    Science.gov (United States)

    2013-11-14

    ...; Oceania Cruises; Paul Gauguin Cruises; Pearl Seas Cruises; Princess Cruises; Regent Seven Seas Cruises.... Agreement No.: 012232. Title: MSC/CMA CGM North West European Continent-US East Coast Service Space Charter... authorizes MSC to charter space to CMA CGM in the trade between the North West European Continent and the U.S...

  18. Emerging practices in community development agreements | Loutit ...

    African Journals Online (AJOL)

    ... capacitated, and prepared to engage in meaningful negotiations regarding how the investor's operations should benefit local stakeholders. This article reviews existing research on CDAs, as well as available agreements from the extractive sector in Australia, Canada, Laos, Papua New Guinea, Ghana and Greenland.

  19. 75 FR 14245 - Voluntary Intermodal Sealift Agreement

    Science.gov (United States)

    2010-03-24

    ... measures so that Contingency planning information can be shared with Participants to enable them to plan... Intermodal Sealift Agreement (VISA) Table of Contents Abbreviations Definitions Preface I. Purpose II... of VISA Contingency Provisions A. General B. Notification of Activation C. Voluntary Capacity D...

  20. Regulations for the Registration of Agreements

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1959-11-06

    The Regulations for the Registration of Agreements adopted by the Board of Governors on 25 April 1958 in implementation of Article XXII.B of the Statute of the Agency are reproduced in this document for the information of all Members.

  1. 7 CFR 1415.11 - Restoration agreements.

    Science.gov (United States)

    2010-01-01

    ... functions and values of the grassland to meet both USDA and the participant's objective and the purposes of... restoration agreement at that time to improve the functions and values with USDA approval and when funds are... grassland resources are adequate to meet the participant's objectives and the purposes of the program, or if...

  2. Regulatory domain limits of unilateral agreements

    International Nuclear Information System (INIS)

    Grenier, M.

    1986-06-01

    Simple in its principle unilateral agreement application in practice arise nevertheless some problems, not only for international transport when interpretation is somewhat different between countries, but also in domestic transport. This report tries to determine what being misapprehension and to propose a way to solve misapprehension which does not facilitate radioactive materials transport [fr

  3. Unfolding the phenomenon of interrater agreement

    DEFF Research Database (Denmark)

    Slaug, Björn; Schilling, Oliver; Helle, Tina

    2012-01-01

    accounted for 6-11%, the items for 32-33%, and the residual for 57-60% of the variation. Multilevel regression analysis showed barrier prevalence and raters' familiarity with using standardized instruments to have the strongest impact on agreement. CONCLUSION: Supported by a conceptual analysis, we propose...

  4. 75 FR 31438 - Notice of Agreements Filed

    Science.gov (United States)

    2010-06-03

    ..., Panama, Colombia, Venezuela, Brazil, Argentina, Uruguay, Paraguay, Chile, and Peru. Dated: May 28, 2010... Berhad; Mitsui O.S.K. Lines Ltd.; Nippon Yusen Kaisha; Safmarine Container Lines N.V.; Norasia Container... ports in Asia. Agreement No.: 012097. Title: Mitsui O.S.K. Lines/Kawasaki Kisen Kaisha U.S. Atlantic...

  5. 75 FR 19402 - Notice of Agreements Filed

    Science.gov (United States)

    2010-04-14

    ... cargo from ports on the U.S. east coast to ports in Chile, Ecuador, Peru, Panama, Colombia, and... Joint Service Agreement and Mitsui O.S.K. Lines, Ltd. Filing Party: Robert B. Yoshitomi, Esq., Nixon... Co. Pte. Ltd.; Hyundai Merchant Marine; and Mitsui O.S.K. Lines, Ltd. Filing Party: Robert Yoshitomi...

  6. 77 FR 58140 - Notice of Agreements Filed

    Science.gov (United States)

    2012-09-19

    ... Colombia, Ecuador, Peru, and Chile, on the other hand. Agreement No.: 201112-004. Title: Lease and... O'Connor; 1627 I Street NW., Suite 1100; Washington, DC 20006-4007. Synopsis: The amendment corrects... R. Rohde, Esq.; Cozen O'Connor; 1627 I Street NW., Suite 1100; Washington, DC 20006-4007. Synopsis...

  7. 50 CFR 81.6 - Project Agreement.

    Science.gov (United States)

    2010-10-01

    ...) FINANCIAL ASSISTANCE-WILDLIFE SPORT FISH RESTORATION PROGRAM CONSERVATION OF ENDANGERED AND THREATENED..., the period of time necessary to accomplish the objectives, and both the Federal and State costs. All... Office of Management and Budget Circular No. A-95 (as revised). (d) The Project Agreement will follow...

  8. 76 FR 17653 - Notice of Agreements Filed

    Science.gov (United States)

    2011-03-30

    ...: CSCL/ELJSA Vessel Sharing Agreement-Asia and Mexico, US East Coast Service. Parties: China Shipping Container Lines Co., Ltd.; China Shipping Container Lines (Hong Kong) Co., Ltd.; and Evergreen Lines Joint... coordinate sailings in the trades between Japan, China, and the Pacific coast of the United States. By Order...

  9. 31 CFR 540.305 - HEU Agreements.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false HEU Agreements. 540.305 Section 540.305 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... Federation for Atomic Energy Concerning the Transfer of Source Material to the Russian Federation signed at...

  10. 77 FR 13604 - Notice of Agreements Filed

    Science.gov (United States)

    2012-03-07

    ...: Maersk Line/New World Alliance Slot Exchange Agreement. Parties: A.P. Moller-Maersk A/S trading under the... exchange space on their respective services in the trade between the U.S. Atlantic Coast and ports in Panama, the United Kingdom, Germany, the Netherlands and Mediterranean ports in France, Italy and Spain...

  11. 78 FR 53455 - Notice of Agreements Filed

    Science.gov (United States)

    2013-08-29

    .... Parties: Zim Integrated Shipping Services, Ltd.; China Shipping Container Line Co., Ltd. and China Shipping Container Lines (Hong Kong) Co., Ltd. (acting as a single party). Filing Party: Mark E. Newcomb.... Synopsis: The agreement authorizes Hamburg Sud to charter space to Hapag-Lloyd in the trade between the U.S...

  12. 78 FR 76624 - Notice of Agreements Filed

    Science.gov (United States)

    2013-12-18

    ... Agreement. Parties: BBC Chartering & Logistic GmbH & Co. KG; Industrial Maritime Carriers LLC; Seaboard... amendment clarifies that BBC Chartering Carriers GmbH & Co. KG (BBC Carriers) and BBC Chartering & Logistic GmbH & Co. KG (BBC Logistic), both common carrier members of BBC Chartering Group, are to be treated...

  13. Atomic energy: agreement between Canada and Australia

    International Nuclear Information System (INIS)

    1983-01-01

    This agreement provides for the exchange of nuclear materials and equipment between Canada and Australia and specifies the safeguards and other protective measures that shall be employed to ensure the peaceful use of the nuclear technology shared between the two countries

  14. ACHP | News | St. Elizabeths Programmatic Agreement Signed

    Science.gov (United States)

    Search skip specific nav links Home arrow News arrow St. Elizabeths Programmatic Agreement Signed St redevelopment of the St. Elizabeths West Campus, which is part of the St. Elizabeths National Historic Landmark this project, due to the historic significance of the NHL. GSA's client for the St. Elizabeths

  15. Making Education Markets through Global Trade Agreements

    Science.gov (United States)

    Robertson, Susan L.

    2017-01-01

    This paper uses the global trade negotiations and agreements, which include education sectors as potentially tradable services, to show the complex processes at work in making global education markets. Drawing on the work of Jens Beckert and others, I focus on the micro-processes of making capitalist orders and the challenges at hand in bringing…

  16. 46 CFR 356.41 - Management agreements.

    Science.gov (United States)

    2010-10-01

    ... which the management company provides marketing services, consulting services or other services that are... otherwise effectively gain control over the management and operation of the vessel or vessel-owning entity... 46 Shipping 8 2010-10-01 2010-10-01 false Management agreements. 356.41 Section 356.41 Shipping...

  17. Exploring hubness in Regional Trade Agreements

    NARCIS (Netherlands)

    Vaal, A. de

    2016-01-01

    In the plethora of Regional Trade Agreements (RTAs) some countries take in a more central position than others in the sense that some countries are much more engaged with other countries through RTAs. Furthermore, the position of some countries is that of a hub: they have (many) trade

  18. Corporate Social Responsibility Agreements Model for Community ...

    African Journals Online (AJOL)

    Corporate Social Responsibility Agreements Model for Community ... their host communities with concomitant adverse effect on mining operations. ... sustainable community development an integral part of the mining business. This paper presents the evolutionary strategic models, with differing principles and action plans, ...

  19. What agreement in Paris in 2015?

    International Nuclear Information System (INIS)

    Colombier, Michel; Ribera, Teresa

    2015-01-01

    In Warsaw, countries agreed to a process whereby each will unilaterally design and communicate its contribution toward reducing greenhouse gas emissions in the atmosphere. This process is to be ratified in late 2015 in Paris. Will the Paris agreement mark a turning point in climate policy? Will it measure up to the ambitions proclaimed by the international community at the Durban meeting?

  20. The Kyoto Agreement: Trade and Design

    DEFF Research Database (Denmark)

    Svendsen, Gert Tinggaard

    1999-01-01

    The Kyoto Agreement from 1997 allows trade of CO2 emission quotas between the 38 industrialized countries which have committed themselves to an emission ceiling. However, it does not define how this potential trade system should be designed. The intention was to clarify these matters during the 1...

  1. Physical attractiveness, issue agreement, and assimilation effects in candidate appraisal.

    Science.gov (United States)

    Schubert, James N; Curran, Margaret Ann; Strungaru, Carmen

    2011-01-01

    This study examines the cognitive and affective factors of candidate appraisal by manipulating candidate attractiveness and levels of issue agreement with voters. Drawing upon research in evolutionary psychology and cognitive neuroscience, this analysis proposes that automatic processing of physical appearance predisposes affective disposition toward more attractive candidates, thereby influencing cognitive processing of issue information. An experimental design presented attractive and unattractive candidates who were either liberal or conservative in a mock primary election. The data show strong partial effects for appearance on vote intention, an interaction between appearance and issue agreement, and a tendency for voters to assimilate the dissimilar views of attractive candidates. We argue that physical appearance is important in primary elections when the differences in issue positions and ideology between candidates is small.

  2. Policy space for health and trade and investment agreements.

    Science.gov (United States)

    Koivusalo, Meri

    2014-06-01

    New trade agreements affect how governments can regulate for health both within health systems and in addressing health protection, promotion and social determinants of health in other policies. It is essential that those responsible for health understand the impacts of these trade negotiations and agreements on policy space for health at a national and local level. While we know more about implications from negotiations concerning intellectual property rights and trade in goods, this paper provides a screening checklist for less-discussed areas of domestic regulation, services, investment and government procurement. As implications are likely to differ on the basis of the organization and structures of national health systems and policy priorities, the emphasis is on finding out key provisions as well as on how exemptions and exclusions can be used to ensure policy space for health. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  3. 23 CFR 630.110 - Modification of original agreement.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Modification of original agreement. 630.110 Section 630... OPERATIONS PRECONSTRUCTION PROCEDURES Project Authorization and Agreements § 630.110 Modification of original agreement. (a) When changes are needed to the original project agreement, a modification of agreement shall...

  4. The Text of a Safeguards Transfer Agreement relating to the Bilateral Agreement between France and Japan

    International Nuclear Information System (INIS)

    1973-01-01

    The text of a Safeguards Transfer Agreement between the Agency, France and Japan relating to the agreement of 26 February 1972 between the two Governments for co-operation in the peaceful uses of nuclear energy is reproduced in this document for the information or all Members

  5. The Text of the Safeguards Transfer Agreement relating to the Bilateral Agreement between Pakistan and Canada

    International Nuclear Information System (INIS)

    1969-01-01

    The text of the Safeguard Transfer Agreement between Pakistan, Canada and the Agency relating to the agreement of 14 May 1959 between the two Governments for co-operation in the peaceful uses of atomic energy is reproduced in this document for the information of all Members

  6. The Text of the Safeguards Transfer Agreement relating to the Bilateral Agreement between Pakistan and Canada

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1969-11-13

    The text of the Safeguard Transfer Agreement between Pakistan, Canada and the Agency relating to the agreement of 14 May 1959 between the two Governments for co-operation in the peaceful uses of atomic energy is reproduced in this document for the information of all Members.

  7. 48 CFR 1642.1204 - Agreement to recognize a successor in interest (novation agreement).

    Science.gov (United States)

    2010-10-01

    ... that the corporate name of (insert old corporate name) was changed to (insert new corporate name) on... MANAGEMENT CONTRACT ADMINISTRATION Novation and Change-of-Name Agreements 1642.1204 Agreement to recognize a... corporate name) (Transferor), a corporation duly organized and existing under the laws of (insert State...

  8. 12 CFR 346.5 - Related agreements considered a single agreement.

    Science.gov (United States)

    2010-01-01

    ... STATEMENTS OF GENERAL POLICY DISCLOSURE AND REPORTING OF CRA-RELATED AGREEMENTS § 346.5 Related agreements...; (2) Were entered into within the same 12-month period; and (3) Are each in fulfillment of the CRA. (b... in fulfillment of the CRA, if the contracts were negotiated in a coordinated fashion and a NGEP is a...

  9. The Text of the Safeguards Transfer Agreement relating to the Bilateral Agreement between Canada and Japan

    International Nuclear Information System (INIS)

    1966-01-01

    The text of the Safeguards Transfer Agreement between the Agency, Canada and Japan relating to the agreement between those Governments concerning co-operation in the promotion and development of the peaceful uses of atomic energy is reproduced in this document for the information of all Members

  10. The Text of a Safeguards Agreement relating to the Bilateral Agreement between Japan and Australia

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1973-01-26

    The text of a Safeguards Agreement between the Agency, Japan and Australia relating to the agreement of 21 February 1972 between the two Governments for co-operation in the peaceful uses of atomic energy is reproduced in this document for the information of all Members.

  11. The Text of a Safeguards Transfer Agreement relating to the Bilateral Agreement between France and Japan

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1973-01-31

    The text of a Safeguards Transfer Agreement between the Agency, France and Japan relating to the agreement of 26 February 1972 between the two Governments for co-operation in the peaceful uses of nuclear energy is reproduced in this document for the information or all Members.

  12. Effects of parallel planning on agreement production.

    Science.gov (United States)

    Veenstra, Alma; Meyer, Antje S; Acheson, Daniel J

    2015-11-01

    An important issue in current psycholinguistics is how the time course of utterance planning affects the generation of grammatical structures. The current study investigated the influence of parallel activation of the components of complex noun phrases on the generation of subject-verb agreement. Specifically, the lexical interference account (Gillespie & Pearlmutter, 2011b; Solomon & Pearlmutter, 2004) predicts more agreement errors (i.e., attraction) for subject phrases in which the head and local noun mismatch in number (e.g., the apple next to the pears) when nouns are planned in parallel than when they are planned in sequence. We used a speeded picture description task that yielded sentences such as the apple next to the pears is red. The objects mentioned in the noun phrase were either semantically related or unrelated. To induce agreement errors, pictures sometimes mismatched in number. In order to manipulate the likelihood of parallel processing of the objects and to test the hypothesized relationship between parallel processing and the rate of agreement errors, the pictures were either placed close together or far apart. Analyses of the participants' eye movements and speech onset latencies indicated slower processing of the first object and stronger interference from the related (compared to the unrelated) second object in the close than in the far condition. Analyses of the agreement errors yielded an attraction effect, with more errors in mismatching than in matching conditions. However, the magnitude of the attraction effect did not differ across the close and far conditions. Thus, spatial proximity encouraged parallel processing of the pictures, which led to interference of the associated conceptual and/or lexical representation, but, contrary to the prediction, it did not lead to more attraction errors. Copyright © 2015 Elsevier B.V. All rights reserved.

  13. Relationship satisfaction and interpartner agreement about acts of physical and psychological aggression: a multilevel analysis.

    Science.gov (United States)

    Graña, José Luis; Cuenca, María Luisa; Redondo, Natalia

    2017-08-15

    To analyze, in a multilevel context, the impact of individual-level relationship satisfaction on couples' mean reports of aggression and agreement about acts of physical and psychological aggression. We conducted a quota sampling method to recruit a community sample of 2.988 heterosexual adult couples from the Region of Madrid (Spain). The percentages of intimate partner aggression considering the highest report of aggression in the couple were around 60% of psychological aggression and 15% of physical aggression. Couples that used aggressive tactics showed low to moderate levels of agreement about physical and psychological aggression. Multilevel models confirm that women's relationship satisfaction had a significant influence on the level of agreement about acts of psychological aggression, but the same pattern of results was not observed for men. On the other hand, men and women's relationship satisfaction had no significant influence on the level of agreement about physical aggression. Psychological aggression plays a more relevant role in women's relationship satisfaction than physical aggression.

  14. Intergovernmental organisation activities and Multilateral agreements

    International Nuclear Information System (INIS)

    2012-01-01

    This section summarises the activities of Intergovernmental organisations and the status of Multilateral agreements on December 1, 2011: 1 - Intergovernmental organisation activities: European Atomic Energy Community: Adopted legislative instruments, Reports, Meetings; International Atomic Energy Agency: IAEA Action Plan on Nuclear Safety, Non-binding instrument on the transboundary movement of scrap metal, 55. IAEA General Conference, Basic Safety Standards, Nuclear Law Institute; OECD Nuclear Energy Agency: Basic Safety Standards, International Nuclear Law Essentials, International School of Nuclear Law, New members, Russian Federation request for membership; 2 - Multilateral agreements: Status of conventions in the nuclear energy domain on December 1, 2011; Status of conventions in the environmental protection/evaluation impacting the nuclear energy use on December 1, 2011; participation of OECD Member States to nuclear energy and environment protection/evaluation related treaties/conventions

  15. China and nuclear arms limitation agreements

    International Nuclear Information System (INIS)

    Roberts, E.V.

    1980-01-01

    The Chinese attitudes from 1949 to 1980 towards nuclear arms limitation are divided into four distinct periods: 1949-1956, 1957-1963, 1964-1972 and 1973-1980. During 1949-1956, China held the view that an atom bomb or nuclear weapons are not decisive for the outcome of any war. It is the people who decide the outcome of a war. The period 1957-1963, after Soviet refusal to transfer nuclear technology, is marked by the development of the nuclear programme which led to the explosion of a nuclear device in 1964. China continued to build nuclear capability during 1964-1972. Mao died in 1976 and the relations with the U.S.A. were normalised in 1979. Taking an anti-Soviet stance China now takes the view that any nuclear arms agreement with Soviet Union is futile and describes SALT II agreement as an absolute farce. (M.G.B.)

  16. OPEC's response to international climate agreements

    International Nuclear Information System (INIS)

    Braaten, J.; Golombek, R.

    1998-01-01

    This paper studies a game between a group of countries that have agreed to participate in an international climate agreement (the signatories) and OPEC. The purpose of the signatories is to design carbon taxes that maximize their total net income, given a goal on global carbon emissions. As a response to the climate agreement, OPEC imposes an oil tax on its member states that maximizes OPEC's profits. Within a numerical model we find the subgame-perfect equilibrium of a game in which each player chooses when to fix his decision variables. It is shown that in equilibrium the group of signatories chooses to be the leader and OPEC chooses to be the follower. It is demonstrated, however, that for both agents the order of move is of minor (numerical) importance. Hence, the players have limited incentives for strategic behaviour. 17 refs

  17. Sinopec and COSCO Sign Strategic Partnership Agreement

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    @@ Sinopec and China Ocean Shipping (Group)Company (COSCO), the country's biggest shipping company, signed a framework cooperation agreement on June 18 in Beijing, under which COSCO would provide quality crude oil transport from the current 1.94 million deadweight tons. The ambitious plan was made to chter to COSCO's establishment of a long-term strategic partnership for cooperation with Sinopec, China's leading producer and supplier of petroleum products.

  18. The Ranger and Nabarlek mining agreements

    International Nuclear Information System (INIS)

    Gray, W.J.

    1980-01-01

    This article contains information about the content of the agreements which have been entered into between the Australian Government and the Northern Land Council in relation to the Ranger deposits in the Northern Territory and between the Government and Queensland Mines Limited and the N.L.C. in relation to the Nabarlek deposit. A statement by the Minister for Aboriginal Affairs on the impact of uranium mining on Northern Territory Aboriginals is included

  19. Attraction Effects in Honorific Agreement in Korean.

    Science.gov (United States)

    Kwon, Nayoung; Sturt, Patrick

    2016-01-01

    Previous studies have suggested that sentence processing is mediated by content-addressable direct retrieval processes (McElree, 2000; McElree et al., 2003). However, the memory retrieval processes may differ as a function of the type of dependency. For example, while many studies have reported facilitatory intrusion effects associated with a structurally illicit antecedent during the processing of subject-verb number or person agreement and negative polarity items (Pearlmutter et al., 1999; Xiang et al., 2009; Dillon et al., 2013), studies investigating reflexives have not found consistent evidence of intrusion effects (Parker et al., 2015; Sturt and Kwon, 2015; cf. Nicol and Swinney, 1989; Sturt, 2003). Similarly, the memory retrieval processes could be also sensitive to cross-linguistic differences (cf. Lago et al., 2015). We report one self-paced reading experiment and one eye-tracking experiment that examine the processing of subject-verb honorific agreement, a dependency that is different from those that have been studied to date, in Korean, a typologically different language from those previously studied. The overall results suggest that the retrieval processes underlying the processing of subject-verb honorific agreement in Korean are susceptible to facilitatory intrusion effects from a structurally illicit but feature-matching subject, with a pattern that is similar to subject-verb agreement in English. In addition, the attraction effect was not limited to the ungrammatical sentences but was also found in grammatical sentences. The clear attraction effect in the grammatical sentences suggest that the attraction effect does not solely arise as the result of an error-driven process (cf. Wagers et al., 2009), but is likely also to result from general mechanisms of retrieval processes of activating of potential items in memory (Vasishth et al., 2008).

  20. The Economics of Advance Pricing Agreements

    OpenAIRE

    Johannes Becker; Ronald B. Davies; Gitte Jakobs

    2014-01-01

    Advance pricing agreements (APAs) determine transfer prices for intra-firm transactions in advance. This paper interprets these contracts as a means to overcome a hold-up problem that occurs because governments cannot commit to non-excessive future tax rates. In addition, with private information, just as in practice, our APAs will be complex and require lengthy negotiations. Never- theless, implemented APAs lead to a Pareto improvement even when all agents are risk neutral. However, not all ...

  1. CHARACTERISTICS OF MANAGED ENTRY AGREEMENTS IN AUSTRALIA.

    Science.gov (United States)

    Robinson, Maxine F; Mihalopoulos, Cathrine; Merlin, Tracy; Roughead, Elizabeth

    2018-01-01

    Australia relies on managed entry agreements (MEAs) for many medicines added to the national Pharmaceutical Benefits Scheme (PBS). Previous studies of Australian MEAs examined public domain documents and were not able to provide a comprehensive assessment of the types and operation of MEAs. This study used government documents approved for release to examine the implementation and administration of MEAs implemented January 2012 to May 2016. We accessed documents for medicines with MEAs on the PBS between January 2012 and May 2016. Data were extracted on Anatomical Therapeutic Classification (ATC), type of MEA (financial, financial with outcomes, outcomes, and subcategories within each group), implementation and administration methods, source of MEA recommendation, and type of economic analysis. Of all medication indication pairs (MIPs) recommended for listing, one-third had MEAs implemented. Our study of eighty-seven MIPs had 170 MEAs in place. The Government's expert health technology assessment (HTA) committee recommended MEAs for 90 percent of the eighty-seven MIPs. A total of 81 percent of MEAs were simple financial agreements: the majority either discounts (32 percent) or reimbursement caps (43 percent). Outcome-based MEAs were least common (5 percent). Ninety-two percent of MEAs were implemented and operated through legal agreements. Approximately half of the MIPs were listed on the basis of accepted claims of cost-minimization. Forty-nine percent of medicines were in ATC L group. Advice from HTA evaluations strongly influences the implementation of ways to manage uncertainties while providing access to medicines. The government relied primarily on simple financial agreements for the managed entry of medicines for which there were perceived risks.

  2. Profile agreement indices in Rietveld and pattern-fitting analysis

    International Nuclear Information System (INIS)

    Hill, R.J.; Fischer, R.X.

    1990-01-01

    Two definitions of profile agreement indices are now in common use for estimating the degree of fit in Rietveld refinement and in structure-independent pattern-fitting methods of powder diffraction analysis. In the original program written by Rietveld, the background was subtracted and the 'non-peak' regions of the pattern were removed from further consideration in a preliminary data-reduction stage prior to structure refinement. However, the agreement indices used in many of the more recent programs retain the background counts in the observed step intensities and include all portions of the pattern in the sums. These latter definitions are strongly dependent on the signal-to-noise ratio and on the relative amount of 'background-only' regions and do not, therefore, provide a sound basis for comparing the degree of fit of peak profile and crystal structure model refinements in the general case. The extent of this dependence is illustrated quantitatively using conventional and synchrotron X-ray and constant-wavelength and time-of-flight neutron data sets with different inherent background levels and peak densities. The unweighted background-corrected peak-only profile agreement index R' p =Σ i vertical strokeY io -Y ic vertical stroke/Σ i vertical strokeY io -Y ib vertical stroke (and, to a lesser extent, its weighted equivalent) is recommended as the most appropriate criterion of fit for comparative work between diffraction patterns of all kinds. (orig.)

  3. Mitotic Figure Recognition: Agreement among Pathologists and Computerized Detector

    Directory of Open Access Journals (Sweden)

    Christopher Malon

    2012-01-01

    Full Text Available Despite the prognostic importance of mitotic count as one of the components of the Bloom – Richardson grade [3], several studies ([2, 9, 10] have found that pathologists’ agreement on the mitotic grade is fairly modest. Collecting a set of more than 4,200 candidate mitotic figures, we evaluate pathologists' agreement on individual figures, and train a computerized system for mitosis detection, comparing its performance to the classifications of three pathologists. The system’s and the pathologists’ classifications are based on evaluation of digital micrographs of hematoxylin and eosin stained breast tissue. On figures where the majority of pathologists agree on a classification, we compare the performance of the trained system to that of the individual pathologists. We find that the level of agreement of the pathologists ranges from slight to moderate, with strong biases, and that the system performs competitively in rating the ground truth set. This study is a step towards automatic mitosis count to accelerate a pathologist's work and improve reproducibility.

  4. International Technology-Oriented Agreements to Address Climate Change

    International Nuclear Information System (INIS)

    De Coninck, H.C.; Fischer, C.; Newell, R.G.; Ueno, T.

    2007-01-01

    Much discussion has surrounded possible alternatives for international agreements on climate change, particularly post-2012. Among these alternatives, technology-oriented agreements (TOAs) are perhaps the least well defined. We explore what TOAs may consist of, why they might be sensible, which TOAs already exist in international energy and environmental governance, and whether they have the potential to make a valuable contribution to addressing climate change. We conclude that TOAs aimed at knowledge sharing and coordination, research, development, or demonstration could increase the overall efficiency and effectiveness of international climate cooperation, but have limited environmental effectiveness on their own. Technology transfer agreements are likely to have similar properties unless the level of resources expended on them is large, in which case they could be environmentally significant. Technology mandates, standards, or incentives can be environmentally effective, within the applicable sector. However, they are likely to be less cost-effective than broad-based, flexible approaches that place a price on emissions. These results indicate that TOAs have the potential to improve the effectiveness of the global response to climate change. The success of specific TOAs will depend on their design, implementation, and the role they are expected to play relative to other components of the climate policy portfolio

  5. Dayton Agreement as Legalization of Ethnic Cleainsing

    Directory of Open Access Journals (Sweden)

    Irina Vinčić Manojlović

    2015-06-01

    Full Text Available The article analyzes neo-racism in Bosnia and Herzegovina, which is a direct result of the political structure of the country. The constitution of Bosnia and Herzegovina, drafted under the Dayton Agreement, does not define BiH as a country of its citizens, but as a country of ethnically pure groups, mainly Serbs, Croats, Bosnians, and members of minority groups. The country continually reproduces neo-racism and the marginalization of its citizens, because the primary purpose of ethno-nationalist policies is to ensure the unity of a particular ethnic group. In this society, human rights are limited to collective rights, and the individual becomes entirely irrelevant. By analyzing policies and discourses of political parties, and analyzing the educational system and media freedom, the author focuses on the tools used for ideological control, which produces neo-racism. The article also analyzes neo-racist discrimination in state symbols and state holidays. In the end, the author discusses the possibility of the abolition of the Dayton Agreement. Examples of respect and solidarity between people, in the author's opinion, are the most suitable basis for the fight against neo-racism. The article concludes that the ethno-nationalist political divide remains strong, and that it is not likely that, in the near future, Bosnia and Herzegovina will abolish the Dayton Agreement, and with it the neo-racist discrimination against its citizens.

  6. International trade agreements: hazards to health?

    Science.gov (United States)

    Shaffer, Ellen R; Brenner, Joseph E

    2004-01-01

    Since the 1980s, neoliberal policies have prescribed reducing the role of governments, relying on market forces to organize and provide health care and other vital human services. In this context, international trade agreements increasingly serve as mechanisms to enforce the privatization, deregulation, and decentralization of health care and other services, with important implications for democracy as well as for health. Critics contend that social austerity and "free" trade agreements contribute to the rise in global poverty and economic inequality and instability, and therefore to increased preventable illness and death. Under new agreements through the World Trade Organization that cover vital human services such as health care, water, education, and energy, unaccountable, secret trade tribunals could overrule decisions by democratically elected officials on public financing for national health care systems, licensing and training standards for health professionals, patient safety and quality regulations, occupational safety and health, control of hazardous substances such as tobacco and alcohol, the environment, and affordable access to safe water and sanitation. International negotiations in 2003 in Cancun and in Miami suggested that countervailing views are developing momentum. A concerned health care community has begun to call for a moratorium on trade negotiations on health care and water, and to reinvigorate an alternative vision of universal access to vital services.

  7. WTO new round agreement and nuclear

    International Nuclear Information System (INIS)

    Lee, M. K.; Moon, L. H.; Kim, S. S.

    2002-01-01

    The start of new round of WTO could be recognized as a turning point shifting from bilateral or regional trade system to multilateral trade system worldwide. The changes in international trade system are expected to have some impact on the Korean nuclear industry. The purpose of this study is to understand the impact on prepare opening the market for the plant design and engineering. This market has been protected by Agreement on Government Procurement(AGP). However, this market will be eventually influenced by GATS(General Agreement on Trade in Services) with KEPCO's on going privatization being completed. There have been no impacts on R and D fund provided by the government as yet. However, in case of Government supported R and D for commercial purpose, there are much concerns to be discussed further within new WTO agreement. It is necessary to develop a strategy for maximizing national interests and promoting R and D in the negotiation for design and construction services related with nuclear industry, and energy services. Furthermore, to effectively explore new nuclear markets in developing countries including China, market analyses for their countries are required

  8. Patterns of third person plural verbal agreement

    Directory of Open Access Journals (Sweden)

    Silvia Rodrigues Vieira

    2013-12-01

    Full Text Available This paper aims to provide a Labovian sociolinguistic description of 3rd person plural patterns of agreement in European (EP, Brazilian (BP and São Tomé (STP Portuguese based on very recent samples of speech stratified for age, sex/gender and education. Linguistic and social restrictions for the variation are investigated. Results from statistical analysis indicate that there are two patterns of agreement in Portuguese: a semi-categorical rule, typical of EP, and a variable rule, typical of BP and STP, restricted by specific linguistic and social factors. Additionally, the results indicate that general linguistic constraints – such as the position of the subject, semantic feature of the subject or even discursive parallelism – cannot say anything about historical origin of Portuguese varieties, since they can be concerned with any language. Therefore, besides the quantitative expression of non-agreement, the quality of the occurrences of non-plural marking may support the characterization of each variety.

  9. Cues, quantification, and agreement in language comprehension.

    Science.gov (United States)

    Tanner, Darren; Bulkes, Nyssa Z

    2015-12-01

    We investigated factors that affect the comprehension of subject-verb agreement in English, using quantification as a window into the relationship between morphosyntactic processes in language production and comprehension. Event-related brain potentials (ERPs) were recorded while participants read sentences with grammatical and ungrammatical verbs, in which the plurality of the subject noun phrase was either doubly marked (via overt plural quantification and morphological marking on the noun) or singly marked (via only plural morphology on the noun). Both acceptability judgments and the ERP data showed heightened sensitivity to agreement violations when quantification provided an additional cue to the grammatical number of the subject noun phrase, over and above plural morphology. This is consistent with models of grammatical comprehension that emphasize feature prediction in tandem with cue-based memory retrieval. Our results additionally contrast with those of prior studies that showed no effects of plural quantification on agreement in language production. These findings therefore highlight some nontrivial divergences in the cues and mechanisms supporting morphosyntactic processing in language production and comprehension.

  10. PRE-CONTRACTUAL INFORMATION IN CREDIT AGREEMENTS FOR CONSUMERS

    Directory of Open Access Journals (Sweden)

    Mihaela-Irina IONESCU

    2015-07-01

    Full Text Available The article provides an image to the point on information provided to consumers before the conclusion of a credit contract, starting with the importance of information and ending with the legal framework. A high consumer protection may be achieved primarily through consumer information. The complexity of banking services but also the vulnerability of consumers in relation to the banks and the unbalanced relationship led to the need to develop specific legislation that clearly establishes the rights and obligations of the parties of a credit agreement for consumers. In this regard, in 2008, after many debates, Directive 2008/48/EC of the European Parliament and of the Council on credit agreements for consumers was adopted. At national level, the Directive was transposed by the Government Emergency Ordinance no. 50/2010 on credit agreements for consumers. Taking into account national specificities, such as lack of experience of consumers in financial products, the irresponsible lending and the unfair practices of creditors, the national act includes wider provisions than the European Directive, such as those relating to fees limitations or those related to the calculation of the variable interest rate. Also the GEO no 50/2010 applies to all credit agreements concluded by consumers and creditors. As regards the advertising, any advertisement shall include a series of standard information. Also, pre-contractual information is standard information, is provided to consumers 15 days before the contract is concluded and is transmitted through the “European Consumer Credit Information sheet Standard”. The article presents when, how and what information should be given to consumers and insists on the importance of annual percentage rate and to what consumers should pay attention in order to be able to compare different offers.

  11. On description of contracts and agreements in the context of SOA

    Directory of Open Access Journals (Sweden)

    Laima Paliulionienė

    2013-09-01

    Full Text Available The issue of making contracts between services in Service-Oriented Architecture (SOA arises naturally, because in real life services are subjects for negotiation and contracting. The notion of contract in SOA is rather misleading, because usually means just technical specification – input and output parameters, pre- and postconditions. However, there are also other aspects of contract. Service Level Agreements (SLAs often are used together with technical contract. SLAs describes the level of service expected by a customer from a supplier, laying out the metrics by which that service is measured, the remedies or penalties in case the agreed-upon levels are not achieved. The paper aim to clear up the notions of contract and agreement in SOA, discusses the properties of languages that are used to specify contacts and agreements, paying special attention to their legal aspects and comparing contract features in WS-Agreement ir WSLA.

  12. The Texts of the Agency's Headquarters Agreement with Austria and Related Agreements

    International Nuclear Information System (INIS)

    1975-01-01

    The texts of the Agreement between the International Atomic Energy Agency and the Republic of Austria that were in force on 30 September 1975 are reproduced in this document for the information of all Members of the Agency [fr

  13. The Texts of the Agency's Headquarters Agreement with Austria and Related Agreements

    International Nuclear Information System (INIS)

    1975-01-01

    The texts of the Agreement between the International Atomic Energy Agency and the Republic of Austria that were in force on 30 September 1975 are reproduced in this document for the information of all Members of the Agency [ru

  14. Agreement processing and attraction errors in aging: evidence from subject-verb agreement in German.

    Science.gov (United States)

    Reifegerste, Jana; Hauer, Franziska; Felser, Claudia

    2017-11-01

    Effects of aging on lexical processing are well attested, but the picture is less clear for grammatical processing. Where age differences emerge, these are usually ascribed to working-memory (WM) decline. Previous studies on the influence of WM on agreement computation have yielded inconclusive results, and work on aging and subject-verb agreement processing is lacking. In two experiments (Experiment 1: timed grammaticality judgment, Experiment 2: self-paced reading + WM test), we investigated older (OA) and younger (YA) adults' susceptibility to agreement attraction errors. We found longer reading latencies and judgment reaction times (RTs) for OAs. Further, OAs, particularly those with low WM scores, were more accepting of sentences with attraction errors than YAs. OAs showed longer reading latencies for ungrammatical sentences, again modulated by WM, than YAs. Our results indicate that OAs have greater difficulty blocking intervening nouns from interfering with the computation of agreement dependencies. WM can modulate this effect.

  15. The Texts of the Agency's Headquarters Agreement with Austria and Related Agreements

    International Nuclear Information System (INIS)

    1975-01-01

    The texts of the Agreement between the International Atomic Energy Agency and the Republic of Austria that were in force on 30 September 1975 are reproduced in this document for the information of all Members of the Agency [es

  16. Designing Comprehensive Partnering Agreements : An Introduction to the Partnering Agreement Scorecard

    NARCIS (Netherlands)

    S.M. Pfisterer (Stella); N. Payandeh (Nasim); S. Reid

    2014-01-01

    textabstractAgreements are a key mechanism of partnerships because their role is to govern interactions. They help partnerships become more effective by allowing partners to cope with relational, performance and situational risks that characterise inter-organisational relationships. The

  17. Shared use agreements between municipalities and public schools in the United States, 2014.

    Science.gov (United States)

    Omura, John D; Carlson, Susan A; Paul, Prabasaj; Sliwa, Sarah; Onufrak, Stephen J; Fulton, Janet E

    2017-02-01

    Shared use agreements allow public use of school facilities during non-school hours. Such agreements can cover outdoor facilities alone or may be more comprehensive by also including indoor facilities. Our aim was to: 1) estimate the prevalence of shared use agreements and facility types covered among U.S. municipalities and 2) identify differences in prevalence by municipality characteristics. The 2014 National Survey of Community-based Policy and Environmental Supports for Healthy Eating and Active Living is a representative survey of US municipalities (n=2029). Data were analyzed using survey weights to create national estimates. Logistic and multinomial regression models determined odds ratios adjusting for municipality characteristics. Among 1930 municipalities with a school, 41.6% had a shared use agreement as reported by a local official, 45.6% did not, and 12.8% did not know. Significant differences in prevalence existed by population size, rural/urban status, poverty prevalence, median education level, and census region; however, after adjustment for other municipality characteristics significant differences remained only by population size, median education level, and census region. Among municipalities with a shared use agreement, 59.6% covered both outdoor and indoor facilities, 5.5% covered indoor facilities only, and 34.9% covered outdoor facilities only. Opportunities exist to expand the use of shared use agreements particularly in municipalities with small populations, lower education levels, and in the South, and to promote more comprehensive shared use agreements that include both indoor and outdoor facilities. Published by Elsevier Inc.

  18. Developing State Level Approaches under the State Level Concept

    International Nuclear Information System (INIS)

    Budlong Sylvester, K.; Murphy, C.L.; Boyer, B.; Pilat, J.F.

    2015-01-01

    With the pursuit of the State-Level Concept (SLC), the IAEA has sought to further evolve the international safeguards system in a manner which maintains (or improves) the effectiveness of the system in an environment of expanding demands and limited resources. The IAEA must not remain static and should continuously examine its practices to ensure it can capture opportunities for cost reductions while adapting to, and staying ahead of, emerging proliferation challenges. Contemporary safeguards have been focused on assessing the nuclear programme of the State as a whole, rather than on the basis of individual facilities. Since the IAEA's integrated safeguards program, State-level Approaches (SLAs) have been developed that seek to optimally combine the measures provided for by the Additional Protocol with those of traditional safeguards. This process resulted in facility specific approaches that, while making use of a State's broader conclusion, were nonetheless prescriptive. Designing SLAs on a State-by-State basis would avoid the shortcomings of a one-size-fits-all system. It would also enable the effective use of the Agency's information analysis and State evaluation efforts by linking this analysis to safeguards planning efforts. Acquisition Path Analysis (APA), along with the State Evaluation process, can be used to prioritize paths in a State in terms of their attractiveness for proliferation. While taking advantage of all safeguards relevant information, and tailoring safeguards to individual characteristics of the State, paths of the highest priority in all States will necessarily meet the same standard of coverage. Similarly, lower priority paths will have lower performance targets, thereby promoting nondiscrimination. Such an approach would improve understanding of safeguards implementation under the SLC and the rational for safeguards resource allocation. The potential roles for APA and performance targets in SLA development will be reviewed

  19. High inter-observer agreement of observer-perceived pain assessment in the emergency department

    DEFF Research Database (Denmark)

    Hangaard, Martin Høhrmann; Malling, Brian; Mogensen, Christian Backer

    2018-01-01

    degree of inter-observer agreement. The aim of the present study was to assess the inter-observer agreement of perceived pain among emergency department nurses and to evaluate if it was influenced by predetermined factors like age and gender. Method: A project assistant randomly recruited two nurses, who...... of 0.05 and 95% limits of agreement of +/-1 category. Patient age, gender, localization of pain, examination room or presence of a significant other did not affect the inter-observer agreement. Conclusion: We found 70% agreement on pain category between the nurses and it is justified that nurse......Background: Triage is used to prioritize the patients in the emergency department. The majority of the triage systems include the patients' pain score to assess their level of acuity by using a combination of patient reported pain and observer-perceived pain; the latter therefore requires a certain...

  20. Name agreement in picture naming : An ERP study

    NARCIS (Netherlands)

    Cheng, Xiaorong; Schafer, Graham; Akyürek, Elkan G.

    Name agreement is the extent to which different people agree on a name for a particular picture. Previous studies have found that it takes longer to name low name agreement pictures than high name agreement pictures. To examine the effect of name agreement in the online process of picture naming, we

  1. 25 CFR 225.33 - Assignment of minerals agreements.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Assignment of minerals agreements. 225.33 Section 225.33 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS OIL AND GAS, GEOTHERMAL, AND SOLID MINERALS AGREEMENTS Minerals Agreements § 225.33 Assignment of minerals agreements. An...

  2. 77 FR 59064 - United States-Colombia Trade Promotion Agreement

    Science.gov (United States)

    2012-09-26

    ...-Colombia Trade Promotion Agreement AGENCY: U.S. Customs and Border Protection, Department of Homeland... Trade Promotion Agreement entered into by the United States and the Republic of Colombia. DATES: Interim...-Colombia Trade Promotion Agreement (``CTPA'' or ``Agreement''), and on June 28, 2007, the Parties signed a...

  3. 14 CFR 1274.909 - Term of agreement.

    Science.gov (United States)

    2010-01-01

    ... Agreement, which, by their express terms or by necessary implication, apply for periods of time other than... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Term of agreement. 1274.909 Section 1274... COMMERCIAL FIRMS Other Provisions and Special Conditions § 1274.909 Term of agreement. Term of Agreement July...

  4. 12 CFR 533.6 - Disclosure of covered agreements.

    Science.gov (United States)

    2010-01-01

    ... REPORTING OF CRA-RELATED AGREEMENTS § 533.6 Disclosure of covered agreements. (a) Applicability date. This... mailing the agreement. (7) Use of CRA public file by insured depository institution or affiliate. An... institution's CRA public file if the institution makes the agreement available in accordance with the...

  5. 12 CFR 346.6 - Disclosure of covered agreements.

    Science.gov (United States)

    2010-01-01

    ... POLICY DISCLOSURE AND REPORTING OF CRA-RELATED AGREEMENTS § 346.6 Disclosure of covered agreements. (a... exceed the cost of copying and mailing the agreement. (7) Use of CRA public file by insured depository... the insured depository institution's CRA public file if the institution makes the agreement available...

  6. 76 FR 65365 - United States-OMAN Free Trade Agreement

    Science.gov (United States)

    2011-10-21

    ... Free Trade Agreement AGENCIES: U.S. Customs and Border Protection, Department of Homeland Security... other customs-related provisions of the United States--Oman Free Trade Agreement entered into by the... the U.S.-Oman Free Trade Agreement (``OFTA'' or ``Agreement''). The provisions of the OFTA were...

  7. 78 FR 32356 - United States-Korea Free Trade Agreement

    Science.gov (United States)

    2013-05-30

    ...-Korea Free Trade Agreement AGENCIES: U.S. Customs and Border Protection, Department of Homeland Security... treatment and other customs-related provisions of the United States-Korea Free Trade Agreement entered into...-Korea Free Trade Agreement (hereinafter ``UKFTA'' or the ``Agreement''). On December 3, 2010, the United...

  8. Climatic changes: explicative guide of international agreements

    International Nuclear Information System (INIS)

    2005-01-01

    The following themes of the negotiation in the United Nations Convention framework, on the climatic changes and the kyoto protocol are taken into account: the observation, the information communication, the policies and the measures, the developing countries, the flexibility mechanisms, the soils utilizations and the regime evolution. For each theme the document recalls quickly how the theme is detailed in the Convention and in the Protocol, it presents then the decisions and the adopted rules and defines the agreements contain, in terms of challenges and implication in the protocol implementation. (A.L.B.)

  9. AGREEMENT BETWEEN CERN AND UBS SA

    CERN Multimedia

    2002-01-01

    We wish to inform you that the agreement between CERN and UBS SA has been renewed for a period of five years with effect from 1st July 2002. This represents the culmination of work carried out since 1999 by a group consisting of representatives of the Finance Division, the SPL Division, the Staff Association and the Users Office. After analysis of the results of a market survey, it emerged that OVERALL the UBS offered the best conditions and guarantees for the CERN personnel. Owing to developments in the banking market, new conditions have had to be negotiated, which will be presented to you by the UBS (see article).

  10. Technology Cooperation Agreement Pilot Project (TCAPP)

    Energy Technology Data Exchange (ETDEWEB)

    Keegan, P.; Benioff, R.

    1999-10-20

    The Technology Cooperation Agreement Pilot Project (TCAPP) is helping developing countries design and implement actions to attract investment in clean energy technologies that will meet their economic development goals, while mitigating greenhouse gas emissions. TCAPP was launched by three US government agencies -- the US Agency for International Development (USAID), the US Environmental Protection Agency (USEPA), and the US Department of Energy (USDOE) -- in August 1997 to establish a model for climate change technology cooperation with developing and transition countries. This report describes the TCAPP approach and the significant progress made by the participating countries.

  11. USDOE/EPRI BIOMASS COFIRING COOPERATIVE AGREEMENT

    International Nuclear Information System (INIS)

    D. Tillman; E. Hughes

    1999-01-01

    During the period of April 1, 1999 through June 30, 1999, wood cofiring testing at both Seward Generating Station of GPU Genco and Bailly Generating Station of Northern Indiana Public Service Company provided the focus for all activities. In both cases, the testing was directed at the impacts of cofiring on efficiency, operability, and NO(sub x) emissions. This report summarizes the activities during the second calendar quarter in 1999 of the USDOE/EPRI Biomass Cofiring Cooperative Agreement. It focuses upon reporting the results of testing activities at both generating stations

  12. USDOE/EPRI BIOMASS COFIRING COOPERATIVE AGREEMENT

    Energy Technology Data Exchange (ETDEWEB)

    D. Tillman; E. Hughes

    1999-04-01

    During the period of January 1, 1999 through March 31, 1999, construction was performed in support of two major demonstrations. Major progress was made on several projects including cofiring at Seward (GPU Genco), and Bailly (NIPSCO). Most of the work was focused on construction and system commissioning activities at the Seward and Bailly Generating Stations. Additionally, petroleum coke cofiring testing was completed at the Bailly Generating Station. This report summarizes the activities during the first calendar quarter in 1999--the fourth contract quarter in 1998--of the USDOE/EPRI Biomass Cofiring Cooperative Agreement. It focuses upon reporting the results of construction activities and related events.

  13. Possible elements of a 2015 legal agreement on climate change

    International Nuclear Information System (INIS)

    Haites, Erik; Yamin, Farhana; Hoehne, Niklas

    2013-10-01

    Countries have committed to negotiating a new legally binding agreement by 2015, applicable to all countries for the period after 2020. This commitment has given new impetus and direction to the UN climate talks. The talks certainly need to progress on individual elements in the run up to 2015. However, Copenhagen showed that unless there is clarity and convergence on the overall objectives of the negotiation (the meta-negotiation), the technical level negotiations will get stuck. This is why there is a need to step back and envisage all potential elements of a new climate agreement, and their interaction. This is the objective of this paper, which IDDRI invited from three renowned international experts. Governments have committed to limiting warming to 2 degrees C above pre-industrial levels. The recently released IPCC report shows that this essentially requires capping total cumulative emissions: in the future emissions will need to decline to close to zero. The paper proposes that governments commit to phasing down net anthropogenic GHG emissions to zero by 2050. This multilaterally negotiated objective would be complemented by nationally determined mitigation objectives, which would be subject to international ex ante review and ex post verification. The paper proposes a clear process for regularly updating and strengthening national commitments. The climate regime needs to move out of continuous negotiation and into a framework of continuous implementation. The paper proposes no explicit differentiation of countries. Rather countries would propose nationally determined commitments, guided by the multilaterally agreed phase out goal and the international review. This would maximize participation. The Agreement should also include provisions for recognizing the actions of parties unable to ratify and for deterring egregious cases of free-riding. (authors)

  14. Canada-United States air quality agreement: Making progress

    International Nuclear Information System (INIS)

    1992-01-01

    The Canada-USA Air Quality Agreement was signed in March 1991. Canada's commitment under the agreement is to reduce emissions of SO 2 in the seven easternmost provinces to 2.3 million tonnes/y by 1994 and to cap these emissions at 3.2 million tonnes/y by 2000; in addition, Canada agrees to reduce nitrogen oxide emissions from stationary sources by 100,000 tonnes/y by 2000 and to implement more stringent nitrogen oxide emission standards for vehicles from 1994-96. The USA agrees to reduce SO 2 emissions by ca 10 million tons/y below 1980 levels by 2000, to achieve a permanent cap of 8.95 million tons/y for electric utilities by 2010, to ensure that industrial emissions do not exceed 5.6 million tons, and to reduce total nitrogen oxide emissions by ca 2 million tons/y below 1980 levels, primarily through new regulations for power plants and automobiles. In Canada, SO 2 emissions are now within 16% of target, with control efforts centered around metal smelters and power plants. In the USA, considerable progress has been made in promulgating regulations that will implement the acid rain control provisions of the agreement. Both countries are sharing information, are continuing a variety of scientific and technical activities, and cooperating in areas such as emission inventorying, atmospheric modelling, deposition monitoring, effects research and monitoring, human health studies, and control technologies. In the USA, market based incentives are being used in controlling acid emissions and are being assessed for their potential use in Canada. 13 figs., 3 tabs

  15. Comfort monitoring? Environmental assessment follow-up under community-industry negotiated environmental agreements

    International Nuclear Information System (INIS)

    Noble, Bram; Birk, Jasmine

    2011-01-01

    Negotiated environmental agreements are becoming common practice in the mining industry. In principle, negotiated environmental agreements are said to respond to many of the shortcomings of environmental impact assessment by providing for improved follow-up of project impacts through, among other things, data provision, engaging stakeholders in the monitoring and management of project impacts, and building capacity at the local level to deal with project-induced environmental change. In practice, however, little is known about the efficacy of follow-up under negotiated environmental agreements between proponents and communities and the demonstrated value added to project impact management. This paper examines follow-up practice under negotiated environmental agreements with a view to understanding whether and how community-based monitoring under privatized agreements actually contributes to improved follow-up and impact management. Based on lessons emerging from recent experiences with environmental agreements in Canada's uranium industry, we show that follow-up under negotiated agreements may be described as 'comfort monitoring'. While such monitoring does improve community-industry relations and enhance corporate image, it does little to support effects-based management. If follow-up under negotiated agreements is to be credible over the long term, there is a need to ensure that monitoring results are useful for, and integrated with, regulatory-based monitoring and project impact management practices.

  16. Health care agreements as a tool for coordinating health and social services

    Directory of Open Access Journals (Sweden)

    Andreas Rudkjøbing

    2014-12-01

    Full Text Available Introduction: In 2007, a substantial reform changed the administrative boundaries of the Danish health care system and introduced health care agreements to be signed between municipal and regional authorities. To assess the health care agreements as a tool for coordinating health and social services, a survey was conducted before (2005–2006 and after the reform (2011.Theory and methods: The study was designed on the basis of a modified version of Alter and Hage's framework for conceptualising coordination. Both surveys addressed all municipal level units (n = 271/98 and a random sample of general practitioners (n = 700/853.Results: The health care agreements were considered more useful for coordinating care than the previous health plans. The power relationship between the regional and municipal authorities in drawing up the agreements was described as more equal. Familiarity with the agreements among general practitioners was higher, as was the perceived influence of the health care agreements on their work.Discussion: Health care agreements with specific content and with regular follow-up and systematic mechanisms for organising feedback between collaborative partners exemplify a useful tool for the coordination of health and social services.Conclusion: There are substantial improvements with the new health agreements in terms of formalising a better coordination of the health care system.

  17. Agreement in the assessment of metastatic spine disease using scoring systems.

    Science.gov (United States)

    Arana, Estanislao; Kovacs, Francisco M; Royuela, Ana; Asenjo, Beatriz; Pérez-Ramírez, Ursula; Zamora, Javier

    2015-04-01

    To assess variability in the use of Tomita and modified Bauer scores in spine metastases. Clinical data and imaging from 90 patients with biopsy-proven spinal metastases, were provided to 83 specialists from 44 hospitals. Spinal levels involved and the Tomita and modified Bauer scores for each case were determined twice by each clinician, with a minimum of 6-week interval. Clinicians were blinded to every evaluation. Kappa statistic was used to assess intra and inter-observer agreement. Subgroup analyses were performed according to clinicians' specialty (medical oncology, neurosurgery, radiology, orthopedic surgery and radiation oncology), years of experience (⩽7, 8-13, ⩾14), and type of hospital (four levels). For metastases identification, intra-observer agreement was "substantial" (0.600.80) at the other levels. Inter-observer agreement was "almost perfect" at lumbar spine, and "substantial" at the other levels. Intra-observer agreement for the Tomita and Bauer scores was almost perfect. Inter-observer agreement was almost perfect for the Tomita score and substantial for the Bauer one. Results were similar across specialties, years of experience and type of hospital. Agreement in the assessment of metastatic spine disease is high. These scoring systems can improve communication among clinicians involved in oncology care. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  18. Agreement in the assessment of metastatic spine disease using scoring systems

    International Nuclear Information System (INIS)

    Arana, Estanislao; Kovacs, Francisco M.; Royuela, Ana; Asenjo, Beatriz; Pérez-Ramírez, Ursula; Zamora, Javier; Abraira, Víctor

    2015-01-01

    Purpose: To assess variability in the use of Tomita and modified Bauer scores in spine metastases. Materials and methods: Clinical data and imaging from 90 patients with biopsy-proven spinal metastases, were provided to 83 specialists from 44 hospitals. Spinal levels involved and the Tomita and modified Bauer scores for each case were determined twice by each clinician, with a minimum of 6-week interval. Clinicians were blinded to every evaluation. Kappa statistic was used to assess intra and inter-observer agreement. Subgroup analyses were performed according to clinicians’ specialty (medical oncology, neurosurgery, radiology, orthopedic surgery and radiation oncology), years of experience (⩽7, 8–13, ⩾14), and type of hospital (four levels). Results: For metastases identification, intra-observer agreement was “substantial” (0.60 < k < 0.80) at sacrum, and “almost perfect” (k > 0.80) at the other levels. Inter-observer agreement was “almost perfect” at lumbar spine, and “substantial” at the other levels. Intra-observer agreement for the Tomita and Bauer scores was almost perfect. Inter-observer agreement was almost perfect for the Tomita score and substantial for the Bauer one. Results were similar across specialties, years of experience and type of hospital. Conclusion: Agreement in the assessment of metastatic spine disease is high. These scoring systems can improve communication among clinicians involved in oncology care

  19. Confronting water in an Israeli-Palestinian peace agreement

    Science.gov (United States)

    Brooks, David; Trottier, Julie

    2010-03-01

    SummaryTrans-boundary water agreements are usually conceived as allocation agreements. In other words, water is treated as if it were a pie to be divided among the riparian states. The treatment of water as if it were as immobile as land may be useful in the short term, but it is fundamentally flawed as a means to avoid conflict as well as to ensure efficient, equitable, and sustainable management of water over the long term. This article proposes to avoid quantitative allocations within international water agreements, whether they be presented as percentage or fixed allocations or whether or not accompanied by a periodic revision clause. It proposes instead an ongoing joint management structure that allows for continuous conflict resolution concerning water demands and uses in a manner that effectively de-nationalises water uses. As well, it builds on existing, functioning institutions that are already active over a variety of scalar levels. It disaggregates what is usually perceived as a national water demand into its component institutions and re-aggregates them within an international institutional context. Though this approach for building trans-boundary water agreements can prove useful in any geographical situation, this article uses the Israeli-Palestinian conflict as a model. It proposes to respect the existing differences in the institutional management of water between the two entities and to reach four general objectives: economic efficiency, social and political equity, ecological sustainability, and the ability to implement the agreement in practice. The institutional design and proposed mechanisms follow five key principles for shared management: water allocations that are not fixed but variable over time; equality in rights and responsibilities; priority for demand management over supply management; continuous monitoring of water quality and quantity; and mediation among competing uses of fresh water. This institutional structure balances water

  20. Agreement between radiographic and photographic trabecular patterns

    International Nuclear Information System (INIS)

    Korstjens, C.M.; Geraets, W.G.M.; Stelt, P.F. van der; Spruijt, R.J.; Mosekilde, L.

    1998-01-01

    Purpose: It has been hypothesized that photographs can facilitate the interpretation of the radiographic characteristics of trabecular bone. The reliability of these photographic and radiographic approaches has been determined, as have various agreements between the two approaches and their correlations with biomechanical characteristics. Material and Methods: Fourteen vertebral bodies were obtained at autopsy from 6 women and 8 men aged 22-76 years. Photographs (n=28) and radiographs (n=28) were taken of midsagittal slices from the third lumbar vertebra. The radiographs and photographs were digitized and the geometric properties of the trabecular architecture were then determined with a digital images analysis technique. Information on the compressive strength and ash density of the vertebral body was also available. Results: The geometric properties of both radiographs and photographs could be measured with a high degree of reliability (Cronbach's α>0.85). Agreement between the radiographic and photographic approaches was mediocre as only the radiographic measurements showed insignificant correlations (p<0.05) with the biomechanical characteristics. We suggest that optical phenomena may result in the significant correlations between the photographs and the biomechanical characteristics. Conclusion: For digital image processing, radiography offers a superior description of the architecture of trabecular bone to that offered by photography. (orig.)

  1. Long term agreements energy efficiency. Progress 1999

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-11-01

    Long Term Agreements (LTAs) on energy efficiency have been contracted with various business sectors since 1992, as part of energy conservation policy: industrial sectors, commercial services, agrarian sectors and non-profit services. LTAs are voluntary agreements between a specific sector and the Minister of Economic Affairs. In some cases, the Minister of Agriculture, Nature Management and Fisheries is also involved. The sector commits to an effort to improve energy efficiency by a particular percentage within an agreed period. As at 31 December 1999, a total of 29 LTAs had been contracted with industrial sectors and 14 with non-industrial ones. This report describes the progress of the LTAs in 1999. It reviews the energy efficiency improvements realised through the LTAs, both overall and in each individual sector. The aim is to make the efforts and results in the various sectors accessible to the general public. Appendix 1 describes the positioning of the LTA instrument. This Appendix provides and insight into the position of the LTAs within the overall set of policy instruments. It also covers the subsidy schemes and fiscal instruments that support the LTAs, the relationships between LTAs and environmental policy and new developments relating to the LTAs in the years ahead. Appendices 2 to 6 contain the reports on the LTAs and a list of abbreviations (Appendix 7)

  2. Fully device-independent conference key agreement

    Science.gov (United States)

    Ribeiro, Jérémy; Murta, Gláucia; Wehner, Stephanie

    2018-02-01

    We present a security analysis of conference key agreement (CKA) in the most adversarial model of device independence (DI). Our protocol can be implemented by any experimental setup that is capable of performing Bell tests [specifically, the Mermin-Ardehali-Belinskii-Klyshko (MABK) inequality], and security can in principle be obtained for any violation of the MABK inequality that detects genuine multipartite entanglement among the N parties involved in the protocol. As our main tool, we derive a direct physical connection between the N -partite MABK inequality and the Clauser-Horne-Shimony-Holt (CHSH) inequality, showing that certain violations of the MABK inequality correspond to a violation of the CHSH inequality between one of the parties and the other N -1 . We compare the asymptotic key rate for device-independent conference key agreement (DICKA) to the case where the parties use N -1 device-independent quantum key distribution protocols in order to generate a common key. We show that for some regime of noise the DICKA protocol leads to better rates.

  3. Agreement between radiographic and photographic trabecular patterns

    Energy Technology Data Exchange (ETDEWEB)

    Korstjens, C.M.; Geraets, W.G.M.; Stelt, P.F. van der [Dept. of Oral Radiology, Academic Centre for Dentistry, Amsterdam (Netherlands); Spruijt, R.J. [Div. of Psychosocial Research and Epidemiology, Netherlands Cancer Inst., Amsterdam (Netherlands); Mosekilde, L. [Dept. of Cell Biology, Univ. of Aarhus (Denmark)

    1998-11-01

    Purpose: It has been hypothesized that photographs can facilitate the interpretation of the radiographic characteristics of trabecular bone. The reliability of these photographic and radiographic approaches has been determined, as have various agreements between the two approaches and their correlations with biomechanical characteristics. Material and Methods: Fourteen vertebral bodies were obtained at autopsy from 6 women and 8 men aged 22-76 years. Photographs (n=28) and radiographs (n=28) were taken of midsagittal slices from the third lumbar vertebra. The radiographs and photographs were digitized and the geometric properties of the trabecular architecture were then determined with a digital images analysis technique. Information on the compressive strength and ash density of the vertebral body was also available. Results: The geometric properties of both radiographs and photographs could be measured with a high degree of reliability (Cronbach`s {alpha}>0.85). Agreement between the radiographic and photographic approaches was mediocre as only the radiographic measurements showed insignificant correlations (p<0.05) with the biomechanical characteristics. We suggest that optical phenomena may result in the significant correlations between the photographs and the biomechanical characteristics. Conclusion: For digital image processing, radiography offers a superior description of the architecture of trabecular bone to that offered by photography. (orig.)

  4. Working under the PJVA gas processing agreement

    International Nuclear Information System (INIS)

    Collins, S.

    1996-01-01

    The trend in the natural gas industry is towards custom processing. New gas reserves tend to be smaller and in tighter reservoirs than in the past. This has resulted in plants having processing and transportation capacity available to be leased to third parties. Major plant operators and owners are finding themselves in the business of custom processing in a more focused way. Operators recognize that the dilution of operating costs can result in significant benefits to the plant owners as well as the third party processor. The relationship between the gas processor and the gas producer as they relate to the Petroleum Joint Venture Association (PJVA) Gas Processing Agreement were discussed. Details of the standard agreement that clearly defines the responsibilities of the third party producer and the processor were explained. In addition to outlining obligations of the parties, it also provides a framework for fee negotiation. It was concluded that third party processing can lower facility operating costs, extend facility life, and keep Canadian gas more competitive in holding its own in North American gas markets

  5. Structuring agreements for seismic group shoots

    International Nuclear Information System (INIS)

    Keeping, C.E.

    1999-01-01

    Sigma Explorations Inc. sells licenses to use Sigma owned seismic data. The company participates with exploration and production companies in the joint acquisition of semi-private participation surveys. This paper discusses three major types of seismic group shoots and the essential elements of the agreements that govern or should govern them. They are: (1) exploration and production company joint ventures, (2) publicly offered spec shoots, and (3) semi-private participation surveys. The key issue with the exploration and production company joint ventures is that the companies are owners of the seismic data in proportion to their contribution towards the cost of the program. Their use of the data should be restricted to those situations permitted by the other owners. These are not often well documented, and there is much concern in the industry as a result. The key issue with publicly offered spec shoots is that the seismic company ultimately owns the data and the client exploration and production company is a licensee and must behave as such. In most such cases the rights and responsibilities are well documented in formal agreements that are signed in advance of the program's beginning date

  6. EPA perspective on federal facility agreements

    International Nuclear Information System (INIS)

    Grundler, C.

    1988-01-01

    Although DOE's image with Congress and the media concerning environmental compliance may be poor, EPA sees the Department's recent attitude toward the environment as good. DOE and EPA must continue to move forward. In particular, EPA would like to emphasize less study of a problem and more clean-up. Strong, enforceable agreements will allow this goal to be met by letting EPA take more risks in its decision making. Currently EPA is developing an enforcement strategy for Federal facilities. This strategy will address identifying Federal facilities of concern, increasing enforcement and compliance monitoring activities at those facilities, implementing the model agreements, resource planning, and the establishment of an Agency Management System for Federal facilities. There are over 1000 Federal facilities which are listed on the EPA compliance docket. Over 200 Federal facilities are expected to be included on the NPL. Increased EPA attention may increase the ability of the various Federal agencies to obtain the necessary funding. Another subject being addressed by EPA is the liability of government contractors under the environmental statutes. The Agency is developing a GoCo enforcement strategy. In the hazardous waste enforcement program, three criteria are being considered for determining when to proceed against a contractor: Degree of contractor control over the hazardous waste management activity. Who is actually performing the work, and Degree of Departmental cooperation

  7. Subject-verb agreement: Error production by Tourism undergraduate students

    Directory of Open Access Journals (Sweden)

    Ana Paula Correia

    2014-11-01

    Full Text Available The aim of this paper, which is part of a more extensive research on verb tense errors, is to investigate the subject-verb agreement errors in the simple present in the texts of a group of Tourism undergraduate students. Based on the concept of interlanguage and following the error analysis model, this descriptive non-experimental study applies qualitative and quantitative procedures. Three types of instruments were used to collect data: a sociolinguistic questionnaire (to define the learners’ profile; the Dialang test (to establish their proficiency level in English; and our own learner corpus (140 texts. Errors were identified and classified by an expert panel in accordance with a verb error taxonomy developed for this study based on the taxonomy established by the Cambridge Learner Corpus. The Markin software was used to code errors in the corpus and the Wordsmith Tools software to analyze the data. Subject-verb agreement errors and their relation with the learners’ proficiency levels are described.

  8. Methodological Aspects of the IAEA State Level Concept and Acquisition Path Analysis: A State’s Nuclear Fuel Cycle, Related Capabilities, and the Quantification of Acquisition Paths

    International Nuclear Information System (INIS)

    Lance, K. Kim; Renda, Guido; Cojazzi, Giacomo G. M.

    2015-01-01

    Within its State Level Concept (SLC), the International Atomic Energy Agency (IAEA) envisions a State Level Approach (SLA) for safeguards implementation that considers, inter alia, a State’s nuclear and nuclear-related activities and capabilities as a whole when developing an annual implementation plan. Based on the assessed nuclear fuel cycle and related capabilities of a State, Acquisition Path Analysis (APA) identifies, characterizes, and prioritizes plausible routes for acquiring weapons-usable material to aid in safeguards implementation planning. A review of proposed APA methods and historical evidence indicates that assessments of pathway completion time can be fraught with uncertainty and subject to bias, potentially undermining safeguards effectiveness and efficiency. Based on considerations of theory and evidence, a number of methodological insights are identified to support consistent implementation and ongoing APA development. The use of algorithms to support APA and SLA processes in lieu of human judgement is a contentious issue requiring an evidence- based assessment and is also briefly discussed. This paper captures concepts derived primarily from open sources of information, including publications, presentations, and workshops on on-going APA development by the IAEA and various Member States Support Programs (MSSP) as well as relevant work found in the open literature. While implementation of the SLA has begun for a number of States, these SLAs are being updated and developed for other States. In light of these ongoing developments, the topics covered here should be considered a snapshot in time that does not reflect finished products and does not necessarily reflect official views.

  9. Plurilateral Trade Deals: An Alternative for Multilateral Trade Agreements?

    Directory of Open Access Journals (Sweden)

    Agnes Ghibuțiu

    2016-04-01

    Full Text Available While multilateral trade negotiations under the World Trade Organization (WTO continue to be in impasse, plurilateral trade negotiations – i.e. among a group of WTO members – have intensified in recent years, and also recorded a series of concrete results in liberalizing specific sectors of international trade. Hence, there is a widely shared view that plurilateral trade negotiations could be an alternative for the multilateral ones. This paper aims to answer the following questions: What are plurilateral trade agreements? Which are the reasons behind the surge in plurilateral negotiations in recent years? What are the main achievements in liberalizing trade at the plurilateral level? What are the advantages of plurilateral negotiations relative to multilateral ones, and why are they considered an attractive alternative for negotiations at the multilateral level?

  10. Community-based naming agreement, familiarity, image agreement and visual complexity ratings among adult Indians

    Directory of Open Access Journals (Sweden)

    George Annamma

    2007-01-01

    Full Text Available The validity of Snodgrass and Vanderwart pictures and their norms derived on a western population on naming, familiarity, imageability and visual-complexity, is not established on a population with cultural background different from the west. We developed, therefore, a set of culturally appropriate pictures for and derived norms on Indians. Line-drawings of 103 concepts (67 from Snodgrass and Vanderwart, 36 new from 10 semantic-categories were normed on 200 community-based older subjects. Only 31% of the Snodgrass and Vanderwart items showed a concept-agreement on the Indians comparable to western norms. Naming, familiarity and image-agreement mutually correlated but not with visual-complexity. Low-education and rural-residence tended to reduced concept-agreement. The output of this study will be of use in national and cross-national studies.

  11. MULTILATERAL ENVIRONMENTAL AGREEMENTS AND THE TRADE MEASURES CONTAINED IN THESE AGREEMENTS

    Directory of Open Access Journals (Sweden)

    Margareta Timbur

    2012-06-01

    Full Text Available The environmental problems which the society is facing, ozone depletion, biodiversity loss, the spread of persistent organic pollutants, are a result of human activity with a worldwide impact, requiring immediate resolution. In this context, negotiation, signing and implementation of several multilateral environmental agreements (MEAs are one of the best solutions, affordable and reliable. The aim of this study is to analyze the commercial measures, which to some extent, ensure stability, security, and expansion of MEAs. The paper discusses, also, the efficiency, necessity and the influences of trade measures in MEAs and the WTO role in signing these agreements.

  12. An agreement for applied research in Italy

    CERN Multimedia

    2002-01-01

    On 26 February, two of CERN's Directors-General had a very official handshake. Luciano Maiani, CERN's current Director-General, and Carlo Rubbia, one of his predecessors and current "commissario straordinario" of ENEA (Ente per le Nuove tecnologie, l'Energia e l'Ambiante, Institute for new technologies, energy and the environment) signed a collaboration agreement between their two organisations. ENEA carries out applied research in various fields such as renewable energies, new materials and medical applications. The organisation, which employs 3400 people in 10 laboratories in Italy, has a clear interest, therefore, in the technologies developed at CERN, which, in turn, seeks to promote them. Their collaboration will shortly lead to common research projects. CERN now has two Italian partners : INFN, its historical partner for particle physics research and ENEA for technological applications.

  13. Multiparty quantum key agreement with single particles

    Science.gov (United States)

    Liu, Bin; Gao, Fei; Huang, Wei; Wen, Qiao-yan

    2013-04-01

    Two conditions must be satisfied in a secure quantum key agreement (QKA) protocol: (1) outside eavesdroppers cannot gain the generated key without introducing any error; (2) the generated key cannot be determined by any non-trivial subset of the participants. That is, a secure QKA protocol can not only prevent the outside attackers from stealing the key, but also resist the attack from inside participants, i.e. some dishonest participants determine the key alone by illegal means. How to resist participant attack is an aporia in the design of QKA protocols, especially the multi-party ones. In this paper we present the first secure multiparty QKA protocol against both outside and participant attacks. Further more, we have proved its security in detail.

  14. Enhancing regional security agreements through cooperative monitoring

    International Nuclear Information System (INIS)

    Pregenzer, A.L.

    1995-05-01

    This paper proposes that strengthening regional capabilities for formulating and implementing arms control and confidence-building measures is a tangible method of enhancing regional security. It discusses the importance of developing a regional infrastructure for arms control and confidence building and elucidates the role of technology in facilitating regional arms control and confidence-building agreements. In addition, it identifies numerous applications for regional cooperative monitoring in the areas of arms control, resource management, international commerce and disaster response. The Cooperative Monitoring Center at Sandia National Laboratories, whose aim is to help individual countries and regions acquire the tools they need to develop their own solutions to regional problems, is discussed briefly. The paper ends with recommendations for establishing regional cooperative monitoring centers

  15. Industry agreement on efficient electrical motors

    International Nuclear Information System (INIS)

    Schnyder, G.

    2004-01-01

    This comprehensive final report presents the results of a project carried out on behalf of the Swiss Federal Office of Energy (SFOE) and the Swiss Automation Pool (SAP) concerning the efficiency of electrical drives. The main goal of the project was to conclude a target agreement between the federal government and the Swiss electric motors/drives industry. This involves the promotion of the highest, 'eff1' energy-efficiency category of the three categories defined by the European Committee of Manufacturers of Electrical Machines and Power Electronics (CEMP). The report presents the findings of the project and recommends the banning of the use of motors in the lowest, 'eff3' category. Comparisons are made between the CEMP standards and further standards and promotion programmes in the USA and in Great Britain. Associated measures to be taken to aid the promotion of the drive standard are discussed

  16. Can the Paris Agreement stop global warming?

    DEFF Research Database (Denmark)

    Howalt Owe, Selina; Pedersen, Jens Olaf Pepke

    in the year 2030 of about 55 Gt Carbon to 40 Gt Carbon. This can be compared to an approximate emission of 35 Gt in 2014 and thus means that a global rise in emission of only 5 Gt Carbon is allowed over the next 15 years Using the Danish Center for Earth System Science (DCESS)model [1] we have investigated...... how large an emission reduction is necessary to keep the global temperatures below these targets.The DCESS model is a low order Earth system box model which includes atmosphere, ocean, ocean sediment, land biosphere and lithosphere components, and using the year 1765 as the preindustriallevel. We have...... examined different emission scenarios and the national commitments and find that even if the Paris Agreement is fulfilled, global temperatures will have increased by 1.5 degree C in 2030, and then only a yearly percentage reduction of 5% or more will be sufficient to keep temperatures below 2 degree C...

  17. Understanding the development of international environmental agreements

    DEFF Research Database (Denmark)

    Stærdahl, Jens

    There are many different theoretical schools concerned with how international regimes develop, and each supplies its own interpretation focusing on one or a few aspects of the process. Such ‘one shot’ explanations may be fruitful for scientific debate, but less useful as conceptual frameworks...... for practitioners and planners manoeuvring in a complex world. On the basis of a review of selected theories of international and environmental regulation, this article initiates the development of a conceptual framework for understanding the development of internationalenvironmental agreements. The point...... of departure for developing the model is the actor-structure debate within social science and theory of international relations. Based on critical realism, a framework is developed specifying the relation between collective action problem situations and negotiation situations. It is argued that the main...

  18. On limiting technology by negotiated agreement

    Science.gov (United States)

    Carnesale, Albert

    1983-10-01

    The substance of my remarks tonight will be far narrower in scope than the prescribed title of my talk would indicate. This reflects two considerations: first, this topical meeting is focused on technologies associated with nuclear weapons systems; and, second, President Reagan recently (i.e., on March 23, 1983) called for ``a program to counter the awesome Soviet missile threat with measures that are defensive.'' In light of these considerations, I will concentrate tonight on the case of anti-ballistic missile (ABM) systems as an example of a countinuing effort to limit technology by negotiated agreement? Why limit ABM systems? After all, such systems are defensive in nature, not offensive. Defensive systems are intended to protect people and the things of value to them. It is the offensive systems that cause death and destruction. Why don't we just go ahead and deploy the best available ABM system, and develop and test even better systems for deployment in the future?

  19. Ocean commitments under the Paris Agreement

    Science.gov (United States)

    Gallo, Natalya D.; Victor, David G.; Levin, Lisa A.

    2017-11-01

    Under the Paris Agreement nations made pledges known as nationally determined contributions (NDCs), which indicate how national governments are evaluating climate risks and policy opportunities. We find that NDCs reveal important systematic patterns reflecting national interests and capabilities. Because the ocean plays critical roles in climate mitigation and adaptation, we created a quantitative marine focus factor (MFF) to evaluate how governments address marine issues. In contrast to the past, when oceans received minimal attention in climate negotiations, 70% of 161 NDCs we analysed include marine issues. The percentage of the population living in low-lying areas--vulnerable to rising seas--positively influences the MFF, but negotiating group (Annex 1 or small island developing states) is equally important, suggesting political motivations are crucial to NDC development. The analysis reveals gaps between scientific and government attention, including on ocean deoxygenation, which is barely mentioned. Governments display a keen interest in expanding marine research on climate priorities.

  20. Disagreements in meta-analyses using outcomes measured on continuous or rating scales: observer agreement study

    DEFF Research Database (Denmark)

    Tendal, Britta; Higgins, Julian P T; Jüni, Peter

    2009-01-01

    difference (SMD), the protocols for the reviews and the trial reports (n=45) were retrieved. DATA EXTRACTION: Five experienced methodologists and five PhD students independently extracted data from the trial reports for calculation of the first SMD result in each review. The observers did not have access...... to the reviews but to the protocols, where the relevant outcome was highlighted. The agreement was analysed at both trial and meta-analysis level, pairing the observers in all possible ways (45 pairs, yielding 2025 pairs of trials and 450 pairs of meta-analyses). Agreement was defined as SMDs that differed less...... than 0.1 in their point estimates or confidence intervals. RESULTS: The agreement was 53% at trial level and 31% at meta-analysis level. Including all pairs, the median disagreement was SMD=0.22 (interquartile range 0.07-0.61). The experts agreed somewhat more than the PhD students at trial level (61...

  1. How Useful Is Connectionism for SLA Research?

    Science.gov (United States)

    Jasdzewski, Gary

    The work of connectionist researchers is examined in order to understand better the implications for modeling second language learning processes. Connectionism is a biologically-oriented framework for understanding complex behavior, and provides a modeling tool (computer simulation) that behaves and learns without rules being explicitly wired into…

  2. Revitalization of Emergentism in SLA: A Panacea!

    Directory of Open Access Journals (Sweden)

    Nima Shakouri Masouleh

    2012-09-01

    Full Text Available Emergentists claim learning takes place by extracting regularities from the input. By the same token, Ellis (1998 disputed the view held by generative linguistics that such a complex phenomenon as language can only be learnt if it is assumed that humans are endowed genetically with a language specific learning device. Emergentists, as O’Grady (2003 reports, claim simple learning mechanisms are sufficient to bring about the emergence of complex language representations. Nevertheless, this perspective toward learning has so far failed to take into account how language competence could emerge (O’Grady, 2003. The following paper is an attempt to elucidate the theoretical assumptions behind emergentism.

  3. Spine Instability Neoplastic Score: agreement across different medical and surgical specialties.

    Science.gov (United States)

    Arana, Estanislao; Kovacs, Francisco M; Royuela, Ana; Asenjo, Beatriz; Pérez-Ramírez, Úrsula; Zamora, Javier

    2016-05-01

    Spinal instability is an acknowledged complication of spinal metastases; in spite of recent suggested criteria, it is not clearly defined in the literature. This study aimed to assess intra and interobserver agreement when using the Spine Instability Neoplastic Score (SINS) by all physicians involved in its management. Independent multicenter reliability study for the recently created SINS, undertaken with a panel of medical oncologists, neurosurgeons, radiologists, orthopedic surgeons, and radiation oncologists, was carried out. Ninety patients with biopsy-proven spinal metastases and magnetic resonance imaging, reviewed at the multidisciplinary tumor board of our institution, were included. Intraclass correlation coefficient (ICC) was used for SINS score agreement. Fleiss kappa statistic was used to assess agreement on the location of the most affected vertebral level; agreement on the SINS category ("stable," "potentially stable," or "unstable"); and overall agreement with the classification established by tumor board. Clinical data and imaging were provided to 83 specialists in 44 hospitals across 14 Spanish regions. No assessment criteria were pre-established. Each clinician assessed the SINS score twice, with a minimum 6-week interval. Clinicians were blinded to assessments made by other specialists and to their own previous assessment. Subgroup analyses were performed by clinicians' specialty, experience (≤7, 8-13, ≥14 years), and hospital category (four levels according to size and complexity). This study was supported by Kovacs Foundation. Intra and interobserver agreement on the location of the most affected levels was "almost perfect" (κ>0.94). Intra-observer agreement on the SINS score was "excellent" (ICC=0.77), whereas interobserver agreement was "moderate" (ICC=0.55). Intra-observer agreement in SINS category was "substantial" (k=0.61), whereas interobserver agreement was "moderate" (k=0.42). Overall agreement with the tumor board classification

  4. 14 CFR 372.24 - Surety bond, depository agreement, escrow agreement.

    Science.gov (United States)

    2010-01-01

    ... (2) which is listed in Best's Insurance Reports (fire and casualty) with a general policyholders... surety to any charter participant shall not exceed the charter operator's applicable tariff fare. Such... not exceed the charter operator's applicable tariff fare; and (ii) Enter into an agreement with a bank...

  5. Agreement at the Boundaries: Synchronic and Diachronic Approaches to phi-Agreement in the Left Periphery

    Science.gov (United States)

    Courtney, Sarah Gray

    2017-01-01

    This dissertation examines complementizer agreement (CA) phenomena in which phi-features appear on a complementizer, clause-linking marker, or otherwise, syntactically speaking, at the C[superscript 0] position. This dissertation will argue that CA is in fact a straightforward output of the syntax module under standard Minimalist assumptions, and…

  6. 12 CFR 207.5 - Related agreements considered a single agreement.

    Science.gov (United States)

    2010-01-01

    ... RESERVE SYSTEM DISCLOSURE AND REPORTING OF CRA-RELATED AGREEMENTS (REGULATION G) § 207.5 Related... of the CRA. (b) Substantively related contracts. All written contracts to which an insured depository... each such contract is in fulfillment of the CRA, if the contracts were negotiated in a coordinated...

  7. The Texts of the Agency's Headquarters Agreement with Austria and Related Agreements

    International Nuclear Information System (INIS)

    1975-01-01

    The texts of six agreements concluded between the Agency and the Republic of Austria as a result of the location of the Agency's headquarters in Austria, which were in force on 31 October 1975, are reproduced in this document for the information of all Members

  8. Technology transfer and the Argentina-German cooperation agreement

    International Nuclear Information System (INIS)

    Di Primio, J.C.

    1977-01-01

    The transfer of technology from developed countries is usually done through industrial enterprises. The local industrialization of imported technology does not necessary imply that full benefit is extracted from its application. A pre-established scientific and technical infrastructure is needed to understand and incorporate it, and to develop methods for improvement and use at the industrial level, in the frame of national conditions. The transference of nuclear technology has shown recently new concepts for the implementation. It is becoming a rule that massive industrial nuclear technology transfer to developing nations is conditioned by the latter requirement for simulataneous assistance to create or promote that infrastructure. An example of international cooperation to meet the requirement explained above is the Argentine-German agreement for the peaceful applications of nuclear energy. Since 1971 it has been used to strengthen the scientific and technical programs of the Argentine Atomic Energy Commission, by application to fields relevant by its industrial implications. The objectives and implementation of the agreement are described: cooperative actions where initially directed to the infrastructure needed to support the nuclear fuel cycle industry. The results achieved during the period 1971-76 are critically analyzed. This analysis has influenced the selection of future cooperative projects as well as the extension of the cooperation to other nuclear fields of common interest [es

  9. Ice-free Arctic projections under the Paris Agreement

    Science.gov (United States)

    Sigmond, Michael; Fyfe, John C.; Swart, Neil C.

    2018-05-01

    Under the Paris Agreement, emissions scenarios are pursued that would stabilize the global mean temperature at 1.5-2.0 °C above pre-industrial levels, but current emission reduction policies are expected to limit warming by 2100 to approximately 3.0 °C. Whether such emissions scenarios would prevent a summer sea-ice-free Arctic is unknown. Here we employ stabilized warming simulations with an Earth System Model to obtain sea-ice projections under stabilized global warming, and correct biases in mean sea-ice coverage by constraining with observations. Although there is some sensitivity to details in the constraining method, the observationally constrained projections suggest that the benefits of going from 2.0 °C to 1.5 °C stabilized warming are substantial; an eightfold decrease in the frequency of ice-free conditions is expected, from once in every five to once in every forty years. Under 3.0 °C global mean warming, however, permanent summer ice-free conditions are likely, which emphasizes the need for nations to increase their commitments to the Paris Agreement.

  10. The Impact of the Canada-Korea Free Trade Agreement as Negotiated

    Directory of Open Access Journals (Sweden)

    Dan Ciuriak

    2014-12-01

    Full Text Available This paper analyzes the impact of the Canada-Korea Free Trade Agreement on the basis of the published text and agreed schedule of commitments. We find that the Agreement reinforces existing patterns of comparative advantage between Canada (agriculture and resource-based sectors and Korea (autos and other industries. The sensitive sectors that held up the deal for years - autos into Canada and beef into Korea - witness major trade gains, but are not unduly disrupted. In both economies, the major output gains otherwise come in non-traded services sectors, driven by income effects. We find that trade diversion effects are quite significant; this lends support for the domino theory of major free trade agreements - since the Korea-EU agreement broke the ice, the pressure has intensified on third parties to re-level playing fields by striking their own deals. The study breaks new ground in modelling services trade by developing policy impacts based on the extent to which the text of the Agreement modifies Korea's and Canada's scores on the OECD's Services Trade Restrictiveness Index and by providing estimates of Mode 3 Services trade impacts. The analysis of the Agreement as negotiated, the present study, in our view, is a step forward in understanding the impact of modern free trade agreements.

  11. 40 CFR 35.3130 - The capitalization grant agreement.

    Science.gov (United States)

    2010-07-01

    ... ASSISTANCE STATE AND LOCAL ASSISTANCE State Water Pollution Control Revolving Funds § 35.3130 The... SRF Operating Agreement. (b) Operating agreement. At the option of the State, the organizational and... Management and Budget under control number 2040-0118) ...

  12. 45 CFR 1640.4 - Violation of agreement.

    Science.gov (United States)

    2010-10-01

    ... OF FEDERAL LAW TO LSC RECIPIENTS § 1640.4 Violation of agreement. (a) A violation of the agreement... negligence allowed the employee or board member to engage in the activities which led to the conviction or...

  13. The texts of the Agency's relationship agreements with specialized agencies

    International Nuclear Information System (INIS)

    1988-03-01

    The text of the relationship agreement which the Agency has concluded with the United Nations Industrial Development Organization, together with the protocol regarding its entry into force is reproduced. The agreement entered into force on 9 October 1987

  14. 20 years of the implementation of the safeguards agreements

    International Nuclear Information System (INIS)

    Ramirez Quijada, Renan

    2001-01-01

    Peru has signed an INFIRC/153 type safeguards agreement with the IAEA in 1979. The paper describes the nuclear material under control and outlines the organization and the activities related to the implementation of the safeguards agreements

  15. Agreement on the privileges and immunities of the Agency

    International Nuclear Information System (INIS)

    1993-04-01

    The document lists the 63 Member States which by 28 February 1993 had accepted the Agreement on the Privileges and Immunities of the International Atomic Energy Agency. The list is followed by the texts of reservations made to the Agreement

  16. 48 CFR 27.204 - Patented technology under trade agreements.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Patented technology under trade agreements. 27.204 Section 27.204 Federal Acquisition Regulations System FEDERAL ACQUISITION... Patented technology under trade agreements. ...

  17. 47 CFR 76.1805 - Alternative rate regulation agreements.

    Science.gov (United States)

    2010-10-01

    ... agreements. Small systems owned by small cable companies must file with the Commission a copy of any operative alternative rate regulation agreement entered into with a local franchising authority pursuant to...

  18. Agreements to work outside the scope of employment

    OpenAIRE

    Svobodová, Tereza

    2010-01-01

    Resumé / Summary Title: Agreements on work performed outside an employment relationship Agreements on work performed outside an employment relationship are a specific type of labour relationship allowing the employer to employ an employee on the basis of its actual needs. These agreements are unique in whole Europe; we may find them only in the Czech Republic and Slovak Republic, which is caused by the common development until the first half of 1990's. There are two kinds of these agreements ...

  19. Group size effects in two repeated game models of a global climate agreement

    Energy Technology Data Exchange (ETDEWEB)

    Helland, Leif

    2002-07-01

    What levels of total abatement can one hope for in a global climate agreement. Some potential answers to this question are provided by game theory. This working paper contains a critical discussion of two (prominent) game ,models that answer the question quite pessimistically. Both models take the n-person, infinitely repeated prisoner's dilemma game as their point of departure. The first model is a full information model and utilises the motion of a weakly re negotiation proof equilibrium. This results in the (maybe counterintuitive) prediction that an agreement that can provide high utility to the group will attract less total abatement than an agreement that can only provide low utility to the group. The second model assumes imperfect public information and utilises the notion of a trigger level equilibrium. This results in the (more intuitive) prediction that the level of total abatements will increase with improved verification techniques for a given player set. Still the level of total abatements decrease with an increasing player set for a given verification technique. Empirical implications of the two models are identified and it is argued that one should confront these with experimentally generated data in order to discriminate between the models. One reason for this is that historical data on abatement efforts in a global climate agreement do not exist since no such agreement has entered into force yet. (Author)

  20. Group size effects in two repeated game models of a global climate agreement

    International Nuclear Information System (INIS)

    Helland, Leif

    2002-01-01

    What levels of total abatement can one hope for in a global climate agreement. Some potential answers to this question are provided by game theory. This working paper contains a critical discussion of two (prominent) game ,models that answer the question quite pessimistically. Both models take the n-person, infinitely repeated prisoner's dilemma game as their point of departure. The first model is a full information model and utilises the motion of a weakly re negotiation proof equilibrium. This results in the (maybe counterintuitive) prediction that an agreement that can provide high utility to the group will attract less total abatement than an agreement that can only provide low utility to the group. The second model assumes imperfect public information and utilises the notion of a trigger level equilibrium. This results in the (more intuitive) prediction that the level of total abatements will increase with improved verification techniques for a given player set. Still the level of total abatements decrease with an increasing player set for a given verification technique. Empirical implications of the two models are identified and it is argued that one should confront these with experimentally generated data in order to discriminate between the models. One reason for this is that historical data on abatement efforts in a global climate agreement do not exist since no such agreement has entered into force yet. (Author)

  1. Intraobserver and interobserver agreement on the radiographical diagnosis of canine cranial cruciate ligament rupture.

    Science.gov (United States)

    Bogaerts, Evelien; Van der Vekens, Elke; Verhoeven, Geert; de Rooster, Hilde; Van Ryssen, Bernadette; Samoy, Yves; Putcuyps, Ingrid; Van Tilburg, Johan; Devriendt, Nausikaa; Weekers, Frederik; Bertal, Mileva; Houdellier, Blandine; Scheemaeker, Stephanie; Versteken, Jeroen; Lamerand, Maryline; Feenstra, Laurien; Peelman, Luc; Nieuwerburgh, Filip Van; Saunders, Jimmy H; Broeckx, Bart J G

    2018-04-28

    Even though radiography is one of the most frequently used imaging techniques for orthopaedic disorders, it has been demonstrated that the interpretation can vary between assessors. As such, the purpose of this study was to examine the intraobserver and interobserver agreement and the influence of level of expertise on the interpretation of radiographs of the stifle in dogs with and without cranial cruciate ligament rupture (CCLR). Sixteen observers, divided in four groups according to their level of experience, evaluated 30 radiographs (15 cases with CCLR and 15 control stifles) twice. Each observer was asked to evaluate joint effusion, presence and location of degenerative joint disease, joint instability and whether CCLR was present or absent. Overall, intraobserver and interobserver agreement ranged from fair to almost perfect with a trend towards increased agreement for more experienced observers. Additionally, it was found that stifles that were classified with high agreement have either overt disease characteristics or no disease characteristics at all, in comparison to the ones that are classified with a low agreement. Overall, the agreement on radiographic interpretation of CCLR was high, which is important, as it is the basis of a correct diagnosis and treatment. © British Veterinary Association (unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  2. Impact of educational intervention on the inter-rater agreement of nasal endoscopy interpretation

    Science.gov (United States)

    Colley, Patrick; Mace, Jess C.; Schaberg, Madeleine R.; Smith, Timothy L.; Tabaee, Abtin

    2015-01-01

    OBJECTIVE Nasal endoscopy is integral to the evaluation of sinonasal disorders. However, prior studies have shown significant variability in the inter-rater agreement of nasal endoscopy interpretation amongst practicing rhinologists. The objective of the current study is to evaluate the inter-rater agreement of nasal endoscopy amongst otolaryngology residents from a single training program at baseline and following an educational intervention. METHODS 11 otolaryngology residents completed nasal endoscopy grading forms for 8 digitally recorded nasal endoscopic examinations. An instructional lecture reviewing nasal endoscopy interpretation was subsequently provided. The residents then completed grading forms for 8 different nasal endoscopic examinations. Inter-rate agreement amongst residents for the pre- and post-lecture videos was calculated using the unweighted Fleiss’ kappa statistic (Kf) and intra-class correlation agreement (ICC). RESULTS Inter-rater agreement improved from a baseline level of fair (Kf range 0.268–0.383) to a post-educational level of moderate (Kf range 0.401–0.547) for nasal endoscopy findings of middle meatus mucosa, middle turbinate mucosa, middle meatus discharge, sphenoethmoid recess mucosa, sphenoethmoid recess discharge and atypical lesions (ICC, pendoscopy interpretation amongst otolaryngology residents. The inter-rater agreement for the majority of the characteristics that were evaluated improved after educational intervention. Further study is needed to improve nasal endoscopy interpretation. PMID:25781864

  3. ENHANCING EU-TAIWAN ECONOMIC COOPERATION AGREEMENT

    Directory of Open Access Journals (Sweden)

    Chung-hung Cho

    2018-01-01

    Full Text Available The EU’s 2015 new trade strategy: Trade for all: toward a more responsible trade and investment policy, highlights its key role in keeping markets open worldwide and lists the Asia-Pacific region as the priority party for signing Regional Trade Arrangements (RTAs with the EU. The new strategy allows the EU and its member states to initiate talks on economic cooperation agreement (ECA with Taiwan. This article takes the EU-Asia interregional cooperation as a case study while exploring the role of Taiwan in the region. The first section describes the shift in EU’s trade policies and the special features of the types of interregionalism between the EU and Asia. The second section explores the bilateral trade relations. The third section evaluates the opportunities and the internal and external challenges and limitations of an EU-Taiwan ECA, emphasizing the factor of mainland China. The final section provides conclusions on the influence of an EU-Taiwan ECA on the relations of EUTaiwan considering economic and non-economic factor

  4. Agreement Technologies for Energy Optimization at Home.

    Science.gov (United States)

    González-Briones, Alfonso; Chamoso, Pablo; De La Prieta, Fernando; Demazeau, Yves; Corchado, Juan M

    2018-05-19

    Nowadays, it is becoming increasingly common to deploy sensors in public buildings or homes with the aim of obtaining data from the environment and taking decisions that help to save energy. Many of the current state-of-the-art systems make decisions considering solely the environmental factors that cause the consumption of energy. These systems are successful at optimizing energy consumption; however, they do not adapt to the preferences of users and their comfort. Any system that is to be used by end-users should consider factors that affect their wellbeing. Thus, this article proposes an energy-saving system, which apart from considering the environmental conditions also adapts to the preferences of inhabitants. The architecture is based on a Multi-Agent System (MAS), its agents use Agreement Technologies (AT) to perform a negotiation process between the comfort preferences of the users and the degree of optimization that the system can achieve according to these preferences. A case study was conducted in an office building, showing that the proposed system achieved average energy savings of 17.15%.

  5. NETL-EERC ENVIRONMENTAL MANAGEMENT COOPERATIVE AGREEMENT

    Energy Technology Data Exchange (ETDEWEB)

    Christina B. Behr-Andres; Daniel J. Daly

    2001-07-31

    This final report summarizes the accomplishments of the 6-year Environmental Management Cooperative Agreement (EMCA) between the Energy and Environmental Research Center (EERC), a nonprofit, contract-supported unit of the University of North Dakota, and the U.S. Department of Energy (DOE) National Energy Technology Laboratory (NETL). The first portion of the report summarizes EMCA's structure, activities, and accomplishments. The appendix contains profiles of the individual EMCA tasks. Detailed descriptions and results of the tasks can be found separately in published Final Topical Reports. EMCA (DOE Contract No. DE-FC21-94MC31388) was in place from the fall of 1994 to the summer of 2001. Under EMCA, approximately $5.4 million was applied in three program areas to expedite the commercialization of 15 innovative technologies for application in DOE's EM Program ($3.8 million, or 69% of funds), provide technical support to the Deactivation and Decommissioning Focus Area (DDFA; $1.04 million, or 19% of funds), and provide for the coordination of the EMCA activities ($0.62 million, or 11% of funds). The following sections profile the overall accomplishments of the EMCA program followed by a summary of the accomplishments under each of the EMCA areas: commercialization, DDFA technical support, and management. Table 1 provides an overview of EMCA, including program areas, program activities, the duration and funding of each activity, and the associated industry partner, if appropriate.

  6. 7 CFR 3431.17 - VMLRP service agreement offer.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false VMLRP service agreement offer. 3431.17 Section 3431... Administration of the Veterinary Medicine Loan Repayment Program § 3431.17 VMLRP service agreement offer. The Secretary will make an offer to successful applicants to enter into an agreement with the Secretary to...

  7. 10 CFR 603.1340 - Technology investment agreement.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Technology investment agreement. 603.1340 Section 603.1340 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS TECHNOLOGY INVESTMENT AGREEMENTS Definitions of Terms Used in this Part § 603.1340 Technology investment agreement. A TIA is a special type of...

  8. 30 CFR 914.30 - State-Federal Cooperative Agreement.

    Science.gov (United States)

    2010-07-01

    ... Agreement (Agreement) to read as follows: Article I: Introduction, Purposes and Responsible Agencies A... provided to the DOR under this Agreement will be adjusted in accordance with Office of Management and.... The financial status report submitted pursuant to 30 CFR 735.26 will include a report of the amount of...

  9. 45 CFR 162.915 - Trading partner agreements.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Trading partner agreements. 162.915 Section 162... REQUIREMENTS ADMINISTRATIVE REQUIREMENTS General Provisions for Transactions § 162.915 Trading partner agreements. A covered entity must not enter into a trading partner agreement that would do any of the...

  10. 78 FR 60191 - United States-Colombia Trade Promotion Agreement

    Science.gov (United States)

    2013-10-01

    ... Trade Promotion Agreement AGENCY: U.S. Customs and Border Protection, Department of Homeland Security... tariff treatment and other customs-related provisions of the United States- Colombia Trade Promotion... States-Colombia Trade Promotion Agreement (``CTPA'' or ``Agreement''), and on June 28, 2007, the Parties...

  11. 77 FR 64031 - United States-Peru Trade Promotion Agreement

    Science.gov (United States)

    2012-10-18

    ... Trade Promotion Agreement AGENCIES: U.S. Customs and Border Protection, Department of Homeland Security... tariff treatment and other customs-related provisions of the United States-Peru Trade Promotion Agreement... other customs-related provisions of the United States-Peru Trade Promotion Agreement (PTPA). Please...

  12. 78 FR 63052 - United States-Panama Trade Promotion Agreement

    Science.gov (United States)

    2013-10-23

    ...-Panama Trade Promotion Agreement AGENCY: U.S. Customs and Border Protection, Department of Homeland... Trade Promotion Agreement entered into by the United States and the Republic of Panama. DATES: Interim... and the Republic of Panama (the ``Parties'') signed the United States-Panama Trade Promotion Agreement...

  13. Texts of the Agency's Agreements with the Republic of Austria

    International Nuclear Information System (INIS)

    1999-01-01

    The document reproduces the text of the Exchange of Letters, dated 8 January 1999 and 27 January 1999 respectively, between the Ministry of Foreign Affairs of Austria and the IAEA, constituting a supplementary agreement t o the Agreement between the Republic of Austria and the IAEA regarding the Headquarters of the IAEA. The aforementioned Agreement entered into force on 8 February 1999

  14. 75 FR 51061 - Joint and Several Liability Reallocation Agreement

    Science.gov (United States)

    2010-08-18

    ..., delivery and performance by such Bank of this Agreement and the performance by it of the transactions... Obligations. The execution, delivery and performance by such Bank of this Agreement and the performance by it... adverse effect on such Bank's observance or performance of this Agreement or the performance of the...

  15. 5 CFR 575.210 - Service agreement requirements.

    Science.gov (United States)

    2010-01-01

    ... agreement must specify that if an employee does not successfully complete the training before the service... employee. (c) The service agreement must specify the total amount of the incentive, the method of paying... incentive, an agency must require the employee to sign a written service agreement to complete a specified...

  16. 32 CFR 22.215 - Distinguishing grants and cooperative agreements.

    Science.gov (United States)

    2010-07-01

    ... GRANT AND AGREEMENT REGULATIONS DoD GRANTS AND AGREEMENTS-AWARD AND ADMINISTRATION Selecting the... than an absolute, concept, and that it is primarily based on programmatic factors, rather than requirements for grant or cooperative agreement award or administration. For example, substantial involvement...

  17. 24 CFR 266.15 - Risk-Sharing Agreement.

    Science.gov (United States)

    2010-04-01

    ... HOUSING FINANCE AGENCY RISK-SHARING PROGRAM FOR INSURED AFFORDABLE MULTIFAMILY PROJECT LOANS General Provisions § 266.15 Risk-Sharing Agreement. Execution of a Risk-Sharing Agreement is a prerequisite to... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Risk-Sharing Agreement. 266.15...

  18. Unfolding the phenomenon of inter-rater agreement

    DEFF Research Database (Denmark)

    Slaug, Bjørn; Schilling, Oliver; Helle, Tina

    2011-01-01

    Objective: The overall objective was to unfold the phenomenon of inter-rater agreement: to identify potential sources of variation in agreement data and to explore how they can be statistically accounted for. The ultimate aim was to propose recommendations for in-depth examination of agreement, i...

  19. 12 CFR 207.6 - Disclosure of covered agreements.

    Science.gov (United States)

    2010-01-01

    ... DISCLOSURE AND REPORTING OF CRA-RELATED AGREEMENTS (REGULATION G) § 207.6 Disclosure of covered agreements... CRA public file by insured depository institution or affiliate. An insured depository institution and...) by placing a copy of the covered agreement in the insured depository institution's CRA public file if...

  20. 41 CFR 109-50.4801 - Equipment Gift Agreement.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Equipment Gift Agreement... 50-SPECIAL DOE DISPOSAL AUTHORITIES 50.48-Exhibits § 109-50.4801 Equipment Gift Agreement. (a) The following Equipment Gift Agreement format will be used to provide gifts of excess and/or surplus equipment...