WorldWideScience

Sample records for lens acs slacs

  1. The Sloan Lens ACS Survey. I. A large spectroscopically selected sample of massive early-type lens galaxies

    NARCIS (Netherlands)

    Bolton, AS; Burles, S; Koopmans, LVE; Treu, T; Moustakas, LA

    2006-01-01

    The Sloan Lens ACS (SLACS) Survey is an efficient Hubble Space Telescope (HST) Snapshot imaging survey for new galaxy-scale strong gravitational lenses. The targeted lens candidates are selected spectroscopically from the Sloan Digital Sky Survey (SDSS) database of galaxy spectra for having multiple

  2. The Sloan Lens ACS Survey. XIII. Discovery of 40 New Galaxy-scale Strong Lenses

    NARCIS (Netherlands)

    Shu, Yiping; Brownstein, Joel R.; Bolton, Adam S.; Koopmans, Léon V. E.; Treu, Tommaso; Montero-Dorta, Antonio D.; Auger, Matthew W.; Czoske, Oliver; Gavazzi, Raphaël; Marshall, Philip J.; Moustakas, Leonidas A.

    2017-01-01

    We present the full sample of 118 galaxy-scale strong-lens candidates in the Sloan Lens ACS (SLACS) Survey for the Masses (S4TM) Survey, which are spectroscopically selected from the final data release of the Sloan Digital Sky Survey. Follow-up Hubble Space Telescope (HST) imaging observations

  3. The Sloan Lens ACS Survey. I. A Large Spectroscopically Selected Sample of Massive Early-Type Lens Galaxies

    Science.gov (United States)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Moustakas, Leonidas A.

    2006-01-01

    The Sloan Lens ACS (SLACS) Survey is an efficient Hubble Space Telescope (HST) Snapshot imaging survey for new galaxy-scale strong gravitational lenses. The targeted lens candidates are selected spectroscopically from the Sloan Digital Sky Survey (SDSS) database of galaxy spectra for having multiple nebular emission lines at a redshift significantly higher than that of the SDSS target galaxy. The SLACS survey is optimized to detect bright early-type lens galaxies with faint lensed sources in order to increase the sample of known gravitational lenses suitable for detailed lensing, photometric, and dynamical modeling. In this paper, the first in a series on the current results of our HST Cycle 13 imaging survey, we present a catalog of 19 newly discovered gravitational lenses, along with nine other observed candidate systems that are either possible lenses, nonlenses, or nondetections. The survey efficiency is thus >=68%. We also present Gemini 8 m and Magellan 6.5 m integral-field spectroscopic data for nine of the SLACS targets, which further support the lensing interpretation. A new method for the effective subtraction of foreground galaxy images to reveal faint background features is presented. We show that the SLACS lens galaxies have colors and ellipticities typical of the spectroscopic parent sample from which they are drawn (SDSS luminous red galaxies and quiescent MAIN sample galaxies), but are somewhat brighter and more centrally concentrated. Several explanations for the latter bias are suggested. The SLACS survey provides the first statistically significant and homogeneously selected sample of bright early-type lens galaxies, furnishing a powerful probe of the structure of early-type galaxies within the half-light radius. The high confirmation rate of lenses in the SLACS survey suggests consideration of spectroscopic lens discovery as an explicit science goal of future spectroscopic galaxy surveys.

  4. The Sloan Lens ACS Survey. XIII. Discovery of 40 New Galaxy-scale Strong Lenses

    Science.gov (United States)

    Shu, Yiping; Brownstein, Joel R.; Bolton, Adam S.; Koopmans, Léon V. E.; Treu, Tommaso; Montero-Dorta, Antonio D.; Auger, Matthew W.; Czoske, Oliver; Gavazzi, Raphaël; Marshall, Philip J.; Moustakas, Leonidas A.

    2017-12-01

    We present the full sample of 118 galaxy-scale strong-lens candidates in the Sloan Lens ACS (SLACS) Survey for the Masses (S4TM) Survey, which are spectroscopically selected from the final data release of the Sloan Digital Sky Survey. Follow-up Hubble Space Telescope (HST) imaging observations confirm that 40 candidates are definite strong lenses with multiple lensed images. The foreground-lens galaxies are found to be early-type galaxies (ETGs) at redshifts 0.06–0.44, and background sources are emission-line galaxies at redshifts 0.22–1.29. As an extension of the SLACS Survey, the S4TM Survey is the first attempt to preferentially search for strong-lens systems with relatively lower lens masses than those in the pre-existing strong-lens samples. By fitting HST data with a singular isothermal ellipsoid model, we find that the total projected mass within the Einstein radius of the S4TM strong-lens sample ranges from 3 × 1010 M ⊙ to 2 × 1011 M ⊙. In Shu et al., we have derived the total stellar mass of the S4TM lenses to be 5 × 1010 M ⊙ to 1 × 1012 M ⊙. Both the total enclosed mass and stellar mass of the S4TM lenses are on average almost a factor of 2 smaller than those of the SLACS lenses, which also represent the typical mass scales of the current strong-lens samples. The extended mass coverage provided by the S4TM sample can enable a direct test, with the aid of strong lensing, for transitions in scaling relations, kinematic properties, mass structure, and dark-matter content trends of ETGs at intermediate-mass scales as noted in previous studies. Based on observations made with the NASA/ESA Hubble Space Telescope (HST), obtained at the Space Telescope Science Institute, which is operated by AURA, Inc., under NASA contract NAS 5-26555. These observations are associated with HST program #12210.

  5. SLAC site design aesthetics

    International Nuclear Information System (INIS)

    Hall, F.F.

    1985-10-01

    Stanford Linear Accelerator Center (SLAC) is a single mission laboratory dedicated to basic research in high energy particle physics. SLAC site also houses Stanford Synchrotron Radiation Laboratory (SSRL) which is a multi-mission laboratory for research using beams of ultraviolet light and low energy photons as emitted tangentially from SLAC colliding beam facilities. This paper discusses various aspects of SLAC site design aesthetics under the following headings: (1) imposed footprint of SLAC, (2) description of selected site, (3) use of earth cover for radiation and sight screens, (4) use of landscaping for cosmetic purposes, (5) use of exterior paint colors to soften SLAC impact on neighbors, (6) relocation of SLAC main entrance, (7) relocation of SLAC collider arcs and experimental hall, (8) parking lots and storage yards, and (9) land use zoning at SLAC

  6. The sloan lens ACS survey. VI. Discovery and analysis of a double Einstein ring

    NARCIS (Netherlands)

    Gavazzi, Raphael; Treu, Tommaso; Koopmans, Leon V. E.; Bolton, Adam S.; Moustakas, Leonidas A.; Burles, Scott; Marshall, Philip J.

    2008-01-01

    We report the discovery of two concentric Einstein rings around the gravitational lens SDSS J0946+ 1006. The main lens is at redshift z(l) = 0.222, while the inner ring ( 1) is at redshift z(s1) 0.609 (R-Ein1 = 1.43 '' +/- 0.01 ''). The wider image separation ( R-Ein2 = 2.07 '' +/- 0.02 '') of the

  7. The SLAC linear collider

    International Nuclear Information System (INIS)

    Richter, B.

    1985-01-01

    A report is given on the goals and progress of the SLAC Linear Collider. The author discusses the status of the machine and the detectors and give an overview of the physics which can be done at this new facility. He also gives some ideas on how (and why) large linear colliders of the future should be built

  8. Sleepless at SLAC

    Energy Technology Data Exchange (ETDEWEB)

    Dement, William (Stanford Sleep Disorders Center)

    2006-01-23

    Feeling tired? More than 30 million Americans suffer from sleep disorders. Nevertheless, as a society we remain largely ignorant of the significance of sleep in determining the quality of our waking lives. Dr. William Dement, Stanford Professor and one of the world's foremost experts on sleep and sleep deprivation, joins SLAC's Colloquium Series to present exciting new findings in the field of sleep research. You'll never sleep the same again!

  9. SLAC B Factory computing

    International Nuclear Information System (INIS)

    Kunz, P.F.

    1992-02-01

    As part of the research and development program in preparation for a possible B Factory at SLAC, a group has been studying various aspects of HEP computing. In particular, the group is investigating the use of UNIX for all computing, from data acquisition, through analysis, and word processing. A summary of some of the results of this study will be given, along with some personal opinions on these topics

  10. SLAC SPIRES HEP database

    CERN Document Server

    Contains over 400,000 bibliographic summaries for particle physics papers (e-prints, journal articles, preprints, reports, theses, etc.). Covers 1974 to the present and is updated daily with links to electronic texts ( e.g. from LANL, CERN, KEK, and other HEP servers). Searchable by all authors and authors' affiliations, title, topic, report number, citation (footnotes), e-print archive number, date, journal, etc. A joint project of the SLAC and DESY libraries with the collaboration of many other research institutions and scholarly societies such as the APS.

  11. Luminosity enhancements at SLAC

    International Nuclear Information System (INIS)

    Coward, D.H.

    1984-04-01

    Several ideas are discussed that have been proposed to improve the luminosity at the SPEAR and PEP electron-positron storage rings and to insure good luminosity at the SLAC Linear Collider. There have been two proposals studied recently for SPEAR: a Microbeta insertion using Samarium Cobalt permanent magnets, and a Minibeta insertion using conventional quadrupole magnets. The notations Microbeta and minibeta used here are somewhat arbitrary since the front faces of the first quadrupole magnets for both insertions are at nearly the same distance from the interaction point

  12. UV curable lens production using molecular weight controlled PEEK based acrylic oligomer (Ac-PEEK).

    Science.gov (United States)

    İnan, Tulay Y; Yıldız, Emel; Karaca, Birsen; Dogan, Hacer; Vatansever, Alican; Nalbant, Muhammed; Eken, Koray

    2014-08-01

    We produced UV curable lenses with properties blocking short wave UV light. In the UV-curable formulations, we used an oligomer (Ac-PEEK) with another urethan oligomer (Mw = 2000). Radically active, molecular weight controlled Ac-PEEK was obtained by reacting 2-hydroxyl ethyl methacrylate with molecular- weight- controlled and isocyanate terminated PEEK (Mn = 4500). We characterized all synthesized monomer, oligomer and optical materials with UV/Vis spectrophotometer with interferogram, elemental analyser, mass spectrophotometer, proton nuclear magnetic resonance, Fourier transform infrared spectroscopy, thermal gravimetric analyzer, differential scanning calorimeter, scanning electron microscopy and gas chromatography. Results suggested that newly synthesized oligomer with the structure of PEEK absorbs short wave UV-light. Ageing tests [ISO 11979-5, Ophthalmic implants-intraocular lenses (IOL)-Part 5: Biocompatibility] performed on the IOL materials were successful. High contact angle of the obtained lenses suggests that all lenses were hydrophobic and SEM results revealed that lenses are morphologically homogeneous. Based on all positive properties just mentioned, we safely conclude that the lenses produced in this study are very promising for IOL production.

  13. The SLAC linear collider

    International Nuclear Information System (INIS)

    Phinney, N.

    1992-01-01

    The SLAC Linear Collider has begun a new era of operation with the SLD detector. During 1991 there was a first engineering run for the SLD in parallel with machine improvements to increase luminosity and reliability. For the 1992 run, a polarized electron source was added and more than 10,000 Zs with an average of 23% polarization have been logged by the SLD. This paper discusses the performance of the SLC in 1991 and 1992 and the technical advances that have produced higher luminosity. Emphasis will be placed on issues relevant to future linear colliders such as producing and maintaining high current, low emittance beams and focusing the beams to the micron scale for collisions. (Author) tab., 2 figs., 18 refs

  14. Combined pars plana lensectomy-vitrectomy with open-loop flexible anterior chamber intraocular lens (AC IOL) implantation for subluxated lenses.

    Science.gov (United States)

    Kazemi, S; Wirostko, W J; Sinha, S; Mieler, W F; Koenig, S B; Sheth, B P

    2000-01-01

    To review our experience with combined pars plana lensectomy-vitrectomy and open-loop flexible anterior chamber intraocular lens (AC IOL) implantation for managing subluxated crystalline lenses. Retrospective review of 36 consecutive eyes (28 patients), all of which had subluxated crystalline lenses, managed by pars plana lensectomy-vitrectomy with insertion of an open-loop flexible AC IOL. The study was performed at the Medical College of Wisconsin, Milwaukee, over an 8-year period. An average preoperative visual acuity of 20/163 (range, 20/25 to hand motions) improved to 20/36 (range, 20/20 to 4/200) with surgery after a mean follow-up of 14 months (range, 1 to 59 months) (P IOL implantation appears to be an excellent technique for managing subluxated crystalline lenses. It is associated with a significant improvement in visual acuity (P subluxated lens through a limbal wound. Additionally, use of an AC IOL offers a simplified alternative to placement of a ciliary sulcus sutured posterior chamber intraocular lens (PC IOL).

  15. Plasma lenses for SLAC Final Focus Test facility

    International Nuclear Information System (INIS)

    Betz, D.; Cline, D.; Joshi, C.; Rajagopalan, S.; Rosenzweig, J.; Su, J.J.; Williams, R.; Chen, P.; Gundersen, M.; Katsouleas, T.; Norem, J.

    1991-01-01

    A collaborative group of accelerator and plasma physicists and engineers has formed with an interest in exploring the use of plasma lenses to meet the needs of future colliders. Analytic and computational models of plasma lenses are briefly reviewed and several design examples for the SLAC Final Focus Test Beam are presented. The examples include discrete, thick, and adiabatic lenses. A potential plasma source with desirable lens characteristics is presented

  16. GOLDEN GRAVITATIONAL LENSING SYSTEMS FROM THE SLOAN LENS ACS SURVEY. I. SDSS J1538+5817: ONE LENS FOR TWO SOURCES ,

    International Nuclear Information System (INIS)

    Grillo, C.; Seitz, S.; Bender, R.; Eichner, T.; Bauer, A.; Lombardi, M.; Gobat, R.

    2010-01-01

    We present a gravitational lensing and photometric study of the exceptional strong lensing system SDSS J1538+5817, identified by the Sloan Lens Advanced Camera for Survey. The lens is a luminous elliptical galaxy at redshift z l = 0.143. Using Hubble Space Telescope public images obtained with two different filters, the presence of two background sources lensed, respectively, into an Einstein ring and a double system is ascertained. Our new spectroscopic observations, performed at the Nordic Optical Telescope, reveal unequivocally that the two sources are located at the same redshift z s = 0.531. We investigate the total (luminous and dark) mass distribution of the lens between 1 and 4 kpc from the galaxy center by means of parametric and non-parametric lensing codes that describe the multiple images as point-like objects. Bootstrapping and Bayesian analyses are performed to determine the uncertainties on the quantities relevant to the lens mass characterization. Several disparate lensing models provide results that are consistent, given the errors, with those obtained from the best-fit model of the lens mass distribution in terms of a singular power-law ellipsoid model. In particular, the lensing models agree on: (1) reproducing accurately the observed positions of the images; (2) predicting a nearly axisymmetric total mass distribution, centered and oriented as the light distribution; (3) measuring a value of 8.11 +0.27 -0.59 x 10 10 M sun for the total mass projected within the Einstein radius of 2.5 kpc; and (4) estimating a total mass density profile slightly steeper than an isothermal one (ρ(r)∝r -2.33 +0.43 -0.20 ). A fit of the Sloan Digital Sky Survey multicolor photometry with composite stellar population models provides a value of 20 +1 -4 x 10 10 M sun for the total mass of the galaxy in the form of stars and of 0.9 +0.1 -0.2 for the fraction of projected luminous over total mass enclosed inside the Einstein radius. By combining lensing (total) and

  17. Golden Gravitational Lensing Systems from the Sloan Lens ACS Survey. I. SDSS J1538+5817: One Lens for Two Sources

    Science.gov (United States)

    Grillo, C.; Eichner, T.; Seitz, S.; Bender, R.; Lombardi, M.; Gobat, R.; Bauer, A.

    2010-02-01

    We present a gravitational lensing and photometric study of the exceptional strong lensing system SDSS J1538+5817, identified by the Sloan Lens Advanced Camera for Survey. The lens is a luminous elliptical galaxy at redshift zl = 0.143. Using Hubble Space Telescope public images obtained with two different filters, the presence of two background sources lensed, respectively, into an Einstein ring and a double system is ascertained. Our new spectroscopic observations, performed at the Nordic Optical Telescope, reveal unequivocally that the two sources are located at the same redshift zs = 0.531. We investigate the total (luminous and dark) mass distribution of the lens between 1 and 4 kpc from the galaxy center by means of parametric and non-parametric lensing codes that describe the multiple images as point-like objects. Bootstrapping and Bayesian analyses are performed to determine the uncertainties on the quantities relevant to the lens mass characterization. Several disparate lensing models provide results that are consistent, given the errors, with those obtained from the best-fit model of the lens mass distribution in terms of a singular power-law ellipsoid model. In particular, the lensing models agree on: (1) reproducing accurately the observed positions of the images; (2) predicting a nearly axisymmetric total mass distribution, centered and oriented as the light distribution; (3) measuring a value of 8.11+0.27 -0.59 × 1010 M sun for the total mass projected within the Einstein radius of 2.5 kpc; and (4) estimating a total mass density profile slightly steeper than an isothermal one (ρ (r) ∝ r^{-2.33^{+0.43}_{-0.20}}). A fit of the Sloan Digital Sky Survey multicolor photometry with composite stellar population models provides a value of 20+1 -4 × 1010 M sun for the total mass of the galaxy in the form of stars and of 0.9+0.1 -0.2 for the fraction of projected luminous over total mass enclosed inside the Einstein radius. By combining lensing (total

  18. Polarized electron beams at SLAC

    International Nuclear Information System (INIS)

    Moffeit, K.C.

    1992-11-01

    SLAC has successfully accelerated high energy polarized electrons for the Stanford Linear Collider and fixed polarized nuclear target experiments. The polarized electron beams at SLAC use a gallium arsenide (GaAlAs for E-142) photon emission source to provide the beam of polarized electrons with polarization of approximately 28% (41% for E-142). While the beam emittance is reduced in the damping ring for SLC operation a system of bend magnets and superconducting solenoids preserve and orient the spin direction for maximum longitudinal polarization at the collision point. The electron polarization is monitored with a Compton scattering polarimeter, and was typically 22% at the e+e- collision point for the 1992 run. Improvements are discussed to increase the source polarization and to reduce the depolarization effects between the source and the collision point

  19. THE SLACS SURVEY. VIII. THE RELATION BETWEEN ENVIRONMENT AND INTERNAL STRUCTURE OF EARLY-TYPE GALAXIES

    NARCIS (Netherlands)

    Treu, Tommaso; Gavazzi, Raphael; Gorecki, Alexia; Marshall, Philip J.; Koopmans, Leon V. E.; Bolton, Adam S.; Moustakas, Leonidas A.; Burles, Scott

    2009-01-01

    We study the relation between the internal structure of early-type galaxies and their environment using 70 strong gravitational lenses from the SLACS Survey. The Sloan Digital Sky Survey (SDSS) database is used to determine two measures of overdensity of galaxies around each lens-the projected

  20. The SLAC polarized electron source

    International Nuclear Information System (INIS)

    Tang, H.; Alley, R.; Frisch, J.

    1995-06-01

    The SLAC polarized electron source employs a photocathode DC high voltage gun with a loadlock and a YAG pumped Ti:sapphire laser system for colliding beam experiments or a flash lamp pumped Ti:sapphire laser for fixed target experiments. It uses a thin, strained GaAs(100) photocathode, and is capable of producing a pulsed beam with a polarization of ≥80% and a peak current exceeding 10 A. Its operating efficiency has reached 99%. The physics and technology of producing high polarization electron beams from a GaAs photocathode will be reviewed. The prospects of realizing a polarized electron source for future linear colliders will also be discussed

  1. Wakefields in SLAC linac collimators

    Directory of Open Access Journals (Sweden)

    A. Novokhatski

    2014-12-01

    Full Text Available When a beam travels near collimator jaws, it gets an energy loss and a transverse kick due to the backreaction of the beam field diffracted from the jaws. The effect becomes very important for an intense short bunch when a tight collimation of the background beam halo is required. In the Linac Coherent Light Source at SLAC a collimation system is used to protect the undulators from radiation due to particles in the beam halo. The halo is most likely formed from gun dark current or dark current in some of the accelerating sections. However, collimators are also responsible for the generation of wake fields. The wake field effect from the collimators not only brings an additional energy jitter and change in the trajectory of the beam, but it also rotates the beam on the phase plane, which consequently leads to a degradation of the performance of the Free Electron Laser at the Linac Coherent Light Source. In this paper, we describe a model of the wake field radiation in the SLAC linac collimators. We use the results of a numerical simulation to illustrate the model. Based on the model, we derive simple formulas for the bunch energy loss and the average kick. We also present results from experimental measurements that confirm our model.

  2. SLAC accelerator operations report: 1995--1997

    International Nuclear Information System (INIS)

    Erickson, R.; Allen, C.W.; Anderson, S.; Linebarger, W.; Stanek, M.

    1997-05-01

    Operational statistics for the linear accelerator programs at SLAC are presented, including run-time records for SLC and the fixed-target programs. Also included are summaries of reliability and maintenance-related statistics

  3. Longitudinal and transverse wake potentials in SLAC

    International Nuclear Information System (INIS)

    Bane, K.; Wilson, P.

    1980-01-01

    In a machine with short bunches of high peak currents, such as the SLAC collider, one needs to know the longitudinal wake potential, for the higher mode losses, and the transverse wake potential, since, for bunches passing slightly off axis, the induced transverse forces will tend to cause beam break up. The longitudinal and transverse wakes of the SLAC structure presented here, were calculated by computer using the modal method, and including an analytic extension for higher modes. (Auth.)

  4. X-BAND KLYSTRON DEVELOPMENT AT SLAC

    Energy Technology Data Exchange (ETDEWEB)

    Vlieks, Arnold E.; /SLAC

    2009-08-03

    The development of X-band klystrons at SLAC originated with the idea of building an X-band Linear Collider in the late 1980's. Since then much effort has been expended in developing a reliable X-band Power source capable of delivering >50 MW RF power in pulse widths >1.5 {micro}s. I will report on some of the technical issues and design strategies which have led to the current SLAC klystron designs.

  5. SLC Energy Upgrade Program at SLAC

    International Nuclear Information System (INIS)

    Loew, G.A.; Allen, M.A.; Cassel, R.L.; Dean, N.R.; Konrad, G.T.; Koontz, R.F.; Lebacqz, J.V.

    1985-03-01

    The SLAC Linear Collider (SLC) must reach a nominal center-of-mass energy of 100 GeV to fulfill its high energy physics goals. This paper describes the energy upgrade program that is being implemented on the SLAC linear accelerator to meet these goals. It includes a discussion of the design requirements and available technical options, the rationale for the adopted solution, and the technical problems involved in the engineering and production of klystrons and modulators

  6. SIMS: The SLAC Industrial Measurement System

    International Nuclear Information System (INIS)

    Bell, B.

    1990-01-01

    Kern was the first survey company to market an Industrial Measurement System when it released ECDS (Electronic Coordinate Determination System) in the mid-1980s. Originally written for the PDP-11, a version was later released for the PC (ECDS-PC). SLAC purchased this system in 1986 and immediately began to use it for the alignment of the SLC (Stanford Linear Collider). Although ECDS enabled SLAC to perform tasks with a speed never before achieved, they experienced limitations in the software. Since Kern proved unresponsive and SLAC was unable to purchase the source code for any amount of money, they set about writing their own portions of code. They first wrote a system of menus tailored for their specific alignment tasks, and disabled much of the ECDS menu structure. Due to dissatisfaction with the ECDS bundle adjustment program, they wrote their own bundle adjustment in 1988. A further step towarad having their own complete IMS was to develop a data capture program, a task which has been underway since the beginning of this year. They do not yet have data analysis features that are fully integrated, but they do have stand-alone packages that have been written at SLAC. When they first started tinkering with ECDS there was no intention of developing a complete system, but they now have all the elements of such a system - SIMS, the SLAC Industrial Measurement System

  7. Computer control of rf at SLAC

    International Nuclear Information System (INIS)

    Schwarz, H.D.

    1985-03-01

    The Stanford Linear Accelerator is presently upgraded for the SLAC Linear Collider project. The energy is to be increased from approximately 31 GeV to 50 GeV. Two electron beams and one positron beam are to be accelerated with high demands on the quality of the beams. The beam specifications are shown. To meet these specifications, all parameters influencing the beams have to be under tight control and continuous surveillance. This task is accomplished by a new computer system implemented at SLAC which has, among many other functions, control over rf accelerating fields. 13 refs., 8 figs., 2 tabs

  8. Physics results with polarized electrons at SLAC

    International Nuclear Information System (INIS)

    Prescott, C.Y.

    1996-03-01

    Polarized electron beams can play an important role in the dynamics of interactions at high energies. Polarized electron beams at SLAC have been an important part of the physics program since 1970, when they were first proposed for use in testing the spin structure of the proton. Since 1992, the SLAC linear accelerator and the SLC have operated solely with polarized electrons, providing data for tests of QCD in studies of the spin structure of the nucleon and tests of the electroweak sector of the Standard Model. In the following sections, the performance of the source is summarized, and some of the recent results using the polarized beams are discussed

  9. Operational experience with SLAC's beam containment electronics

    International Nuclear Information System (INIS)

    Constant, T.N.; Crook, K.; Heggie, D.

    1977-03-01

    Considerable operating experience was accumulated at SLAC with an extensive electronic system for the containment of high power accelerated beams. Average beam power at SLAC can approach 900 kilowatts with the potential for burning through beam stoppers, protection collimators, and other power absorbers within a few seconds. Fast, reliable, and redundant electronic monitoring circuits have been employed to provide some of the safeguards necessary for minimizing the risk to personnel. The electronic systems are described, and the design philosophy and operating experience are discussed

  10. Future Proof for Physics: Preserving the Record of SLAC

    Energy Technology Data Exchange (ETDEWEB)

    Deken, Jean M

    2003-05-14

    Paper provides a brief introduction to SLAC, discusses the origins of the SLAC Archives and History Office, its present-day operations, and the present and future challenges it faces in attempting to preserve an accurate historical record of SLAC's activities.

  11. SLAC physicists develop test for string theory

    CERN Multimedia

    Yajnik, Juhi

    2006-01-01

    "Under certain conditions, string theory solves many of the questions wracking the minds of physicists, but until recently it had one major flaw - it could not be tested. SLAC (Stanford Linear Accelerator Center) scientists have found a way to test this revolutionary theory, which posits that there are 10 or 11 dimensions in our universe" (1 page)

  12. Progress report on the SLAC Linear Collider

    International Nuclear Information System (INIS)

    Rees, J.

    1986-06-01

    The SLAC Linear Collider project (SLC) is reported as being near completion. The performance specifications are tabulated both for the initial form and for eventual goals. Various parts of the SLC are described and the status of their construction is reported, including the front end electron gun and booster, the linac, damping ring, positron source, SLC arcs, and conventional facilities. 5 refs., 12 figs

  13. Liquid Hydrogen Target Experience at SLAC

    International Nuclear Information System (INIS)

    Weisend, J. G. II; Boyce, R.; Candia, A.; Kaminskas, W.; Mark, J.; Racine, M.; St Lorant, S.; Weber, T.; Arnold, R.; Bosted, P.; Carr, R.; Gao, J.; Jones, C. E.; McKeown, R.

    2006-01-01

    Liquid hydrogen targets have played a vital role in the physics program at SLAC for the past 40 years. These targets have ranged from small 'beer can' targets to the 1.5 m long E158 target that was capable of absorbing up to 800 W without any significant density changes. Successful use of these targets has required the development of thin-wall designs, liquid hydrogen pumps, remote positioning and alignment systems, safety systems, control and data acquisition systems, cryogenic cooling circuits and heat exchangers. Detailed operating procedures have been created to ensure safety and operational reliability.This paper surveys the evolution of liquid hydrogen targets at SLAC and discusses advances in several of the enabling technologies that made these targets possible

  14. ''ARBOLA'' SLAC branch driver for PDP-11

    International Nuclear Information System (INIS)

    Oxoby, G.

    1976-08-01

    The wide use of CAMAC systems in the Large Aperture Solenoid Spectrometer facility led to the design of several dedicated CAMAC interfaces. The one described here features the implementation of bidirectional data transfers, and is used exclusively with the SLAC crate controller, 135-279. Efforts were made to ensure maximum versatility for acquisition of high-energy physics data. Specifications are set forth, and hardware and software (memory address register, word count register, data buffer register, and high-byte register) are described. 4 figures

  15. Binary rf pulse compression experiment at SLAC

    International Nuclear Information System (INIS)

    Lavine, T.L.; Spalek, G.; Farkas, Z.D.; Menegat, A.; Miller, R.H.; Nantista, C.; Wilson, P.B.

    1990-06-01

    Using rf pulse compression it will be possible to boost the 50- to 100-MW output expected from high-power microwave tubes operating in the 10- to 20-GHz frequency range, to the 300- to 1000-MW level required by the next generation of high-gradient linacs for linear for linear colliders. A high-power X-band three-stage binary rf pulse compressor has been implemented and operated at the Stanford Linear Accelerator Center (SLAC). In each of three successive stages, the rf pulse-length is compressed by half, and the peak power is approximately doubled. The experimental results presented here have been obtained at low-power (1-kW) and high-power (15-MW) input levels in initial testing with a TWT and a klystron. Rf pulses initially 770 nsec long have been compressed to 60 nsec. Peak power gains of 1.8 per stage, and 5.5 for three stages, have been measured. This corresponds to a peak power compression efficiency of about 90% per stage, or about 70% for three stages, consistent with the individual component losses. The principle of operation of a binary pulse compressor (BPC) is described in detail elsewhere. We recently have implemented and operated at SLAC a high-power (high-vacuum) three-stage X-band BPC. First results from the high-power three-stage BPC experiment are reported here

  16. Wake fields in SLAC Linac Collimators

    Energy Technology Data Exchange (ETDEWEB)

    Novokhatski, Alexander [SLAC National Accelerator Laboratory (SLAC), Menlo Park, CA (United States); Stanford Univ., Stanford, CA (United States); Decker, F. -J. [SLAC National Accelerator Laboratory (SLAC), Menlo Park, CA (United States); Stanford Univ., Stanford, CA (United States); Smith, H. [SLAC National Accelerator Laboratory (SLAC), Menlo Park, CA (United States); Stanford Univ., Stanford, CA (United States); Sullivan, M. [SLAC National Accelerator Laboratory (SLAC), Menlo Park, CA (United States); Stanford Univ., Stanford, CA (United States)

    2014-12-02

    When a beam travels near collimator jaws, it gets an energy loss and a transverse kick due to the backreaction of the beam field diffracted from the jaws. The effect becomes very important for an intense short bunch when a tight collimation of the background beam halo is required. In the Linac Coherent Light Source at SLAC a collimation system is used to protect the undulators from radiation due to particles in the beam halo. The halo is most likely formed from gun dark current or dark current in some of the accelerating sections. However, collimators are also responsible for the generation of wake fields. The wake field effect from the collimators not only brings an additional energy jitter and change in the trajectory of the beam, but it also rotates the beam on the phase plane, which consequently leads to a degradation of the performance of the Free Electron Laser at the Linac Coherent Light Source. In this paper, we describe a model of the wake field radiation in the SLAC linac collimators. We use the results of a numerical simulation to illustrate the model. Based on the model, we derive simple formulas for the bunch energy loss and the average kick. In addition, we also present results from experimental measurements that confirm our model.

  17. SLAC low emittance accelerator test facility

    International Nuclear Information System (INIS)

    Loew, G.A.; Miller, R.H.; Sinclair, C.K.

    1986-05-01

    SLAC is proposing to build a new Accelerator Test Facility (ATF) capable of producing a 50 MeV electron beam with an extremely low geometric tranverse emittance (1.5 x 10 -10 rad.m) for the purpose of testing new methods of acceleration. The low emittance will be achieved by assembling a linear accelerator using one standard SLAC three-meter section and a 400 kV electron gun with a very small photocathode (40 microns in diameter). The photocathode will be illuminated from the back by short bursts (on the order of 6 ps) of visible laser light which will produce bunches of about 10 5 electrons. Higher currents could be obtained by illuminating the cathode from the front. The gun will be mounted directly against the accelerator section. Calculations show that in the absence of an rf buncher, injection of these 400 keV small radius electron bunches roughly 30 0 ahead of crest produces negligible transverse emittance growth due to radial rf forces. Acceleration of the electrons up to 50 MeV followed by collimation, energy slits and focusing will provide a 3.2 mm long waist of under 1.5 μm in diameter where laser acceleration and other techniques can be tested

  18. SLAC workshop on high energy electroproduction and spin physics

    International Nuclear Information System (INIS)

    1992-01-01

    These Proceedings contain copies of the transparencies presented at the Workshop on High Energy Electroproduction and Spin Physics held at SLAC on February 5--8, 1992. The purpose of this Workshop was to bring people together to discuss the possibilities for new experiments using the SLAC high intensity electron and photon beams and the facilities of End Station A

  19. Commissioning of SLAC SLD 45-Degree Chambers

    Energy Technology Data Exchange (ETDEWEB)

    Eschenburg, Vance O.

    2002-07-19

    The SLD experiment at the Stanford Linear Accelerator Center had a significant gap in its muon tracking coverage, provided by the Warm Iron Calorimeter. Supplemental planes of limited streamer tube chambers were added to improve the coverage in the vicinity of the gap at 0.65 < |cos{theta}| < 0.85. A software effort to upgrade the tracking software for this system is detailed. The commissioning of the forty-five degree chamber region of the SLAC SLD Warm Iron Calorimeter is presented. This task involved the completion of the forty-five degree chamber region geometry for the Warm Iron Calorimeter's fitter and swimmer and the changing of the way multiple scattering effects are treated in the fitter algorithm.

  20. Microprocessors in physics experiments at SLAC

    International Nuclear Information System (INIS)

    Rochester, L.S.

    1981-01-01

    The increasing size and complexity of high energy physics experiments is changing the way data are collected. To implement a trigger or event filter requires complex logic which may have to be modified as the experiment proceeds. Simply to monitor a detector, large amounts of data must be processed online. The use of microprocessors or other programmable devices can help to achieve these ends flexibly and economically. At SLAC, a number of microprocessor-based systems have been built and are in use in experimental setups, and others are now being developed. This talk is a review of existing systems and their use in experiments, and of developments in progress and future plans. (orig.)

  1. Microprocessors in physics experiments at SLAC

    International Nuclear Information System (INIS)

    Rochester, L.S.

    1981-04-01

    The increasing size and complexity of high energy physics experiments is changing the way data are collected. To implement a trigger or event filter requires complex logic which may have to be modified as the experiment proceeds. Simply to monitor a detector, large amounts of data must be processed on line. The use of microprocessors or other programmable devices can help to achieve these ends flexibly and economically. At SLAC, a number of microprocessor-based systems have been built and are in use in experimental setups, and others are now being developed. This talk is a review of existing systems and their use in experiments, and of developments in progress and future plans

  2. SLAC pulsed x-ray facility

    International Nuclear Information System (INIS)

    Ipe, N.E.; McCall, R.C.; Baker, E.D.

    1986-05-01

    The Stanford Linear Accelerator Center (SLAC) operates a high energy (up to 33 GeV) linear accelerator delivering pulses up to a few microseconds wide. The pulsed nature of the electron beam creates problems in the detection and measurement of radiation both from the accelerator beam and the klystrons that provide the rf power for the accelerator. Hence, a pulsed x-ray facility has been built at SLAC mainly for the purpose of testing the response of different radiation detection instruments to pulsed radiation fields. The x-ray tube consists of an electron gun with a control grid. This provides a stream of pulsed electrons that can be accelerated towards a confined target-window. The window is made up of aluminium 0.051 cm (20 mils) thick, plated on the vacuum side with a layer of gold 0.0006 cm (1/4 mil) thick. The frequency of electron pulses can be varied by an internal pulser from 60 to 360 pulses per second with pulse widths of 360 ns to 5 μs. The pulse amplitude can be varied over a wide range of currents. An external pulser can be used to obtain other frequencies or special pulse shapes. The voltage across the gun can be varied from 0 to 100 kV. The major part of the x-ray tube is enclosed in a large walk-in-cabinet made of 1.9 cm (3/4 in) plywood and lined with 0.32 cm (1/8 in) lead to make a very versatile facility. 3 refs., 5 figs

  3. The creation of SLAC leading to 30 years of operation

    International Nuclear Information System (INIS)

    Panofsky, W.K.H.

    1996-01-01

    The different phases of operation of SLAC which provided the basis of its longevity are outlined. SLAC has been an unusually productive laboratory both in terms of genuinely new revelations and the accumulation of archival data. Current operation of SLAC is divided between fixed target experiments, whose energy has now been extended to 50 GeV, and continued use of the SLC with the SLAC large detector. Because of the availability of polarization, results obtained in the SLC-SLD combination have been competitive with the experiments using LEP at CERN, notwithstanding the significantly larger available luminosities at the much larger LEP machine. In addition the SLC, together with specialized test facilities, constitute a basic laboratory to determine the design of the Next Linear Collider (NLC)

  4. The Search for Millicharged Particles at SLAC

    Energy Technology Data Exchange (ETDEWEB)

    Prinz, Alyssa A

    2002-04-01

    Quantization of electric charge has been probed to a high degree of precision using a variety of experimental techniques. However, the theoretical underpinning of charge quantization has yet to be determined, leaving open the possibility that quantization is not a fundamental law of nature, and that free particles with fractional electric charge may one day be encountered. This dissertation describes a search for particles with very small (10{sup -3}e or below) electric charge, carried out at an electron accelerator (SLAC). The particles sought were assumed to be long lived or stable and to participate primarily in electromagnetic interactions. The search relied upon a large (1.3-meter) scintillation counter to detect low levels of ionization generated by relativistic fractionally charged particles produced in the collision of a 29.5-GeV electron beam with a six radiation length tungsten target. The data reveal no evidence of fractional charge, and allow for the exclusion of a portion of charge-mass parameter space spanning roughly 10{sup -7} to 10{sup 2} MeV/c{sup 2} and 10{sup -2} to 10{sup -5} e.

  5. Parton distributions from SMC and SLAC data

    International Nuclear Information System (INIS)

    Ramsey, G.P.

    1996-01-01

    We have extracted spin-weighted parton distributions in a proton from recent data at CERN and SLAC. The valence, sea quark and Antiquark spin-weighted distributions are determined separately. The data are all consistent with a small to moderate polarized gluon distribution, so that the anomaly term is not significant in the determination of the constituent contributions to the spin of the proton. We have analyzed the consistency of the results obtained from various sets of data and the Biorken sum rule. Although all data are consistent with the sum rule, the polarized distributions from different experiments vary, even with higher order QCD corrections taken into account. Results split into two models, one set implying a large polarized strange sea which violates the positivity bound, and the other set yielding a smaller polarized strange sea. Only further experiments which extract information about the polarized sea will reconcile these differences. We suggest specific experiments which can be performed to determine the size of the polarized sea and gluons

  6. A 100 GeV SLAC Linac

    International Nuclear Information System (INIS)

    Farkas, Zoltan D

    2002-01-01

    The SLAC beam energy can be increased from the current 50 GeV to 100 GeV, if we change the operating frequency from the present 2856 MHz to 11424 MHz, using technology developed for the NLC. We replace the power distribution system with a proposed NLC distribution system as shown in Fig. 1. The four 3 meter s-band 820 nS fill time accelerator sections are replaced by six 2 meter x-band 120 nS fill time sections. Thus the accelerator length per klystron retains the same length, 12 meters. The 4050 65MW-3.5(micro)S klystrons are replaced by 75MW-1.5(micro)S permanent magnet klystrons developed here and in Japan. The present input to the klystrons would be multiplied by a factor of 4 and possibly amplified. The SLED [1] cavities have to be replaced. The increase in beam voltage is due to the higher elastance to group velocity ratio, higher compression ratio and higher unloaded to external Q ratio of the new SLED cavities. The average power input is reduced because of the narrower klystron pulse width and because the klystron electro-magnets are replaced by permanent magnets

  7. Search milli-charged particles at SLAC

    Energy Technology Data Exchange (ETDEWEB)

    Langeveld, W.G.J. [Stanford Univ., CA (United States)

    1997-01-01

    Particles with electric charge q {triple_bond} Qe {le} 10{sup -3} e and masses in the range 1-1000 MeV/c{sup 2} are not excluded by present experiments or by astrophysical or cosmological arguments. A beam dump experiment uniquely suited to the detection of such {open_quotes}milli-charged{close_quotes} particles has been carried out at SLAC, utilizing the short-duration pulses of the SLC electron beam to establish a tight coincidence window for the signal. The detector, a large scintillation counter sensitive to very small energy depositions, provided much greater sensitivity than previous searches. Analysis of the data leads to the exclusion of a substantial portion of the charge-mass plane. In this report, a preliminary mass-dependent upper limit is presented for the charge of milli-charged particles, ranging from Q = 1.7 x 10{sup -5} at milli-charged particle mass 0.1 MeV/c{sup 2} to Q = 9.5 x 10{sup -4} at 100 MeV/c{sup 2}.

  8. Wide-band cable systems at SLAC

    International Nuclear Information System (INIS)

    Struven, W.

    1983-01-01

    SLAC's first cable TV system was installed in 1979 to remotely monitor a narrow pulse which was generated in the west end of the klystron gallery. When Stanford Linear Collider (SLC) experimental work started at the west end of the accelerator, the original 1979 cable was upgraded to a bidirectional system so that 2 MBaud point-to-point data and several video and 9600 baud channels could be transmitted. The implementation of the SLC requires a complete upgrading of the accelerator control system. The system is based on a distributed processing configuration using a PDP11/780 VAX in the Main Control Center (MCC) and Intel single-board computers in a multibus configuration along the accelerator. The high-speed data linking is supplied by a 1 MBaud Time Division Multiple Access (TDMA) Network. The same cable is used to provide video, low-speed data, voice and high-speed point-to-point data services. The transmission system will utilize a wideband midsplit cable facility to collect and distribute signals to all parts of the network

  9. Radiation aspects of the B-Factory at SLAC

    International Nuclear Information System (INIS)

    Liu, J.C.; Nelson, W.R.; Mao, X.S.

    1996-11-01

    The B-Factor is a high-energy physics project at SLAC that studies the phenomenon of CP violation from collisions between two stored beams; high energy electrons (HER, maximum 12-GeV) and low energy positrons (LER, maximum 4-GeV). Both the HER and LER are located in an underground tunnel of 2,200-m-long circumference with a maximum stored current of 3 A. The injector consists of the existing SLAC 2-mile-long LINAC with two extraction and transport lines for both rings. Radiation aspects of the machine are addressed in the context of machine protection and personnel protection. Specific illustrations (e.g., the estimations of neutron, photon and synchrotron radiation environment in the ring tunnel and the radiation levels outside a typical Interaction Region, etc.) are given to show a few natures of the radiation issues for the B-Factory and to reflect the appropriate SLAC policies on radiation safety

  10. Review of the SLAC and Les Houches workshops

    International Nuclear Information System (INIS)

    Prescott, C.Y.

    1994-12-01

    Polarized Electron Source workshops have been held at varying intervals, beginning in 1983 when Charles Sinclair convened the first at SLAC. Since that time, three workshops were held in conjunction with the International Spin Symposia and two at other occasions. The increasing importance of polarized electron beams at accelerators has stimulated interest in these workshops. Two workshops have been held since the last International Spin Symposium in Nagoya. In 1993, a workshop was held at SLAC, and in 1994 at Les Houches, a polarized electron beam session was held as part of a polarized beam and targets workshop. This report summarizes highlights from the latter two workshops

  11. The SLAC Polarized Electron Source and Beam for E-158

    Energy Technology Data Exchange (ETDEWEB)

    Humensky, Thomas B

    2003-01-16

    SLAC E-158 is making the first measurement of parity violation in Moeller scattering. E-158 measures the right-left cross-section asymmetry, A{sub LR}, in the scattering of a 45-GeV polarized electron beam off unpolarized electrons in a liquid hydrogen target. E-158 plans to measure the expected Standard Model asymmetry of {approx} 10{sup -7} to an accuracy of better than 10{sup -8}. This paper discusses the performance of the SLAC polarized electron source and beam during E-158's first physics run in April/May 2002.

  12. SLAC Scanner Processor: a FASTBUS module for data collection and processing

    International Nuclear Information System (INIS)

    Brafman, H.; Glanzman, T.; Lankford, A.J.; Olsen, J.; Paffrath, L.

    1984-10-01

    A new, general purpose, programmable FASTBUS module, the SLAC Scanner Processor (SSP), is introduced. Both hardware and software elements of SSP operation are discussed. The role of the SSP within the upgraded Mark II Detector at SLAC is described

  13. Development of the Virtual Visitor Center at SLAC

    International Nuclear Information System (INIS)

    McDunn, Ruth

    1999-01-01

    The Virtual Visitor Center (VVC) web site (www2.slac.stanford.edu/vvc) is a ''virtual'' version of the Visitor Center, a mini science museum that opened at SLAC in 1996. The VVC was made public in December 1998. Both centers contribute to SLAC mission regarding education of the next generation and increasing scientific awareness of the public. The site is designed to mimic the real visitor center and allow a larger audience to the information. The intent was to reach the 8th-12th grade audience. Considerable effort was made to organize the content, including color-coding graphical elements for each main topic area. Tables of contents, a search tool, several photo tours, as well as graphical and non-graphical menu bars allow users many methods of navigating the site. The site was developed over almost two years using an estimated .95 FTE, split between a program manager, graphic designer, content provider (theoretical physicist), and a summer intern (high school teacher). As of November 1999, the site consists of 1,147 files, 935 images, 3,080 internal hyperlinks, and 190 external hyperlinks. The site has had over 1 million hits between January and mid-October 1999 and averages about 600 page views each day. Future plans include bringing the web site into compliance with the W3Cs Web Content Accessibility guidelines, thoroughly integrating the glossary terms, continued incorporation of current research at SLAC, and adding more interactivity

  14. Review of trigger and on-line processors at SLAC

    International Nuclear Information System (INIS)

    Lankford, A.J.

    1984-07-01

    The role of trigger and on-line processors in reducing data rates to manageable proportions in e + e - physics experiments is defined not by high physics or background rates, but by the large event sizes of the general-purpose detectors employed. The rate of e + e - annihilation is low, and backgrounds are not high; yet the number of physics processes which can be studied is vast and varied. This paper begins by briefly describing the role of trigger processors in the e + e - context. The usual flow of the trigger decision process is illustrated with selected examples of SLAC trigger processing. The features are mentioned of triggering at the SLC and the trigger processing plans of the two SLC detectors: The Mark II and the SLD. The most common on-line processors at SLAC, the BADC, the SLAC Scanner Processor, the SLAC FASTBUS Controller, and the VAX CAMAC Channel, are discussed. Uses of the 168/E, 3081/E, and FASTBUS VAX processors are mentioned. The manner in which these processors are interfaced and the function they serve on line is described. Finally, the accelerator control system for the SLC is outlined. This paper is a survey in nature, and hence, relies heavily upon references to previous publications for detailed description of work mentioned here. 27 references, 9 figures, 1 table

  15. Development of the Virtual Visitor Center at SLAC

    Energy Technology Data Exchange (ETDEWEB)

    McDunn, Ruth

    1999-11-17

    The Virtual Visitor Center (VVC) web site (www2.slac.stanford.edu/vvc) is a ''virtual'' version of the Visitor Center, a mini science museum that opened at SLAC in 1996. The VVC was made public in December 1998. Both centers contribute to SLAC mission regarding education of the next generation and increasing scientific awareness of the public. The site is designed to mimic the real visitor center and allow a larger audience to the information. The intent was to reach the 8th-12th grade audience. Considerable effort was made to organize the content, including color-coding graphical elements for each main topic area. Tables of contents, a search tool, several photo tours, as well as graphical and non-graphical menu bars allow users many methods of navigating the site. The site was developed over almost two years using an estimated .95 FTE, split between a program manager, graphic designer, content provider (theoretical physicist), and a summer intern (high school teacher). As of November 1999, the site consists of 1,147 files, 935 images, 3,080 internal hyperlinks, and 190 external hyperlinks. The site has had over 1 million hits between January and mid-October 1999 and averages about 600 page views each day. Future plans include bringing the web site into compliance with the W3Cs Web Content Accessibility guidelines, thoroughly integrating the glossary terms, continued incorporation of current research at SLAC, and adding more interactivity.

  16. Annual Site Environmental Report: 2015 (ASER) for the SLAC National Accelerator Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Sabba, Dellilah [SLAC National Accelerator Lab., Menlo Park, CA (United States)

    2016-09-01

    This report, prepared by the SLAC National Accelerator Laboratory (SLAC) for the U.S. Department of Energy (DOE), SLAC Site Office (SSO), provides a comprehensive summary of the environmental program activities at SLAC for calendar year 2015. Annual Site Environmental Reports (ASERs) are prepared for all DOE sites with significant environmental activities, and distributed to relevant external regulatory agencies and other interested organizations or individuals. To the best of my knowledge, this report accurately summarizes the results of the 2015 environmental monitoring, compliance, and restoration programs at SLAC. This assurance can be made based on SSO and SLAC review of the ASER, and quality assurance protocols applied to monitoring and data analyses at SLAC.

  17. Objective lens

    Science.gov (United States)

    Olczak, Eugene G. (Inventor)

    2011-01-01

    An objective lens and a method for using same. The objective lens has a first end, a second end, and a plurality of optical elements. The optical elements are positioned between the first end and the second end and are at least substantially symmetric about a plane centered between the first end and the second end.

  18. Multi-Device Knob Utility for LCLS at SLAC

    International Nuclear Information System (INIS)

    Zelazny, Michael

    2009-01-01

    At the SLAC National Accelerator Laboratory (SLAC) the Controls Department (CD) has developed a new Multi-Device Knob Utility (MKB) based on the Experimental Physics and Industrial Control System (EPICS) toolkit for controlling one or more Process Variables (PVs) in unison, or simultaneously, from a physical knob located in the control room, or from various software tools such as the EPICS Extensible Display Manager (EDM) or a Swing slider in Java. A group of devices are hooked up to a knob, and then the value written to the devices is a simple function of the value of the knob. This is used, most commonly, to create a bump in the electron beam for the Linac Coherent Light Source (LCLS). Control system variables typically controlled are magnetic fields, phases, and timing offsets. This paper describes the technologies used to implement this utility.

  19. Status of the SLAC SNOOP diagnostic module for FASTBUS

    International Nuclear Information System (INIS)

    Walz, H.V.; Gustavson, D.B.

    1983-03-01

    A SNOOP Diagnostic Module for FASTBUS is under development at SLAC. The SNOOP Module resides on a FASTBUS crate segment and provides diagnostic monitoring and testing capability. It consists of a high-speed ECL front-end to monitor and single-step segment operations, a simple master interface, and a control processor with two serial communication ports. Module features and specifications are summrized, and prototype hardware is shown

  20. The SLAC E-154 {sup 3}He polarimeter

    Energy Technology Data Exchange (ETDEWEB)

    Hughes, E.W. [California Institute of Technology, Pasadena, California 91125 (United States); Chupp, T.E.; Coulter, K.P.; Smith, T.B.; Welsh, R. [University of Michigan, Ann Arbor, Michigan 48109 (United States); Thompson, A.K. [National Institute of Standards and Technology, Gainesville, Maryland 20899 (United States); Romalis, M.V.; Bogorad, P.L.; Cates, G.D.; Kumar, K.S. [Princeton University, Princeton, New Jersey 08544 (United States); Johnson, J.R. [University of Wisconsin, Madison, Wisconsin 53706 (United States)

    1998-01-01

    We describe the NMR and Rb Zeeman frequency shift polarimeters used for determining the {sup 3}He polarization in a recent precision measurement of the neutron spin structure function g{sub 1} at SLAC (E-154). We performed a detailed study of the systematic errors associated with the calibration of the NMR polarimeter. A new technique was used for determining the {sup 3}He polarization from the frequency shift of the Rb Zeeman resonance. {copyright} {ital 1998 American Institute of Physics.}

  1. Compliance of SLAC_s Laser Safety Program with OSHA Requirements for the Control of Hazardous Energy

    Energy Technology Data Exchange (ETDEWEB)

    Woods, Michael; /SLAC

    2009-01-15

    SLAC's COHE program requires compliance with OSHA Regulation 29CFR1910.147, 'The control of hazardous energy (lockout/tagout)'. This regulation specifies lockout/tagout requirements during service and maintenance of equipment in which the unexpected energization or start up of the equipment, or release of stored energy, could cause injury to workers. Class 3B and Class 4 laser radiation must be considered as hazardous energy (as well as electrical energy in associated equipment, and other non-beam energy hazards) in laser facilities, and therefore requires careful COHE consideration. This paper describes how COHE is achieved at SLAC to protect workers against unexpected Class 3B or Class 4 laser radiation, independent of whether the mode of operation is normal, service, or maintenance.

  2. Plasma lens experiments at the Final Focus Test Beam

    International Nuclear Information System (INIS)

    Barletta, B.; Chattopadhyay, S.; Chen, P.

    1993-04-01

    We intend to carry out a series of plasma lens experiments at the Final Focus Test Beam facility at SLAC. These experiments will be the first to study the focusing of particle beams by plasma focusing devices in the parameter regime of interest for high energy colliders, and is expected to lead to plasma lens designs capable of unprecedented spot sizes. Plasma focusing of positron beams will be attempted for the first time. We will study the effects of lens aberrations due to various lens imperfections. Several approaches will be applied to create the plasma required including laser ionization and beam ionization of a working gas. At an increased bunch population of 2.5 x 10 10 , tunneling ionization of a gas target by an electron beam -- an effect which has never been observed before -- should be significant. The compactness of our device should prove to be of interest for applications at the SLC and the next generation linear colliders

  3. Plasma lens experiments at the Final Focus Test Beam

    Energy Technology Data Exchange (ETDEWEB)

    Barletta, B. [California Univ., Los Angeles, CA (United States)]|[Lawrence Berkeley Lab., CA (United States); Chattopadhyay, S. [Lawrence Berkeley Lab., CA (United States); Chen, P. [Stanford Linear Accelerator Center, Menlo Park, CA (United States)] [and others

    1993-04-01

    We intend to carry out a series of plasma lens experiments at the Final Focus Test Beam facility at SLAC. These experiments will be the first to study the focusing of particle beams by plasma focusing devices in the parameter regime of interest for high energy colliders, and is expected to lead to plasma lens designs capable of unprecedented spot sizes. Plasma focusing of positron beams will be attempted for the first time. We will study the effects of lens aberrations due to various lens imperfections. Several approaches will be applied to create the plasma required including laser ionization and beam ionization of a working gas. At an increased bunch population of 2.5 {times} 10{sup 10}, tunneling ionization of a gas target by an electron beam -- an effect which has never been observed before -- should be significant. The compactness of our device should prove to be of interest for applications at the SLC and the next generation linear colliders.

  4. Searching for light dark matter with the SLAC millicharge experiment.

    Science.gov (United States)

    Diamond, M; Schuster, P

    2013-11-27

    New sub-GeV gauge forces ("dark photons") that kinetically mix with the photon provide a promising scenario for MeV-GeV dark matter and are the subject of a program of searches at fixed-target and collider facilities around the world. In such models, dark photons produced in collisions may decay invisibly into dark-matter states, thereby evading current searches. We reexamine results of the SLAC mQ electron beam dump experiment designed to search for millicharged particles and find that it was strongly sensitive to any secondary beam of dark matter produced by electron-nucleus collisions in the target. The constraints are competitive for dark photon masses in the ~1-30 MeV range, covering part of the parameter space that can reconcile the apparent (g-2)(μ) anomaly. Simple adjustments to the original SLAC search for millicharges may extend sensitivity to cover a sizable portion of the remaining (g-2)(μ) anomaly-motivated region. The mQ sensitivity is therefore complementary to ongoing searches for visible decays of dark photons. Compared to existing direct-detection searches, mQ sensitivity to electron-dark-matter scattering cross sections is more than an order of magnitude better for a significant range of masses and couplings in simple models.

  5. Development of X-band klystron technology at SLAC

    International Nuclear Information System (INIS)

    Caryotakis, G.

    1997-05-01

    The SLAC design for a 1-TeV collider (NLC) requires klystrons with a performance which is well beyond the state-of-the-art for microwave tubes in the United States or abroad. The electrical specifications for the NLC klystrons are not fully established, but they are approximately as follows: Frequency, 11.4 GHz; Peak Power, 75 MW; Pulse Length, 1.5 μs; Repetition Rate, 180 Hz; Gain, 50 dB; Efficiency, (including beam focusing) 50%. SLAC is in the seventh year of a program to develop these klystrons. The choice of X-band as the operating frequency, along with the sheer size of the NLC, have resulted in some new, most demanding standards for the klystrons which may power this future machine. These are related to the overall efficiency required, to the high rf gradients that must be supported at the output circuit without vacuum breakdown, and to the manufacturing cost of the 5,000-10,000 klystrons needed for the collider

  6. Lens Model

    DEFF Research Database (Denmark)

    Nash, Ulrik William

    2014-01-01

    Firms consist of people who make decisions to achieve goals. How do these people develop the expectations which underpin the choices they make? The lens model provides one answer to this question. It was developed by cognitive psychologist Egon Brunswik (1952) to illustrate his theory...

  7. SLACINPT - a FORTRAN program that generates boundary data for the SLAC gun code

    International Nuclear Information System (INIS)

    Michel, W.L.; Hepburn, J.D.

    1982-03-01

    The FORTRAN program SLACINPT was written to simplify the preparation of boundary data for the SLAC gun code. In SLACINPT, the boundary is described by a sequence of straight line or arc segments. From these, the program generates the individual boundary mesh point data, required as input by the SLAC gun code

  8. Physics prospects for the SLAC B-Factory

    Energy Technology Data Exchange (ETDEWEB)

    Coward, D.H.

    1996-11-01

    CP violation has been an enigma since its discovery in the decays of neutral kaons in 1964. The present version of the Standard Model can accommodate CP violation by means of a non-zero phase in the Cabibbo-Kobayashi-Maskawa (CKM) matrix. However, CP violation in the kaon system occurs at the part per mille level and the Standard Model`s predictions for CP violation have not been conclusively tested. In contrast to the kaon system, B-mesons decay into a variety of final states, many of which could exhibit CP violation and therefore offer multiple tests of the Standard Model. Several large efforts currently are in progress to create dedicated experiments or factories which will provide large quantities of B-mesons which, in turn, should give large numbers of CP-violating decays. Here, a very brief presentation of the physics prospects for the SLAC B-Factory, now under construction, is presented.

  9. The development of the Next Linear Collider at SLAC

    International Nuclear Information System (INIS)

    Ruth, R.D.

    1992-02-01

    At SLAC, we are pursuing the design of a Next Linear Collider (NLC) which would begin with a center-of-mass energy of 0.5 TeV and be upgradable to at least 1.0 TeV, and possibly 1.5 TeV. The luminosity is designed to be 10 33 cm -2 s -1 at the lower energy and 10 34 cm -2 s -1 at the top energy. In this paper, we discuss the accelerator physics issues which are important in our approach, and also the present state of the technology development. We also review the impact that the SLC has had in the evolution of our basic approach

  10. Computing and data handling recent experiences at Fermilab and SLAC

    International Nuclear Information System (INIS)

    Cooper, P.S.

    1990-01-01

    Computing has become evermore central to the doing of high energy physics. There are now major second and third generation experiments for which the largest single cost is computing. At the same time the availability of ''cheap'' computing has made possible experiments which were previously considered infeasible. The result of this trend has been an explosion of computing and computing needs. I will review here the magnitude of the problem, as seen at Fermilab and SLAC, and the present methods for dealing with it. I will then undertake the dangerous assignment of projecting the needs and solutions forthcoming in the next few years at both laboratories. I will concentrate on the ''offline'' problem; the process of turning terabytes of data tapes into pages of physics journals. 5 refs., 4 figs., 4 tabs

  11. Thermal stress analysis of the SLAC moveable mask. Addendum 2

    International Nuclear Information System (INIS)

    Johnson, G.L.

    1985-01-01

    X-ray beams emerging from the new SLAC electron-positron storage ring (PEP) can impinge on the walls of tangential divertor channels. A moveable mask made of 6061-T6 aluminum is installed in the channel to limit wall heating. The mask is cooled with water flowing axially at 30 0 C. Beam strikes on the mask cause highly localized heating in the channel structure. Analyses were completed to determine the temperatures and thermally-induced stresses due to this heating. The current design and operating conditions should result in the entrance to the moveable mask operating at a peak temperature of 88 0 C with a peak thermal stress at 19% of the yield of 6061-T6 aluminum

  12. High gradient tests of SLAC Linear Collider Accelerator Structures

    International Nuclear Information System (INIS)

    Wang, J.W.; Deruyter, H.; Eichner, J.; Fant, K.H.; Hoag, H.A.; Koontz, R.F.; Lavine, T.; Loew, G.A.; Loewen, R.; Menegat, L.

    1994-08-01

    This paper describes the current SLAC R ampersand D program to develop room temperature accelerator structures for the Next Linear Collider (NLC). The structures are designed to operate at 11.4 GHz at an accelerating gradient in the range of 50 to 100 MV/m. In the past year a 26 cm constant-impedance traveling-wave section, a 75 cm constant-impedance traveling-wave section, and a 1.8 m traveling-wave section with detuned deflecting modes have been high-power tested. The paper presents a brief description of the RF test setup, the design and manufacturing details of the structures, and a discussion of test results including field emission, RF processing, dark current spectrum and RF breakdown

  13. Electron Bunch Length Measurement for LCLS at SLAC

    International Nuclear Information System (INIS)

    Zelazny, M.; Allison, S.; Chevtsov, Sergei; Emma, P.; Kotturi, K.d.; Loos, H.; Peng, S.; Rogind, D.; Straumann, T.

    2007-01-01

    At Stanford Linear Accelerator Center (SLAC) a Bunch Length Measurement system has been developed to measure the length of the electron bunch for its new Linac Coherent Light Source (LCLS). This destructive measurement uses a transverse-mounted RF deflector (TCAV) to vertically streak the electron beam and an image taken with an insertable screen and a camera. The device control software was implemented with the Experimental Physics and Industrial Control System (EPICS) toolkit. The analysis software was implemented in Matlab(trademark) using the EPICS/Channel Access Interface for Scilab(trademark) and Matlab(trademark) (labCA). This architecture allowed engineers and physicists to develop and integrate their control and analysis without duplication of effort

  14. Electron Bunch Length Measurement for LCLS at SLAC

    Energy Technology Data Exchange (ETDEWEB)

    Zelazny, M.; Allison, S.; Chevtsov, Sergei; Emma, P.; Kotturi, K.d.; Loos, H.; Peng, S.; Rogind, D.; Straumann, T.; /SLAC

    2007-10-04

    At Stanford Linear Accelerator Center (SLAC) a Bunch Length Measurement system has been developed to measure the length of the electron bunch for its new Linac Coherent Light Source (LCLS). This destructive measurement uses a transverse-mounted RF deflector (TCAV) to vertically streak the electron beam and an image taken with an insertable screen and a camera. The device control software was implemented with the Experimental Physics and Industrial Control System (EPICS) toolkit. The analysis software was implemented in Matlab{trademark} using the EPICS/Channel Access Interface for Scilab{trademark} and Matlab{trademark} (labCA). This architecture allowed engineers and physicists to develop and integrate their control and analysis without duplication of effort.

  15. SLC status and SLAC [Stanford Linear Accelerator Center] future plans

    International Nuclear Information System (INIS)

    Richter, B.

    1989-08-01

    In this presentation, I shall discuss the linear collider program at the Stanford Linear Accelerator Center as it is now, and as we hope to see it evolve over the next few years. Of greatest interest to the high energy accelerator physics community gathered here is the development of the linear collider concept, and so I shall concentrate most of this paper on a discussion of the present status and future evolution of the SLC. I will also briefly discuss the research and development program that we are carrying out aimed at the realization of the next generation of high-energy linear colliders. SLAC had a major colliding-beam storage-ring program as well, including present rings and design studies on future high-luminosity projects, but time constraints preclude a discussion of them. 8 figs., 3 tabs

  16. SLAC modulator operation and reliability in the SLC Era

    International Nuclear Information System (INIS)

    Donaldson, A.R.; Ashton, J.R.

    1992-06-01

    A discussion of the operation and reliability of the 244 modulators in the SLAC linac with an emphasis on the past three years of operation. The linac modulators were designed and built in the 60's, upgraded for the SLAC Linear Collider (SLC) in the mid 80s, and despite their age are still reliable accelerator components. The 60s modulator operated at 65 MW peak and 83 kW average power. The upgrade resulted in 150 MW peak output at an average power of 87 kW, a modest increase since the repetition rate was dropped from 360 to 120 Hz. In the present accelerator configuration, the Linac operates as a source of electrons and positrons to a single pass coillider. The classic collider is a storage ring filled with oppositely charged, counter-rotating particles which are allowed to collide until an accelerator fault occurs and the stored beams are aborted. A reasonable storage ring can store and collide particles for as long as eight hours with a 10 or 20 minute filling time. A single pass collider, + on the other hand, can only produce e - and e + collisions at whatever rate the source operates. To be effective the SLC must operate at 120 Hz with a very high degree of reliability and on a continuous basis. Fortunately, the linac has a modest excess of modulator/klystron systems which allows some measure of redundancy and hence some freedom from the constraint that all 244 modulator/klystrons operate simultaneously. Nonetheless, high importance is placed on modulator MTBF and MTRR or, in the parlance of reliability experts and accelerator physicists, availability. This is especially true of the modulators associated with the fundamental requirements of a collider such as injection, compression and positron production

  17. Transport of LCLS-II 1.3 Ghz cryomodule to SLAC

    Energy Technology Data Exchange (ETDEWEB)

    McGee, M. W.; Arkan, T.; Peterson, T.; Tang, Z.; Boo, S.; Carrasco, M.; Daly, E.; Huque, N.

    2016-06-30

    In a partnership with SLAC National Accelerator Laboratory (SLAC) and Jefferson Lab, Fermilab will assemble and test 17 of the 35 total 1.3 GHz cryomodules for the Linac Coherent Light Source II (LCLS-II) Project. These include a prototype built and delivered by each Lab. Another two 3.9 GHz cryomodules will be built, tested and transported by Fermilab to SLAC. Each assembly will be transported over-the-road from Fermilab or Jefferson Lab using specific routes to SLAC. The transport system consists of a base frame, isolation fixture and upper protective truss. The strongback cryomodule lifting fixture is described along with other supporting equipment used for both over-the-road transport and local (on-site) transport at Fermilab. Initially, analysis of fragile components and stability studies will be performed in order to assess the risk associated with over-the-road transport of a fully assembled cryomodule.

  18. Homologue Structure of the SLAC1 Anion Channel for Closing Stomata in Leaves

    Energy Technology Data Exchange (ETDEWEB)

    Y Chen; L Hu; M Punta; R Bruni; B Hillerich; B Kloss; B Rost; J Love; S Siegelbaum; W Hendrickson

    2011-12-31

    The plant SLAC1 anion channel controls turgor pressure in the aperture-defining guard cells of plant stomata, thereby regulating the exchange of water vapour and photosynthetic gases in response to environmental signals such as drought or high levels of carbon dioxide. Here we determine the crystal structure of a bacterial homologue (Haemophilus influenzae) of SLAC1 at 1.20 {angstrom} resolution, and use structure-inspired mutagenesis to analyse the conductance properties of SLAC1 channels. SLAC1 is a symmetrical trimer composed from quasi-symmetrical subunits, each having ten transmembrane helices arranged from helical hairpin pairs to form a central five-helix transmembrane pore that is gated by an extremely conserved phenylalanine residue. Conformational features indicate a mechanism for control of gating by kinase activation, and electrostatic features of the pore coupled with electrophysiological characteristics indicate that selectivity among different anions is largely a function of the energetic cost of ion dehydration.

  19. Support and utilization of the LSI-11 processor family at SLAC

    International Nuclear Information System (INIS)

    Kieffer, J.; Logg, C.A.; Farwell, D.E.

    1981-01-01

    Microcomputer systems based on the DEC LSI-11 processor family have been in use at SLAC for five years. They are used for a wide variety of applications. The support of these systems is divided into three general areas: engineering, maintenance, and software. Engineering specifies the system to match user requirements. SLAC has been able to design one general purpose system which can be tailored to fit many specific requirements. Maintenance provides system and component diagnostic services and repair. Software support includes software consulting services, assistance in systems design, and the development and support of special purpose operating systems and programs. These support functions are handled as subtasks by three teams in the SLAC Electronics Instrumentation Group. Each of these teams utilizes several LSI-11 systems in the performance of its primary tasks. They work closely together to jointly provide overall support for the larger SLAC community

  20. SLAC to host symposium celebrating 10th anniversary of first website in America

    CERN Multimedia

    2001-01-01

    Many of the programmers, web designers and scientists who collaborated to create the world wide web will be in SLAC for a two-day symposium to celebrate the 10th anniversary of the first website in America.

  1. A possible CO2 conducting and concentrating mechanism in plant stomata SLAC1 channel.

    Directory of Open Access Journals (Sweden)

    Qi-Shi Du

    Full Text Available BACKGROUND: The plant SLAC1 is a slow anion channel in the membrane of stomatal guard cells, which controls the turgor pressure in the aperture-defining guard cells, thereby regulating the exchange of water vapour and photosynthetic gases in response to environmental signals such as drought, high levels of carbon dioxide, and bacterial invasion. Recent study demonstrated that bicarbonate is a small-molecule activator of SLAC1. Higher CO(2 and HCO(3(- concentration activates S-type anion channel currents in wild-type Arabidopsis guard cells. Based on the SLAC1 structure a theoretical model is derived to illustrate the activation of bicarbonate to SLAC1 channel. Meanwhile a possible CO(2 conducting and concentrating mechanism of the SLAC1 is proposed. METHODOLOGY: The homology structure of Arabidopsis thaliana SLAC1 (AtSLAC1 provides the structural basis for study of the conducting and concentrating mechanism of carbon dioxide in SLAC1 channels. The pK(a values of ionizable amino acid side chains in AtSLAC1 are calculated using software PROPKA3.0, and the concentration of CO(2 and anion HCO(3(- are computed based on the chemical equilibrium theory. CONCLUSIONS: The AtSLAC1 is modeled as a five-region channel with different pH values. The top and bottom layers of channel are the alkaline residue-dominated regions, and in the middle of channel there is the acidic region surrounding acidic residues His332. The CO(2 concentration is enhanced around 10(4 times by the pH difference between these regions, and CO(2 is stored in the hydrophobic region, which is a CO(2 pool. The pH driven CO(2 conduction from outside to inside balances the back electromotive force and maintain the influx of anions (e.g. Cl(- and NO(3(- from inside to outside. SLAC1 may be a pathway providing CO(2 for photosynthesis in the guard cells.

  2. Design of a semi-custom integrated circuit for the SLAC SLC timing control system

    International Nuclear Information System (INIS)

    Linstadt, E.

    1984-10-01

    A semi-custom (gate array) integrated circuit has been designed for use in the SLAC Linear Collider timing and control system. The design process and SLAC's experiences during the phases of the design cycle are described. Issues concerning the partitioning of the design into semi-custom and standard components are discussed. Functional descriptions of the semi-custom integrated circuit and the timing module in which it is used are given

  3. The 50 GeV program at SLAC

    International Nuclear Information System (INIS)

    Prescott, C.Y.

    1994-03-01

    SLAC has undertaken a modes programs to upgrade the beam energy for fixed target experiments to 50 GeV. This upgrade is possible due to the previous extensive development work on the linac accelerating gradient for the SLC, which has been operational for over five years. The SLC can deliver a beam of energy up to 60 GeV using a pulse compression technique in the rf system which trades pulse length for a higher pulse amplitude. This mode of operation has been reliable and routine for the SLC. However the beam line transport which takes electrons or positrons from the end of the linac to the target in End Station A has not been upgraded from the original design energy of 25 GeV. The 50 GeV upgrade for the fixed target experiments consists in modifying and increasing the number of beam line dipole magnets to reach 50 GeV, plus modernization of the beam line instrumentation and controls. The plans for spin structure experiments using electron beams at energies up to 50 GeV are described

  4. Contact lens in keratoconus

    Directory of Open Access Journals (Sweden)

    Varsha M Rathi

    2013-01-01

    Full Text Available Contact lenses are required for the visual improvement in patients with keratoconus. Various contact lens options, such as rigid gas permeable (RGP lenses, soft and soft toric lenses, piggy back contact lenses (PBCL, hybrid lenses and scleral lenses are availble. This article discusses about selection of a lens depending on the type of keratoconus and the fitting philosophies of various contact lenses including the starting trial lens. A Medline search was carried out for articles in the English language with the keywords keratoconus and various contact lenses such as Rose k lens, RGP lens, hybrid lens, scleral lens and PBCL.

  5. Contact lens in keratoconus

    Science.gov (United States)

    Rathi, Varsha M; Mandathara, Preeji S; Dumpati, Srikanth

    2013-01-01

    Contact lenses are required for the visual improvement in patients with keratoconus. Various contact lens options, such as rigid gas permeable (RGP) lenses, soft and soft toric lenses, piggy back contact lenses (PBCL), hybrid lenses and scleral lenses are availble. This article discusses about selection of a lens depending on the type of keratoconus and the fitting philosophies of various contact lenses including the starting trial lens. A Medline search was carried out for articles in the English language with the keywords keratoconus and various contact lenses such as Rose k lens, RGP lens, hybrid lens, scleral lens and PBCL. PMID:23925325

  6. Acoustic lens for capacitive micromachined ultrasonic transducers

    Science.gov (United States)

    Chang, Chienliu; Firouzi, Kamyar; Park, Kwan Kyu; Sarioglu, Ali Fatih; Nikoozadeh, Amin; Yoon, Hyo-Seon; Vaithilingam, Srikant; Carver, Thomas; Khuri-Yakub, Butrus T.

    2014-08-01

    Capacitive micromachined ultrasonic transducers (CMUTs) have great potential to compete with traditional piezoelectric transducers in therapeutic ultrasound applications. In this paper we have designed, fabricated and developed an acoustic lens formed on the CMUT to mechanically focus ultrasound. The acoustic lens was designed based on the paraxial theory and made of silicone rubber for acoustic impedance matching and encapsulation. The CMUT was fabricated based on the local oxidation of silicon (LOCOS) and fusion-bonding. The fabricated CMUT was verified to behave like an electromechanical resonator in air and exhibited wideband response with a center frequency of 2.2 MHz in immersion. The fabrication for the acoustic lens contained two consecutive mold castings and directly formed on the surface of the CMUT. Applied with ac burst input voltages at the center frequency, the CMUT with the acoustic lens generated an output pressure of 1.89 MPa (peak-to-peak) at the focal point with an effective focal gain of 3.43 in immersion. Compared to the same CMUT without a lens, the CMUT with the acoustic lens demonstrated the ability to successfully focus ultrasound and provided a viable solution to the miniaturization of the multi-modality forward-looking endoscopes without electrical focusing.

  7. Acoustic lens for capacitive micromachined ultrasonic transducers

    International Nuclear Information System (INIS)

    Chang, Chienliu; Firouzi, Kamyar; Sarioglu, Ali Fatih; Nikoozadeh, Amin; Yoon, Hyo-Seon; Vaithilingam, Srikant; Carver, Thomas; Khuri-Yakub, Butrus T; Kyu Park, Kwan

    2014-01-01

    Capacitive micromachined ultrasonic transducers (CMUTs) have great potential to compete with traditional piezoelectric transducers in therapeutic ultrasound applications. In this paper we have designed, fabricated and developed an acoustic lens formed on the CMUT to mechanically focus ultrasound. The acoustic lens was designed based on the paraxial theory and made of silicone rubber for acoustic impedance matching and encapsulation. The CMUT was fabricated based on the local oxidation of silicon (LOCOS) and fusion-bonding. The fabricated CMUT was verified to behave like an electromechanical resonator in air and exhibited wideband response with a center frequency of 2.2 MHz in immersion. The fabrication for the acoustic lens contained two consecutive mold castings and directly formed on the surface of the CMUT. Applied with ac burst input voltages at the center frequency, the CMUT with the acoustic lens generated an output pressure of 1.89 MPa (peak-to-peak) at the focal point with an effective focal gain of 3.43 in immersion. Compared to the same CMUT without a lens, the CMUT with the acoustic lens demonstrated the ability to successfully focus ultrasound and provided a viable solution to the miniaturization of the multi-modality forward-looking endoscopes without electrical focusing. (paper)

  8. Documenting the Physical Universe:Preserving the Record of SLAC from 1962 to 2005

    Energy Technology Data Exchange (ETDEWEB)

    Deken, Jean Marie; /SLAC

    2006-03-10

    Since 1905, Albert Einstein's ''miraculous year'', modern physics has advanced explosively. In 2005, the World Year of Physics, a session at the SAA Annual meeting discusses three institutional initiatives--Einstein's collected papers, an international geophysical program, and a research laboratory--to examine how physics and physicists are documented and how that documentation is being collected, preserved, and used. This paper provides a brief introduction to the research laboratory (SLAC), discusses the origins of the SLAC Archives and History Office, its present-day operations, and the present and future challenges it faces in attempting to preserve an accurate historical record of SLAC's activities.

  9. SLAC R and D toward a TeV Linear Collider

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, P.B.

    1988-10-01

    At CERN, KEK, Novosibirsk and SLAC, serious thought is being given to the design of linear colliders in the 0.5--2.0 TeV center-of-mass energy range. This paper reviews current progress at SLAC toward the design of such a collider. No attempt is made here to summarize ongoing work at the other laboratories. However, research on linear colliders is clearly an international effort, and success at SLAC will be greatly expedited by communication and cooperation with other laboratories in the US and abroad. In addition to major programs at the laboratories mentioned above, contributions relevant to linear collider design are being made at DESY, LAL (Orsay), LBL, LLNL and elsewhere. 49 refs., 6 tabs.

  10. Essay: Bob Siemann-SLC Days at SLAC

    International Nuclear Information System (INIS)

    Raubenheimer, Tor O.

    2008-01-01

    Bob Siemann was a great experimentalist and an excellent teacher.We will greatly miss him. Bob came to SLAC in early 1991 to work on the Stanford Linear Collider (SLC). The SLC was a challenging accelerator which began operating in the late 1980's but still had numerous obstacles to be overcome years into operation. One of the compounding difficulties was making reproducible measurements, since the stability of the collider was poor and the diagnostics were insufficient. Bob dove into this challenge and helped design experiments and diagnostics that provided further clarity. I first got to know Bob while I was still a graduate student, trying to finish my thesis and performing some experimental studies on the SLC, which, at the time, was proving to be very difficult. Most of my expertise had been in beam theory and simulation. Dealing with the real issues of the accelerator was challenging. Bob helped me understand the difference between systematic and statistical errors, and separate operational issues from the fundamental physics. His way of teaching was not to provide an explanation but to ask enough questions so that I could find the answer on my own - this was the best way to learn. I later asked Bob to be a reader on my thesis. As in all things, he took this role extremely seriously. He read through the draft and marked every page to the point where I was regretting my decision. However, his questions again helped me understand my own work better and greatly improved my thesis. Bob was also the de facto leader of an effort focused on the damping rings and the bunch compressors. He was great to work with. He made people think for themselves and refused to simply provide answers. He also worked hard himself, expressing real interest and curiosity. After the studies of the SLC damping rings identified a sawtooth instability due to the vacuum chamber impedance as a source of many downstream fluctuations, Bob took charge of upgrading the rings. As part of this

  11. Colored Contact Lens Dangers

    Medline Plus

    Full Text Available ... lens because they can be purchased over-the-counter or on the Internet," says Thomas Steinemann, MD, ... Halloween Safety Colored Contact Lens Facts Over-the-Counter Costume Contacts May Contain Chemicals Harmful to Eyes ...

  12. Measurement of the longitudinal wakefield and the bunch shape in the SLAC linac

    International Nuclear Information System (INIS)

    Bane, K.L.F.; Decker, F.J.; Seeman, J.T.; Zimmermann, F.

    1997-05-01

    The authors report on measurements of the bunch energy spectrum at the end of the SLAC linac. Using the spectra obtained for two different linac rf phases they obtain both the bunch induced voltage and the longitudinal distribution of the bunch. The measurement results are compared with theoretical predictions. In particular, the induced voltage is in good agreement with that obtained using the calculated wake function for the SLAC linac. This measurement technique may be useful for monitoring changes of the linac bunch shape in the SLC

  13. Electroweak Radiative Corrections to the Parity-violating Asymmetry for SLAC Experiment E158

    Energy Technology Data Exchange (ETDEWEB)

    Zykunov, Vladimir A.; /Gomel State Tech. U.

    2012-04-04

    Electroweak radiative corrections to observable quantities of Moeller scattering of polarized particles are calculated. We emphasize the contribution induced by infrared divergent parts of cross section. The covariant method is used to remove infrared divergences, so that our results do not involve any unphysical parameters. When applied to the kinematics of SLAC E158 experiment, these corrections reduce the parity violating asymmetry by about -6.5% at E = 48 GeV and y = 0.5, and kinematically weighted 'hard' bremsstrahlung effect for SLAC E158 is {approx} 1%.

  14. Proceedings of the SLAC/KEK linear collider workshop on damping ring

    International Nuclear Information System (INIS)

    Urakawa, J.; Yoshioka, M.

    1992-07-01

    Since the SLAC/KEK joint meeting was first held at SLAC in March 1987, we have had such a meeting annually with the present one the 6th. This meeting is planned to discuss the damping ring issue in particular. We have ever stressed the importance of study of damping rings and considered construction of a test damping ring as key issue for the ATF project, since we started construction of the ATF in 1987. In 1991 we had large-scale reconstruction of a building to make a shielded area where a 1.54 GeV injector linac for the ring is to be installed. (J.P.N.)

  15. Archiving SLD Records in SRB: The Persistent Archives Test-Bed (PAT) Project at SLAC in 2004

    Energy Technology Data Exchange (ETDEWEB)

    Deken, J.

    2005-01-26

    Report on the first year of SLAC's participation in the collaboration to test the NARA prototype persistent archives' ability to perform the functions of accessioning, arrangement, description, preservation and access on the electronic records of the SLD (SLAC Large Detector) collaboration.

  16. dE/dx electronics for MARK II experiment at SLAC

    International Nuclear Information System (INIS)

    Bernstein, D.; Boyarski, A.; Coupal, D.; Feldman, G.; Paffrath, L.

    1985-10-01

    This paper describes a 100 MHz pulse digitizer for dE/dx measurements on the MARK II drift chamber at SLAC. The electronics provides the read-out of the detector's 5832 sense based on a 16-channel FASTBUS module. The basic element of the module is the TRW 6-bit Flash-ADC

  17. BABAR - the detector for the PEP II B Factory at SLAC

    International Nuclear Information System (INIS)

    Lueth, V.

    1994-09-01

    BABAR refers to the detector that is being designed for the PEP II B-Factory at SLAC to perform a comprehensive study of CP violation in B meson decays. The design requirements and the principal detector components are briefly described. A summary of the expected physics performance is presented

  18. The desert plant Phoenix dactylifera closes stomata via nitrate-regulated SLAC1 anion channel.

    Science.gov (United States)

    Müller, Heike M; Schäfer, Nadine; Bauer, Hubert; Geiger, Dietmar; Lautner, Silke; Fromm, Jörg; Riederer, Markus; Bueno, Amauri; Nussbaumer, Thomas; Mayer, Klaus; Alquraishi, Saleh A; Alfarhan, Ahmed H; Neher, Erwin; Al-Rasheid, Khaled A S; Ache, Peter; Hedrich, Rainer

    2017-10-01

    Date palm Phoenix dactylifera is a desert crop well adapted to survive and produce fruits under extreme drought and heat. How are palms under such harsh environmental conditions able to limit transpirational water loss? Here, we analysed the cuticular waxes, stomata structure and function, and molecular biology of guard cells from P. dactylifera. To understand the stomatal response to the water stress phytohormone of the desert plant, we cloned the major elements necessary for guard cell fast abscisic acid (ABA) signalling and reconstituted this ABA signalosome in Xenopus oocytes. The PhoenixSLAC1-type anion channel is regulated by ABA kinase PdOST1. Energy-dispersive X-ray analysis (EDXA) demonstrated that date palm guard cells release chloride during stomatal closure. However, in Cl - medium, PdOST1 did not activate the desert plant anion channel PdSLAC1 per se. Only when nitrate was present at the extracellular face of the anion channel did the OST1-gated PdSLAC1 open, thus enabling chloride release. In the presence of nitrate, ABA enhanced and accelerated stomatal closure. Our findings indicate that, in date palm, the guard cell osmotic motor driving stomatal closure uses nitrate as the signal to open the major anion channel SLAC1. This initiates guard cell depolarization and the release of anions together with potassium. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.

  19. Spherical aberration in contact lens wear.

    Science.gov (United States)

    Lindskoog Pettersson, A; Jarkö, C; Alvin, A; Unsbo, P; Brautaset, R

    2008-08-01

    The aim of the present studies was to investigate the effect on spherical aberration of different non custom-made contact lenses, both with and without aberration control. A wavefront analyser (Zywave, Bausch & Lomb) was used to measure the aberrations in each subject's right eye uncorrected and with the different contact lenses. The first study evaluated residual spherical aberration with a standard lens (Focus Dailies Disposable, Ciba Vision) and with an aberration controlled contact lens (ACCL) (Definition AC, Optical Connection Inc.). The second study evaluated the residual spherical aberrations with a monthly disposable silicone hydrogel lens with aberration reduction (PureVision, Bausch & Lomb). Uncorrected spherical aberration was positive for all pupil sizes in both studies. In the first study, residual spherical aberration was close to zero with the standard lens for all pupil sizes whereas the ACCL over-corrected spherical aberration. The results of the second study showed that the monthly disposable lens also over-corrected the aberration making it negative. The changes in aberration were statistically significant (plenses. Since the amount of aberration varies individually we suggest that aberrations should be measured with lenses on the eye if the aim is to change spherical aberration in a certain direction.

  20. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  1. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  2. Protection of the eye lens

    International Nuclear Information System (INIS)

    2015-01-01

    The limit of radiation exposure for eye lens is going to decrease dramatically from 150 to 20 mSv as a transposition into the French law of a CIPR (International Commission for Radiation Protection) directive. Sanitary studies have shown that radiologists are more likely by a factor of 3.8 to get eye lens opacities than the rest of the population. The wearing of protective glasses is recommended and in order to get a better monitoring of the radiation dose new dosimeters have been designed, they can be worn on the glass frame of directly stuck on the skin near the eyes. A study has shown that veterinary surgeons that are accustomed to stay near animals to keep them quiet during radiological exams are prone to receive high doses as well as physicians that use hypnosis to decrease the level of anxiety of their patients during radiological exams. Radiation exposure of radiologists can be mitigated through: the use of protective shields and equipment and the optimization of the dose delivered to the patient. (A.C.)

  3. REFRACTIVE NEUTRON LENS

    OpenAIRE

    Petrov, P. V.; Kolchevsky, N. N.

    2013-01-01

    Compound concave refractive lenses are used for focusing neutron beam. Investigations of spectral and focusing properties of a refractive neutron lens are presented. Resolution of the imaging system on the base of refractive neutron lenses depends on material properties and parameters of neutron source. Model of refractive neutron lens are proposed. Results of calculation diffraction resolution and focal depth of refractive neutron lens are discussed.

  4. Contact lens in keratoconus

    OpenAIRE

    Rathi, Varsha M; Mandathara, Preeji S; Dumpati, Srikanth

    2013-01-01

    Contact lenses are required for the visual improvement in patients with keratoconus. Various contact lens options, such as rigid gas permeable (RGP) lenses, soft and soft toric lenses, piggy back contact lenses (PBCL), hybrid lenses and scleral lenses are availble. This article discusses about selection of a lens depending on the type of keratoconus and the fitting philosophies of various contact lenses including the starting trial lens. A Medline search was carried out for articles in the En...

  5. Proceedings of the SLC workshop on experimental use of the SLAC Linear Collider

    International Nuclear Information System (INIS)

    1982-03-01

    In March 1981, the SLAC management, together with the SLAC users organization, invited interested physicists to a three day meeting to discuss the laboratory's plans and progress on the new colliding e + e - machine - the Stanford Linear Collider (SLC). Those attending were encouraged to join together to study the challenges and opportunities presented by the SLC. The study of the parameters for experiments on 100 GeV e + e - collisions, and the reviews of the state-of-the-art in the four areas of detector technology - Tracking, Calorimetry, Particle Identification and Electronics and Computing - were undertaken from a general standpoint, and not from the particular perspective of a specific experimental proposal. Nine sections were prepared separately for the data base

  6. Gallium arsenide digital integrated circuits for controlling SLAC CW-RF systems

    International Nuclear Information System (INIS)

    Ronan, M.T.; Lee, K.L.; Corredoura, P.; Judkins, J.G.

    1989-01-01

    In order to fill the PEP and SPEAR storage rings with beams from the SLC linac and damping rings, precise control of the linac subharmonic buncher and the damping ring RF is required. Recently several companies have developed resettable GaAs master/slave D-type flip-flops which are capable of operating at frequencies of 3 GHz and higher. Using these digital devices as frequency dividers, one can phase shift the SLAC CW-RF systems to optimize the timing for filling the storage rings. The authors have evaluated the performance of integrated circuits from two vendors for our particular application. Using microstrip circuit techniques, they have built and operated in the accelerator several chassis to synchronize a reset signal from the storage rings to the SLAC 2.856 GHz RF and to phase shift divide-by-four and divide-by-sixteen frequency dividers to the nearest 350 psec bucket required for filling

  7. Present and future developments on the SLAC three-kilometer accelerator

    International Nuclear Information System (INIS)

    Loew, G.A.

    1977-07-01

    A review is given of the innovations which have recently been made or are being planned on the SLAC three-kilometer accelerator. A brief review of overall performance statistics is given, the beam is followed from its origin to the experimental areas. The injector with its new polarized guns, some highlights of klystron research, the SLED or SLAC Energy Development Program, which will boost the electron energy into the 30 to 40 GeV range, and some associated beam loading and beam breakup implications are described. Following these, a brief survey of other microwave developments is given. Some of the innovations being implanted in computer control are summarized, and the changes being planned for the generation and delivery of e +- beams to the PEP ring are discussed

  8. Final Report: BaBar Detector and Experimental at SLAC, September 30, 1998 - September 29, 1999

    International Nuclear Information System (INIS)

    Judd, Dennis J.

    2000-01-01

    The Prairie View AandM University High Energy Physics Group with its contingent of three undergraduates physics majors, joined the BaBar Collaboration at SLAC in September 1994. BaBar is the experiment and detector running in the PEP-II ring at SLAC as part of the Asymmetric B Factory project there to study CP violation and heavy flavor physics. The focus of our effort before this year was with the Muon/Neutral Hadron Detector/Instrumented Flux Return (IFD) subgroup within the BaBar collaboration, and particularly with the GEANT simulation of the IFR-. With the GEANT3 simulation essentially FR-ozen, and the GEANT4 full simulation of the IFR- done, we have decided to redirect our efforts toward other areas

  9. Final Report BaBar Detector and Experimental at SLAC, September 30, 1998 - September 29, 1999

    CERN Document Server

    Judd, D J

    2000-01-01

    The Prairie View AandM University High Energy Physics Group with its contingent of three undergraduates physics majors, joined the BaBar Collaboration at SLAC in September 1994. BaBar is the experiment and detector running in the PEP-II ring at SLAC as part of the Asymmetric B Factory project there to study CP violation and heavy flavor physics. The focus of our effort before this year was with the Muon/Neutral Hadron Detector/Instrumented Flux Return (IFD) subgroup within the BaBar collaboration, and particularly with the GEANT simulation of the IFR-. With the GEANT3 simulation essentially FR-ozen, and the GEANT4 full simulation of the IFR- done, we have decided to redirect our efforts toward other areas.

  10. A 2--4 nm Linac Coherent Light Source (LCLS) using the SLAC linac

    International Nuclear Information System (INIS)

    Winick, H.; Bane, K.; Boyce, R.

    1993-05-01

    We describe the use of the SLAC linac to drive a unique, powerful. short wavelength Linac Coherent Light Source (LCLS). Operating as an FEL, lasing would be achieved in a single pass of a high peak current electron beam through a long undulator by self-amplified spontaneous emission (SASE). The main components are a high-brightness rf photocathode electron gun; pulse compressors; about 1/5 of the SLAC linac; and a long undulator with a FODO quadrupole focussing system. Using electrons below 8 GeV, the system would operate at wavelengths down to about 3 nm, producing ≥10 GW peak power in sub-ps pulses. At a 120 Hz rate the average power is ∼ 1 W

  11. Radiation Dose Measurement for High-Intensity Laser Interactions with Solid Targets at SLAC

    Energy Technology Data Exchange (ETDEWEB)

    Liang, Taiee [SLAC National Accelerator Lab., Menlo Park, CA (United States)

    2015-09-25

    A systematic study of photon and neutron radiation doses generated in high-intensity laser-solid interactions is underway at SLAC National Accelerator Laboratory. We found that these laser-solid experiments are being performed using a 25 TW (up to 1 J in 40 fs) femtosecond pulsed Ti:sapphire laser at the Linac Coherent Light Source’s (LCLS) Matter in Extreme Conditions (MEC) facility. Additionally, radiation measurements were performed with passive and active detectors deployed at various locations inside and outside the target chamber. Results from radiation dose measurements for laser-solid experiments at SLAC MEC in 2014 with peak intensity between 1018 to 7.1x1019 W/cm2 are presented.

  12. Compliance of SLAC's Laser Safety Program with OSHA Requirements for the Control of Hazardous Energy

    International Nuclear Information System (INIS)

    Woods, M.

    2009-01-01

    SLAC's COHE program requires compliance with OSHA Regulation 29CFR1910.147, 'The control of hazardous energy (lockout/tagout)'. This regulation specifies lockout/tagout requirements during service and maintenance of equipment in which the unexpected energization or start up of the equipment, or release of stored energy, could cause injury to workers. Class 3B and Class 4 laser radiation must be considered as hazardous energy (as well as electrical energy in associated equipment, and other non-beam energy hazards) in laser facilities, and therefore requires careful COHE consideration. This paper describes how COHE is achieved at SLAC to protect workers against unexpected Class 3B or Class 4 laser radiation, independent of whether the mode of operation is normal, service, or maintenance

  13. Nucleon resonance electroproduction at high momentum transers: Results from SLAC and suggestions for CEBAF

    Energy Technology Data Exchange (ETDEWEB)

    Keppel, C. [Virginia Union Univ., Richmond, VA (United States)

    1994-04-01

    Nucleon resonance electroproduction results from SLAC Experiment E14OX are presented. A CEBAF facility with doubled energy would enable similar high momentum transfer measurements to be made with greater accuracy. Of particular interest are the Delta P{sub 33}(1232) resonance form factor and R = {sigma}{sub L}/{sigma}{sub T}, the ratio of the longitudinal and transverse components of the cross section. A suggestion is made to study these quantities in conjunction with Bloom-Gilman duality.

  14. The physics program and status of the SLAC B-Factory and detector

    International Nuclear Information System (INIS)

    Hearty, C.

    1994-05-01

    The goal of the SLAC B-Factory is to measure CP violation in the decay of B-mesons and to test the standard model description of CP violation. Work is now underway in upgrading the PEP collider for this project, and much of the preliminary detector design has been done. The physics goals and design of PEP-II are briefly discussed, and the current plans for the detector are outlined

  15. The analog processing system for the Liquid Argon Calorimeter for SLD at SLAC

    International Nuclear Information System (INIS)

    Haller, G.M.; Nelson, D.; Freytag, D.R.

    1986-09-01

    The analog processing system for the Liquid Argon Calorimeter for the SLD project at SLAC is described. Amplification, storage of the analog information, and multiplexing is realized on specially developed hybrids, which will be mounted directly on the detector. This leads to a substantial reduction of the cable plant. Test results for the amplifier and for the sampling and multiplexing hybrid (CDU hybrid) are presented. The latter hybird contains a custom monolithic device, the Calorimeter Data Unit

  16. SLAC Scanner Processor applications in the data acquisition system for the upgraded Mark II detector

    International Nuclear Information System (INIS)

    Barklow, T.; Glanzman, T.; Lankford, A.J.; Riles, K.

    1985-09-01

    The SLAC Scanner Processor is a general purpose, programmable FASTBUS crate/cable master/slave module. This device plays a central role in the readout, buffering and pre-processing of data from the upgraded Mark II detector's new central drift chamber. In addition to data readout, the SSPs assist in a variety of other services, such as detector calibration, FASTBUS system management, FASTBUS system initialization and verification, and FASTBUS module testing. 9 refs., 1 fig., 2 tabs

  17. SLAC linear collider and a few ideas on future linear colliders

    International Nuclear Information System (INIS)

    Loew, G.A.

    1984-04-01

    This paper comes in two parts. The first part is a progress report on the SLAC Linear Collider (SLC) with emphasis on those systems which are of special interest to linear accelerator designers; it sets the stage for a number of contributed papers on specific topics which are also presented at this conference. The second part presents some ideas which are of interest to the design of future linear colliders of higher energies

  18. Status of the SLAC/LBL/LLNL B-factory and the BABAR detector

    International Nuclear Information System (INIS)

    Oddone, P.

    1994-10-01

    After a brief introduction on the physics reach of the SLAC/LBL/LLNL Asymmetric B-Factory, the author describes the status of the accelerator and the detector as of the end of 1994. At this time, essentially all major decisions have been made, including the choice of particle identification for the detector. The author concludes this report with the description of the schedule for the construction of both accelerator and detector

  19. 6D Phase Space Measurements at the SLAC Gun Test Facility

    CERN Document Server

    Schmerge, J

    2003-01-01

    Proposed fourth generation light sources using SASE FELs to generate short pulse, coherent X-rays require demonstration of high brightness electron sources. The Gun Test Facility (GTF) at SLAC was built to test high brightness sources for the proposed Linac Coherent Light Source at SLAC. The GTF is composed of an Sband photocathode rf gun with a Cu cathode, emittance compensating solenoid, single 3 m SLAC linac section and e-beam diagnostic section with a UV drive laser system. The longitudinal emittance exiting the gun has been determined by measuring the energy spectrum downstream of the linac as a function of the linac phase. The e-beam pulse width, correlated and uncorrelated energy spread at the linac entrance have been fit to the measured energy spectra using a least square error fitting routine. The fit yields a pulse width of 2.9 ps FWHM for a 4.3 ps FWHM laser pulse width and 2% rms correlated energy spread with 0.07% rms uncorrelated energy spread. The correlated energy spread is enhanced in the lin...

  20. Anomalous electron loading in SLAC 5045 klystron and relativistic klystron input cavities

    International Nuclear Information System (INIS)

    Koontz, R.F.; Fowkes, R.W.; Lavine, T.L.; Miller, R.H.; Vlieks, A.E.

    1989-03-01

    Recent studies of RF breakup and instability in the SLAC 5045 klystrons have revealed that many production klystrons show loading of the input cavity by low energy electrons even under cold cathode no beam conditions. Sometime after the onset of the RF drive pulse, the input cavity absorbs a portion of the incident RF drive that would otherwise be reflected from the not-beam-loaded cavity. This power absorption is a function of drive level, and of axial magnetic field surrounding the cavity. No power absorption is present when the axial magnetic field is zero. This same phenomenon has been observed in the input cavity of relativistic klystron experiments being conducted as part of the SLAC-LBL-LLNL development program. The phenomenon may be associated with RF breakup and RF instability in SLAC 5045 klystrons, and with unstable pulse shortening in the relativistic klystron experiments. This paper outlines some old and new observations of microwave beam device malfunctions that probably are associated with low energy electron fluxes in the vacuum environments of microwave power devices. 2 refs., 5 figs

  1. Anomalous electron loading in SLAC 5045 klystron and relativistic klystron input cavities

    Energy Technology Data Exchange (ETDEWEB)

    Koontz, R.F.; Fowkes, R.W.; Lavine, T.L.; Miller, R.H.; Vlieks, A.E.

    1989-03-01

    Recent studies of RF breakup and instability in the SLAC 5045 klystrons have revealed that many production klystrons show loading of the input cavity by low energy electrons even under cold cathode no beam conditions. Sometime after the onset of the RF drive pulse, the input cavity absorbs a portion of the incident RF drive that would otherwise be reflected from the not-beam-loaded cavity. This power absorption is a function of drive level, and of axial magnetic field surrounding the cavity. No power absorption is present when the axial magnetic field is zero. This same phenomenon has been observed in the input cavity of relativistic klystron experiments being conducted as part of the SLAC-LBL-LLNL development program. The phenomenon may be associated with RF breakup and RF instability in SLAC 5045 klystrons, and with unstable pulse shortening in the relativistic klystron experiments. This paper outlines some old and new observations of microwave beam device malfunctions that probably are associated with low energy electron fluxes in the vacuum environments of microwave power devices. 2 refs., 5 figs.

  2. AC power supply systems

    International Nuclear Information System (INIS)

    Law, H.

    1987-01-01

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  3. ACS Zero Point Verification

    Science.gov (United States)

    Dolphin, Andrew

    2005-07-01

    The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.

  4. Colored Contact Lens Dangers

    Medline Plus

    Full Text Available ... One Use Facts About Colored Contacts and Halloween Safety Colored Contact Lens Facts Over-the-Counter Costume ... new application of artificial intelligence shows whether a patient’s eyes point to high blood pressure or risk ...

  5. Colored Contact Lens Dangers

    Medline Plus

    Full Text Available ... be purchased over-the-counter or on the Internet," says Thomas Steinemann, MD, professor of ophthalmology at ... ask for a prescription. There is no such thing as a "one size fits all" contact lens. ...

  6. Colored Contact Lens Dangers

    Medline Plus

    Full Text Available ... had not been properly fitted by an eye care professional, the lenses stuck to my eye like ... lenses do not require the same level of care or consideration as a standard contact lens because ...

  7. Colored Contact Lens Dangers

    Medline Plus

    Full Text Available ... sell contacts without a prescription are breaking the law, and may be fined $11,000 per violation. " ... wear any kind of contact lens. In Butler's case, the lenses caused an infection and left her ...

  8. Colored Contact Lens Dangers

    Medline Plus

    Full Text Available ... One Use Facts About Colored Contacts and Halloween Safety Colored Contact Lens Facts Over-the-Counter Costume ... Costume Contact Lenses Can Ruin Vision Eye Makeup Safety In fact, it is illegal to sell colored ...

  9. Colored Contact Lens Dangers

    Medline Plus

    Full Text Available ... with Colored Contact Lenses Julian: Teenager Blinded In One Eye By Non-Prescription Contact Lens Laura: Vision ... Robyn: Blurry Vision and Daily Eye Drops After One Use Facts About Colored Contacts and Halloween Safety ...

  10. Colored Contact Lens Dangers

    Medline Plus

    Full Text Available ... One Use Facts About Colored Contacts and Halloween Safety Colored Contact Lens Facts Over-the-Counter Costume ... Academy Jobs at the Academy Financial Relationships with Industry Medical Disclaimer Privacy Policy Terms of Service For ...

  11. Colored Contact Lens Dangers

    Medline Plus

    Full Text Available ... in a pair of colored contact lenses, Laura Butler of Parkersburg, W.Va., had "extreme pain in ... to wear any kind of contact lens. In Butler's case, the lenses caused an infection and left ...

  12. Colored Contact Lens Dangers

    Medline Plus

    Full Text Available ... One Use Facts About Colored Contacts and Halloween Safety Colored Contact Lens Facts Over-the-Counter Costume ... use of colored contact lenses , from the U.S. Food and Drug Administration (FDA). Are the colored lenses ...

  13. Colored Contact Lens Dangers

    Medline Plus

    Full Text Available ... an impulsive buy from a souvenir shop, but 10 hours after she first put in a pair ... Prescription Contact Lens Laura: Vision Loss After Just 10 Hours Robyn: Blurry Vision and Daily Eye Drops ...

  14. bubble chamber lens

    CERN Multimedia

    Before the days of electronic detectors, visual techniques were used to detect particles, using detectors such as spark chambers and bubble chambers. This plexiglass lens was used to focus the image of tracks so they could be photographed.

  15. Colored Contact Lens Dangers

    Medline Plus

    Full Text Available ... Contact Lens Facts Over-the-Counter Costume Contacts May Contain Chemicals Harmful to Eyes Four Ways Over- ... without a prescription are breaking the law, and may be fined $11,000 per violation. "Many of ...

  16. Colored Contact Lens Dangers

    Medline Plus

    Full Text Available ... not require the same level of care or consideration as a standard contact lens because they can ... sell contacts without a prescription are breaking the law, and may be fined $11,000 per violation. " ...

  17. Colored Contact Lens Dangers

    Medline Plus

    Full Text Available ... One Use Facts About Colored Contacts and Halloween Safety Colored Contact Lens Facts Over-the-Counter Costume ... an ophthalmologist — an eye medical doctor — who will measure each eye and talk to you about proper ...

  18. Colored Contact Lens Dangers

    Medline Plus

    Full Text Available ... prescription. Follow the contact lens care directions for cleaning, disinfecting, and wearing the lenses. Never share contact ... with Industry Medical Disclaimer Privacy Policy Terms of Service For Advertisers For Media Ophthalmology Job Center © American ...

  19. Viscous froth lens

    Science.gov (United States)

    Green, T. E.; Bramley, A.; Lue, L.; Grassia, P.

    2006-11-01

    Microscale models of foam structure traditionally incorporate a balance between bubble pressures and surface tension forces associated with curvature of bubble films. In particular, models for flowing foam microrheology have assumed this balance is maintained under the action of some externally imposed motion. Recently, however, a dynamic model for foam structure has been proposed, the viscous froth model, which balances the net effect of bubble pressures and surface tension to viscous dissipation forces: this permits the description of fast-flowing foam. This contribution examines the behavior of the viscous froth model when applied to a paradigm problem with a particularly simple geometry: namely, a two-dimensional bubble “lens.” The lens consists of a channel partly filled by a bubble (known as the “lens bubble”) which contacts one channel wall. An additional film (known as the “spanning film”) connects to this bubble spanning the distance from the opposite channel wall. This simple structure can be set in motion and deformed out of equilibrium by applying a pressure across the spanning film: a rich dynamical behavior results. Solutions for the lens structure steadily propagating along the channel can be computed by the viscous froth model. Perturbation solutions are obtained in the limit of a lens structure with weak applied pressures, while numerical solutions are available for higher pressures. These steadily propagating solutions suggest that small lenses move faster than large ones, while both small and large lens bubbles are quite resistant to deformation, at least for weak applied back pressures. As the applied back pressure grows, the structure with the small lens bubble remains relatively stiff, while that with the large lens bubble becomes much more compliant. However, with even further increases in the applied back pressure, a critical pressure appears to exist for which the steady-state structure loses stability and unsteady

  20. Smart Reinvention of the Contact Lens with Graphene.

    Science.gov (United States)

    Choi, Kyoungjun; Park, Hyung Gyu

    2017-06-27

    With potential benefits to the 71 million contact lens users worldwide, contact lenses are being reinvented in the form of smart wearable electronics. In this issue of ACS Nano, Lee et al. report on the fascinating functions of a graphene-based smart contact lens that is able to protect eyes from electromagnetic waves and dehydration. Graphene and two-dimensional materials can be exploited in many opportunities in the development of smart contact lenses. Here, we briefly review and describe prospects for the future of smart contact lenses that incorporate graphene in their platforms.

  1. Introduction to high-energy physics and the Stanford Linear Accelerator Center (SLAC)

    Energy Technology Data Exchange (ETDEWEB)

    Clearwater, S.

    1983-03-01

    The type of research done at SLAC is called High Energy Physics, or Particle Physics. This is basic research in the study of fundamental particles and their interactions. Basic research is research for the sake of learning something. Any practical application cannot be predicted, the understanding is the end in itself. Interactions are how particles behave toward one another, for example some particles attract one another while others repel and still others ignore each other. Interactions of elementary particles are studied to reveal the underlying structure of the universe.

  2. Requirements for use of nonmedical x-ray generators at SLAC

    Energy Technology Data Exchange (ETDEWEB)

    Busick, D.D. (comp.)

    1984-09-01

    The risks associated with use of x-ray equipment have long been recognized. While the relative frequency of x-ray damage is small, machine produced x-rays and large radiography sources continue to account for a large percentage of preventable radiation injuries reported worldwide. The intent of this report is to formalize SLAC's radiation safety program as it applies to radiation producing equipment (diffraction, fluorescence analysis and nondestructive testing). It does not apply to the two-mile linac, experimental areas or other x-ray producing equipment directly related to the high energy physics program. 4 refs., 3 figs., 1 tab.

  3. The optical design of the spin manipulation system for the SLAC Linear Collider

    International Nuclear Information System (INIS)

    Fieguth, T.H.

    1989-03-01

    The optical design of the beam transport lines between the SLAC Linac and the electron damping ring and the design of part of the Linac lattice itself will be modified to accommodate three superconducting solenoids for the purpose of manipulating the polarization of the electron beam. In order to allow arbitrary orientation of the polarization vector, this design will be capable of compensating the fields of two independent solenoids for arbitrary strengths ranging to 7.0 T-m. The method of dealing with the coupling of the betatron functions and the method of handling both the electron and positron beams in the common region are discussed. 8 refs., 5 figs

  4. Dipole magnets for the SLAC 50 GeV A-Line upgrade

    International Nuclear Information System (INIS)

    Erickson, R.; DeBarger, S.; Spencer, C.M.; Wolf, Z.

    1995-05-01

    The SLAC A-Line is a transport system originally designed to deliver electron beams of up to 25 GeV to fixed target experiments in End Station A. To raise the beam energy capability of the A-Line to 52 GeV, the eight original bending magnets, plus four more of the same type, have been modified by reducing their gaps and adding trim windings to compensate for energy loss due to synchrotron radiation. In this paper the authors describe the modifications that have been completed, and they compare test and measurement results with predicted performance

  5. Z0 physics from the Mark II at the SLC [SLAC Linear Collider

    International Nuclear Information System (INIS)

    Abrams, G.S.

    1989-06-01

    The MARK II detector has started to take data at the new SLAC Linear Collider. The novel aspects of the accelerator and of the MARK II are briefly described. Displays of event pictures from some of the early-on data are presented to illustrate the quality of the data. A first presentation of the results of an energy scan near the Z 0 mass that is currently in progress shows the expected resonant enhancement near 91 GeV. 2 refs., 23 figs., 1 tab

  6. The proposed alignment system for the Final Focus Test Beam at SLAC

    International Nuclear Information System (INIS)

    Ruland, R.E.; Fischer, G.E.

    1990-09-01

    This report describes the current state of work in progress with respect to the geometry, alignment requirements, scenarios, and hardware for meeting the tolerances of the Final Focus Test Beam (FFTB) at SLAC. The methods and systems proposed acknowledge that component motion at the micron level, from whatever cause (ground motion, thermal effects, etc.) must be measured on-line and compensated for on relatively short time scales. To provide an integrated alignment/positioning package, some unique designs for reference systems, calibration of effect electric and magnetic centers, and component movers are introduced. 24 refs., 28 figs

  7. Fast track-finding trigger processor for the SLAC/LBL Mark II Detector

    International Nuclear Information System (INIS)

    Brafman, H.; Breidenbach, M.; Hettel, R.; Himel, T.; Horelick, D.

    1977-10-01

    The SLAC/LBL Mark II Magnetic Detector consists of various particle detectors arranged in cylindrical symmetry located in and around an axial magnetic field. A versatile, programmable secondary trigger processor was designed and built to find curved tracks in the detector. The system operates at a 10 MHz clock rate with a total processing time of 34 μsec and is used to ''trigger'' the data processing computer, thereby rejecting background and greatly improving the data acquisition aspects of the detector-computer combination

  8. Introduction to high-energy physics and the Stanford Linear Accelerator Center (SLAC)

    International Nuclear Information System (INIS)

    Clearwater, S.

    1983-03-01

    The type of research done at SLAC is called High Energy Physics, or Particle Physics. This is basic research in the study of fundamental particles and their interactions. Basic research is research for the sake of learning something. Any practical application cannot be predicted, the understanding is the end in itself. Interactions are how particles behave toward one another, for example some particles attract one another while others repel and still others ignore each other. Interactions of elementary particles are studied to reveal the underlying structure of the universe

  9. Gallium arsenide digital integrated circuits for controlling SLAC CW-RF systems

    International Nuclear Information System (INIS)

    Ronan, M.T.; Lee, K.L.; Corredoura, P.; Judkins, J.G.

    1988-10-01

    In order to fill the PEP and SPEAR storage rings with beams from the SLC linac and damping rings, precise control of the linac subharmonic buncher and the damping ring RF is required. Recently several companies have developed resettable GaAs master/slave D-type flip-flops which are capable of operating at frequencies of 3 GHz and higher. Using these digital devices as frequency dividers, one can phase shift the SLAC CW-RF systems to optimize the timing for filling the storage rings. We have evaluated the performance of integrated circuits from two vendors for our particular application. Using microstrip circuit techniques, we have built and operated in the accelerator several chassis to synchronize a reset signal from the storage rings to the SLAC 2.856 GHz RF and to phase shift divide-by-four and divide-by-sixteen frequency dividers to the nearest 350 psec bucket required for filling. 4 refs., 4 figs., 2 tabs

  10. Production of high intensity electron bunches for the SLAC Linear Collider

    International Nuclear Information System (INIS)

    James, M.B.

    1987-08-01

    This thesis describes the design and performance of a high intensity electron injecfor for the SLAC Linear Collider. Motivation for the collider and the specifications for the injector are discussed. An analytic theory of the bunching and capture of electrons by rf fields is discussed in the limit of low space charge and small signal. The design and performance of SLAC's main injector are described to illustrate a successful application of this theory. The bunching and capture of electrons by rf fields are then discussed in the limit of high space charge and large signal, and a description of the design of the collider injector follows. In the limit of high space charge forces and large rf signals, the beam dynamics are considerably more complex and numerical simulations are required to predict particle motion. A computer code which models the longitudinal dynamics of electrons in the presence of space charge and rf fields is described. The results of the simulations, the resulting collider injector design and the various components which make up the collider injector are described. These include the gun, subharmonic bunchers, traveling-wave buncher and velocity-of-light accelerator section. Finally, the performance of the injector is described including the beam intensity, bunch length, transverse emittance and energy spectrum. While the final operating conditions differ somewaht from the design, the performance of the collider injector is in good agreement with the numerical simulations and meets all of the collider specifications. 28 refs

  11. Ground motion measurements at the LBL Light Source site, the Bevatron and at SLAC

    International Nuclear Information System (INIS)

    Green, M.A.; Majer, E.I.; More, V.D.; O'Connell, D.R.; Shilling, R.C.

    1986-12-01

    This report describes the technique for measuring ground motion at the site of the 1.0 to 2.0 GeV Synchrotron Radiation Facility which was known as the Advanced Light Source (in 1983 when the measurements were taken). The results of ground motion measurements at the Light Source site at Building 6 at LBL are presented. As comparison, ground motion measurements were made at the Byerly Tunnel, the Bevatron, Blackberry Canyon, and SLAC at the Spear Ring. Ground Motion at the Light Source site was measured in a band from 4 to 100 Hz. The measured noise is primarily local in origin and is not easily transported through LBL soils. The background ground motion is for the most part less than 0.1 microns. Localized truck traffic near Building 6 and the operation of the cranes in the building can result in local ground motions of a micron or more for short periods of time. The background motion at Building 6 is between 1 and 2 orders of magnitude higher than ground motion in a quiet seismic tunnel, which is representative of quiet sites worldwide. The magnitude of the ground motions at SLAC and the Bevatron are comparable to ground motions measured at the Building 6 Light Source site. However, the frequency signature of each site is very different

  12. Advocacy for the Archives and History Office of the SLAC National Accelerator Laboratory: Stages and Methods

    Energy Technology Data Exchange (ETDEWEB)

    Deken, Jean Marie; /SLAC

    2009-06-19

    Advocating for the good of the SLAC Archives and History Office (AHO) has not been a one-time affair, nor has it been a one-method procedure. It has required taking time to ascertain the current and perhaps predict the future climate of the Laboratory, and it has required developing and implementing a portfolio of approaches to the goal of building a stronger archive program by strengthening and appropriately expanding its resources. Among the successful tools in the AHO advocacy portfolio, the Archives Program Review Committee has been the most visible. The Committee and the role it serves as well as other formal and informal advocacy efforts are the focus of this case study My remarks today will begin with a brief introduction to advocacy and outreach as I understand them, and with a description of the Archives and History Office's efforts to understand and work within the corporate culture of the SLAC National Accelerator Laboratory. I will then share with you some of the tools we have employed to advocate for the Archives and History Office programs and activities; and finally, I will talk about how well - or badly - those tools have served us over the past decade.

  13. From the {psi} to charmed mesons: Three years with the SLAC-LBL detector at SPEAR

    Energy Technology Data Exchange (ETDEWEB)

    Goldhaber, G.

    1992-06-01

    As I look back at the first three years or so at SPEAR, I consider this one of the most revolutionary or perhaps the most revolutionary, experiment in the 60 year history of particle physics. It certainly was the most exciting time, in a laboratory that is, that I have ever experienced. In my talk I will cover the period 1973--1976 which saw the discoveries of the {psi} and {psi}{prime} resonances the {chi} states and most of the Psion spectroscopy, the D{degree}, D{sup +}* charmed meson doublet as well as the D{degree}* and D{sup +}* doublet. I will also refer briefly to some more recent results. Most of the discoveries I will mention were made with the SLAC-LBL Magnetic Detector or ``MARK I`` which we operated at SPEAR from 1973 to 1976. In 1976 the MARK I was modified to include a ``Lead Glass Wall`` (LGW) for improved photon and electron detection. This involved a new physics group from LBL, who built the LGW, Lina Barbaro-Galtieri et al. as well as a continuing group from SLAC, Martin Perl and Gary Feldman et al. to provide continuity in the running of the MARK I and to continue the study of the anomalous e{mu}events which Martin found earlier and which eventually were identified as the signature of the {tau} lepton.

  14. Development for a supercompact X-band pulse compression system and its application at SLAC

    Directory of Open Access Journals (Sweden)

    Juwen W. Wang

    2017-11-01

    Full Text Available We have successfully designed, fabricated, installed, and tested a super compact X-band SLAC Energy Doubler system at SLAC. It is composed of an elegant 3 dB coupler–mode converter–polarizer coupled to a single spherical energy storage cavity with high Q_{0} of 94000 and a diameter less than 12 cm. The available rf peak power of 50 MW can be compressed to a peak average power of more than 200 MW in order to double the kick for the electron bunches in a rf transverse deflector system and greatly improve the measurement resolution of both the electron bunches and the x-ray free-electron laser pulses. The design physics and fabrication as well as the measurement results will be presented in detail. High-power operation has demonstrated the excellent performance of this rf compression system without rf breakdown, sign of pulse heating, and rf radiation.

  15. Technical Design Report for the FACET-II Project at SLAC National Accelerator Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2016-08-26

    Electrons can “surf” on waves of plasma – a hot gas of charged particles – gaining very high energies in very short distances. This approach, called plasma wakefield acceleration, has the potential to dramatically shrink the size and cost of particle accelerators. Research at the SLAC National Accelerator Laboratory has demonstrated that plasmas can provide 1,000 times the acceleration in a given distance compared with current technologies. Developing revolutionary and more efficient acceleration techniques that allow for an affordable high-energy collider has been the focus of FACET, a National User Facility at SLAC. FACET used part of SLAC’s two-mile-long linear accelerator to generate high-density beams of electrons and their antimatter counterparts, positrons. Research into plasma wakefield acceleration was the primary motivation for constructing FACET. In April 2016, FACET operations came to an end to make way for the second phase of SLAC’s x-ray laser, the LCLS-II, which will use part of the tunnel occupied by FACET. FACET-II is a new test facility to provide the unique capability to develop advanced acceleration and coherent radiation techniques with high-energy electron and positron beams. FACET-II represents a major upgrade over current FACET capabilities and the breadth of the potential research program makes it truly unique.

  16. A catoptric lens

    International Nuclear Information System (INIS)

    Rambauske, W.R.

    1973-01-01

    The invention relates to a catoptric lens for combining energies transmitted by several sources such as lasers; said lens comprising mirrors, the reflective surfaces of which have their focuses spaced from a common axis of symmetry. By means of these reflecting surfaces, which are generated by the nutation of portions of quadratic conics about the axis of symmetry, it is possible to focus the energy emmited by several lasers at the focus of the exit-mirror reflecting surface. This can be applied to thermonuclear fusion [fr

  17. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  18. Species identification and molecular characterization of Acanthamoeba isolated from contact lens paraphernalia.

    Science.gov (United States)

    Lee, S M; Choi, Y J; Ryu, H W; Kong, H H; Chung, D I

    1997-06-01

    We applied ribosomal RNA gene (rDNA) polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) to identify Acanthamoeba isolates from contact lens paraphernalia, and characterized these on the basis of mitochondrial DNA (mtDNA) RFLP and isoenzyme analysis. The 22 Acanthamoeba strains used as reference strains were obtained from the American Type Culture Collection. Twenty-eight isolates were classified into six ribogroups, as follows: Acanthamoeba ribogroup (AcRG) 1 consisted of 18 isolates; AcRG 2, of three, AcRG 3, of three; AcRG 4, of two; AcRG 5, of one, and AcRG 6, of one. AcRG 1, which was the most frequently isolated type, was identified as A. lugdunensis, and AcRG 2 as A. hatchetti. AcRG 4 was identified as A. triangularis, while AcRG 3 and AcRG 5 were closely related to A. triangularis. AcRG 6 was identified as A. castellanii. The mtDNA RFLP patterns and zymograms for five isoenzymes of the isolates belonging to a ribogroup were identical to one another. The mtDNA digestion phenotype and zymogram for acid phosphatase (AcP) of AcRG 1 were identical to those of A. lugdunensis L3a and KA/E2, the type strain and corneal isolates from a Korean keratitis patient, respectively. The mtDNA digestion phenotype and zymogram for AcP of AcRG 6 were identical to those of A. castellanii Castellani and KA/E3, the type strain and another corneal isolate found in Korea, respectively. The mtDNA RFLP and zymogram for AcP of AcRG 2 were very similar to those of A. hatchetti BH-2 and Chang, respectively the type strain and a pathogen. The mtDNA RFLP and zymogram for AcP of AcRG 4 were similar to those of A. triangularis SH621, the type strain. The mtDNA RFLP patterns of AcRG 3 and 5 were unique. These results showed that the riboprints, mtDNA RFLP and zymograms of 22 of 28 Acanthamoeba isolates were the same as or very similar to those of the clinical isolates, which can probably be regarded as keratopathogens. More attention should be paid to the prevention

  19. Quadrupole magnetic lens

    International Nuclear Information System (INIS)

    Piskunov, V.A.

    1981-01-01

    The following connection of windings of electromagnet is suggested for simplification of the design of qUadrupole magnetic lens intended for use in radiotechnical and electron-optical devices. The mentioned windings are connected with each other by a bridge scheme and the variable resistors are switched in its diagonals in the lens containing four electromagnet with windings connected with two variable resistors the mobile contacts of which are connected with a direct current source. Current redistribution between left windings and right windings takes place at shift of mobile contact of variable resistor, and current redistribution between upper and low coils of electromagnets takes place at shifting mobile contact of the other variable resistor. In this case smooth and independent electron-optical misalignment of lens by two mutually perpendicular directions proceeds. Use of the given design of the lens in the oscillograph permits to use printing assembly for alignment plate and to reduce the number of connections at the expense of decreasing the number of resistors

  20. Colored Contact Lens Dangers

    Medline Plus

    Full Text Available ... prescription. There is no such thing as a "one size fits all" contact lens. Lenses that are not properly fitted may scratch the eye or cause blood vessels to grow into the cornea. Even if you have perfect vision, you need to get an eye exam and a prescription ...

  1. Colored Contact Lens Dangers

    Medline Plus

    Full Text Available ... Ophthalmologist Patient Stories Español Eye Health / News Halloween Hazard: The Hidden Dangers of Buying Decorative Contact Lenses ... One Use Facts About Colored Contacts and Halloween Safety Colored Contact Lens Facts Over-the-Counter Costume ...

  2. MISSING: BUBBLE CHAMBER LENS

    CERN Multimedia

    2001-01-01

    Would the person who borrowed the large bubble chamber lens from the Microcosm workshops on the ISR please return it. This is a much used piece from our object archives. If anybody has any information about the whereabouts of this object, please contact Emma.Sanders@cern.ch Thank you

  3. The Lens of Chemistry

    Science.gov (United States)

    Thalos, Mariam

    2013-01-01

    Chemistry possesses a distinctive theoretical lens--a distinctive set of theoretical concerns regarding the dynamics and transformations of a perplexing variety of organic and nonorganic substances--to which it must be faithful. Even if it is true that chemical facts bear a special (reductive) relationship to physical facts, nonetheless it will…

  4. Colored Contact Lens Dangers

    Medline Plus

    Full Text Available ... wear any kind of contact lens. In Butler's case, the lenses caused an infection and left her with a corneal ... A recent article from U.S. News and World Report explains what ophthalmologists are and how they can ...

  5. bubble chamber lens

    CERN Multimedia

    Was used in a PS experiment. Before the days of electronic detectors, visual techniques were used to detect particles, using detectors such as spark chambers and bubble chambers. This plexiglass lens was used to focus the image of tracks so they could be photographed.

  6. Thermal Lens Microscope

    Science.gov (United States)

    Uchiyama, Kenji; Hibara, Akihide; Kimura, Hiroko; Sawada, Tsuguo; Kitamori, Takehiko

    2000-09-01

    We developed a novel laser microscope based on the thermal lens effect induced by a coaxial beam comprised of excitation and probe beams. The signal generation mechanism was confirmed to be an authentic thermal lens effect from the measurement of signal and phase dependences on optical configurations between the sample and the probe beam focus, and therefore, the thermal lens effect theory could be applied. Two-point spatial resolution was determined by the spot size of the excitation beam, not by the thermal diffusion length. Sensitivity was quite high, and the detection ability, evaluated using a submicron microparticle containing dye molecules, was 0.8 zmol/μm2, hence a distribution image of trace chemical species could be obtained quantitatively. In addition, analytes are not restricted to fluorescent species, therefore, the thermal lens microscope is a promising analytical microscope. A two-dimensional image of a histamine molecule distribution, which was produced in mast cells at the femtomole level in a human nasal mucous polyp, was obtained.

  7. Colored Contact Lens Dangers

    Medline Plus

    Full Text Available ... an Ophthalmologist Patient Stories Español Eye Health / News Halloween Hazard: The Hidden Dangers of Buying Decorative Contact ... After One Use Facts About Colored Contacts and Halloween Safety Colored Contact Lens Facts Over-the-Counter ...

  8. Clinical survey of lens care in contact lens patients.

    Science.gov (United States)

    Ky, W; Scherick, K; Stenson, S

    1998-10-01

    Overall, contact lenses provide a safe and effective modality for vision correction. However, problems do occasionally arise. Up to 80% of contact lens complications can be traced to poor patient compliance with recommended lens care guidelines. We conducted a survey to evaluate the level of patient compliance in specific areas of lens care and maintenance and to assess patient knowledge of basic contact lens information. Patients were asked to complete an anonymous 15 question survey that focused on lens care--specifically the use of contact lens cleaners, methods of disinfection, enzyme treatments, use of rewetting drops, and the frequency of follow-up exams. In addition, the survey included six true/false questions relating to contact lens care and safety. There were a total of 103 participants in the study. Approximately 24% of patients stated they never cleaned their lenses prior to disinfection, and 5% used saline solutions as their primary mode of disinfection. A sizable portion of those surveyed (43% of soft lens wearers and 71% of rigid gas permeable lens wearers) either never used enzyme cleaners or used them less than once a month. Seventy percent of patients either never used rewetting drops or used them less than once a day. Twenty-nine percent of patients consulted their eye care professionals every 2 years and 6% less often than every two years. Six questions assessed patient knowledge of contact lens care safety. Of a possible six out of six correct answers, the mean number of correct responses was 3.74. A sizable proportion of contact lens wearers do not adequately adhere to recommended contact lens care, and many have an inadequate understanding of contact lens care guidelines. Therefore, it is important that practitioners place more emphasis on patient education at the time of initial contact lens fitting and reinforce such instruction during follow-up visits.

  9. Highlights of the SLD Physics Program at the SLAC Linear Collider

    Energy Technology Data Exchange (ETDEWEB)

    Willocq, Stephane

    2001-09-07

    Starting in 1989, and continuing through the 1990s, high-energy physics witnessed a flowering of precision measurements in general and tests of the standard model in particular, led by e{sup +}e{sup -} collider experiments operating at the Z{sup 0} resonance. Key contributions to this work came from the SLD collaboration at the SLAC Linear Collider. By exploiting the unique capabilities of this pioneering accelerator and the SLD detector, including a polarized electron beam, exceptionally small beam dimensions, and a CCD pixel vertex detector, SLD produced a broad array of electroweak, heavy-flavor, and QCD measurements. Many of these results are one of a kind or represent the world's standard in precision. This article reviews the highlights of the SLD physics program, with an eye toward associated advances in experimental technique, and the contribution of these measurements to our dramatically improved present understanding of the standard model and its possible extensions.

  10. Computer modelling of bunch-by-bunch feedback for the SLAC B-factory design

    International Nuclear Information System (INIS)

    Briggs, D.; Fox, J.D.; Hosseini, W.; Klaisner, L.; Morton, P.; Pellegrin, J.L.; Thompson, K.A.; Lambertson, G.

    1991-05-01

    The SLAC B-factory design, with over 1600 high current bunches circulating in each ring, will require a feedback system to avoid coupled-bunch instabilities. A computer model of the storage ring, including the RF system, wave fields, synchrotron radiation loss, and the bunch-by-bunch feedback system is presented. The feedback system model represents the performance of a fast phase detector front end (including system noise and imperfections), a digital filter used to generate a correction voltage, and a power amplifier and beam kicker system. The combined ring-feedback system model is used to study the feedback system performance required to suppress instabilities and to quantify the dynamics of the system. Results are presented which show the time development of coupled bunch instabilities and the damping action of the feedback system. 3 refs., 5 figs., 2 tabs

  11. Measurement of the Left-Right Asymmetry in Z0 Events at SLAC

    Energy Technology Data Exchange (ETDEWEB)

    Szumilo, A

    2004-01-05

    Recent results from the 1992 and 1993 left-right asymmetry cross section measurements at the Stanford Linear Accelerator Center are presented. Measurements made with SLAC running with a center-of-mass energy at the Z{sup 0}-pole (91.2 GeV) by the SLD detector and an average electron beam polarization of 22.4 {+-} 0.7% for 1992 and 62.6 {+-} 1.2% for 1993. The asymmetry measured was A{sub LR} = 0.100 {+-} 0.044 and A{sub LR} = 0.1656 {+-} 0.0073 for the 1992 and 1993 runs, respectively. This in turn allows them to calculate the weak mixing angle value of sin{sup 2} {theta}{sub W} = 0.2378 {+-} 0.0056 and sin{sup 2} {theta}{sub W} = 0.2288 {+-} 0.0009 for the two data sets.

  12. 3D Modeling Activity for Novel High Power Electron Guns at SLAC

    CERN Document Server

    Krasnykh, Anatoly K

    2003-01-01

    The next generation of powerful electronic devices requires new approaches to overcome the known limitations of existing tube technology. Multi-beam and sheet beam approaches are novel concepts for the high power microwave devices. Direct and indirect modeling methods are being developed at SLAC to meet the new requirements in the 3D modeling. The direct method of solving of Poisson's equations for the multi-beam and sheet beam guns is employed in the TOPAZ 3D tool. The combination of TOPAZ 2D and EGUN (in the beginning) with MAFIA 3D and MAGIC 3D (at the end) is used in an indirect method to model the high power electron guns. Both methods complement each other to get reliable representation of the beam trajectories. Several gun ideas are under consideration at the present time. The collected results of these simulations are discussed.

  13. Analysis of the Wakefield Effects in the PEP-II SLAC B-FACTORY

    Energy Technology Data Exchange (ETDEWEB)

    Novokhatski, A; Seeman, J.; Sullivan, M.; Wienands, U.; /SLAC

    2009-07-06

    We present the history and analysis of different wake field effects throughout the operational life of the PEP-II SLAC B-factory. Although the impedance of the high and low energy rings is small, the intense high current beams generated a lot of power. The effects from these wake fields are: heating and damage of vacuum beam chamber elements like RF seals, vacuum valves , shielded bellows, BPM buttons and ceramic tiles; vacuum spikes, vacuum instabilities and high detector background; beam longitudinal and transverse instabilities. We also discuss the methods used to eliminate these effects. Results of this analysis and the PEP-II experience may be very useful in the design of new storage rings and light sources.

  14. The Spin Structure Function of the Proton from SLAC Experiment E155

    Energy Technology Data Exchange (ETDEWEB)

    McKee, P

    2004-02-17

    Experiment E155 at the Stanford Linear Accelerator Center (SLAC) measured the longitudinal and transverse deep inelastic structure functions of the proton and deuteron using a polarized, 48.3 GeV electron beam and solid polarized targets of ammonia ({sup 15}NH{sub 3}) for proton measurements and lithium deuteride ({sup 6}Li{sup 2}H) for deuteron measurements. Three electromagnetic spectrometers at angles of 2.75{sup o}, 5.5{sup o}, and 10.5{sup o} measured the scattered electrons. This work presents an analysis of the longitudinal structure function of the proton, g{sub 1}{sup p}(x, Q{sup 2}). Included is a re-analysis of the proton target polarization data that for the first time corrects a problem encountered which altered those measurements.

  15. 600 kV modulator design for the SLAC Next Linear Collider Test Accelerator

    International Nuclear Information System (INIS)

    Harris, K.; de Lamare, J.; Nesterov, V.; Cassel, R.

    1992-07-01

    Preliminary design for the SLAC Next Linear Collider Test Accelerator (NLCTA) requires a pulse power source to produce a 600 kV, 600 A, 1.4 μs, 0.1% flat top pulse with rise and fall times of approximately 100 ns to power an X-Band klystron with a microperveance of 1.25 at ∼ 100 MW peak RF power. The design goals for the modulator, including those previously listed, are peak modulator pulse power of 340 MW operating at 120 Hz. A three-stage darlington pulse-forming network, which produces a >100 kV, 1.4 μs pulse, is coupled to the klystron load through a 6:1 pulse transformer. Careful consideration of the transformer leakage inductance, klystron capacitance, system layout, and component choice is necessary to produce the very fast rise and fall times at 600 kV operating continuously at 120 Hz

  16. Single-bunch beam loading on the SLAC two-mile accelerator

    International Nuclear Information System (INIS)

    Koontz, R.F.

    1976-05-01

    The experiments described were initially prompted by interest in the radiation loss of relativistic electron rings passing through periodic structures. Later the same experiments became relevant to the theory of energy loss of electrons in large storage rings. In both of these cases energy loss to the higher order modes of the respective structures could seriously limit their effective operation. In these experiments, single bunches of electrons with intensities up to 7 x 10 8 electrons per bunch are accelerated through the SLAC three-kilometer accelerator, and their energy spectra are analyzed. Early experiments over a wide energy range (900 MeV to 19 GeV) demonstrated that the energy loss was proportional to the total charge in the bunch but was independent of beam energy. The average energy loss of a single bunch normalized to 10 9 electrons was initially measured to be 38 MeV

  17. Committee Report of the BEPC-II Project Design Review May 13-15, 2002, SLAC

    Energy Technology Data Exchange (ETDEWEB)

    Kawakami, Traci M.

    2002-08-26

    As part of the US-China Cooperative Program in High Energy Physics for the year 2002, a BEPC-II Upgrade Review meeting was held at SLAC, May 13-15, 2002. The upgrade is aimed at improving the luminosity and performance of the BEPC facility at IHEP in Beijing, China with major upgrades to the injector linac, storage ring, and detector. This review addresses mainly the accelerator related issues. Prior to the review, an updated Draft Design Report was made available to the review team. Most important technical change since April 2001 has been a change from a single-ring configuration to a doublering. The goal of the review is to determine whether BEPC-II, if built as described, will meet the operations and physics goals. The charge to the review team is attached as Appendix A.

  18. Facility for Advanced Accelerator Experimental Tests at SLAC (FACET) Conceptual Design Report

    Energy Technology Data Exchange (ETDEWEB)

    Amann, J.; Bane, K.; /SLAC

    2009-10-30

    This Conceptual Design Report (CDR) describes the design of FACET. It will be updated to stay current with the developing design of the facility. This CDR begins as the baseline conceptual design and will evolve into an 'as-built' manual for the completed facility. The Executive Summary, Chapter 1, gives an introduction to the FACET project and describes the salient features of its design. Chapter 2 gives an overview of FACET. It describes the general parameters of the machine and the basic approaches to implementation. The FACET project does not include the implementation of specific scientific experiments either for plasma wake-field acceleration for other applications. Nonetheless, enough work has been done to define potential experiments to assure that the facility can meet the requirements of the experimental community. Chapter 3, Scientific Case, describes the planned plasma wakefield and other experiments. Chapter 4, Technical Description of FACET, describes the parameters and design of all technical systems of FACET. FACET uses the first two thirds of the existing SLAC linac to accelerate the beam to about 20GeV, and compress it with the aid of two chicanes, located in Sector 10 and Sector 20. The Sector 20 area will include a focusing system, the generic experimental area and the beam dump. Chapter 5, Management of Scientific Program, describes the management of the scientific program at FACET. Chapter 6, Environment, Safety and Health and Quality Assurance, describes the existing programs at SLAC and their application to the FACET project. It includes a preliminary analysis of safety hazards and the planned mitigation. Chapter 7, Work Breakdown Structure, describes the structure used for developing the cost estimates, which will also be used to manage the project. The chapter defines the scope of work of each element down to level 3.

  19. Facility for Advanced Accelerator Experimental Tests at SLAC (FACET) Conceptual Design Report

    International Nuclear Information System (INIS)

    Amann, J.; Bane, K.

    2009-01-01

    This Conceptual Design Report (CDR) describes the design of FACET. It will be updated to stay current with the developing design of the facility. This CDR begins as the baseline conceptual design and will evolve into an 'as-built' manual for the completed facility. The Executive Summary, Chapter 1, gives an introduction to the FACET project and describes the salient features of its design. Chapter 2 gives an overview of FACET. It describes the general parameters of the machine and the basic approaches to implementation. The FACET project does not include the implementation of specific scientific experiments either for plasma wake-field acceleration for other applications. Nonetheless, enough work has been done to define potential experiments to assure that the facility can meet the requirements of the experimental community. Chapter 3, Scientific Case, describes the planned plasma wakefield and other experiments. Chapter 4, Technical Description of FACET, describes the parameters and design of all technical systems of FACET. FACET uses the first two thirds of the existing SLAC linac to accelerate the beam to about 20GeV, and compress it with the aid of two chicanes, located in Sector 10 and Sector 20. The Sector 20 area will include a focusing system, the generic experimental area and the beam dump. Chapter 5, Management of Scientific Program, describes the management of the scientific program at FACET. Chapter 6, Environment, Safety and Health and Quality Assurance, describes the existing programs at SLAC and their application to the FACET project. It includes a preliminary analysis of safety hazards and the planned mitigation. Chapter 7, Work Breakdown Structure, describes the structure used for developing the cost estimates, which will also be used to manage the project. The chapter defines the scope of work of each element down to level 3.

  20. [Correct contact lens hygiene].

    Science.gov (United States)

    Blümle, S; Kaercher, T; Khaireddin, R

    2013-06-01

    Although contact lenses have long been established in ophthalmology, practical aspects of handling contact lenses is becoming increasingly less important in the clinical training as specialist for ophthalmology. Simultaneously, for many reasons injuries due to wearing contact lenses are increasing. In order to correct this discrepancy, information on contact lenses and practical experience with them must be substantially increased from a medical perspective. This review article deals with the most important aspects for prevention of complications, i.e. contact lens hygiene.

  1. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    International Nuclear Information System (INIS)

    Jarvis, P.; Belzile, F.; Page, T.; Dean, C.

    1997-01-01

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  2. Prolonging contact lens wear and making contact lens wear safer.

    Science.gov (United States)

    Foulks, Gary N

    2006-02-01

    To summarize the present status of safety and efficacy of contact lens wear. Literature review. Ovid Medline searches were performed on records from 1966 through 2005 using keywords: keratitis, contact lens complications, extended-wear contact lenses, and silicone-hydrogel contact lenses. Patients desire comfort, clarity of vision, and prolonged contact lens wear when contact lenses are used to correct refractive error. Practitioners desire patient satisfaction but also require maintenance of the integrity of the eye and no complications that jeopardize vision or health of the eye. Improvements in the oxygen permeability of the contact lens materials, design of the contact lens and its surface, and solutions for the maintenance of the lens have reduced but not eliminated the risks of infection, inflammation, and conjunctival papillary reaction associated with contact lens wear. The lessons of past and recent history suggest that patient education and practitioner participation in the management of contact lens wear continue to be critical factors for patient satisfaction and safety in the extended wear of contact lenses. The availability of highly oxygen permeable contact lenses has increased the tolerance and safety of extended contact lens wear, but patient instruction and education in proper use and care of lenses is required and caution is advised.

  3. Superconducting ac cable

    International Nuclear Information System (INIS)

    Schmidt, F.

    1980-01-01

    The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.) [de

  4. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  5. AC resistance measuring instrument

    Science.gov (United States)

    Hof, P.J.

    1983-10-04

    An auto-ranging AC resistance measuring instrument for remote measurement of the resistance of an electrical device or circuit connected to the instrument includes a signal generator which generates an AC excitation signal for application to a load, including the device and the transmission line, a monitoring circuit which provides a digitally encoded signal representing the voltage across the load, and a microprocessor which operates under program control to provide an auto-ranging function by which range resistance is connected in circuit with the load to limit the load voltage to an acceptable range for the instrument, and an auto-compensating function by which compensating capacitance is connected in shunt with the range resistance to compensate for the effects of line capacitance. After the auto-ranging and auto-compensation functions are complete, the microprocessor calculates the resistance of the load from the selected range resistance, the excitation signal, and the load voltage signal, and displays of the measured resistance on a digital display of the instrument. 8 figs.

  6. Linear and nonlinear optical properties of a hydrogenic donor in lens-shaped quantum dots

    International Nuclear Information System (INIS)

    Vahdani, M.R.K.; Rezaei, G.

    2009-01-01

    Optical transitions in a Lens-Shaped Quantum Dot (LSD) are investigated in the presence of a hydrogenic impurity. The electronic wave functions are obtained analytically and the energy eigenvalues are calculated numerically. The density matrix formulation with the intersubband relaxation are used to evaluate the (linear and third order nonlinear) absorption coefficient (AC) and the change in the refractive indices (RI) analytically. The effect of the size of the LSD and optical intensity on the AC and RI are investigated. It is found that AC and RI are strongly affected by the optical intensity and the size of the LSD.

  7. Preliminary Conceptual Design Report for the FACET-II Project at SLAC National Accelerator Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Hogan, Mark [SLAC National Accelerator Lab., Menlo Park, CA (United States)

    2016-04-22

    Plasma wakefield acceleration has the potential to dramatically shrink the size and cost of particle accelerators. Research at the SLAC National Accelerator Laboratory has demonstrated that plasmas can provide 1,000 times the acceleration in a given distance compared with current technologies. Developing revolutionary and more efficient acceleration techniques that allow for an affordable high-energy collider is the focus of FACET, a National User Facility at SLAC. The existing FACET National User Facility uses part of SLAC’s two-mile-long linear accelerator to generate high-density beams of electrons and positrons. FACET-II is a new test facility to develop advanced acceleration and coherent radiation techniques with high-energy electron and positron beams. It is the only facility in the world with high energy positron beams. FACET-II provides a major upgrade over current FACET capabilities and the breadth of the potential research program makes it truly unique. It will synergistically pursue accelerator science that is vital to the future of both advanced acceleration techniques for High Energy Physics, ultra-high brightness beams for Basic Energy Science, and novel radiation sources for a wide variety of applications. The design parameters for FACET-II are set by the requirements of the plasma wakefield experimental program. To drive the plasma wakefield requires a high peak current, in excess of 10kA. To reach this peak current, the electron and positron design bunch size is 10μ by 10μ transversely with a bunch length of 10μ. This is more than 200 times better than what has been achieved at the existing FACET. The beam energy is 10 GeV, set by the Linac length available and the repetition rate is up to 30 Hz. The FACET-II project is scheduled to be constructed in three major stages. Components of the project discussed in detail include the following: electron injector, bunch compressors and linac, the positron system, the Sector 20 sailboat and W chicanes

  8. Single-Phase Direct Boost AC-AC Converter

    Directory of Open Access Journals (Sweden)

    URSARU, O.

    2017-11-01

    Full Text Available This paper introduces and studies a boost AC-AC converter circuit that can be used to supply power to the 220V receivers in the 110V grids or to increase and adjust voltage at the end of long lines. High frequency AC-AC converters have better specifications than alternative voltage phase control drives with thyristors or TRIACs. When frequency exceeds 20kHz, noise is eliminated, filters are smaller and efficiency is higher. The current waveform is much better, the output voltage can be higher than the input voltage and voltage control is more accurate.

  9. ACS Postflash Characterization

    Science.gov (United States)

    Smith, Linda

    2011-10-01

    This program will evaluate the in-flight performance of the ACS/WFC post-flash lamp. A series of observations of Omega Cen will be taken using short and long exposures. The short exposures will be post-flashed using pre-determined exposure times to produce backgrounds from 0 to 125 e-. The data will be used to {1} make an empirical study of the effectiveness in preserving counts for faint stars on various post-flash backgrounds; {2} validate that our current mechanisms for formula-based and pixel-based corrections provide good fixes for whatever CTE remains; and {3} probe a fine enough range of backgrounds that users will be able to pick the level that optimizes their science, which will be a straightforward compromise between the noise added and the signal preserved.

  10. Compliance among soft contact lens wearers.

    OpenAIRE

    Kuzman, Tomislav; Barišić Kutija, Marija; Masnec, Sanja; Jandroković, Sonja; Mrazovac, Danijela; Jurišić, Darija; Škegro, Ivan; Kalauz, Miro; Kordić, Rajko

    2014-01-01

    Contact lens compliance is proven to be crucial for preventing lens wear-related complications because of the interdependence of the steps in lens care regime and their influence on lens system microbial contamination. Awareness of the patients' lens handling compliance as well as correct recognition of non-compliant behaviours is the basis for creating more targeted strategies for patient education. The aim of this study was to investigate compliance among soft contact lens (SCL) wearers in ...

  11. Studies of Hadronic Physics with the BaBar Detector at SLAC and the Atlas Detector at the LHC

    Energy Technology Data Exchange (ETDEWEB)

    Brown, David Norvil [Univ. of Louisville, KY (United States). Dept. of Physics

    2016-06-30

    The University of Louisville High Energy Physics group contributed significantly to the success of the BaBar Experiment at SLAC and the Mu2e Experiment at Fermilab. In particular, they have contributed to understanding hadronic processes in electron-positron annihilation and charged lepton flavor violation in a very rare muon conversion process. Both are high-precision undertakings at the Intensity Frontier of High Energy Physics.

  12. Panoramic lens applications revisited

    Science.gov (United States)

    Thibault, Simon

    2008-04-01

    During the last few years, innovative optical design strategies to generate and control image mapping have been successful in producing high-resolution digital imagers and projectors. This new generation of panoramic lenses includes catadioptric panoramic lenses, panoramic annular lenses, visible/IR fisheye lenses, anamorphic wide-angle attachments, and visible/IR panomorph lenses. Given that a wide-angle lens images a large field of view on a limited number of pixels, a systematic pixel-to-angle mapping will help the efficient use of each pixel in the field of view. In this paper, we present several modern applications of these modern types of hemispheric lenses. Recently, surveillance and security applications have been proposed and published in Security and Defence symposium. However, modern hemispheric lens can be used in many other fields. A panoramic imaging sensor contributes most to the perception of the world. Panoramic lenses are now ready to be deployed in many optical solutions. Covered applications include, but are not limited to medical imaging (endoscope, rigiscope, fiberscope...), remote sensing (pipe inspection, crime scene investigation, archeology...), multimedia (hemispheric projector, panoramic image...). Modern panoramic technologies allow simple and efficient digital image processing and the use of standard image analysis features (motion estimation, segmentation, object tracking, pattern recognition) in the complete 360° hemispheric area.

  13. Application of the code Slac to the study of Ion Extraction Systems in Neutral Injectors

    International Nuclear Information System (INIS)

    Garcia, M.; Liniers, M.; Guasp, J.

    1997-01-01

    In this study different extraction geometries for intense ion beams have been analyzed with the code SLAC, in view of its possible application to the neutral injectors of TJ-II. With this aim, we have introduced several modifications in the code in order to correctly simulate the transition between the ion source plasma and the extraction region, which has great impact on the beam optics. These modifications include the introduction of a population of Boltzmann electrons in the transition region, and the implementation of an option to simulate the thermal velocity of the ions in the source. We have found a better agreement between the results obtained with the new version of the code and the experimental data in two well known systems. With this new version of the code two different studies have been carried out: in the first place an optimization of the ATF injectors extraction system for its use on TJ-II, leading to an optimum value of the gap in the energy range 30-40 KeV, and in the second place a systematic study of extraction geometries at 40 KeV. As a result of this second study we have found the combinations of parameters that can be used under different working conditions (e.g. different pulse lengths), leading to acceptable values of the beam divergence. (Author)

  14. Reproducibility of X-rays and CT arthrography in SLAC, SNAC, SCAC wrists.

    Science.gov (United States)

    Belhaouane, R; Lebeau, N; Maes-Clavier, C; Hustin, C; Krief, E; Bonnaire, B; Warin, M; Rotari, V; David, E

    2016-12-01

    The purpose of this study was to assess the inter-observer and intra-observer reproducibility of the interpretation of CT arthrography and plain X-rays for scapholunate advanced collapse (SLAC), scaphoid non-union advanced collapse (SNAC) and scaphoid chondrocalcinosis advanced collapse (SCAC) wrist conditions, as well as the clinical relevance of these imaging modalities. The CT and X-rays images were reviewed twice in a blinded and randomized manner by two experienced orthopedic surgeons specialized in hand surgery, two orthopedic surgery residents and two experienced radiologists specialized in bone and joint imaging. Cohen's kappa and Fleiss' kappa coefficients were used to analyze the reproducibility of interpretation of the radiological examinations. With CT arthrography, the overall diagnosis was often a problem, in terms of both inter- or intra-observer reproducibility. The assessment of the joint line appeared to be fairly reproducible for each observer but was poorly reproducible between different observers. Plain X-rays are not sufficient to assess cartilage quality in degenerative wrist disease. CT arthrography is a reliable examination, but its interpretation is not always standardized. Diagnostic arthroscopy may be justified in doubtful cases. Copyright © 2016 SFCM. Published by Elsevier Masson SAS. All rights reserved.

  15. A Proof-of-Principle Echo-enabled Harmonic Generation Free Electron Laser Experiment at SLAC

    Energy Technology Data Exchange (ETDEWEB)

    Pernet, Pierre-Louis [Swiss Federal Institute of Technology, Lausanne (Switzerland)

    2010-06-24

    With the advent of X-ray Free Electron Lasers (FELs), new methods have been developed to extend capabilities at short wavelengths beyond Self-Amplified Spontaneous Emission (SASE). In particular, seeding of a FEL allows for temporal control of the radiation pulse and increases the peak brightness by orders of magnitude. Most recently, Gennady Stupakov and colleagues at SLAC proposed a new technique: Echo-Enabled Harmonic Generation (EEHG). Here a laser microbunches the beam in an undulator and the beam is sheared in a chicane. This process is repeated with a second laser, undulator and chicane. The interplay between these allows a seeding of the X-ray laser up to the 100th harmonic of the first laser. After introducing the physics of FELs and the EEHG seeding technique, we describe contributions to the experimental effort. We will present detailed studies of the experiment including the choice of parameters and their optimization, the emittance effect, spontaneous emission in the undulators, the second laser phase effect, and measurements of the jitter between RF stations. Finally, the status and preliminary results of the Echo-7 experiment will be outlined.

  16. The E142 SLAC experiment: measurement of the neutron gn1(x) spin structure function

    International Nuclear Information System (INIS)

    Roblin, Y.

    1995-01-01

    This thesis describes the E142 experiment which has been carried out at the Stanford Linear Accelerator (SLAC), USA, from October to December 1992. This experiment of polarized inelastic scattering of a 22.6 GeV electron beam on a polarized helium 3 target has allowed the first measurement of the neutron g n 1 (x) spin structure function. The knowledge of this structure function gives informations on the nucleon spin structure. On the other hand, the g n 1 (x) structure function integral value on the 0 2 mean value of 2 GeV 2 after some extrapolations. This value is at about two standard deviations away from the theoretical predictions of the Ellis-Jaffe rule. Thanks to the existing experimental results for the proton (E143 experiment), the Bjorken sum rule has been precisely tested and is perfectly compatible with the theoretical value. The results have allowed to estimate the nucleon spin fraction carried by the quarks. (J.S.). 86 refs., 58 figs., 13 tabs

  17. Passive performance monitoring and traffic characteristics on the SLAC internet border

    International Nuclear Information System (INIS)

    Logg, C.; Cottrell, L.

    2001-01-01

    Understanding how the Internet is used by HEP is critical to optimizing the performance of the inter-lab computing environment. Typically use requirements have been defined by discussions between collaborators. However, later analysis of the actual traffic has show this is often misunderstood and actual use is significantly different to that predicted. Passive monitoring of the real traffic provides insight into the true communications requirements and the performance of a large number of inter-communicating nodes. It may be useful in identifying performance problems that are due to factors other than Internet congestion, especially when compared to other methods such as active monitoring where traffic is generated specifically to measure its performance. Controlled active monitoring between dedicated servers often gives an indication of what can be achieved on a network. Passive monitoring of the real traffic gives a picture of the true performance. The authors will discuss the method and results of collecting and analyzing flows of data obtained from the SLAC Internet border. The insights this has brought to understanding the network will be reviewed and the benefit it can bring to engineering networks will be discussed

  18. An Exploration of Analysis Software at SLAC through the Study of X(3872)

    International Nuclear Information System (INIS)

    Fischer, A.

    2004-01-01

    X(3872), a particle discovered by Belle Labs, has not yet been described in a sufficient enough way by any group to draw definitive conclusions about it. In order to verify the claims of Belle Labs and learn more about X(3872), Stanford Linear Accelerator Center (henceforth SLAC) has undertaken a project to analyze the particle, a subgroup of the BaBar project. The computing systems involved are complex; the tutorials for the software and new software releases both need constant testing and revision. Using a new software release, I tested tutorials for various software used by the BaBar group, including UNIX, Root, and CM2, in an effort to eventually analyze X(3872) data. The offline workbook for the BaBar software needs to be better maintained, and the CM2 tutorials need to be modified and updated. While none of my results contributed directly to the project (i.e. I have no results that add to information about X(3872)), improvement of the tutorials will streamline integration of new scientists into the BaBar group

  19. STATUS OF X-BAND STANDING WAVE STRUCTURE STUDIES AT SLAC

    International Nuclear Information System (INIS)

    Dolgashev, Valery A.

    2003-01-01

    The linacs proposed for the Next Linear Collider (NLC) and Japanese Linear Collider (JLC) would contain several thousand X-Band accelerator structures that would operate at a loaded gradient of 50 MV/m. An extensive experimental and theoretical program is underway at SLAC, FNAL and KEK to develop structures that reliably operate at this gradient. The development of standing wave structures is a part of this program. The properties of standing wave structures allow them to operate at the loaded gradient in contrast to traveling wave structures that need conditioning to the unloaded gradient (65 MV/m for NLC/JLC). The gradients in the standing structures tested thus far have been limited by input coupler breakdowns. The behavior of these breakdowns is consistent with a model of pulsed heating due to high magnetic fields. New input couplers have been designed to reduce maximum magnetic fields. This paper discusses design considerations related to high power performance, wakefield suppression and results of high power tests of prototype standing wave structures

  20. Recent Measurements And Plans for the SLAC Compton X-Ray Source

    Energy Technology Data Exchange (ETDEWEB)

    Vlieks, A.E.; Akre, R.; Caryotakis, G.; DeStefano, C.; Frederick, W.J.; Heritage, J.P.; Luhmann, N.C.; Martin, D.; Pellegrini, C.; /SLAC /UC, Davis /UCLA

    2006-02-14

    A compact source of monoenergetic X-rays, generated via Compton backscattering, has been developed in a collaboration between U.C Davis and SLAC. The source consists of a 5.5 cell X-band photoinjector, a 1.05 m long high gradient accelerator structure and an interaction chamber where a high power (TW), short pulse (sub-ps) infrared laser beam is brought into a nearly head-on collision with a high quality focused electron beam. Successful completion of this project will result in the capability of generating a monoenergetic X-ray beam, continuously tunable from 20 - 85 keV. We have completed a series of measurements leading up to the generation of monoenergetic X-rays. Measurements of essential electron beam parameters and the techniques used in establishing electron/photon collisions will be presented. We discuss the design of an improved interaction chamber, future electro-optic experiments using this chamber and plans for expanding the overall program to the generation of Terahertz radiation.

  1. Study of the nucleon spin structure functions: the E154 experiment at SLAC

    International Nuclear Information System (INIS)

    Sabatie, Franck

    1998-01-01

    In experiment E154 at SLAC, the spin dependent structure function g 1 n was measured by scattering longitudinally polarized 50 GeV electrons off a longitudinally polarized helium 3 target. We report the integral over the measured x range to be ∫ 0.014 0.7 g 1 n (x,5 GeV 2 )dx = -0.0348 ± 0.0033 ± 0.0043 ± 0.0014. We observe relatively large values of g 1 n at low x, calling into question the reliability of the data extrapolation down to x equal 0. Such a divergent behavior seems to disagree with the prediction of the Regge theory but can be quantitatively explained by perturbative QCD. Moreover, we have performed a NLO perturbative QCD analysis of the world data on g 1 , paying careful attention to both the theoretical hypothesis and the calculation of errors. Using a parametrization of the polarized parton distribution at a low scale, we can access the fraction of spin carried by quarks: ΔΣ = 29 ± 6 pc in the MS-bar scheme, and ΔΣ = 37 ± 7 pc in the AB scheme. The gluon contribution to the nucleon spin is not well enough constrained by the current data, but seems to lie between 0 and 2. This study allows us to extract the first moment of the g 1 structure function and we find agreement with the Bjorken sum rule expectations. (author) [fr

  2. Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax ...

    Indian Academy of Sciences (India)

    Prakash

    Therefore, these glycoproteins appear to be potential candidates for a vector- directed transmission-blocking vaccine (TBV). [Chugh M, Gulati B R and Gakhar S K 2010 Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax development in the Indian malaria vector Anopheles culicifacies (Diptera: culicidae); J.

  3. Crystalline lens radioprotectors

    International Nuclear Information System (INIS)

    Belkacemi, Y.; Pasquier, D.; Castelain, B.; Lartigau, E.; Warnet, J.M.

    2003-01-01

    During more than a half of century, numerous compounds have been tested in different models against radiation-induced cataract. In this report, we will review the radioprotectors that have been already tested for non-human crystalline lens protection. We will focus on the most important published studies in this topic and the mechanisms of cyto-protection reported in. vitro and in. vivo from animals. The most frequent mechanisms incriminated in the cyto-protective effect are: free radical scavenging, limitation of lipid peroxidation, modulation of cycle progression increase of intracellular reduced glutathione pool, reduction of DNA strand breaks and limitation of apoptotic cell death. Arnifostine (or Ethyol) and anethole dithiolethione (or Sulfarlem), already used clinically as chemo- and radio-protectants, could be further test?r for ocular radioprotection particularly for radiation-induced cataract. (author)

  4. ACS Photometric Zero Point Verification

    Science.gov (United States)

    Dolphin, Andrew

    2003-07-01

    The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.

  5. Electricity-AC versus DC

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 10. Electricity - AC versus DC. D P Sen Gupta. General Article Volume 2 Issue 10 October 1997 pp 46-53. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/002/10/0046-0053. Author Affiliations.

  6. Introduction to AC machine design

    CERN Document Server

    Lipo, Thomas A

    2018-01-01

    AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...

  7. Contact Lens Wear at Altitude: Subcontact Lens Bubble Formation

    Science.gov (United States)

    1987-11-01

    incidence of (PMMA) lenses . Reported here are the results of contact lens subcontact lens bubble formation under scleral lenses at bubble studies with soft...vision from formation of large bubbles greater than 6,096 m (20,000 It). With soft contact lenses , bubble under their contact lenses . They also found...always located at the limbus and were without sequela to vision or corneal epithelial integrity. scleral lenses used by Jaeckle were permeable to gases

  8. Design of the SLAC RCE Platform: A General Purpose ATCA Based Data Acquisition System

    Energy Technology Data Exchange (ETDEWEB)

    Herbst, R. [SLAC National Accelerator Laboratory, Menlo Park, CA (United States). Research Engineering Div.; Claus, R. [SLAC National Accelerator Laboratory, Menlo Park, CA (United States). Research Engineering Div.; Freytag, M. [SLAC National Accelerator Laboratory, Menlo Park, CA (United States). Research Engineering Div.; Haller, G. [SLAC National Accelerator Laboratory, Menlo Park, CA (United States). Research Engineering Div.; Huffer, M. [SLAC National Accelerator Laboratory, Menlo Park, CA (United States). Research Engineering Div.; Maldonado, S. [SLAC National Accelerator Laboratory, Menlo Park, CA (United States). Research Engineering Div.; Nishimura, K. [SLAC National Accelerator Laboratory, Menlo Park, CA (United States). Research Engineering Div.; O' Grady, C. [SLAC National Accelerator Laboratory, Menlo Park, CA (United States). Research Engineering Div.; Panetta, J. [SLAC National Accelerator Laboratory, Menlo Park, CA (United States). Research Engineering Div.; Perazzo, A. [SLAC National Accelerator Laboratory, Menlo Park, CA (United States). Research Engineering Div.; Reese, B. [SLAC National Accelerator Laboratory, Menlo Park, CA (United States). Research Engineering Div.; Ruckman, L. [SLAC National Accelerator Laboratory, Menlo Park, CA (United States). Research Engineering Div.; Thayer, J. G. [SLAC National Accelerator Laboratory, Menlo Park, CA (United States). Research Engineering Div.; Weaver, M. [SLAC National Accelerator Laboratory, Menlo Park, CA (United States). Research Engineering Div.

    2015-01-23

    The SLAC RCE platform is a general purpose clustered data acquisition system implemented on a custom ATCA compliant blade, called the Cluster On Board (COB). The core of the system is the Reconfigurable Cluster Element (RCE), which is a system-on-chip design based upon the Xilinx Zynq family of FPGAs, mounted on custom COB daughter-boards. The Zynq architecture couples a dual core ARM Cortex A9 based processor with a high performance 28nm FPGA. The RCE has 12 external general purpose bi-directional high speed links, each supporting serial rates of up to 12Gbps. 8 RCE nodes are included on a COB, each with a 10Gbps connection to an on-board 24-port Ethernet switch integrated circuit. The COB is designed to be used with a standard full-mesh ATCA backplane allowing multiple RCE nodes to be tightly interconnected with minimal interconnect latency. Multiple shelves can be clustered using the front panel 10-gbps connections. The COB also supports local and inter-blade timing and trigger distribution. An experiment specific Rear Transition Module adapts the 96 high speed serial links to specific experiments and allows an experiment-specific timing and busy feedback connection. This coupling of processors with a high performance FPGA fabric in a low latency, multiple node cluster allows high speed data processing that can be easily adapted to any physics experiment. RTEMS and Linux are both ported to the module. The RCE has been used or is the baseline for several current and proposed experiments (LCLS, HPS, LSST, ATLAS-CSC, LBNE, DarkSide, ILC-SiD, etc).

  9. Design of the SLAC RCE Platform: A General Purpose ATCA Based Data Acquisition System

    International Nuclear Information System (INIS)

    Herbst, R.; Claus, R.; Freytag, M.; Haller, G.; Huffer, M.; Maldonado, S.; Nishimura, K.; O'Grady, C.; Panetta, J.; Perazzo, A.; Reese, B.; Ruckman, L.; Thayer, J.G.; Weaver, M.

    2015-01-01

    The SLAC RCE platform is a general purpose clustered data acquisition system implemented on a custom ATCA compliant blade, called the Cluster On Board (COB). The core of the system is the Reconfigurable Cluster Element (RCE), which is a system-on-chip design based upon the Xilinx Zynq family of FPGAs, mounted on custom COB daughter-boards. The Zynq architecture couples a dual core ARM Cortex A9 based processor with a high performance 28nm FPGA. The RCE has 12 external general purpose bi-directional high speed links, each supporting serial rates of up to 12Gbps. 8 RCE nodes are included on a COB, each with a 10Gbps connection to an on-board 24-port Ethernet switch integrated circuit. The COB is designed to be used with a standard full-mesh ATCA backplane allowing multiple RCE nodes to be tightly interconnected with minimal interconnect latency. Multiple shelves can be clustered using the front panel 10-gbps connections. The COB also supports local and inter-blade timing and trigger distribution. An experiment specific Rear Transition Module adapts the 96 high speed serial links to specific experiments and allows an experiment-specific timing and busy feedback connection. This coupling of processors with a high performance FPGA fabric in a low latency, multiple node cluster allows high speed data processing that can be easily adapted to any physics experiment. RTEMS and Linux are both ported to the module. The RCE has been used or is the baseline for several current and proposed experiments (LCLS, HPS, LSST, ATLAS-CSC, LBNE, DarkSide, ILC-SiD, etc).

  10. Straylight Measurements in Contact Lens Wear

    NARCIS (Netherlands)

    van der Meulen, Ivanka J. E.; Engelbrecht, Leonore A.; van Vliet, Johannes M. J.; Lapid-Gortzak, Ruth; Nieuwendaal, Carla P.; Mourits, Maarten P.; Schlingemann, Reinier O.; van den Berg, Thomas J. T. P.

    2010-01-01

    Purpose: (1) To quantify the effect of contact lens wear on straylight in rigid and soft contact lens wearers and (2) to relate findings to morphological changes and subjective complaints. Methods: Straylight was measured using the Oculus C-Quant during contact lens wear and after contact lens

  11. Aislamiento acústico

    Directory of Open Access Journals (Sweden)

    Tobío, J. M.

    1970-07-01

    Full Text Available This is a very specific subject in the field of architectural acoustics, namely, insulation'. Emphasis is placed on the theoretical foundations of this phenomenon, and the most simple formula are developed to calculate easily the transmission losses of a material or the constructional insulating arrangements. The practical aspect of insulation can be considered by means of several graphs and charts, without the use of mathematics, and utilising common materials, that will not substantially increase the cost of the project. Finally this papers offers a critical discussion of building codes, and their reference to the acoustical insulation of dwellings, and data is included on the new regulations of the Madrid Municipality.Se trata un tema muy concreto de la Acústica Arquitectónica, el aislamiento, haciendo hincapié en los fundamentos teóricos del fenómeno y estableciendo las fórmulas más sencillas que permiten calcular fácilmente las pérdidas de transmisión de un material o disposición constructiva aislante. Varias gráficas y abacos permiten abordar, sin ningún tratamiento matemático, el problema práctico del aislamiento, aprovechando los materiales comunes y sin ocasionar gastos que graven sustancialmente el importe del proyecto. Por último, se hace un estudio crítico de las normas y su incidencia en los problemas del aislamiento de viviendas, incluyendo datos referentes a la nueva Ordenanza del Ayuntamiento de Madrid.

  12. Reconstitution of CO2 Regulation of SLAC1 Anion Channel and Function of CO2-Permeable PIP2;1 Aquaporin as CARBONIC ANHYDRASE4 Interactor

    Science.gov (United States)

    Zeise, Brian; Xu, Danyun; Rappel, Wouter-Jan; Boron, Walter F.; Schroeder, Julian I.

    2016-01-01

    Dark respiration causes an increase in leaf CO2 concentration (Ci), and the continuing increases in atmospheric [CO2] further increases Ci. Elevated leaf CO2 concentration causes stomatal pores to close. Here, we demonstrate that high intracellular CO2/HCO3− enhances currents mediated by the Arabidopsis thaliana guard cell S-type anion channel SLAC1 upon coexpression of any one of the Arabidopsis protein kinases OST1, CPK6, or CPK23 in Xenopus laevis oocytes. Split-ubiquitin screening identified the PIP2;1 aquaporin as an interactor of the βCA4 carbonic anhydrase, which was confirmed in split luciferase, bimolecular fluorescence complementation, and coimmunoprecipitation experiments. PIP2;1 exhibited CO2 permeability. Mutation of PIP2;1 in planta alone was insufficient to impair CO2- and abscisic acid-induced stomatal closing, likely due to redundancy. Interestingly, coexpression of βCA4 and PIP2;1 with OST1-SLAC1 or CPK6/23-SLAC1 in oocytes enabled extracellular CO2 enhancement of SLAC1 anion channel activity. An inactive PIP2;1 point mutation was identified that abrogated water and CO2 permeability and extracellular CO2 regulation of SLAC1 activity. These findings identify the CO2-permeable PIP2;1 as key interactor of βCA4 and demonstrate functional reconstitution of extracellular CO2 signaling to ion channel regulation upon coexpression of PIP2;1, βCA4, SLAC1, and protein kinases. These data further implicate SLAC1 as a bicarbonate-responsive protein contributing to CO2 regulation of S-type anion channels. PMID:26764375

  13. AcEST: DK945159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available id J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac

  14. AcEST: DK945724 [AcEST

    Lifescience Database Archive (English)

    Full Text Available id J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac

  15. Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax ...

    Indian Academy of Sciences (India)

    The number of oocysts that developed was reduced by 78.6% when mosquitoes ingested a combination of these two mAbs along with the blood meal. AC-43 mAb binds to the epitope common in 97, 80 and 43 kDa polypeptides from the midgut protein extract, as indicated by western blot analysis. Similarly, the mAb AC-29 ...

  16. Using AC Motors in Robotics

    Directory of Open Access Journals (Sweden)

    Hosein Marzi

    2008-11-01

    Full Text Available It has been proven that fuzzy controllers are capable of controlling non-linear systems where it is cumbersome to develop conventional controllers based on mathematical modeling. This paper describes designing fuzzy controllers for an AC motor run mechanism. It also compares performance of two controllers designed based on Mamdani and Takagi-Sugeno with the conventional control scheme in a short track length, following a high disturbance. Fine and rapid control of AC motors have been a challenge and the main obstacle in gaining popularity in use of AC motors in robots actuators. This chapter reviews how use of intelligent control scheme can help to solve this problem.

  17. Contact Lens Related Corneal Ulcer

    OpenAIRE

    Loh, KY; Agarwal, P

    2010-01-01

    A corneal ulcer caused by infection is one of the major causes of blindness worldwide. One of the recent health concerns is the increasing incidence of corneal ulcers associated with contact lens user especially if the users fail to follow specific instruction in using their contact lenses. Risk factors associated with increased risk of contact lens related corneal ulcers are: overnight wear, long duration of continuous wear, lower socio-economic classes, smoking, dry eye and poor hygiene. Th...

  18. AcEST: BP921068 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |L_PIRVV RNA-directed RNA polymerase OS=Pirital virus (isolate Rat/Venezuela/VAV-488/1995) Align length 54 S...L_PIRVV RNA-directed RNA polymerase OS=Pirital virus (isolate Rat/Venezuela/VAV-488/1995) GN=L PE=3 SV=1 Len

  19. A course in lens design

    CERN Document Server

    Velzel, Chris

    2014-01-01

    A Course in Lens Design is an instruction in the design of image-forming optical systems. It teaches how a satisfactory design can be obtained in a straightforward way. Theory is limited to a minimum, and used to support the practical design work. The book introduces geometrical optics, optical instruments and aberrations. It gives a description of the process of lens design and of the strategies used in this process. Half of its content is devoted to the design of sixteen types of lenses, described in detail from beginning to end. This book is different from most other books on lens design because it stresses the importance of the initial phases of the design process: (paraxial) lay-out and (thin-lens) pre-design. The argument for this change of accent is that in these phases much information can be obtained about the properties of the lens to be designed. This information can be used in later phases of the design. This makes A Course in Lens Design a useful self-study book, and a suitable basis for an intro...

  20. Gabor lens theory

    International Nuclear Information System (INIS)

    Irani, A.A.

    1978-01-01

    The principle of using the space charge of an electron cloud to focus ion beams was first proposed by Gabor. Electrons are to be confined radially by means of an axial magnetic field B/sub z/ and axially by means of externally applied electric fields E/sub z/. An ion beam of charge density n/sub i/ much less than n/sub e/, the electron charge density can then be focused by the radial electric field set up by the electron cloud. The case considered here is that of a hollow cylindrical conductor charged to a potential +V with grounded rings on either side to set up the axial E/sub z/ field. A solenoid wound around the central conductor supplies the B/sub z/ field. Theoretical calculations are carried out for n/sub e/ maximum as a function of B/sub z/ due to radial confinement and V due to axial confinement and the focal length of the Gabor Lens is calculated

  1. Iris pigmentation and AC thresholds.

    Science.gov (United States)

    Roche, A F; Mukherjee, D; Chumlea, W C; Siervogel, R M

    1983-03-01

    Data from 160 White children were used to analyze possible associations between iris pigmentation and AC pure-tone thresholds. Iris pigmentation was graded from iris color using glass models of eyes, and AC thresholds were obtained under carefully controlled conditions. Analyses of variance using two groupings of iris color grades showed no evidence of an association between iris color grade and AC thresholds. Furthermore, inspection of arrays of the actual glass eye models, in conjunction with the order of mean thresholds at each test frequency, did not indicate the presence of an association between iris color grades and thresholds. It was concluded that while iris pigmentation may be related to some aspects of hearing ability, it does not appear to be related to AC thresholds in children.

  2. [Contact lens care and maintenance].

    Science.gov (United States)

    Bloise, L

    2017-04-01

    All contact lenses with replacement schedules longer than daily must be maintained. At each step of their use, the lenses may be contaminated. Contact lens solutions perform the essential functions of cleaning, decontaminating and preserving the lenses to prevent infectious problems and improve wearing comfort. Contact lens contamination essentially comes from hands, cleaning solutions, cases, water and the environment. The pathogenic microorganisms are mainly Gram-negative bacteria, fungi and amoebae. Contact lens deposits may or may not have an organic origin. Their presence increases the risk of infection because they serve as a nutrient matrix for microbes, and they are responsible for wearing discomfort. Contact lens solutions differ in their composition, their mechanism of action and the concentration of the various agents. To prescribe the best lens care system to each wearer and for each material, it is necessary to be very familiar with them. Maintenance is the main cause of discomfort with contact lenses, either through improper use, solution-material incompatibility, or a reaction of the wearer to the components. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  3. Research and Development Toward a 4.5-1.5 Angstrom Linac Coherent Light Source (LCLS) at SLAC

    International Nuclear Information System (INIS)

    Tatchyn, R.; Arthur, J.; Baltay, M.

    1995-08-01

    In recent years significant studies have been initiated on the feasibility of utilizing a portion of the 3km S-band accelerator at SLAC to drive a short wavelength (4.5-1.5 A) Linac Coherent Light Source (LCLS), a Free Electron Laser (FEL) operating in the Self- Amplified Spontaneous Emission (SASE) regime. Electron beam requirements for single-pass saturation in a minimal time include: (1) a peak current in the 7 kA range, (2) a relative energy spread of <0.05%, and (3) a transverse emittance, ε[r-m], approximating the diffraction limit condition ε = λ / 4π, where lambda(m) is the output wavelength. Requirements on the insertion device include field error levels of 0.02% for keeping the electron bunch centered on and in phase with the amplified photons, and a focusing beta of 8 m/rad for inhibiting the dilution of its transverse density. Although much progress has been made in developing individual components and beam processing techniques necessary for LCLS operation down to approx. 20 A, a substantial amount of research and development is still required in a number of theoretical and experimental areas leading to the construction and operation of a 4.5-1.5 A LCLS. In this paper we report on a research and development program underway and in planning at SLAC for addressing critical questions in these areas

  4. AcEST: DK961653 [AcEST

    Lifescience Database Archive (English)

    Full Text Available s P... 30 6.4 sp|Q93WH6|LEC_LENCC Lectin OS=Lens culinaris subsp. culinaris PE... 30 6.4 sp|P0C6A2|MAMD1_MOUSE Master... P+ L+ S+++N P VPEWV G Sbjct: 200 TNVLTVTLTYPNSLEEENVTSYTLNEVVPLKDVVPEWVRIG 240 >sp|P0C6A2|MAMD1_MOUSE Master

  5. The SNAP Strong Lens Survey

    Energy Technology Data Exchange (ETDEWEB)

    Marshall, P.

    2005-01-03

    Basic considerations of lens detection and identification indicate that a wide field survey of the types planned for weak lensing and Type Ia SNe with SNAP are close to optimal for the optical detection of strong lenses. Such a ''piggy-back'' survey might be expected even pessimistically to provide a catalogue of a few thousand new strong lenses, with the numbers dominated by systems of faint blue galaxies lensed by foreground ellipticals. After sketching out our strategy for detecting and measuring these galaxy lenses using the SNAP images, we discuss some of the scientific applications of such a large sample of gravitational lenses: in particular we comment on the partition of information between lens structure, the source population properties and cosmology. Understanding this partitioning is key to assessing strong lens cosmography's value as a cosmological probe.

  6. Automated Fresnel lens tester system

    Energy Technology Data Exchange (ETDEWEB)

    Phipps, G.S.

    1981-07-01

    An automated data collection system controlled by a desktop computer has been developed for testing Fresnel concentrators (lenses) intended for solar energy applications. The system maps the two-dimensional irradiance pattern (image) formed in a plane parallel to the lens, whereas the lens and detector assembly track the sun. A point detector silicon diode (0.5-mm-dia active area) measures the irradiance at each point of an operator-defined rectilinear grid of data positions. Comparison with a second detector measuring solar insolation levels results in solar concentration ratios over the image plane. Summation of image plane energies allows calculation of lens efficiencies for various solar cell sizes. Various graphical plots of concentration ratio data help to visualize energy distribution patterns.

  7. Compliance among soft contact lens wearers.

    Science.gov (United States)

    Kuzman, Tomislav; Kutija, Marija Barisić; Masnec, Sanja; Jandroković, Sonja; Mrazovac, Danijela; Jurisić, Darija; Skegro, Ivan; Kalauz, Miro; Kordić, Rajko

    2014-12-01

    Contact lens compliance is proven to be crucial for preventing lens wear-related complications because of the interdependence of the steps in lens care regime and their influence on lens system microbial contamination. Awareness of the patients' lens handling compliance as well as correct recognition of non-compliant behaviours is the basis for creating more targeted strategies for patient education. The aim of this study was to investigate compliance among soft contact lens (SCL) wearers in different aspects of lens care handling and wearing habits. In our research 50 asymptomatic lens wearers filled out a questionnaire containing demographic data, lens type, hygiene and wearing habits, lenses and lens care system replacement schedule and self-evaluation of contact lens handling hygiene. We established criteria of compliance according to available manufacturer's recommendations, prior literature and our clinical experience. Only 2 (4%) of patients were fully compliant SCL wearers. The most common non-compliant behaviours were insufficient lens solution soaking time (62%), followed by failure to daily exchange lens case solution and showering while wearing lenses. 44% of patients reported storing lenses in saline solution. Mean lens storage case replacement was 3.6 months, with up to 78% patients replacing lens case at least once in 3 months. Average grade in self evaluating level of compliance was very good (4 +/- 0.78) (from 1-poor level of hygiene to 5-great level of hygiene). Lens wearers who reported excessive daily lens wear and more than 10 years of lens wearing experience were also found to be less compliant with other lens system care procedures. (t = -2.99, df=47, p lens system maintenance steps. Most common non-compliant behaviours were the ones that are crucial for maintaining lens sterility and preventing infection. Despite the low objective compliance rate, self grading was relatively high. Therefore, these results indicate the need for patient

  8. Computer-aided lens assembly

    Science.gov (United States)

    Tomlinson, Richard; Alcock, Rob; Petzing, Jon; Coupland, Jeremy

    2004-01-01

    We propose a computer-aided method of lens manufacture that allows assembly, adjustment, and test phases to be run concurrently until an acceptable level of optical performance is reached. Misalignment of elements within a compound lens is determined by a comparison of the results of physical ray tracing by use of an array of Gaussian laser beams with numerically obtained geometric ray traces. An estimate of misalignment errors is made, and individual elements are adjusted in an iterative manner until performance criteria are achieved. The method is illustrated for the alignment of an air-spaced doublet.

  9. Acanthamoeba keratitis. Contact lens and noncontact lens characteristics.

    Science.gov (United States)

    Chynn, E W; Lopez, M A; Pavan-Langston, D; Talamo, J H

    1995-09-01

    To identify potential differences in time to diagnosis and final visual outcome between contact lens and noncontact lens users with Acanthamoeba keratitis. Prior studies have shown early diagnosis and therapy to be related to outcome but have not analyzed differences among patients with and without contact lenses. A retrospective analysis of 11 consecutive cases (involving 13 eyes) of Acanthamoeba keratitis diagnosed at one institution over a 3-year period. Mean time to diagnosis was significantly longer in noncontact lens users versus those who wore contact lenses (mean, 5.8 versus 3.3 weeks). Fifty percent of patients who did not wear contact lenses had a poor outcome (visual acuity worse than 20/40 or penetrating keratoplasty) versus 14% of patients who wore contact lenses. Diagnoses were made later in patients without contact lenses, and these patients had a worse visual outcome than those with Acanthamoeba keratitis who wore contact lenses. All patients with unresponsive microbial keratitis, even those without contact lens use, should be evaluated for Acanthamoeba.

  10. AcEST: DK963222 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|P81919|OR46A_DROME Odorant receptor 46a, isoform A OS=Drosoph... 32 2.8 sp|Q5MJ68|SPDYC_HUMAN Speed...FCFKA 181 CS +T + AV S L + +YV + AC Q FI C+ A Sbjct: 262 CSVLVLTANFYAIAVLSDERLELFKYVTYQACMLIQIFILCYYA 305 >sp|Q5MJ68|SPDYC_HUMAN Spee

  11. AcEST: BP913556 [AcEST

    Lifescience Database Archive (English)

    Full Text Available N Ubiquitin-protein ligase E3B OS=Homo sapie... 31 3.5 sp|Q9VDW6|DMDA_DROME Dystrophin, isoforms A/C/F/G/H O...SVPALVTHLSTVTPERLTVLESHDMLRKF 287 >sp|Q9VDW6|DMDA_DROME Dystrophin, isoforms A/C/

  12. AcEST: BP918420 [AcEST

    Lifescience Database Archive (English)

    Full Text Available D 180 >sp|A8AC98|APGM_IGNH4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ignicoccus hosp...italis (strain KIN4/I / DSM 18386 / JCM 14125) GN=apgM PE=3 SV=1 Length = 416 Score

  13. A Precision Measurement of the Spin Structure of the Proton at SLAC

    Energy Technology Data Exchange (ETDEWEB)

    Erbacher, Robin D

    1999-09-22

    E143 at SLAC Endstation A performed deep-inelastic scattering measurements of polarized electrons from polarized protons and deuterons within cryogenic {sup 15}NH{sub 3} and {sup 15}ND{sub 3}, respectively. Data were taken at incident energies of 29.1, 16.2 and 9.7 GeV, and covered the kinematical range x > 0:03 and 0:3 < Q{sup 2} < 12 (GeV/c){sup 2}. The scattered electrons were detected by two spectrometers at angles of 4.5{sup o} and 7.0{sup o}. From these data, the spin-dependent structure functions g{sub 1}{sup p}(x; Q{sup 2}) and g{sub 1}{sup d}(x; Q{sup 2}) were determined. This dissertation describes the experiment, with emphasis on the results on the proton spin structure. The integral of g{sub 1} over the range 0 < x < 1 was found to be {Gamma}{sub 1}{sup p} = 0.130 {+-} 0.003 {+-} 0.008 for the proton and {Gamma}{sub 1}{sup d} = 0.044 {+-} 0.003 {+-} 0.004 for the deuteron. Both values are in agreement with world data, and violate the Ellis-Jaffe sum rule by more than 3 standard deviations. The neutron structure function was obtained by combining proton and deuteron results, giving {Gamma}{sub 1}{sup n} = [0.035 {+-} 0.007 {+-} 0.010]. From this the integral {Gamma}{sub 1}{sup p}-{Gamma}{sub 1}{sup n} followed, yielding 0.165 {+-} 0.009 {+-} 0.016 at Q{sup 2} = 3 (GeV/c){sup 2}, in agreement with the Bjorken sum rule to within one standard deviation. The Q{sup 2}-dependence of the ratio g{sub 1}/F{sub 1} was determined to be small for Q{sup 2} > 1 (GeV/c){sup 2}, validating the assumption of no Q{sup 2}-dependence used in obtaining the integrals. A small rise with increasing Q{sup 2} was seen in the ratio for Q{sup 2} < 1 (GeV/c){sup 2}, however. The total quark contribution to the spin was found to be {Delta}q = 0.28 {+-} 0.09 for the proton, and {Delta}q = 0.32 {+-} 0.05 for the deuteron. Furthermore, a large negative spin contribution from the strange sea quarks was measured for both nucleons, giving {Delta}s = 0.10 {+-} 0.03 and {Delta}s = -0

  14. Nuclear structure of $^{231}$Ac

    CERN Document Server

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  15. Nuclear structure of 231Ac

    International Nuclear Information System (INIS)

    Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.

    2008-01-01

    The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus

  16. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA...

  17. A microcapillary lens for X-rays

    CERN Document Server

    Dudchik, Y I

    1999-01-01

    A new design of a compound refractive lens for X-rays is proposed. The lens is made as a set of glue microlenses placed in a glass capillary. The technique of lens fabrication is described. Results of ray tracing calculations for 8 and 15 keV photons are represented.

  18. The Ultrawideband Leaky Lens Antenna

    NARCIS (Netherlands)

    Bruni, S.; Neto, A.; Marliani, F.

    2007-01-01

    A novel directive and nondispersive antenna is presented: the ultrawideband (UWB) leaky lens. It is based on the broad band Cherenkov radiation occurring at a slot printed between different infinite homogeneous dielectrics. The first part of the paper presents the antenna concept and the UWB design.

  19. ECTOPIC LENS EXTRACTION IN CHILDREN

    Directory of Open Access Journals (Sweden)

    Vladimir Pfeifer

    2002-12-01

    Full Text Available Background. Ectopia lentis continues to be a therapeutic challenge for ophthalmologists. It can occur as an isolated condition, after ocular trauma, in association with other ocular disorders, as part of a systemic mesodermal disease or a complication of general metabolic disorders. Minimal subluxation of the lens may cause no visual symptoms, but in more advanced cases serious optical disturbances arise. The most important is amblyopia. Surgical treatment options include iris manipulation, lens discission, aspiration, intracapsular or extracapsular extraction, and pars plana lensectomy. The choice of surgical technique remains controversial, in part because of the historically poor visual results and high rate of perioperative complications, including vitreous loss and retinal detachment.Methods. We describe a surgical technique based on the use of the Cionni endocapsular tension ring, dry irrigation aspiration of lens material, centration of the capsular bag and foldable intraocular lens implantation into the bag. With mentioned surgical technique 8 patients were operated; 4 boys and 4 girls, together 11 eyes.Results. The final BCVA after follow up period improved in 9 eyes and it remained the same as before operation in one eye. Statistical comparison of preoperative and postoperative visual acuities showed significant improvement. On the other hand there was no correlation between preoperative and postoperative visual acuity.Conclusions. This surgical procedure is an alternative approach in solving this challenging cases of ectopia lentis with good postoperative visual rehabilitation.

  20. Spinning pipe gas lens revisited

    CSIR Research Space (South Africa)

    Mafusire, C

    2008-01-01

    Full Text Available , there is little information on optical phase aberrations and no study to date on the propagation parameters of the laser beam, but has rather remained rooted in the domain of ray optics. Researchers revisit the spinning pipe gas lens in this paper with new...

  1. Tube entrance lens focus control

    Science.gov (United States)

    Weisser, D. C.; Fifield, L. K.; Kitchen, T. F. G.; Tunningley, T. B.; Lobanov, N. R.; Muirhead, A. G.

    2013-02-01

    The entrance of the accelerator tube in a large electrostatic accelerator imposes a strong lens that dominates the beam optics. The magnification of the lens is large because of the low injection energy, the high voltage gradient of the acceleration tube and the long distance to the terminal. In the absence of the acceleration, the magnification would produce an unacceptably large beam spot at the terminal. The tyranny of the lens is especially irksome when the accelerator is required to operate at a lower terminal voltage than the one corresponding to the nominal gradient at high voltage. One way around the difficulty, used in NEC Pelletron accelerators, is to insert a series of nylon and steel rods that short together units of the acceleration structure at the terminal leaving the ones near the entrance close to the nominal gradient for optimum transmission. This operation takes time and risks the loss of insulating gas. Another alternative used in the 25URC at Oak Ridge National Laboratory, is to focus the beam at the tube entrance, substantially diluting the effect of the entrance lens. The beam then diverges and so requires an additional lens part way to the terminal. This solution is only partially effective and still necessitates use of shorting rods for low voltage operation. The fact that these elaborate strategies are used is evidence that the alternative of lowering the injection energy as the terminal voltage is lowered imposes enough problems that it is not used in practice. We have modeled a solution that controls the voltage gradient at the tube entrance using an external power supply. This not only maintains the focusing effect of the lens but provides the opportunity to tune the beam by adjusting the entrance lens. A 150 kV power supply outside the pressure vessel feeds a controllable voltage through a high voltage feed-through to the fifth electrode of the accelerator tube. Thus 150 kV on this electrode creates the nominal gradient of 30 kV per

  2. AcEST: BP921082 [AcEST

    Lifescience Database Archive (English)

    Full Text Available B Pol polyprotein (Fragment) OS=Cas-Br-E murin... 52 1e-06 sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation... muri... 52 1e-06 sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation muri...LLLPLALYRARN 431 >sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 Le...N Sbjct: 75 ADLLGIDWKLHCAYRPQSSGQVERMNRTIKETLTKLTLATGSRDWVLLLPLALYRARN 132 >sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiati...on murine leukemia virus (strain Kaplan) GN=pol PE=3 SV=1 Length = 581 Score = 52.0

  3. AcEST: DK948593 [AcEST

    Lifescience Database Archive (English)

    Full Text Available DKLSHFNYVVDVLIPYPIHLEI 163 >sp|A4QKR2|MATK_CRUWA Maturase K OS=Crucihimalaya wallichii GN=matK PE=3 SV=2 Len..._LOBMA Maturase K OS=Lobularia maritima GN=matK PE... 32 2.3 sp|A4QKR2|MATK_CRUWA Maturase K OS=Crucihimal...aya wallichii GN=ma... 32 3.0 sp|Q9GF51|MATK_ARAHA Maturase K OS=Arabidopsis haller

  4. AcEST: BP918710 [AcEST

    Lifescience Database Archive (English)

    Full Text Available um l... 31 2.9 sp|P03313|POLG_CXB3N Genome polyprotein OS=Coxsackievirus B3 (st... 31 3.7 sp|Q86UN2|R4RL1_HU...karyotic translation initiation factor 3... 31 3.8 sp|Q66282|POLG_CXB3W Genome polyprotein OS=Coxsackievirus...HHAAHHHPWFHHH 164 >sp|P03313|POLG_CXB3N Genome polyprotein OS=Coxsackievirus B3 (strain Nancy) PE=1 SV=4 Len

  5. Lens stem cells may reside outside the lens capsule: an hypothesis

    Directory of Open Access Journals (Sweden)

    Meyer Rita A

    2007-06-01

    Full Text Available Abstract In this paper, we consider the ocular lens in the context of contemporary developments in biological ideas. We attempt to reconcile lens biology with stem cell concepts and a dearth of lens tumors. Historically, the lens has been viewed as a closed system, in which cells at the periphery of the lens epithelium differentiate into fiber cells. Theoretical considerations led us to question whether the intracapsular lens is indeed self-contained. Since stem cells generate tumors and the lens does not naturally develop tumors, we reasoned that lens stem cells may not be present within the capsule. We hypothesize that lens stem cells reside outside the lens capsule, in the nearby ciliary body. Our ideas challenge the existing lens biology paradigm. We begin our discussion with lens background information, in order to describe our lens stem cell hypothesis in the context of published data. Then we present the ciliary body as a possible source for lens stem cells, and conclude by comparing the ocular lens with the corneal epithelium.

  6. Modern lens antennas for communications engineering

    CERN Document Server

    Thornton, John

    2012-01-01

    The aim of this book is to present the modern design principles and analysis of lens antennas. It gives graduates and RF/Microwave professionals the design insights in order to make full use of lens antennas.  Why do we want to write a book in lens antennas? Because this topic has not been thoroughly publicized, its importance is underestimated. As antennas play a key role in communication systems, recent development in wireless communications would indeed benefit from the characteristics of lens antennas: low profile, and low cost etc.  The major advantages of lens antennas are na

  7. Complete Genomes of Bacillus coagulans S-lac and Bacillus subtilis TO-A JPC, Two Phylogenetically Distinct Probiotics

    Science.gov (United States)

    Ramya, T. N. C.; Subramanian, Srikrishna

    2016-01-01

    Several spore-forming strains of Bacillus are marketed as probiotics due to their ability to survive harsh gastrointestinal conditions and confer health benefits to the host. We report the complete genomes of two commercially available probiotics, Bacillus coagulans S-lac and Bacillus subtilis TO-A JPC, and compare them with the genomes of other Bacillus and Lactobacillus. The taxonomic position of both organisms was established with a maximum-likelihood tree based on twenty six housekeeping proteins. Analysis of all probiotic strains of Bacillus and Lactobacillus reveal that the essential sporulation proteins are conserved in all Bacillus probiotic strains while they are absent in Lactobacillus spp. We identified various antibiotic resistance, stress-related, and adhesion-related domains in these organisms, which likely provide support in exerting probiotic action by enabling adhesion to host epithelial cells and survival during antibiotic treatment and harsh conditions. PMID:27258038

  8. Complete Genomes of Bacillus coagulans S-lac and Bacillus subtilis TO-A JPC, Two Phylogenetically Distinct Probiotics.

    Directory of Open Access Journals (Sweden)

    Indu Khatri

    Full Text Available Several spore-forming strains of Bacillus are marketed as probiotics due to their ability to survive harsh gastrointestinal conditions and confer health benefits to the host. We report the complete genomes of two commercially available probiotics, Bacillus coagulans S-lac and Bacillus subtilis TO-A JPC, and compare them with the genomes of other Bacillus and Lactobacillus. The taxonomic position of both organisms was established with a maximum-likelihood tree based on twenty six housekeeping proteins. Analysis of all probiotic strains of Bacillus and Lactobacillus reveal that the essential sporulation proteins are conserved in all Bacillus probiotic strains while they are absent in Lactobacillus spp. We identified various antibiotic resistance, stress-related, and adhesion-related domains in these organisms, which likely provide support in exerting probiotic action by enabling adhesion to host epithelial cells and survival during antibiotic treatment and harsh conditions.

  9. Complete Genomes of Bacillus coagulans S-lac and Bacillus subtilis TO-A JPC, Two Phylogenetically Distinct Probiotics.

    Science.gov (United States)

    Khatri, Indu; Sharma, Shailza; Ramya, T N C; Subramanian, Srikrishna

    2016-01-01

    Several spore-forming strains of Bacillus are marketed as probiotics due to their ability to survive harsh gastrointestinal conditions and confer health benefits to the host. We report the complete genomes of two commercially available probiotics, Bacillus coagulans S-lac and Bacillus subtilis TO-A JPC, and compare them with the genomes of other Bacillus and Lactobacillus. The taxonomic position of both organisms was established with a maximum-likelihood tree based on twenty six housekeeping proteins. Analysis of all probiotic strains of Bacillus and Lactobacillus reveal that the essential sporulation proteins are conserved in all Bacillus probiotic strains while they are absent in Lactobacillus spp. We identified various antibiotic resistance, stress-related, and adhesion-related domains in these organisms, which likely provide support in exerting probiotic action by enabling adhesion to host epithelial cells and survival during antibiotic treatment and harsh conditions.

  10. First Measurements of the Longitudinal Bunch Profile at SLAC Using Coherent Smith-Purcell Radiation at 28GeV

    International Nuclear Information System (INIS)

    Arnold, R.; Molloy, S.; Woods, M.; Kimmitt, M.F.; Blackmore, V.; Doucas, G.; Ottewell, B.; Perry, C.

    2011-01-01

    Coherent Smith-Purcell radiation has been demonstrated as a technique for measuring the longitudinal profile of charged particles bunches in the low to intermediate energy range. However, with the advent of the International Linear Collider, the need has arisen for a non-invasive method of measuring the bunch profile at extremely high energies. Smith-Purcell radiation has been used for the first time in the multi-GeV regime to measure the longitudinal profile of the 28GeV SLAC beam. The experiment has both successfully determined the bunch length, and has also demonstrated its sensitivity to bunch profile changes. The challenges associated with this technique, and its prospects as a diagnostic tool are reported here.

  11. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  12. AcEST: DK954361 [AcEST

    Lifescience Database Archive (English)

    Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac

  13. Research and development toward a 4.5-1.5{angstrom} linac coherent light source (LCLS) at SLAC

    Energy Technology Data Exchange (ETDEWEB)

    Tatchyn, R.; Arthur, J.; Baltay, M. [Stanford Univ., CA (United States)] [and others

    1995-12-31

    In recent years significant studies have been initiated on the theoretical and technical feasibility of utilizing a portion of the 3km S-band accelerator at the Stanford Linear Accelerator Center (SLAC) to drive a short wavelength (4.5-1.5 {Angstrom}) Linac Coherent Light Source (LCLS), a Free-Electron Laser (FEL) operating in the Self-Amplified Spontaneous Emission (SASE) regime. Electron beam requirements for single-pass saturation include: (1) a peak current in the 3-7 kA range, (2) a relative energy spread of <0.05%, ad (3) a transverse emittance, {epsilon}{le}{lambda}/4{pi}, where {lambda}[m] is the output wavelength. Requirements on the insertion device include field error levels of 0.1-0.2% for keeping the electron bunch centered on and in phase with the amplified photons, and a focusing beta of 4-8 m for inhibiting the dilution of its transverse density. Although much progress techniques necessary for LCLS operation down to {approximately}20 {angstrom}, a substantial amount of research and development is still required in a number of theoretical and experimental areas leading to the construction and operation of a 4.5-1.5 {angstrom} LCLS. In this paper we report on a research and development program underway and in planning at SLAC for addressing critical questions in these areas. These include the construction and operation of a linac test stand for developing laser-driven photocathode rf guns with normalized emittances approaching 1 mm-mr; development of advanced beam compression, stability, an emittance control techniques at multi-GeV energies; the construction and operation of a FEL Amplifier Test Experiment (FATE) for theoretical and experimental studies of SASE at IR wavelengths; an undulator development program to investigate superconducting, hybrid/permanent magnet (hybrid/PM), and pulsed-Cu technologies; theoretical and computational studies of high-gain FEL physics and LCLS component designs.

  14. Contact lens surface by electron beam

    International Nuclear Information System (INIS)

    Shin, Jung Hyuck; Lee, Suk Ju; Hwang, Kwang Ha; Jeon Jin

    2011-01-01

    Contact lens materials needs good biocompatibility, high refractive index, high optical transparency, high water content etc. Surface treat method by using plasma and radiation can modify the physical and/or chemical properties of the contact lens surface. Radiation technology such as electron beam irradiation can apply to polymerization reaction and enhance the functionality of the polymer.The purpose of this study is to modify of contact lens surface by using Eb irradiation technology. Electron beam was irradiated to the contact lens surface which was synthesized thermal polymerization method and commercial contact lens to modify physical and chemical properties. Ft-IR, XP, UV-vis spectrophotometer, water content, oxygen trans-metastability were used to characterize the surface state, physicochemical, and optical property of the contact lens treated with Eb. The water content and oxygen transmissibility of the contact lens treated with Eb were increased due to increase in the hydrophilic group such as O-C=O and OH group on the contact lens surface which could be produced by possible reaction between carbon and oxygen during the Eb irradiation. All of the lenses showed the high optical transmittance above 90%. In this case of B/Es, TES, Ti contact lens, the optical transmittance decreased about 5% with increasing Eb dose in the wavelength of UV-B region. The contact lens modified by Eb irradiation could improve the physical properties of the contact lens such as water content and oxygen transmissibility

  15. Lens decenter and tilt measurement by interferogram

    Science.gov (United States)

    Hung, Min-Wei; Wu, Wen-Hong; Huang, Kuo-Cheng

    2009-11-01

    For the recent years, the vigorous development of the electro-optic industry, particularly the digital camera and the cellular phone camera, has placed a larger and larger demand for the optical devices. Among the optical lens, the aspherical optical lens plays the key component because the aspherical lens may provide better imaging quality then the spherical lens does. For the manufacturing reason, the aspherical lens is prone to a decenter or tilt issue with respect to the optical axes of its two surfaces. To measure decenter and tile error specifically would help to obviate the deficient lens, but most of the present measuring method can't provide this function. This paper proposed a new method to specifically measure the decenter and tile of lens by observing the interferogram of each surface. And the corresponding measuring instrument, which contains interferometer and motion stages, was introduced as well.

  16. Aperture measurements with AC dipole

    CERN Document Server

    Fuster Martinez, Nuria; Dilly, Joschua Werner; Nevay, Laurence James; Bruce, Roderik; Tomas Garcia, Rogelio; Redaelli, Stefano; Persson, Tobias Hakan Bjorn; CERN. Geneva. ATS Department

    2018-01-01

    During the MDs performed on the 15th of September and 29th of November 2017, we measured the LHC global aperture at injection with a new AC dipole method as well as using the Transverse Damper (ADT) blow-up method used during the 2017 LHC commissioning for benchmarking. In this note, the MD procedure is presented as well as the analysis of the comparison between the two methods. The possible benefits of the new method are discussed.

  17. Looking beyond the perfect lens

    International Nuclear Information System (INIS)

    Wee, W H; Pendry, J B

    2010-01-01

    The holy grail of imaging is the ability to see through anything. From the conservation of energy, we can easily see that to see through a lossy material would require lenses with gain. The aim of this paper therefore is to propose a simple scheme by which we can construct a general perfect lens, with gain-one that can restore both the phases and amplitudes of near and far fields.

  18. CONTACT LENS RELATED CORNEAL ULCER

    Directory of Open Access Journals (Sweden)

    AGARWAL P

    2010-01-01

    Full Text Available A corneal ulcer caused by infection is one of the major causes of blindness worldwide. One of the recent health concerns is the increasing incidence of corneal ulcers associated with contact lens user especially if the users fail to follow specific instruction in using their contact lenses. Risk factors associated with increased risk of contact lens related corneal ulcers are:overnight wear, long duration of continuous wear, lower socio-economic classes, smoking, dry eye and poor hygiene. The presenting symptoms of contact lens related corneal ulcers include eye discomfort, foreign body sensation and lacrimation. More serious symptoms are redness (especially circum-corneal injection, severe pain, photophobia, eye discharge and blurring of vision. The diagnosis is established by a thorough slit lamp microscopic examination with fluorescein staining and corneal scraping for Gram stain and culture of the infective organism. Delay in diagnosing and treatment can cause permanent blindness, therefore an early referral to ophthalmologist and commencing of antimicrobial therapy can prevent visual loss.

  19. AcEST: BP912184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available o sapiens GN=NOX4 PE=... 39 0.019 sp|Q9JHI8|NOX4_MOUSE NADPH oxidase 4 OS=Mus musculus GN=Nox4 PE=... 35 0.2...7 sp|Q924V1|NOX4_RAT NADPH oxidase 4 OS=Rattus norvegicus GN=Nox4 ... 34 0.35 sp|...Q9JHI8|NOX4_MOUSE NADPH oxidase 4 OS=Mus musculus GN=Nox4 PE=1 SV=1 Length = 578 Score = 34.7 bits (78), Exp...KVP---SRRTRRLLDKSKTLHITCG 109 >sp|Q924V1|NOX4_RAT NADPH oxidase 4 OS=Rattus norvegicus GN=Nox4 PE=1 SV=2 Len

  20. AcEST: BP918619 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tr|Q9VJK6|Q9VJK6_DROME Dachshund, isoform A OS=Drosophila melanogaster Align len...ficant alignments: (bits) Value tr|Q9VJK6|Q9VJK6_DROME Dachshund, isoform A OS=Drosophila melano... 35 1.9 t...r|Q8IP21|Q8IP21_DROME Dachshund, isoform C OS=Drosophila melano... 35 1.9 tr|Q8IP20|Q8IP20_DROME Dachshund, ...isoform D OS=Drosophila melano... 35 1.9 tr|Q8IP19|Q8IP19_DROME Dachshund, isoform B OS=Drosophila melano...... 35 1.9 tr|Q59DZ0|Q59DZ0_DROME Dachshund, isoform G OS=Drosophila melano... 35 1.

  1. AcEST: BP918646 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1.1 sp|Q1PDC4|L_MABVR Large structural protein OS=Lake Victoria marb... 32 1.5 sp|P35262|L_MABVP Large structural protein OS=Lake Vic...toria marb... 32 1.5 sp|Q6UY63|L_MABVO Large structural protein OS=Lake Victoria... marb... 32 1.5 sp|P31352|L_MABVM Large structural protein OS=Lake Victoria marb... ...32 1.5 sp|Q1PD54|L_MABVA Large structural protein OS=Lake Victoria marb... 32 1.5 sp|Q9KA63|RS2_BACHD 30S ri...sp|Q1PDC4|L_MABVR Large structural protein OS=Lake Victoria marburgvirus (strain Ravn-87) GN=L PE=3 SV=1 Len

  2. Analysis of causes of intraocular lens explantations in the material of Department of Ophthalmology, Medical University of Lodz.

    Science.gov (United States)

    Wilczyński, Michał; Wilczyńska, Olena; Omulecki, Wojciech

    2009-01-01

    Implantation of intraocular lenses (IOLS) has become a standard practice in cataract surgery, however, similar to any other type of surgery, using IOLs is not complication-free and sometimes explantation of intraocular lenses may be necessary. This study was to gather data and analyze causes of intraocular lens explantations, performed in the Department of Ophthalmology, Medical University of Łódź. The data were gathered from medical documentation of all patients who underwent intraocular lens removal from January 2003 to July 2006. The examined group consisted of 16 patients (16 eyes): 9 women (fraction 0.56), and 7 men (fraction 0.44), at the age from 21 to 82 years (mean age 62.4 years, SD +/- 15.5). In all patients IOL explantation was performed under local, peribulbar anaesthesia. Two groups of patients were distinguished: patients who had an anterior chamber lens explanted (3 patients, fraction 0.19) and patients who underwent posterior chamber lens explantation (13 patients, fraction 0.81). Causes of AC IOL explantations were: vaulting of the IOL (1 eye, fraction 0.06), luxation of the IOL to the vitreous cavity (1 eye, fraction 0.06), and painful eyeball after anterior chamber lens implantation (1 eye, fraction 0.06). Causes of PC IOL explantations were: subluxation of the IOL (6 eyes, fraction 0.38), luxation of the lens to the vitreous cavity (3 eyes, fraction 0.19), luxation of the lens to the anterior chamber (1 eye, fraction 0.06), endophthalmitis (2 eyes, fraction 0.13) and incorrect lens power (1 eye, fraction 0.06). In the majority of eyes (n = 13, fraction 0.81) the removed implant was replaced by another intraocular lens, but 3 eyes (fraction 0.19) were left aphakic. We did not observe serious intra- or early postoperative complications which might influence the final result of the operation.

  3. Simultaneous distribution of AC and DC power

    Science.gov (United States)

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  4. Primary intraocular lens implantation for penetrating lens trauma in Africa.

    Science.gov (United States)

    Bowman, R J; Yorston, D; Wood, M; Gilbert, C; Foster, A

    1998-09-01

    This study aimed to audit the surgical strategy of primary posterior chamber intraocular lens implantation for cases of recent penetrating trauma involving the lens in an African population. Retrospective, noncomparative case series. Seventy-two cases are reported, including all patients who underwent primary intraocular lens implantation for traumatic cataract extraction performed within 1 month of injury between 1988 and 1996. Demographic characteristics and follow-up attendance rates are analyzed. Surgical technique and the occurrence of intraoperative and postoperative complications are reported. Visual outcomes are reported with detailed analysis for cases of poor visual outcome. Mean age was 14.3 years (standard deviation = 11.1), 57 (79%) were male and 15 (21%) were female (chi-square = 23.66, P capsule had been breached by the trauma in 27 (38%) cases, and 15 of these required anterior vitrectomy. Capsular fixation of the implant was achieved in 49% of patients, the remainder having sulcus fixation. Intraoperative rupture of the posterior capsule occurred in four cases. The only common postoperative complication was acute fibrinous anterior uveitis, which occurred in 29 (40%) patients, and 32% of patients followed up for at least 6 months required secondary posterior capsulotomy. This was more common in younger patients (chi-square = 4.2, P < 0.05). Corrected postoperative visual acuities were available for 51 patients, of which 71% achieved 20/60 or better visual acuity. Patients 6 years of age or younger were less likely to achieve 20/60 (chi-square = 6.61, P = 0.01). This surgical strategy has proved successful, producing good visual results and causing no sight-threatening complications. Primary posterior capsulotomy may be appropriate for younger patients.

  5. Research on one manual zoom liquid lens

    Science.gov (United States)

    Zhao, Cunhua; Shi, Yongpeng; Li, Wenjiao; Li, Congcong

    2011-11-01

    In liquid zoom lens, the accurate fixed-focus location needs the accurate calculation of focal length. That is to say, the accurate calculation of surface curvature must be obtained. Therefore, the research of their relation in liquid zoom lens becomes extremely important which has a directly theoretical instruction for the design of liquid zoom lenses. In our paper, the relation is studied. A manual liquid lens is reported which has upper and nether components with specificaton Φ12×5mm. The zoom lens is obtained by the upper component circumvolving down into the nether components.

  6. Numerical analyses of planer plasmonic focusing lens

    Science.gov (United States)

    Chou, Yen-Yu; Lee, Yeeu-Chang

    2018-03-01

    The use of polystyrene (PS) sphere lithography has been widely applied in the fabrication of micron and nano structures, due to their low cost and ease of fabrication in large scale applications. This study evaluated the feasibility of plasmonic lens base on metal thin films with nanohole structures fabricated by using PS sphere lithography through three-dimensional (3D) finite difference time domain (FDTD) method. We calculated the intensity profile of lens with various wavelength of incident light, lens size, cutting positions, diameters of nanohole, and periods of nanohole to investigate the geometric parameters influence on the focusing properties of the plasmonic lens.

  7. Exchange of tears under a contact lens is driven by distortions of the contact lens.

    Science.gov (United States)

    Maki, Kara L; Ross, David S

    2014-12-01

    We studied the flow of the post-lens tear film under a soft contact lens to understand how the design parameters of contact lenses can affect ocular health. When a soft contact lens is inserted, the blinking eyelid causes the lens to stretch in order to conform to the shape of the eye. The deformed contact lens acts to assume its un-deformed shape and thus generates a suction pressure in the post-lens tear film. In consequence, the post-lens tear fluid moves; it responds to the suction pressure. The suction pressure may draw in fresh fluid from the edge of the lens, or it may eject fluid there, as the lens reassumes its un-deformed shape. In this article, we develop a mathematical model of the flow of the post-lens tear fluid in response to the mechanical suction pressure of a deformed contact lens. We predict the amount of exchange of fluid exchange under a contact lens and we explore the influence of the eye's shape on the rate of exchange of fluid. © The Author 2014. Published by Oxford University Press on behalf of the Society for Integrative and Comparative Biology. All rights reserved. For permissions please email: journals.permissions@oup.com.

  8. SNS AC Power Distribution and Reliability of AC Power Supply

    CERN Document Server

    Holik, Paul S

    2005-01-01

    The SNS Project has 45MW of installed power. A design description under the Construction Design and Maintenance (CDM) with regard to regulations (OSHA, NFPA, NEC), reliability issues and maintenance of the AC power distribution system are herewith presented. The SNS Project has 45MW of installed power. The Accelerator Systems are Front End (FE)and LINAC KLYSTRON Building (LK), Central Helium Liquefier (CHL), High Energy Beam Transport (HEBT), Accumulator Ring and Ring to Target Beam Transport (RTBT) Support Buildings have 30MW installed power. FELK has 16MW installed, majority of which is klystron and magnet power supply system. CHL, supporting the super conducting portion of the accelerator has 7MW installed power and the RING Systems (HEBT, RING and RTBT) have also 7MW installed power.*

  9. Final report for the 1996 DOE grant supporting research at the SLAC/LBNL/LLNL B factory

    International Nuclear Information System (INIS)

    Judd, D.; Wright, D.

    1997-01-01

    This final report discusses Department of Energy-supported research funded through Lawrence Livermore National Laboratory (LLNL) which was performed as part of a collaboration between LLNL and Prairie View A and M University to develop part of the BaBar detector at the SLAC B Factory. This work focuses on the Instrumented Flux Return (IFR) subsystem of BaBar and involves a full range of detector development activities: computer simulations of detector performance, creation of reconstruction algorithms, and detector hardware R and D. Lawrence Livermore National Laboratory has a leading role in the IFR subsystem and has established on-site computing and detector facilities to conduct this research. By establishing ties with the existing LLNL Research Collaboration Program and leveraging LLNL resources, the experienced Prairie View group was able to quickly achieve a more prominent role within the BaBar collaboration and make significant contributions to the detector design. In addition, this work provided the first entry point for Historically Black Colleges and Universities into the B Factory collaboration, and created an opportunity to train a new generation of minority students at the premier electron-positron high energy physics facility in the US

  10. A precise measurement of the left-right asymmetry of Z Boson production at the SLAC linear collider

    International Nuclear Information System (INIS)

    1994-09-01

    We present a precise measurement of the left-right cross section asymmetry of Z boson production (A LR ) observed in 1993 data at the SLAC linear collider. The A LR experiment provides a direct measure of the effective weak mixing angle through the initial state couplings of the electron to the Z. During the 1993 run of the SLC, the SLD detector recorded 49,392 Z events produced by the collision of longitudinally polarized electrons on unpolarized positrons at a center-of-mass energy of 91.26 GeV. A Compton polarimeter measured the luminosity-weighted electron polarization to be (63.4±1.3)%. ALR was measured to be 0.1617±0.0071(stat.)±0.0033(syst.), which determines the effective weak mixing angle to be sin 2 θ W eff = 0.2292±0.0009(stat.)±0.0004(syst.). This measurement of A LR is incompatible at the level of two standard deviations with the value predicted by a fit of several other electroweak measurements to the Standard Model

  11. A precise measurement of the left-right asymmetry of Z Boson production at the SLAC linear collider

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-09-01

    We present a precise measurement of the left-right cross section asymmetry of Z boson production (A{sub LR}) observed in 1993 data at the SLAC linear collider. The A{sub LR} experiment provides a direct measure of the effective weak mixing angle through the initial state couplings of the electron to the Z. During the 1993 run of the SLC, the SLD detector recorded 49,392 Z events produced by the collision of longitudinally polarized electrons on unpolarized positrons at a center-of-mass energy of 91.26 GeV. A Compton polarimeter measured the luminosity-weighted electron polarization to be (63.4{+-}1.3)%. ALR was measured to be 0.1617{+-}0.0071(stat.){+-}0.0033(syst.), which determines the effective weak mixing angle to be sin {sup 2}{theta}{sub W}{sup eff} = 0.2292{+-}0.0009(stat.){+-}0.0004(syst.). This measurement of A{sub LR} is incompatible at the level of two standard deviations with the value predicted by a fit of several other electroweak measurements to the Standard Model.

  12. [Acanthamoeba isolation from contact lens solution of contact lens wearers without keratitis].

    Science.gov (United States)

    Watanabe, R; Ishibashi, Y; Hommura, S; Ishii, K

    1994-05-01

    Acanthamoeba keratitis seems to be associated with wearing contact lenses. As controls, we surveyed contact lens wearers without keratitis. Contact lens solutions of 93 persons were examined in order to identify risk factors for contamination by Acanthamoeba. Therefore, the contact lens disinfection system and storage schedules were studied in each case. Acanthamoeba organisms were isolated from 4 specimens (4.3%). The incidence of Acanthamoeba was higher in specimens of soft contact lens solution than in those of hard contact lens solution, and all the Acanthamoeba positive cases had been using tap water.

  13. Primary anterior chamber intraocular lens for the treatment of severe crystalline lens subluxation.

    Science.gov (United States)

    Hoffman, Richard S; Fine, I Howard; Packer, Mark

    2009-10-01

    Subluxated cataractous and clear lenses are commonly treated by limbal or pars plana lensectomy followed by primary or secondary intraocular lens (IOL) implantation. Adjunctive capsular prosthetic devices have facilitated lens removal and IOL centration in these challenging cases but have also added complexity and potential complications to the procedure. Although crystalline lens extraction may be required to clear the visual axis in mild to moderate lens subluxations, we propose insertion of a primary anterior chamber IOL without lens extraction in severe subluxations when the eye is optically aphakic or can be made functionally aphakic following neodymium:YAG laser zonulysis. Two cases demonstrating this approach are presented.

  14. Color corrected Fresnel lens for solar concentration

    International Nuclear Information System (INIS)

    Kritchman, E.M.

    1979-01-01

    A new linear convex Fresnel lens with its groove side down is described. The design philosophy is similar to the highly concentrating two focal Fresnel lens but including a correction for chromatic aberration. A solar concentration ratio as high as 80 is achieved. For wide acceptance angles the concentration nears the theoretical maximum. (author)

  15. Modified suturing contact lens for penetrating keratoplasty.

    Science.gov (United States)

    Kramer, S G; Stewart, H L

    1978-11-01

    The authors have previously described a suturing contact lens that protects the corneal endothelium by aiding in the maintenance of the anterior chamber during penetrating keratoplasty. This report describes structural modifications of the suturing contact lens, which improve its stability and effectiveness. An additional configuration for use in corneal lacerations is presented.

  16. Charged black lens in de Sitter space

    Science.gov (United States)

    Tomizawa, Shinya

    2018-02-01

    We obtain a charged black lens solution in the five-dimensional Einstein-Maxwell-Chern-Simons theory with a positive cosmological constant. It is shown that the solution obtained here describes the formation of a black hole with the spatial cross section of a sphere from that of the lens space of L (n ,1 ) in five-dimensional de Sitter space.

  17. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  18. Contact Lens Use in the Civil Airman Population

    National Research Council Canada - National Science Library

    Nakagawara, Van

    2002-01-01

    ...) aeromedical certificate. Although contact lens technology has advanced dramatically in recent years, the aviation environment may still have adverse effects on contact lens performance in some flight situations...

  19. Corrected electrostatic lens systems for ion beams

    International Nuclear Information System (INIS)

    Dalgish, R.L.

    1981-01-01

    Recent work in our laboratory has introduced a new class of electrostatic focus forming element for beams, the ELCO lens. It compares favourably with the electrostatic and magnetic quadrupole elements conventionally used for microbeam formation. The ELCO lens does however have disadvantages associated with apertures and alignment. We have continued with the development of ion beam lenses and have evolved a further class of lens element which eliminates aperture and alignment problems. This new element can be combined like optical lenses into an aberration corrected system. Experimental measurement on the basic lens element has confirmed mathematical analysis of ion trajectories through the element. This mathematical analysis predicts that the basic element can be combined into a corrected lens system for, either: (1) high resolution microprobe formation with intrinsic rastering ability, the spot size limited only by the beam properties; or (2) high quality image formation with large magnification/demagnification ratio and wide angular aperture. (orig.)

  20. RHIC spin flipper AC dipole controller

    Energy Technology Data Exchange (ETDEWEB)

    Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

    2011-03-28

    The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

  1. Study of the doubly-charmed decays of B mesons with the experiment BABAR in SLAC; Etude des desintegrations doublement charmees des mesons B avec l'experience BABAR a SLAC

    Energy Technology Data Exchange (ETDEWEB)

    Robbe, P

    2002-04-01

    The BABAR experiment at SLAC (Stanford linear acceleration center) has been studying since 1999 B meson decays from e{sup +}e{sup -} collisions at the {gamma}(4S) resonance. The first goal of the collaboration was to measure the sin (2{beta}) CP-violation parameter within the standard model. This measurement requires to know with precision the absolute length scale of the detector. A method to test this scale was developed using nuclear interactions in the beam-pipe material. The longitudinal length scale was then determined at the 1 % level precision. The systematic error associated with length measurement in the detector concerning B meson lifetime and B meson oscillation frequency is then negligible with respect to the other errors. The K meson content of B decays is a key ingredient of the sin (2{beta}) measurement and is used to tag the flavour of the other B in events containing a B decaying to a CP eigenstate. The K charge is correlated to the B flavour. Wrong sign kaons, which can dilute B tagging, can come from wrong sign D decays (B{yields} DX). Doubly charmed decays (B{yields} D{sup (*)}D-bar{sup (*)}) K are one possibility to produce wrong sign D decays. The twenty-two decay modes are reconstructed exclusively. The total branching fraction is measured with enough precision to establish that B{yields} D{sup (*)}D-bar{sup (*)} K decays are not the only source of wrong sign D mesons in B decays. (author)

  2. Investigation of lens morphology and mechanical characteristics of lens capsule and lens nucleus in patients with agerelated and diabetic cataract

    Directory of Open Access Journals (Sweden)

    A. S. Tishkova

    2014-07-01

    Full Text Available Purpose: To investigate the influence of carbohydrate metabolism on the structure and mechanical properties of the lens capsule and nucleus.Methods: Human lens pathology was studied in different forms of cataract. 220 patients with a cataract (220 eyes were included in this study. Morphological, immunohystological and immunocytochemical investigations of lens substance (antibodies to a- (a-А and a-В, b-, g- crystallines, spectroscopic analyses of smears and morphometric analyses of slices, investigation of lens morphology and mechanical caracteristics of lens capsule and lens nucleus were performed.Results: The capsule of the lens in patients with senile cataract contains more Na+, Cl-. The capsule of the lens in patients with senile cataract contains more Ca2+, O. Mechanical strength of the capsule in the case of diabetes mellitus was lower comparatively with senile cataract in the same age groups. More significant expression of a-В and b-crystallines was found in patients with diabetes mellitus comparatively with patients with age-related cataract. Morphological features were founded in patients with cortical and nuclear forms of senile cataract and the diabetic cataract.Conclusion: During surgery (ultrasonic microcoaxial phacoemulsification the equivalent of ultrasound was recorded. Lower density of the lens nucleus of patients with diabetes mellitus made it possible to use lower energy parameters. Using the torsion ultrasound in those cases allowed us to decrease the influence of ultrasound on eye tissues and reduce the time of achieving the maximum BCVA in the postsurgical period.

  3. Investigation of lens morphology and mechanical characteristics of lens capsule and lens nucleus in patients with agerelated and diabetic cataract

    Directory of Open Access Journals (Sweden)

    A. S. Tishkova

    2013-01-01

    Full Text Available Purpose: To investigate the influence of carbohydrate metabolism on the structure and mechanical properties of the lens capsule and nucleus.Methods: Human lens pathology was studied in different forms of cataract. 220 patients with a cataract (220 eyes were included in this study. Morphological, immunohystological and immunocytochemical investigations of lens substance (antibodies to a- (a-А and a-В, b-, g- crystallines, spectroscopic analyses of smears and morphometric analyses of slices, investigation of lens morphology and mechanical caracteristics of lens capsule and lens nucleus were performed.Results: The capsule of the lens in patients with senile cataract contains more Na+, Cl-. The capsule of the lens in patients with senile cataract contains more Ca2+, O. Mechanical strength of the capsule in the case of diabetes mellitus was lower comparatively with senile cataract in the same age groups. More significant expression of a-В and b-crystallines was found in patients with diabetes mellitus comparatively with patients with age-related cataract. Morphological features were founded in patients with cortical and nuclear forms of senile cataract and the diabetic cataract.Conclusion: During surgery (ultrasonic microcoaxial phacoemulsification the equivalent of ultrasound was recorded. Lower density of the lens nucleus of patients with diabetes mellitus made it possible to use lower energy parameters. Using the torsion ultrasound in those cases allowed us to decrease the influence of ultrasound on eye tissues and reduce the time of achieving the maximum BCVA in the postsurgical period.

  4. Cuba Through A New Lens

    Directory of Open Access Journals (Sweden)

    Jean Stubbs

    2008-12-01

    Full Text Available [First paragraph] The Origins of the Cuban Revolution Reconsidered. Samuel Farber. Chapel Hill: University of North Carolina Press, 2006. x + 212 pp. (Paper US$ 19.95 Cuba: A New History. Ric hard Gott . New Haven: Yale University Press, 2005. xii + 384 pp. (Paper US$ 17.00 Havana: The Making of Cuban Culture. Antoni Kapcia. Oxford: Berg Publishers, 2005. xx + 236 pp. (Paper US$ 24.95 Richard Gott, Antoni Kapcia, and Samuel Farber each approach Cuba through a new lens. Gott does so by providing a broad-sweep history of Cuba, which is epic in scope, attaches importance to social as much as political and economic history, and blends scholarship with flair. Kapcia homes in on Havana as the locus for Cuban culture, whereby cultural history becomes the trope for exploring not only the city but also Cuban national identity. Farber revisits his own and others’ interpretations of the origins of the Cuban Revolution.

  5. Radiation studies in Lens culinaris

    International Nuclear Information System (INIS)

    Sinha, S.S.N.

    1977-01-01

    Estimation of chromosomal aberrations in flowers of Lens culinaris according to their sequence of development in the plants at 4, 8 and 12 Kr in the M 1 generation, showed that the later formed flowers had smaller percentages of cells with aberrations than those developed earlier. It is suggested that this may be the result of competition between more damaged and less damaged cells during the development of the shoot. There is consequently a decrease of sterility in successive flowers. The numbers of karyotypes taking part in the formation of lower and uppermost flowers were estimated cytologically at 4, 8 and 12 Kr. It was found that more karyotypes were involved in the formation of the lower flowers than in the upper ones. It appeared that at lower doses larger numbers of karyotypes were taking part in the formation of the chimaera than at higher doses. (auth.)

  6. Microbial contamination of contact lens storage cases and domestic tap water of contact lens wearers.

    Science.gov (United States)

    Üstüntürk, Miray; Zeybek, Zuhal

    2012-11-01

    Contact lenses have been widely used as an alternative to spectacles both in developed and developing countries. However, under certain circumstances, adverse responses can occur during contact lens wear and several microorganisms--including bacteria, fungi, and free living amoebae--can cause several eye infections in wearers. Extended wear of contact lenses is the major risk factor of eye infections such as microbial keratitis, besides contaminated contact lens storage case, contaminated lens care solutions, and inaccurate contact lens handling. In this study, we collected contact lens storage case and domestic tap water samples from 50 asymptomatic contact lens wearers. We determined that total aerobic mesophilic bacteria were isolated in 45 (90 %), Gram negative rod bacteria were isolated in 20 (40 %), Pseudomonas spp. were isolated in 2 (4 %) and fungi were isolated in 18 (36 %) out of 50 contact lens storage cases. Free living amoebae were not detected in investigated contact lens storage cases. At the same time, out of 50, total aerobic mesophilic bacteria were isolated in 34 (68 %), fungi were isolated in 15 (30 %) and free living amoebae were isolated in 15 (30 %) domestic tap water samples. No Gram-negative rod bacteria and Pseudomonas spp. were detected in investigated water samples. Two contact lens case samples and two tap water samples were excluded from the analysis for Pseudomonas spp. for technical reasons. According to our findings, inadequate contact lens maintenance during lens wear may result in the contamination of contact lens storage cases. This situation can lead to severe eye infections in contact lens wearers over time.

  7. Bioinformatics and Astrophysics Cluster (BinAc)

    Science.gov (United States)

    Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas

    2017-09-01

    BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.

  8. Three phase AC motor controller

    Science.gov (United States)

    Vuckovich, Michael; Wright, Maynard K.; Burkett, John P.

    1984-03-20

    A motor controller for a three phase AC motor (10) which is adapted to operate bidirectionally from signals received either from a computer (30) or a manual control (32). The controller is comprised of digital logic circuit means which implement a forward and reverse command signal channel (27, 29) for the application of power through the forward and reverse power switching relays (16, 18, 20, 22). The digital logic elements are cross coupled to prevent activation of both channels simultaneously and each includes a plugging circuit (65, 67) for stopping the motor upon the removal of control signal applied to one of the two channels (27, 29) for a direction of rotation desired. Each plugging circuit (65, 67) includes a one-shot pulse signal generator (88, 102) which outputs a single pulse signal of predetermined pulsewidth which is adapted to inhibit further operation of the application of power in the channel which is being activated and to apply a reversal command signal to the other channel which provides a reversed phase application of power to the motor for a period defined by the pulse-width output of the one-shot signal generator to plug the motor (10) which will then be inoperative until another rotational command signal is applied to either of the two channels.

  9. Influence of SDBD plasma aerodynamic actuation on flow control by AC power supply and AC-DC power supply

    Science.gov (United States)

    Hu, Xu; Gao, Chao; Hao, Jiangnan

    2018-01-01

    In this paper, the excitation effect of single dielectric barrier discharge plasma actuator (SDBD) is compared by using AC power supply and AC-DC power supply. AC-DC power supply is based on the AC power supply, just adding DC component. The flow measurement is carried out by PIV technique. Results show that the excitation effect of AC power supply and AC-DC power supply increases by the increase of voltage, the range of speed field excited by AC power is greater than that of AC-DC power supply. For x direction maximum speed, excited by AC power supply is close to AC-DC, and for y direction maximum speed, AC power supply is greater than AC-DC power supply. So the excitation effect of AC power supply is better than that of AC-DC power supply for SDBD.

  10. Contact lens compliance among a group of young, university-based lens users in South India.

    Science.gov (United States)

    Noushad, Babu; Saoji, Yeshwant; Bhakat, Premjit; Thomas, Jyothi

    2012-01-01

    To investigate the rate of compliance with the soft contact lens care and maintenance procedures with a focus on contact lens wearing habits, cleaning and disinfecting procedures, and maintenance of lens care accessories in a group of young, university-based contact lens wearers Two hundred and sixteen young soft contact lens wearers with an age range of 18-22 years were selected conveniently from the student population of Manipal University, Manipal, India. After receiving informed consent from the participants, their level of compliance with contact lenses was assessed using a questionnaire. The mean (±SD) age of the participants was 21.86±2.35 years. Out of 216 subjects, only 34% of the lens users were identified to be compliant with the least level of compliance observed in the maintenance of lens care accessories. Conventional users showed significantly (p=0.001) better level of compliance compared to disposable wearers and so did the users who acquired their lenses from clinicians (p=0.001) compared to over-the-counter lens receipt. The gender (p=0.496) and years of experience in contact lens use (p=0.142) did not show any statistically significant difference in the level of compliance. This study demonstrated that non-compliance with lens care procedures among a group of young, university-based soft contact lens wearers is common. The results indicated that all subjects had some degree of non-compliance and the least level of compliance observed in the care of lens accessories.

  11. Tear film physiology and contact lens wear. II. Contact lens-tear film interaction.

    Science.gov (United States)

    Holly, F J

    1981-04-01

    The successful fitting of contact lenses requires the practitioner to take into account many properties of the specific lens type used but the practitioner must also understand patient factors including tear properties, use of appropriate solutions, procedures for lens cleaning, and efficiency of blinking. Selection of appropriate patients, selection of lens type, proper fitting, good maintenance, and training and monitoring of patients increase the probability of achieving success.

  12. Placement of a crystalline lens and intraocular lens: Retinal image quality.

    Science.gov (United States)

    Siedlecki, Damian; Nowak, Jerzy; Zajac, Marek

    2006-01-01

    The influence of changes of both crystalline lens and intraocular lens (IOL) misalignment on the retinal image quality was investigated. The optical model of the eye used in investigations was the Liou-Brennan model, which is commonly considered as one of the most anatomically accurate. The original crystalline lens from this model was replaced with an IOL, made of rigid polymethylmethacrylate, in a way that recommend obligatory procedures. The modifications that were made both for crystalline lens and IOL were the longitudinal, the transversal, and the angular displacement.

  13. Restoring lens capsule integrity enhances lens regeneration in New Zealand albino rabbits and cats.

    Science.gov (United States)

    Gwon, A; Gruber, L J; Mantras, C

    1993-11-01

    In studies conducted by numerous investigators for 150 years, lenses regenerated following endocapsular lens extraction in New Zealand albino rabbits have been irregular in shape, appearing primarily doughnut-shaped as a result of lack of lens growth at the site of the anterior capsulotomy and its adhesion to the posterior capsule. In the present study, we restored the lens capsule integrity by inserting a collagen patch at the time of surgery to seal the anterior capsulotomy and to improve the shape and structure of the regenerated lenses. We then filled the capsule bag with air to prevent adhesions between the anterior and posterior capsule and maintain capsule tautness and shape. Lens regeneration was first noted as early as one to two weeks. Regenerated lens filled approximately 50% of the capsule bag at two weeks and 100% by five weeks. Subsequent growth was in the anterior-posterior direction and measured by A-scan biometry. Lens thickness increased by 0.3 mm per month. The regenerated lenses were spherical with normal cortical structure and a nuclear opacity. In conclusion, restoration of lens capsular integrity with a collagen patch following endocapsular lens extraction enhanced the shape, structure, and growth rate of the regenerated lenses. In addition, lens regeneration was shown to occur in two cats.

  14. Development of Fresnel lens for improvement of rear visibility; Shikai kojo Fresnel lens no kaihatsu

    Energy Technology Data Exchange (ETDEWEB)

    Iwamoto, K.; Sanada, C.; Tsukino, M. [Nissan Motor Co. Ltd., Tokyo (Japan)

    1997-10-01

    Fresnel lenses have been widely used to increase the visual field around vehicles for drivers. However, internal reflection in these lenses has been an obstacle in producing dear images. This internal glow is generated by incident light from an unexpected direction reflecting on the non-lens surface or radiating from the non-lens surface of the Fresnel lens. The cause of internal glow has been made dear combining louver film with the lens. The newly developed technology removes obstacles in producing dear images by reducing internal glow. 7 figs.

  15. Night Vision Goggles Objectives Lens Focusing Methodology

    National Research Council Canada - National Science Library

    Pinkus, Alan; Task, H. L

    2000-01-01

    ...: interpupillary distance, tilt, eye relief, height, eyepiece and objective lens focus. Currently, aircrew use a Hoffman 20/20 test unit to pre-focus their NVG objective lenses at optical infinity before boarding their aircraft...

  16. Role of Aquaporin 0 in lens biomechanics

    Energy Technology Data Exchange (ETDEWEB)

    Sindhu Kumari, S.; Gupta, Neha [Physiology and Biophysics, Stony Brook University, Stony Brook, NY (United States); Shiels, Alan [Washington University School of Medicine, St. Louis, MO (United States); FitzGerald, Paul G. [Cell Biology and Human Anatomy, School of Medicine, University of California, Davis, CA (United States); Menon, Anil G. [University of Cincinnati College of Medicine, Cincinnati, OH (United States); Mathias, Richard T. [Physiology and Biophysics, Stony Brook University, Stony Brook, NY (United States); SUNY Eye Institute, NY (United States); Varadaraj, Kulandaiappan, E-mail: kulandaiappan.varadaraj@stonybrook.edu [Physiology and Biophysics, Stony Brook University, Stony Brook, NY (United States); SUNY Eye Institute, NY (United States)

    2015-07-10

    Maintenance of proper biomechanics of the eye lens is important for its structural integrity and for the process of accommodation to focus near and far objects. Several studies have shown that specialized cytoskeletal systems such as the beaded filament (BF) and spectrin-actin networks contribute to mammalian lens biomechanics; mutations or deletion in these proteins alters lens biomechanics. Aquaporin 0 (AQP0), which constitutes ∼45% of the total membrane proteins of lens fiber cells, has been shown to function as a water channel and a structural cell-to-cell adhesion (CTCA) protein. Our recent ex vivo study on AQP0 knockout (AQP0 KO) mouse lenses showed the CTCA function of AQP0 could be crucial for establishing the refractive index gradient. However, biomechanical studies on the role of AQP0 are lacking. The present investigation used wild type (WT), AQP5 KO (AQP5{sup −/−}), AQP0 KO (heterozygous KO: AQP0{sup +/−}; homozygous KO: AQP0{sup −/−}; all in C57BL/6J) and WT-FVB/N mouse lenses to learn more about the role of fiber cell AQPs in lens biomechanics. Electron microscopic images exhibited decreases in lens fiber cell compaction and increases in extracellular space due to deletion of even one allele of AQP0. Biomechanical assay revealed that loss of one or both alleles of AQP0 caused a significant reduction in the compressive load-bearing capacity of the lenses compared to WT lenses. Conversely, loss of AQP5 did not alter the lens load-bearing ability. Compressive load-bearing at the suture area of AQP0{sup +/−} lenses showed easy separation while WT lens suture remained intact. These data from KO mouse lenses in conjunction with previous studies on lens-specific BF proteins (CP49 and filensin) suggest that AQP0 and BF proteins could act co-operatively in establishing normal lens biomechanics. We hypothesize that AQP0, with its prolific expression at the fiber cell membrane, could provide anchorage for cytoskeletal structures like BFs and

  17. A Strong-Lens Survey in AEGIS: the influence of large scalestructure

    Energy Technology Data Exchange (ETDEWEB)

    Moustakas, Leonidas A.; Marshall, Phil; Newman, Jeffrey A.; Coil,Alison L.; Cooper, Michael C.; Davis, Marc; Fassnacht, Christopher D.; Guhathakurta, Puragra; Hopkins, Andrew; Koekemoer, Anton; Konidaris,Nicholas P.; Lotz, Jennifer M.; Willmer, Christopher N. A.

    2006-10-13

    We report on the results of a visual search for galaxy-scale strong gravitational lenses over 650 arcmin{sup 2} of HST/ACS (F606W and F814W) imaging in the DEEP2-Extended Groth Strip (EGS). In addition to a previously-known Einstein Cross also found by our search (the 'Cross', HSTJ141735+52264, z{sub lens} = 0.8106, z{sub source} = 3.40), we identify two new strong galaxy-galaxy lenses with multiple extended arcs. The first, HSTJ141820+52361 (the 'Dewdrop'; z{sub lens} = 0.5798), lenses two distinct extended sources into two pairs of arcs (z{sub source} = 0.9818), while the second, HSTJ141833+52435 (the 'Anchor'; z{sub lens} = 0.4625), produces a single pair of arcs (z{sub lens} not yet known). Four less convincing arc/counter-arc and two-image lens candidates are also found and presented for completeness. Lenses are found in a both underdense and overdense local environments, as characterized by a robust measure, 1+{delta}{sub 3}, a normalized density that uses the distance to the third nearest neighbor. All three definite lenses are fit reasonably well by simple singular isothermal ellipsoid models including external shear, giving {chi}{sub {nu}}{sup 2} values close to unity. These shears are much greater than those implied by a simple consideration of the three-dimensional convergence and shear from galaxies along the line of sight, where each galaxy is approximated by a singular isothermal sphere halo truncated at 200 h{sup -1} kpc. This shows how a realistic treatment of galaxies and the large scale structure they are embedded in is necessary, and that simply characterizing the very-local environment may be insufficient.

  18. Lens Crystallin Modifications and Cataract in Transgenic Mice Overexpressing Acylpeptide Hydrolase*

    Science.gov (United States)

    Santhoshkumar, Puttur; Xie, Leike; Raju, Murugesan; Reneker, Lixing; Sharma, K. Krishna

    2014-01-01

    The accumulation of crystallin fragments in vivo and their subsequent interaction with crystallins are responsible, in part, for protein aggregation in cataracts. Transgenic mice overexpressing acylpeptide hydrolase (APH) specifically in the lens were prepared to test the role of protease in the generation and accumulation of peptides. Cataract development was seen at various postnatal days in the majority of mice expressing active APH (wt-APH). Cataract onset and severity of the cataracts correlated with the APH protein levels. Lens opacity occurred when APH protein levels were >2.6% of the total lens protein and the specific activity, assayed using Ac-Ala-p-nitroanilide substrate, was >1 unit. Transgenic mice carrying inactive APH (mt-APH) did not develop cataract. Cataract development also correlated with N-terminal cleavage of the APH to generate a 57-kDa protein, along with an increased accumulation of low molecular weight (LMW) peptides, similar to those found in aging human and cataract lenses. Nontransgenic mouse lens proteins incubated with purified wt-APH in vitro resulted in a >20% increase in LMW peptides. Crystallin modifications and cleavage were quite dramatic in transgenic mouse lenses with mature cataract. Affected lenses showed capsule rupture at the posterior pole, with expulsion of the lens nucleus and degenerating fiber cells. Our study suggests that the cleaved APH fragment might exert catalytic activity against crystallins, resulting in the accumulation of distinct LMW peptides that promote protein aggregation in lenses expressing wt-APH. The APH transgenic model we developed will enable in vivo testing of the roles of crystallin fragments in protein aggregation. PMID:24554718

  19. Contractual considerations in contact lens practice.

    Science.gov (United States)

    Classé, J G

    1986-03-01

    The use of forms in contact lens practice can save time, promote patient education, and reduce the opportunity for legal or economic disputes. The most commonly employed forms are those for contact lens fitting agreements, instructions for care and maintenance of lenses, prepaid service agreements, clinical investigations of investigatory lenses or solutions, and for extended wear patients. Sample forms are utilized for purposes of illustration.

  20. Evolution and the Calcite Eye Lens

    OpenAIRE

    Williams, Vernon L.

    2013-01-01

    Calcite is a uniaxial, birefringent crystal, which in its optically transparent form, has been used for animal eye lenses, the trilobite being one such animal. Because of the calcite birefringence there is a difficulty in using calcite as a lens. When the propagation direction of incoming light is not exactly on the c-axis, the mages blur. In this paper, calcite blurring is evaluated, and the non-blurring by a crystallin eye lens is compared to a calcite one.

  1. Acute lens-induced glaucomas: A review

    Directory of Open Access Journals (Sweden)

    Syed Shoeb Ahmad

    2017-02-01

    Full Text Available Lens-induced factors are important and common mechanisms causing acute elevation of intraocular pressure. While in most cases, the diagnosis and management are straight-forward, in others it is difficult and can lead to improper procedures, complications and poor visual outcomes. This review was done with the aim of studying the various types of lens-induced glaucomas, classifying them in an easy way to understand manner, their clinical features, current management and future possibilities.

  2. SLAC/DESY International Workshop on Interactions of Intense Sub-Picosecond X-Rays with Matter, Stanford, CA, January 23-24, 1997

    International Nuclear Information System (INIS)

    Tatchyn, Roman

    1998-01-01

    This is the proceedings volume of the 1997 SLAC/DESY International Workshop on Interactions of Intense Sub-picosecond X-Ray Pulses with Matter. The workshop theme evolved out of design and R and D studies, undertaken at SLAC, DESY, and elsewhere [1,2], of the new class of linac-driven X-Ray Free Electron Lasers (XRFELs) operating with photocathode-based, low-emittance electron beams in the Self-Amplified Spontaneous Emission (SASE) regime [3]. It can be noted that, following the conclusion of the workshop, funded design study reports on R and D facilities based on these novel sources have been completed and published by both laboratories [4,5]. Topical significance was imparted to the workshop agenda by a series of prior workshops organized to explore scientific and technological applications of linac driven XRFELs [6,7,8,9]. These served to highlight underlying concerns regarding the potential loading effects of the highly intense radiation pulses from this new class of light source on the instrumentation, samples, and experimental phenomena being considered. The primary objectives of the workshop were: (a) to provide tutorial overviews of existing theoretical, numerical, and experimental techniques in the study of interactions of intense, ultra-short radiation pulses with matter, and of their applicability to the parameter regimes of the SLAC and DESY XRFELs; (b) to discuss practical optics and instrumentation issues related to peak and average power density loading; (c) to identify and explore novel concepts and design approaches, with an emphasis on optical instrumentation and experimental physics; (d) to formulate independent or collaborative R and D programs and activities in the areas of theory, numerical simulation, and experimental physics relevant to the linac-driven XRFEL parameter regime

  3. LENS: Science Scope and Development Stages

    Science.gov (United States)

    Vogelaar, R. Bruce

    2013-04-01

    The Low-Energy Neutrino Spectroscopy (LENS) experiment will resolve the solar metallicity question via measurement of the CNO neutrino flux, as well as test the predicted equivalence of solar luminosity as measured by photon versus neutrinos. The LENS detector uses charged-current interaction of neutrinos on Indium-115 (loaded in a scintillator, InLS) to reveal the complete solar neutrino spectrum. LENS's optically segmented 3D lattice geometry achieves precise time and spatial resolution and unprecedented background rejection and sensitivity for low-energy neutrino events. This first-of-a-kind lattice design is also suited for a range of other applications where high segmentation and large light collection are required (eg: sterile neutrinos with sources, double beta decay, and surface detection of reactor neutrinos). The physics scope, detector design, and logic driving the microLENS and miniLENS prototyping stages will be presented. The collaboration is actively running programs; building, operating, developing, and simulating these prototypes using the Kimballton Underground Research Facility (KURF). New members are welcome to the LENS Collaboration, and interested parties should contact R. Bruce Vogelaar.

  4. Report on Proton and Ion Beam measurements at the Matter in Extreme Condition (MCC) end station at SLAC National Accelerator Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Gauthier, M.; Goede, S.; Schumaker, W.; Roedel, C.; Galtier, E.; Glenzer, S.H.; /SLAC

    2016-02-16

    We report on MeV ion beams produced with high-repetition rates of 1 Hz at the MEC end station at SLAC National Accelerator Laboratory. These data were obtained during the commissioning beam time of the new 30TW laser. After describing the experimental set-up, the laser conditions and the target diagnostics, ion beam spectra measured for different foil thicknesses and laser intensities will be presented and discussed. These results are subsequently compared with results from cryogenic hydrogen jets at MEC in January 2015.

  5. Design Studies for Flux and Polarization Measurements of Photons and Positrons for SLAC Proposal E166: An experiment to test polarized positron production in the FFTB (LCC-0107)

    Energy Technology Data Exchange (ETDEWEB)

    Woods, M

    2003-10-02

    We present results from design studies carried out to investigate measurements of the flux, spectrum and polarization of undulator photons for SLAC Proposal E166. A transmission Compton polarimeter is considered for measuring the photon circular polarization. We also present results for measuring the flux and spectrum of positrons produced by the undulator photons in an 0.5X{sub 0} Titanium target. And we present some considerations for use of a transmission Compton polarimeter to measure the circular polarization of bremsstrahlung photons emitted by the polarized positrons in a thin radiator.

  6. Sharing of secondary electrons by in-lens and out-lens detector in low-voltage scanning electron microscope equipped with immersion lens.

    Science.gov (United States)

    Kumagai, Kazuhiro; Sekiguchi, Takashi

    2009-03-01

    To understand secondary electron (SE) image formation with in-lens and out-lens detector in low-voltage scanning electron microscopy (LV-SEM), we have evaluated SE signals of an in-lens and an out-lens detector in LV-SEM. From the energy distribution spectra of SEs with various boosting voltages of the immersion lens system, we revealed that the electrostatic field of the immersion lens mainly collects electrons with energy lower than 40eV, acting as a low-pass filter. This effect is also observed as a contrast change in LV-SEM images taken by in-lens and out-lens detectors.

  7. AC distribution system for TFTR pulsed loads

    International Nuclear Information System (INIS)

    Carroll, R.F.; Ramakrishnan, S.; Lemmon, G.N.; Moo, W.I.

    1977-01-01

    This paper outlines the AC distribution system associated with the Tokamak Fusion Test Reactor and discusses the significant areas related to design, protection, and equipment selection, particularly where there is a departure from normal utility and industrial applications

  8. Logistics Reduction: Advanced Clothing System (ACS)

    Data.gov (United States)

    National Aeronautics and Space Administration — The goal of the Advanced Exploration System (AES) Logistics Reduction (LR) project's Advanced Clothing System (ACS) is to use advanced commercial off-the-shelf...

  9. Second generation SLAC modulator

    International Nuclear Information System (INIS)

    Donaldson, A.R.; Cron, J.C.; Hanselman, R.R.

    1986-06-01

    The Stanford Linear Accelerator Laboratory has undertaken the construction of a single pass electron-positron collider. In order to reach required beam energy 235 new klystrons needed upgraded modulator systems. The collider will use 50 GeV electrons and positrons. The increase in accelerator energy from the present 30 GeV necessitates the replacement of existing 35 MW klystrons with new 67 MW units. The doubling of klystron output power required a redesign of the modulator system. The 67 MW klystron needs a 350 kV beam voltage pulse with a 3.7 μs pulse width. A new pulse transformer was designed to deliver the increased voltage and pulse width. Pulse cable design was evaluated to obtain increased reliability of that critical element. The modulator, with the exception of its power supply, was rebuilt to produce the required power increase while enhancing reliability and improving maintainability. An investigation of present thyratron switch tube performance under the new operating conditions resulted in agitation and some warranted panic but these conditions were mitigated after several successful experiments and some evolutionary narrowing of the klystron pulse width. The discussion will cover the upgraded modulator system specifications and some details of the new pulse transformer tank, pulse cable, modulator, and modulator switch tube

  10. Acanthamoeba keratitis and contact lens wear.

    Science.gov (United States)

    Lindsay, Richard G; Watters, Grant; Johnson, Richard; Ormonde, Susan E; Snibson, Grant R

    2007-09-01

    Acanthamoeba keratitis is a rare but serious complication of contact lens wear that may cause severe visual loss. The clinical picture is usually characterised by severe pain, sometimes disproportionate to the signs, with an early superficial keratitis that is often misdiagnosed as herpes simplex virus (HSV) keratitis. Advanced stages of the infection are usually characterised by central corneal epithelial loss and marked stromal opacification with subsequent loss of vision. In this paper, six cases of contact lens-related Acanthamoeba keratitis that occurred in Australia and New Zealand over a three-year period are described. Three of the patients were disposable soft lens wearers, two were hybrid lens wearers and one was a rigid gas permeable lens wearer. For all six cases, the risk factors for Acanthamoeba keratitis were contact lens wear with inappropriate or ineffective lens maintenance and exposure of the contact lenses to tap or other sources of water. All six patients responded well to medical therapy that involved topical use of appropriate therapeutic agents, most commonly polyhexamethylene biguanide and propamidine isethionate, although two of the patients also subsequently underwent deep lamellar keratoplasty due to residual corneal surface irregularity and stromal scarring. Despite the significant advances that have been made in the medical therapy of Acanthamoeba keratitis over the past 10 years, prevention remains the best treatment and patients who wear contact lenses must be thoroughly educated about the proper use and care of the lenses. In particular, exposure of the contact lenses to tap water or other sources of water should be avoided.

  11. Proportional-Integral-Resonant AC Current Controller

    Directory of Open Access Journals (Sweden)

    STOJIC, D.

    2017-02-01

    Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.

  12. Properties of the cathode lens combined with a focusing magnetic/immersion-magnetic lens

    International Nuclear Information System (INIS)

    Konvalina, I.; Muellerova, I.

    2011-01-01

    The cathode lens is an electron optical element in an emission electron microscope accelerating electrons from the sample, which serves as a source for a beam of electrons. Special application consists in using the cathode lens first for retardation of an illuminating electron beam and then for acceleration of reflected as well as secondary electrons, made in the directly imaging low energy electron microscope or in its scanning version discussed here. In order to form a real image, the cathode lens has to be combined with a focusing magnetic lens or a focusing immersion-magnetic lens, as used for objective lenses of some commercial scanning electron microscopes. These two alternatives are compared with regards to their optical properties, in particular with respect to predicted aberration coefficients and the spot size, as well as the optimum angular aperture of the primary beam. The important role of the final aperture size on the image resolution is also presented.

  13. SLAC/DESY International Workshop on Interactions of Intense Sub-Picosecond X-Rays with Matter, Stanford, CA, January 23-24, 1997

    CERN Document Server

    Tatchyn, R

    1998-01-01

    This is the proceedings volume of the 1997 SLAC/DESY International Workshop on Interactions of Intense Sub-picosecond X-Ray Pulses with Matter. The workshop theme evolved out of design and R and D studies, undertaken at SLAC, DESY, and elsewhere [1,2], of the new class of linac-driven X-Ray Free Electron Lasers (XRFELs) operating with photocathode-based, low-emittance electron beams in the Self-Amplified Spontaneous Emission (SASE) regime [3]. It can be noted that, following the conclusion of the workshop, funded design study reports on R and D facilities based on these novel sources have been completed and published by both laboratories [4,5]. Topical significance was imparted to the workshop agenda by a series of prior workshops organized to explore scientific and technological applications of linac driven XRFELs [6,7,8,9]. These served to highlight underlying concerns regarding the potential loading effects of the highly intense radiation pulses from this new class of light source on the instrumentation, s...

  14. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    International Nuclear Information System (INIS)

    Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.

    2001-11-01

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  15. Lens exposure during brain scans using multidetector row CT scanners: methods for estimation of lens dose.

    Science.gov (United States)

    Suzuki, S; Furui, S; Ishitake, T; Abe, T; Machida, H; Takei, R; Ibukuro, K; Watanabe, A; Kidouchi, T; Nakano, Y

    2010-05-01

    Some recent studies on radiation lens injuries have indicated much lower dose thresholds than specified by the current radiation protection guidelines. The purpose of this research was to measure the lens dose during brain CT scans with multidetector row CT and to assess methods for estimating the lens dose. With 8 types of multidetector row CT scanners, both axial and helical scans were obtained for the head part of a human-shaped phantom by using normal clinical settings with the orbitomeatal line as the baseline. We measured the doses on both eyelids by using an RPLGD during whole-brain scans including the orbit with the starting point at the level of the inferior orbital rim. To assess the effect of the starting points on the lens doses, we measured the lens doses by using 2 other starting points for scanning (the orbitomeatal line and the superior orbital rim). The CTDIvols and the lens doses during whole-brain CT including the orbit were 50.9-113.3 mGy and 42.6-103.5 mGy, respectively. The ratios of lens dose to CTDIvol were 80.6%-103.4%. The lens doses decreased as the starting points were set more superiorly. The lens doses during scans from the superior orbital rim were 11.8%-20.9% of the doses during the scans from the inferior orbital rim. CTDIvol can be used to estimate the lens dose during whole-brain CT when the orbit is included in the scanning range.

  16. imulation Results of Single Stage AC- AC Converter for Induction Heating

    Directory of Open Access Journals (Sweden)

    S. ARUMUGAM

    2010-12-01

    Full Text Available This paper presents simulation of single stage Induction heating system with series Load Resonance. Low frequency AC is converted in to High Frequency Ac using newly developed ZVS-PWM high frequency inverter. This High Frequency is used for Induction Heating .Single stage AC-AC converter system is modeled and simulated using Matlab Simulink. The simulation results of ZVS-PWM high frequency system are presented. The effectiveness of this UFAC-to-HFAC direct power frequency converter using IGBTs for consumer high-frequency IH appliances is evaluated and proved on the basis of simulation results.

  17. Development of Powerhouse Using Fresnel lens

    Directory of Open Access Journals (Sweden)

    Al-Dohani Nawar Saif

    2018-01-01

    Full Text Available Solar energy is an alternative source of renewable energy. Sultanate of Oman government showed initiation on utilization of solar energy for domestic and industrial applications. Fresnel lens is one of the methods to collect maximum energy by gathering heat of the sun in the concentrated form (using solar collectors. Earlier research work discloses that Fresnel lens gave better result in terms of power output and produces lower heat loss as compared to linear –parabolic solar collectors. In this work, development of a proto Fresnel lens power house was made to generate electricity. The focused heat from Fresnel lens was used to heat the molten salt in a heat exchanger to produce the steam. The generated steam was used to rotate the steam engine coupled to a generator. In the current work, a maximum power of 30 W was produced. In addition, comparative study was carried out regarding solar salts and heat exchanger materials to understand the Fresnel powerhouse performance. Overall the present study gave valuable information regarding usage of Fresnel lens for electricity generation in Oman.

  18. Non-compliance in contact lens wear.

    Science.gov (United States)

    Claydon, B E; Efron, N

    1994-10-01

    Non-compliance is emerging as a critical issue in the contact lens field. This problem has been studied at depth in general health care situations and is seen as the responsibility of both practitioner and patient (client) working in a health care partnership. The contact lens practitioner and patient present a specific case for the study of non-compliance in areas such as hygiene, solution use, appointment attendance and wearing times. From 40 to 91% of contact lens patients have been reported as non-complaint in the use of recommended care and maintenance regimens and many of these are confused or ignorant about their behaviour. In order to arrive at a general set of conclusions from the studies published to date, it is important to understand the methodology of each study, it purpose, the definition of non-compliance used and the way the results were analysed and described. This review summarizes the research into non-compliance in the contact lens field to data. A set of general conclusions is drawn and a model for compliance in the context of contact lens practice is proposed.

  19. A lazy way to design infrared lens

    Science.gov (United States)

    Qiu, RongSheng; Wu, JianDong; Chen, LongJiang; Yu, Kun; Pang, HaoJun; Hu, BaiZhen

    2017-08-01

    We designed a compact middle-wave infrared (MWIR) lens with a large focal length ratio (about 1.5:1), used in the 3.7 to 4.8 μm range. The lens is consisted of a compact front group and a re-imaging group. Thanks to the compact front group configuration, it is possible to install a filter wheel mechanism in such a tight space. The total track length of the lens is about 50mm, which includes a 2mm thick protective window and a cold shield of 12mm. The full field of view of the lens is about 3.6°, and F number is less than 1.6, the image circle is about 4.6mm in diameter. The design performance of the lens reaches diffraction limitation, and doesn't change a lot during a temperature range of -40°C +60°C. This essay proposed a stepwise design method of infrared optical system guided by the qualitative approach. The method fully utilize the powerful global optimization ability, with a little effort to write code snippet in optical design software, frees optical engineer from tedious calculation of the original structure.

  20. TESS Lens-Bezel Assembly Modal Testing

    Science.gov (United States)

    Dilworth, Brandon J.; Karlicek, Alexandra

    2017-01-01

    The Transiting Exoplanet Survey Satellite (TESS) program, led by the Kavli Institute for Astrophysics and Space Research at the Massachusetts Institute of Technology (MIT) will be the first-ever spaceborne all-sky transit survey. MIT Lincoln Laboratory is responsible for the cameras, including the lens assemblies, detector assemblies, lens hoods, and camera mounts. TESS is scheduled to be launched in August of 2017 with the primary goal to detect small planets with bright host starts in the solar neighborhood, so that detailed characterizations of the planets and their atmospheres can be performed. The TESS payload consists of four identical cameras and a data handling unit. Each camera consists of a lens assembly with seven optical elements and a detector assembly with four charge-coupled devices (CCDs) including their associated electronics. The optical prescription requires that several of the lenses are in close proximity to a neighboring element. A finite element model (FEM) was developed to estimate the relative deflections between each lens-bezel assembly under launch loads to predict that there are adequate clearances preventing the lenses from making contact. Modal tests using non-contact response measurements were conducted to experimentally estimate the modal parameters of the lens-bezel assembly, and used to validate the initial FEM assumptions. Key Words Non-contact measurements, modal analysis, model validation

  1. Time Resolved Magneto-Optical Imaging in High Frequency AC Currents of YBa2Cu3O7-delta Thin Films (Postprint)

    Science.gov (United States)

    2012-02-01

    thick sapphire window on top of the cryostat allows optical access to the sample. A 10x fluorite tension-free objective lens is used to minimize...µm for an external magnetic field of 750 Oe perpendicular to the film surface . Currently, the time resolution of our setup is determined by the jitter...images indicate the direction of the applied AC current. Small defects on the surface of the MO indicator are revealed in the images as dark spots. The

  2. Acanthamoeba, bacterial, and fungal contamination of contact lens storage cases.

    Science.gov (United States)

    Gray, T B; Cursons, R T; Sherwan, J F; Rose, P R

    1995-01-01

    BACKGROUND--Microbial corneal infection is the most serious complication of contact lens wear. Contact lens cases are a recognised potential source of pathogens associated with corneal ulcers. METHODS--This survey established the incidence of protozoal, bacterial, and fungal contact lens case contamination in 101 asymptomatic daily wear cosmetic contact lens wearers from a domiciliary contact lens practice. RESULTS--Eighty two (81%) contact lens cases were found to be contaminated, with 19 (19%) sterile. Of all contact lens cases, 78 (77%) grew bacteria, 24 (24%) fungi, and 20 (20%) protozoa. Acanthamoeba spp were isolated from eight (8%) contact lens cases. Fifty six (55%) contact lens cases yielded mixed bacterial contamination. This is the first contact lens case survey in which hydrogen peroxide disinfection was the major method of contact lens disinfection (75% of subjects) and no home made saline was used. All the contaminating organisms were shown to possess the enzyme catalase that breaks down hydrogen peroxide to oxygen and water. The polymicrobial nature of the biofilms found in many contact lens cases is illustrated electron micrographically. CONCLUSION--Based on data from this and previous studies, the authors conclude with recommendations for contact lens wearers: (1) regular scrubbing of contact lens case interior to disrupt biofilms; (2) exposure of contact lens case to very hot water (> or = 70 degrees C) will kill Acanthamoeba contaminants; (3) allow contact lens case to air dry between uses; (4) if hydrogen peroxide disinfection is preferred, use a two step system; (5) replace contact lens case regularly. Images PMID:7626578

  3. Characterization of lens based photoacoustic imaging system

    Directory of Open Access Journals (Sweden)

    Kalloor Joseph Francis

    2017-12-01

    Full Text Available Some of the challenges in translating photoacoustic (PA imaging to clinical applications includes limited view of the target tissue, low signal to noise ratio and the high cost of developing real-time systems. Acoustic lens based PA imaging systems, also known as PA cameras are a potential alternative to conventional imaging systems in these scenarios. The 3D focusing action of lens enables real-time C-scan imaging with a 2D transducer array. In this paper, we model the underlying physics in a PA camera in the mathematical framework of an imaging system and derive a closed form expression for the point spread function (PSF. Experimental verification follows including the details on how to design and fabricate the lens inexpensively. The system PSF is evaluated over a 3D volume that can be imaged by this PA camera. Its utility is demonstrated by imaging phantom and an ex vivo human prostate tissue sample.

  4. Freeform micromachining of an infrared Alvarez lens

    Science.gov (United States)

    Smilie, Paul J.; Dutterer, Brian S.; Lineberger, Jennifer L.; Davies, Matthew A.; Suleski, Thomas J.

    2011-02-01

    In 1967, Luis Alvarez introduced a novel concept for a focusing lens whereby two transmitting elements with cubic polynomial surfaces yield a composite lens of variable focal length with small lateral shifts. Computer simulations have demonstrated the behavior of these devices, but fabricating the refractive cubic surfaces of the types needed with adequate precision and depth modulation has proven to be challenging using standard methods, and, to the authors' knowledge, Alvarez lens elements have not been previously machined in infrared materials. Recent developments in freeform diamond machining capability have enabled the fabrication of such devices. In this paper, we discuss the fabrication of freeform refractive Alvarez elements in germanium using diamond micro-milling on a five-axis Moore Nanotech® 350FG Freeform Generator. Machining approaches are discussed, and measurements of surface figure and finish are presented. Initial experimental tests of optical performance are also discussed.

  5. Invited review article: the electrostatic plasma lens.

    Science.gov (United States)

    Goncharov, Alexey

    2013-02-01

    The fundamental principles, experimental results, and potential applications of the electrostatic plasma lens for focusing and manipulating high-current, energetic, heavy ion beams are reviewed. First described almost 50 years ago, this optical beam device provides space charge neutralization of the ion beam within the lens volume, and thus provides an effective and unique tool for focusing high current beams where a high degree of neutralization is essential to prevent beam blow-up. Short and long lenses have been explored, and a lens in which the magnetic field is provided by rare-earth permanent magnets has been demonstrated. Applications include the use of this kind of optical tool for laboratory ion beam manipulation, high dose ion implantation, heavy ion accelerator injection, in heavy ion fusion, and other high technology.

  6. 3D printed helical antenna with lens

    KAUST Repository

    Farooqui, Muhammad Fahad

    2016-12-19

    The gain of an antenna can be enhanced through the integration of a lens, however this technique has traditionally been restricted to planar antennas due to fabrication limitations of standard manufacturing processes. Here, with a unique combination of 3D and 2D inkjet printing of dielectric and metallic inks respectively, we demonstrate a Fresnel lens that has been monolithically integrated to a non-planar antenna (helix) for the first time. Antenna measurements show that the integration of a Fresnel lens enhances the gain of a 2-turn helix by around 4.6 dB giving a peak gain of about 12.9 dBi at 8.8 GHz.

  7. An "ESA-affordable" Laue-lens

    DEFF Research Database (Denmark)

    Lund, Niels

    2005-01-01

    With ESA's INTEGRAL mission gamma-ray astronomy has advanced to the point where major scientific advances must be expected from detailed studies of the many new point sources. The interest in developing focusing telescopes operating in the soft gamma-ray regime up to 1 MeV is therefore mounting r...... constraints of a specific medium size launch vehicle. The introduction of the lens mass as a primary design driver has some surprising effects for the choice of material for the crystals and new tradeoff considerations are introduced....... rapidly. Telescopes based on Laue diffraction of gamma-rays from crystals appear as one promising route, although the practical difficulties of realizing a large scale Laue lens are certainly not small. In this paper I have attempted to develop an optimized lens design considering the size and mass...

  8. The effectiveness of soft contact lens disinfection systems against Acanthamoeba on the lens surface.

    Science.gov (United States)

    Liedel, K K; Begley, C G

    1996-03-01

    This investigation compared the efficacy of three widely used contact lens disinfection systems against an ocular isolate of Acanthamoeba polyphaga. Twenty-seven worn Ciba NewVues lenses were quartered, heat sterilized and inoculated with Acanthamoeba. Lens quarters were then randomly assigned to three experimental groups, with Group A lenses exposed to cleaner and saline rinse only, Group B to disinfection only, and Group C to both cleaner and disinfection. One quarter of each lens served as a control and the other three quarters were experimental. Quantification of viable Acanthamoeba remaining on the lens was performed after each step of the disinfection process. Group A lenses showed no significant difference between the treatments, or the treatments and the control. Group B lenses demonstrated a significant difference (p = 0.0001) between the treatments and the control. In Group C (cleaning and disinfection), the control lens quarters were significantly different (p = 0.037) from the experimental group, but there was no significant difference between the treatments. All three disinfection regimens were very effective in reducing the number of viable Acanthamoeba on the contact lens surface. In the absence of proper cleaning (Group B), AOSept was the most effective of the three. These results also show the importance of thoroughly rubbing the contact lens surface to decrease the number of Acanthamoeba.

  9. Non-compliance with lens care and maintenance in diabetic contact lens wearers.

    Science.gov (United States)

    O'Donnell, Clare; Efron, Nathan

    2004-11-01

    We hypothesize that diabetic contact lens wearers may represent a special group displaying higher levels of compliance with their lens care regimens as a result of learned behaviour relating to maintenance of their diabetic condition. To test this hypothesis, a prospective, single centre, controlled, masked study was performed whereby 29 diabetic contact lens patients and 29 non-diabetic control subjects were issued with disposable hydrogel contact lenses and a multipurpose lens care regimen. All participants were given identical instruction on lens care and maintenance. Compliance levels were assessed at a 12-month aftercare appointment by demonstration and questionnaire. Twenty-four different aspects of compliance were scored, 12 by observation and 12 by questionnaire report, of which only two showed a significant difference between the diabetic and control groups. Although the combined population of contact lens wearers was generally compliant, there were examples of non-compliance in both groups. Neither the duration of diabetes nor the degree of metabolic control appeared to have a significant effect on compliance. The results suggest that eye care practitioners cannot assume that diabetic patients will be more compliant with contact lens care and maintenance than non-diabetic patients.

  10. Analytic models of plausible gravitational lens potentials

    International Nuclear Information System (INIS)

    Baltz, Edward A.; Marshall, Phil; Oguri, Masamune

    2009-01-01

    Gravitational lenses on galaxy scales are plausibly modelled as having ellipsoidal symmetry and a universal dark matter density profile, with a Sérsic profile to describe the distribution of baryonic matter. Predicting all lensing effects requires knowledge of the total lens potential: in this work we give analytic forms for that of the above hybrid model. Emphasising that complex lens potentials can be constructed from simpler components in linear combination, we provide a recipe for attaining elliptical symmetry in either projected mass or lens potential. We also provide analytic formulae for the lens potentials of Sérsic profiles for integer and half-integer index. We then present formulae describing the gravitational lensing effects due to smoothly-truncated universal density profiles in cold dark matter model. For our isolated haloes the density profile falls off as radius to the minus fifth or seventh power beyond the tidal radius, functional forms that allow all orders of lens potential derivatives to be calculated analytically, while ensuring a non-divergent total mass. We show how the observables predicted by this profile differ from that of the original infinite-mass NFW profile. Expressions for the gravitational flexion are highlighted. We show how decreasing the tidal radius allows stripped haloes to be modelled, providing a framework for a fuller investigation of dark matter substructure in galaxies and clusters. Finally we remark on the need for finite mass halo profiles when doing cosmological ray-tracing simulations, and the need for readily-calculable higher order derivatives of the lens potential when studying catastrophes in strong lenses

  11. Photonic crystal based polarization insensitive flat lens

    Science.gov (United States)

    Turduev, M.; Bor, E.; Kurt, H.

    2017-07-01

    The paper proposes a new design of an inhomogeneous artificially created photonic crystal lens structure consisting of annular dielectric rods to efficiently focus both transverse electric and transverse magnetic polarizations of light into the same focal point. The locations of each individual cell that contains the annular dielectric rods are determined according to a nonlinear distribution function. The inner and outer radii of the annular photonic dielectric rods are optimized with respect to the polarization insensitive frequency response of the transmission spectrum of the lens structure. The physical background of the polarization insensitive focusing mechanism is investigated in both spatial and frequency domains. Moreover, polarization independent wavefront transformation/focusing has been explored in detail by investigating the dispersion relation of the structure. Corresponding phase index distribution of the lens is attained for polarization insensitive normalized frequency range of a/λ  =  0.280 and a/λ  =  0.300, where a denotes the lattice constant of the designed structure and λ denotes the wavelength of the incident light. We show the wave transformation performance and focal point movement dynamics for both polarizations of the lens structure by specially adjusting the length of the structure. The 3D finite-difference time domain numerical analysis is also performed to verifiy that the proposed design is able to focus the wave regardless of polarization into approximately the same focal point (difference between focal distances of both polarizations stays below 0.25λ) with an operating bandwidth of 4.30% between 1476 nm and 1541 nm at telecom wavelengths. The main superiorities of the proposed lens structure are being all dielectric and compact, and having flat front and back surfaces, rendering the proposed lens design more practical in the photonic integration process in various applications such as optical switch

  12. Effect of infrared radiation on the lens

    Directory of Open Access Journals (Sweden)

    Aly Eman

    2011-01-01

    Full Text Available Background: Infrared (IR radiation is becoming more popular in industrial manufacturing processes and in many instruments used for diagnostic and therapeutic application to the human eye. Aim : The present study was designed to investigate the effect of IR radiation on rabbit′s crystalline lens and lens membrane. Materials and Methods: Fifteen New Zealand rabbits were used in the present work. The rabbits were classified into three groups; one of them served as control. The other two groups were exposed to IR radiation for 5 or 10 minutes. Animals from these two irradiated groups were subdivided into two subgroups; one of them was decapitated directly after IR exposure, while the other subgroup was decapitated 1 hour post exposure. IR was delivered from a General Electric Lamp model 250R 50/10, placed 20 cm from the rabbit and aimed at each eye. The activity of Na + -K + ATPase was measured in the lens membrane. Soluble lens proteins were extracted and the following measurements were carried out: estimation of total soluble protein, sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE and Fourier transform infrared (FTIR spectroscopy. For comparison between multiple groups, analysis of variance was used with significance level set at P < 0.001. Results: The results indicated a change in the molecular weight of different lens crystalline accompanied with changes in protein backbone structure. These changes increased for the groups exposed to IR for 10 minutes. Moreover, the activity of Na + -K + ATPase significantly decreased for all groups. Conclusions: The protein of eye lens is very sensitive to IR radiation which is hazardous and may lead to cataract.

  13. From Beamline to Scanner with 225Ac

    Science.gov (United States)

    Robertson, Andrew K. H.; Ramogida, Caterina F.; Kunz, Peter; Rodriguez-Rodriguez, Cristina; Schaffer, Paul; Sossi, Vesna

    2016-09-01

    Due to the high linear energy transfer and short range of alpha-radiation, targeted radiation therapy using alpha-emitting pharmaceuticals that successfully target small disease clusters will kill target cells with limited harm to healthy tissue, potentially treating the most aggressive forms of cancer. As the parent of a decay chain with four alpha- and two beta-decays, 225Ac is a promising candidate for such a treatment. However, this requires retention of the entire decay chain at the target site, preventing the creation of freely circulating alpha-emitters that reduce therapeutic effect and increase toxicity to non-target tissues. Two major challenges to 225Ac pharmaceutical development exist: insufficient global supply, and the difficulty of preventing toxicity by retaining the entire decay chain at the target site. While TRIUMF works towards large-scale (C i amounts) production of 225Ac, we already use our Isotope Separation On-Line facility to provide small (< 1 mCi) quantities for in-house chemistry and imaging research that aims to improve and assess 225Ac radiopharmaceutical targeting. This presentation provides an overview of this research program and the journey of 225Ac from the beamline to the scanner. This research is funded by the Natural Sciences and Engineering Research Council of Canada.

  14. The corneal stroma during contact lens wear.

    Science.gov (United States)

    Jalbert, Isabelle; Stapleton, Fiona

    2005-03-01

    Recent technological advances have lead to novel descriptions of the microanatomy of the corneal stroma. In the first section of this review, these findings and the role they play in the maintenance of vital properties such as corneal transparency, mechanical strength, homeostasis, wound-healing response and metabolism are described. In the second part, contact lens induced stromal alterations such as acidosis, oedema, striae, thinning and opacities are reviewed as well as the more recently described phenomenon of microdot deposits and keratocyte loss with an emphasis on how lens wearing stromal effects can be minimised.

  15. Sterilization potential of contact lens solutions

    Directory of Open Access Journals (Sweden)

    Dada Vijay

    1988-01-01

    Full Text Available In a dynamic field of Contact Lens Solutions maintenance of high standards of anti-microbial activity is a must Resterilization Activity Time′ is a universally accepted yardstick for such an evaluation. In this study eight brands of indigenous popular solutions alongwith two FDA approved solutions were tested for their sterilization efficacy: Standardized suspensions of Pseudomonas aeruginosa, Staphylococcus aureus, Candida albicans and Aspergillus fumigatus were used for the purpose. It was observed that the contact lens solutions available ir, the domestic market were not upto the mark Suggestions for improvement have also been made.

  16. Rotman lens for mm-wavelengths

    Science.gov (United States)

    Hall, Leonard T.; Hansen, Hedley J.; Abbott, Derek

    2002-11-01

    The 77 GHz band has been reserved for intelligent cruise control in luxury cars and some public transport services in America and the United Kingdom. The Rotman lens offers a cheap and compact means to extend the single beam systems generally used, to fully functional beam staring arrangements. Rotman lenses have been built for microwave frequencies with limited success. The flexibility of microstrip transmission lines and the advent of fast accurate simulation packages allow practical Rotman lenses to be designed at mm-wavelengths. This paper discusses the limitations of the conventional design approach and predicts the performance of a new Rotman lens designed at 77 GHz.

  17. Pulse transformer for the AA lithium lens

    CERN Document Server

    CERN PhotoLab

    1980-01-01

    The antiprotons emanating from the target were initially focused by a magnetic horn. Later on, a Li-lens was used during operation for the SPS collider, until 1992. A Li-rod (130 mm long, 34 mm in diameter) constituted the secondary of a 1:23 pulse-transformer. The half-sine pulse rose to 1000 kA in 900 microsec. The angular acceptance was 95 mrad. In operation after 1992, for LEAR only, a more modest Li-lens was used (155 mm long, diameter 20 mm, 480 kA, risetime 240 microsec, angular acceptance 75 mrad).

  18. single-phase dc phase dc-ac boost converter ac boost converter

    African Journals Online (AJOL)

    User

    supply (UPS) AC motor drives and other power sup systems, need to step-up the DC input voltage. increase the output voltage level in order requirements, DC-DC boost converter is used provide DC bus voltage for PWM inverters. Hence, conventional design always cascades DC and a separate DC-AC converter.

  19. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  20. Immunochemical analyses of soluble lens proteins in some marine fishes

    Digital Repository Service at National Institute of Oceanography (India)

    Menezes, M.R.

    Soluble eye lens proteins of 10 fishes, belonging to the families Clupeidae, Hemirhamphidae, Lactaridae, Scombridae, Stromatidae, Psettodidae, Bothidae and Soleidae were studied by immunoelectrophoresis using the lens antiserum of Sardinella...

  1. IOL Implants: Lens Replacement and Cataract Surgery (Intraocular Lenses)

    Science.gov (United States)

    ... Cataract Surgery vs. Laser-Assisted Cataract Surgery Cataract Vision Simulator Cataract Pictures and Videos: What Do ... Mar. 27, 2018 An intraocular lens (or IOL) is a tiny, artificial lens for the eye. It replaces the eye's ...

  2. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...

  3. Alternating current (AC) iontophoretic transport across human epidermal membrane: effects of AC frequency and amplitude.

    Science.gov (United States)

    Yan, Guang; Xu, Qingfang; Anissimov, Yuri G; Hao, Jinsong; Higuchi, William I; Li, S Kevin

    2008-03-01

    As a continuing effort to understand the mechanisms of alternating current (AC) transdermal iontophoresis and the iontophoretic transport pathways in the stratum corneum (SC), the objectives of the present study were to determine the interplay of AC frequency, AC voltage, and iontophoretic transport of ionic and neutral permeants across human epidermal membrane (HEM) and use AC as a means to characterize the transport pathways. Constant AC voltage iontophoresis experiments were conducted with HEM in 0.10 M tetraethyl ammonium pivalate (TEAP). AC frequencies ranging from 0.0001 to 25 Hz and AC applied voltages of 0.5 and 2.5 V were investigated. Tetraethyl ammonium (TEA) and arabinose (ARA) were the ionic and neutral model permeants, respectively. In data analysis, the logarithm of the permeability coefficients of HEM for the model permeants was plotted against the logarithm of the HEM electrical resistance for each AC condition. As expected, linear correlations between the logarithms of permeability coefficients and the logarithms of resistances of HEM were observed, and the permeability data were first normalized and then compared at the same HEM electrical resistance using these correlations. Transport enhancement of the ionic permeant was significantly larger than that of the neutral permeant during AC iontophoresis. The fluxes of the ionic permeant during AC iontophoresis of 2.5 V in the frequency range from 5 to 1,000 Hz were relatively constant and were approximately 4 times over those of passive transport. When the AC frequency decreased from 5 to 0.001 Hz at 2.5 V, flux enhancement increased to around 50 times over passive transport. While the AC frequency for achieving the full effect of iontophoretic enhancement at low AC frequency was lower than anticipated, the frequency for approaching passive diffusion transport at high frequency was higher than expected from the HEM morphology. These observations are consistent with a transport model of multiple

  4. Control of grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe

    2010-01-01

    Over the last decade, distributed energy resources (DER) technology has undergone a fast development. Increased penetration of DER units and wide spread use of renewable energy sources challenge the entire architecture of traditional power system. Microgrid, characterizing higher flexibility...... and reliability, becomes an attractive candidate for the configuration of future electrical power system. This paper gives a brief review of grid interactive ac microgrid configurations. Control methods for power electronics interfaced DER units in grid interactive ac microgrids are discussed. In addition......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....

  5. ac propulsion system for an electric vehicle

    Science.gov (United States)

    Geppert, S.

    1980-01-01

    It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

  6. Superconducting three element synchronous ac machine

    International Nuclear Information System (INIS)

    Boyer, L.; Chabrerie, J.P.; Mailfert, A.; Renard, M.

    1975-01-01

    There is a growing interest in ac superconducting machines. Of several new concepts proposed for these machines in the last years one of the most promising seems to be the ''three elements'' concept which allows the cancellation of the torque acting on the superconducting field winding, thus overcoming some of the major contraints. This concept leads to a device of induction-type generator. A synchronous, three element superconducting ac machine is described, in which a room temperature, dc fed rotating winding is inserted between the superconducting field winding and the ac armature. The steady-state machine theory is developed, the flux linkages are established, and the torque expressions are derived. The condition for zero torque on the field winding, as well as the resulting electrical equations of the machine, are given. The theoretical behavior of the machine is studied, using phasor diagrams and assuming for the superconducting field winding either a constant current or a constant flux condition

  7. Lens autofluorescence is not increased at high altitude

    DEFF Research Database (Denmark)

    Kessel, Line; Kofoed, Peter Kristian; Zubieta-Calleja, Gustavo

    2010-01-01

    PURPOSE: To study the relation between ambient environmental ultraviolet radiation exposure and lens fluorescence. METHODS: Non-invasive lens fluorometry measurements were compared in healthy Bolivian and Danish subjects. Background ultraviolet radiation was 4.5 times higher in Bolivia than in De...... living at sea level at 55 degrees northern latitude. These results suggest that lens ageing, as assessed by lens autofluorometry, is independent of exposure to ultraviolet radiation....

  8. Archeologie smyšlené identity

    Czech Academy of Sciences Publication Activity Database

    Květina, Petr

    2010-01-01

    Roč. 62, č. 4 (2010), s. 629-660 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : culture * archaeological culture * social identity * ethnicity Subject RIV: AC - Archeology, Anthropology, Ethnology

  9. Nuclear structure of {sup 231}Ac

    Energy Technology Data Exchange (ETDEWEB)

    Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)

    2008-10-15

    The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  10. Preliminary study on AC superconducting machines

    International Nuclear Information System (INIS)

    Yamamoto, M.; Ishigohka, T.; Shimohka, T.; Mizukami, N.; Yamaguchi, M.

    1988-01-01

    This paper describes the issues involved in developing AC superconducting machines. In the first phase, as a preliminary experiment, a 4kVa AC superconducting coil which employs 100A class 50/60Hz superconductors is made and tested. And, in the second phase, as an extension of the 4kVa coil, a model superconducting transformer is made and examined. The transformer has a novel quench protection system with an auxiliary coil only in the low voltage side. The behavior of the overcurrent protection system is confirmed

  11. AC conductivity for a holographic Weyl semimetal

    Energy Technology Data Exchange (ETDEWEB)

    Grignani, Gianluca; Marini, Andrea; Peña-Benitez, Francisco; Speziali, Stefano [Dipartimento di Fisica e Geologia, Università di Perugia,I.N.F.N. Sezione di Perugia,Via Pascoli, I-06123 Perugia (Italy)

    2017-03-23

    We study the AC electrical conductivity at zero temperature in a holographic model for a Weyl semimetal. At small frequencies we observe a linear dependence in the frequency. The model shows a quantum phase transition between a topological semimetal (Weyl semimetal phase) with a non vanishing anomalous Hall conductivity and a trivial semimetal. The AC conductivity has an intermediate scaling due to the presence of a quantum critical region in the phase diagram of the system. The phase diagram is reconstructed using the scaling properties of the conductivity. We compare with the experimental data of https://www.doi.org/10.1103/PhysRevB.93.121110 obtaining qualitative agreement.

  12. 21 CFR 886.1420 - Ophthalmic lens gauge.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Ophthalmic lens gauge. 886.1420 Section 886.1420...) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1420 Ophthalmic lens gauge. (a) Identification. An ophthalmic lens gauge is a calibrated device intended to manually measure the curvature of a...

  13. In vivo study of lens regeneration in Rana cyanophlyctis under ...

    African Journals Online (AJOL)

    SAM

    2014-03-12

    Mar 12, 2014 ... enhanced the percentage lens regeneration not only in young tadpoles but also in froglets. Lens regeneration ability ... Influence of vitamin A and ascorbic acid on lens regeneration in young, mature tadpoles and froglets of the frog Rana cyanophlyctis. Group .... ingested by macrophages. Dorsal iris cells ...

  14. 21 CFR 800.10 - Contact lens solutions; sterility.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Contact lens solutions; sterility. 800.10 Section...) MEDICAL DEVICES GENERAL Requirements for Specific Medical Devices § 800.10 Contact lens solutions... ophthalmic use, including contact lens solutions, should be sterile. It is further evident that such...

  15. Initial Experience With Posterior Chamber Intraocular Lens Implant ...

    African Journals Online (AJOL)

    The results of extracapsular cataract extraction with posterior chamber intraocular lens implant at the Jos University Teaching Hospital are reviewed. The results suggest that despite lack of facilities to calculate the lens power for emmetropia, the use of a standard lens of about 19.0D will provide a good number of our ...

  16. Vitrectorhexis and lens aspiration with posterior chamber intraocular lens implantation in spherophakia.

    Science.gov (United States)

    Al-Haddad, Christiane; Khatib, Lama

    2012-07-01

    We describe a technique that uses the vitrector to perform successful lens aspiration and posterior chamber intraocular lens (IOL) implantation in children with spherophakia and anterior lens subluxation. After an anterior chamber maintainer is placed, the ocutome is introduced through a limbal incision to perform a circular vitrectorhexis to avoid excessive manipulation of the unstable lens followed by gentle cortex aspiration. A foldable IOL is injected into the sulcus (3-piece IOL) or bag (1-piece IOL) if the capsule is sufficiently stable. Through a pars plana incision, the ocutome is then used to perform a posterior capsulotomy to prevent late posterior capsule opacification. In our patient, sulcus IOL placement was more stable than in-the-bag placement. Neither author has a financial or proprietary interest in any material or method mentioned. Copyright © 2012 ASCRS and ESCRS. Published by Elsevier Inc. All rights reserved.

  17. Solar powered desalination system using Fresnel lens

    Science.gov (United States)

    Sales, M. T. B. F.

    2016-11-01

    The Philippines is surrounded by coastal areas and these areas can be a potential source for potable water. This study aims to design and construct a solar powered desalination system using Fresnel lens. The experimental study was conducted using polluted salt water for the sample and desalination was carried out using the designed system. The desalination system was composed of the solar concentrator, solar still and the condenser system. The Fresnel lens was made of acrylic plastic and was an effective solar concentrator. Solar stills made of dark colored glass bottles were effective in absorbing the solar energy. The condenser system made of polybutylene and polystyrene were effective in condensing the vapor at ambient temperature. The shortest time of vaporization of the salt water was at 293 sec and the optimum angle of position of the lens was 36.42°. The amount of condensate collected was directly proportional to the amount of salt water in the solar still. The highest mean efficiency of the designed set-up was 34.82%. The water produced by the solar powered desalination system using Fresnel lens passed the standards set by WHO (World Health Organization) for drinking water.

  18. Electronic states in a quantum lens

    International Nuclear Information System (INIS)

    Rodriguez, Arezky H.; Trallero-Giner, C.; Ulloa, S. E.; Marin-Antuna, J.

    2001-01-01

    We present a model to find analytically the electronic states in self-assembled quantum dots with a truncated spherical cap (''lens'') geometry. A conformal analytical image is designed to map the quantum dot boundary into a dot with semispherical shape. The Hamiltonian for a carrier confined in the quantum lens is correspondingly mapped into an equivalent operator and its eigenvalues and eigenfunctions for the corresponding Dirichlet problem are analyzed. A modified Rayleigh-Schro''dinger perturbation theory is presented to obtain analytical expressions for the energy levels and wave functions as a function of the spherical cap height b and radius a of the circular cross section. Calculations for a hard wall confinement potential are presented, and the effect of decreasing symmetry on the energy values and eigenfunctions of the lens-shape quantum dot is studied. As the degeneracies of a semicircular geometry are broken for b≠a, our perturbation approach allows tracking of the split states. Energy states and electronic wave functions with m=0 present the most pronounced influence on the reduction of the lens height. The method and expressions presented here can be straightforwardly extended to deal with more general Hamiltonians, including strains and valence-band coupling effects in Group III--V and Group II--VI self-assembled quantum dots

  19. Surgical treatment of hereditary lens subluxations.

    Science.gov (United States)

    Ozdek, Sengul; Sari, Ayca; Bilgihan, Kamil; Akata, Fikret; Hasanreisoglu, Berati

    2002-01-01

    To evaluate the effectiveness and results of pars plana vitreolensectomy approach with transscleral fixation of intraocular lens in hereditary lens subluxations. Fifteen eyes of 9 consecutive patients with a mean age of 12.8+/-6.2 years (6-26 years) with hereditary lens subluxation were operated on and the results were evaluated in a prospective study. Surgery was considered if best spectacle corrected visual acuity (BSCVA) was less than 20/70. All eyes underwent a 2-port pars plana vitreolensectomy and transscleral fixation of an intraocular lens (IOL). The mean follow-up period was 12.6+/-7.5 months (6-22 months). There was no major intraoperative complication. Preoperatively, 8 eyes (53.3%) had a BSCVA of counting fingers (CF) and 7 eyes (46.6%) had a BSCVA of 20/200 to 20/70. Postoperatively, 14 eyes (93.3%) had a BSCVA of 20/50 or better. None of the patients had IOL decentration or intraocular pressure (IOP) increase during the follow-up period. There was a macular hole formation in 1 eye postoperatively. The early results of pars plana vitreolensectomy with IOL implantation using scleral fixation technique had shown that it not only promises a rapid visual rehabilitation but it is also a relatively safe method. More serious complications, however, may occur in the long term.

  20. READING SCRIPTURE THROUGH A MYSTICAL LENS

    African Journals Online (AJOL)

    Reading scripture through a mystical lens. 144 the illuminatory function of scripture which confirms and explains experience, rather than in its philological or scientific status. Elisabeth often juxtaposes several texts when quoting from memory and the biblical foundation of her writings is clearly evident in certain cases which ...

  1. Corneal ring infiltration in contact lens wearers

    Directory of Open Access Journals (Sweden)

    Seyed Ali Tabatabaei

    2017-01-01

    Full Text Available To report a case of atypical sterile ring infiltrates during wearing soft silicone hydrogel contact lens due to poor lens care. A 29-year-old woman presented with complaints of pain, redness, and morning discharge. She was wearing soft silicone hydrogel contact lens previously; her current symptoms began 1 week before presentation. On examination, best-corrected visual acuity was 20/40 in that eye. Slit-lamp examination revealed dense, ring-shaped infiltrate involving both the superficial and deep stromal layers with lucid interval to the limbus, edema of the epithelium, epithelial defect, and vascularization of the superior limbus. Cornea-specific in vivo laser confocal microscopy (Heidelberg Retina Tomograph 2 Rostock Cornea Module, HRT 2-RCM, Heidelberg Engineering GmbH, Dossenheim, Germany revealed Langerhans cells and no sign of Acanthamoeba or fungal features, using lid scraping and anti-inflammatory drops; her vision completely recovered. We reported an atypical case of a sterile corneal ring infiltrate associated with soft contact lens wearing; smear, culture, and confocal microscopy confirmed a sterile inflammatory reaction.

  2. Properties of the cathode lens combined with a focusing magnetic/immersion-magnetic lens

    Czech Academy of Sciences Publication Activity Database

    Konvalina, Ivo; Müllerová, Ilona

    2011-01-01

    Roč. 645, č. 1 (2011), s. 55-59 ISSN 0168-9002 R&D Projects: GA ČR GAP102/10/1410; GA AV ČR IAA100650902; GA MŠk ED0017/01/01 Institutional research plan: CEZ:AV0Z20650511 Keywords : cathode lens * compound objective lens * aberration coefficients * spot size * field calculations Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.207, year: 2011

  3. Multi-phase AC/AC step-down converter for distribution systems

    Energy Technology Data Exchange (ETDEWEB)

    Aeloiza, Eddy C.; Burgos, Rolando P.

    2017-10-25

    A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.

  4. Brazilian Angiostrongylus cantonensis haplotypes, ac8 and ac9, have two different biological and morphological profiles

    Directory of Open Access Journals (Sweden)

    Tainá CC Monte

    2014-12-01

    Full Text Available Angiostrongylus cantonensis is the etiologic agent of eosinophilic meningoencephalitis in humans. Cases have been recorded in many parts of the world, including Brazil. The aim of this study was to compare the differences in the biology and morphology of two different Brazilian haplotypes of A. : ac8 and ac9. A significantly larger number of L1 larvae eliminated in the faeces of rodents at the beginning of the patent period was observed for ac9 haplotype and compared to the total of L1 larvae eliminated, there was a significant difference between the two haplotypes. The ac9 haplotype showed a significant difference in the proportion of female and male specimens (0.6:1, but the same was not observed for ac8 (1.2:1. The morphometric analysis showed that male and female specimens isolated from ac8 haplotype were significantly larger with respect to body length, oesophagus length, spicule length (male and distance from the anus to the rear end (female compared to specimens from ac9. The morphological analysis by light microscopy showed little variation in the level of bifurcations at the lateral rays in the right lobe of the copulatory bursa between the two haplotypes. The biological, morphological and morphometric variations observed between the two haplotypes agree with the observed variation at the molecular level using the cytochrome oxidase subunit I marker and reinforce the possible influence of geographical isolation on the development of these haplotypes.

  5. Brazilian Angiostrongylus cantonensis haplotypes, ac8 and ac9, have two different biological and morphological profiles.

    Science.gov (United States)

    Monte, Tainá C C; Gentile, Rosana; Garcia, Juberlan; Mota, Ester; Santos, Jeannie N; Maldonado Júnior, Arnaldo

    2014-12-01

    Angiostrongylus cantonensis is the etiologic agent of eosinophilic meningoencephalitis in humans. Cases have been recorded in many parts of the world, including Brazil. The aim of this study was to compare the differences in the biology and morphology of two different Brazilian haplotypes of A. cantonensis: ac8 and ac9. A significantly larger number of L1 larvae eliminated in the faeces of rodents at the beginning of the patent period was observed for ac9 haplotype and compared to the total of L1 larvae eliminated, there was a significant difference between the two haplotypes. The ac9 haplotype showed a significant difference in the proportion of female and male specimens (0.6:1), but the same was not observed for ac8 (1.2:1). The morphometric analysis showed that male and female specimens isolated from ac8 haplotype were significantly larger with respect to body length, oesophagus length, spicule length (male) and distance from the anus to the rear end (female) compared to specimens from ac9. The morphological analysis by light microscopy showed little variation in the level of bifurcations at the lateral rays in the right lobe of the copulatory bursa between the two haplotypes. The biological, morphological and morphometric variations observed between the two haplotypes agree with the observed variation at the molecular level using the cytochrome oxidase subunit I marker and reinforce the possible influence of geographical isolation on the development of these haplotypes.

  6. Intrinsic lens potential of neural retina inhibited by Notch signaling as the cause of lens transdifferentiation.

    Science.gov (United States)

    Iida, Hideaki; Ishii, Yasuo; Kondoh, Hisato

    2017-01-15

    Embryonic neural retinas of avians produce lenses under spreading culture conditions. This phenomenon has been regarded as a paradigm of transdifferentiation due to the overt change in cell type. Here we elucidated the underlying mechanisms. Retina-to-lens transdifferentiation occurs in spreading cultures, suggesting that it is triggered by altered cell-cell interactions. Thus, we tested the involvement of Notch signaling based on its role in retinal neurogenesis. Starting from E8 retina, a small number of crystallin-expressing lens cells began to develop after 20 days in control spreading cultures. By contrast, addition of Notch signal inhibitors to cultures after day 2 strongly promoted lens development beginning at day 11, and a 10-fold increase in δ-crystallin expression level. After Notch signal inhibition, transcription factor genes that regulate the early stage of eye development, Prox1 and Pitx3, were sequentially activated. These observations indicate that the lens differentiation potential is intrinsic to the neural retina, and this potential is repressed by Notch signaling during normal embryogenesis. Therefore, Notch suppression leads to lens transdifferentiation by disinhibiting the neural retina-intrinsic program of lens development. Copyright © 2016 Elsevier Inc. All rights reserved.

  7. A Precise Measurement of the Spin Structure Functions G**P(2) G**D(2) from SLAC Experiment E155X

    Energy Technology Data Exchange (ETDEWEB)

    McNulty, D

    2003-12-18

    A precision measurement of the deep inelastic polarized structure functions g{sub 2}{sup p} (x, Q{sup 2}) and g{sub 2}{sup d} (x, Q{sup 2}) and the virtual photon asymmetries A{sub 2}{sup p}(x, Q{sup 2}) and A{sub 2}{sup d}(x, Q{sup 2}) has been made by the E155x collaboration in the ranges 0.02 < x < 0.8 and 0.7 (GeV/c){sup 2} < Q{sup 2} < 20 (GeV/c){sup 2}. The transverse asymmetry (A{sub {perpendicular}}) was measured at SLAC using 29.1 and 32.3 GeV longitudinally polarized electrons incident on transversely polarized target protons and deuterons; the scattered electrons were detected by three fixed angle spectrometers at 2.75{sup o}, 5.5{sup o}, and 10.5{sup o} from the beam line. g{sub 2} was extracted using the measured A{sub {perpendicular}}, an E155 phenomenological fit to g{sub 1}/F{sub 1}, and the SLAC fit to R(x, Q{sup 2}); the function F{sub 1} was obtained from the most recent NMC fit to F{sub 2}(x, Q{sup 2}). The errors on g{sub 2} for both proton and deuteron are more than three times smaller than those of the previously existing world data set, thus enabling the data to resolve clearly between g{sub 2}{sup ww} and zero as well as make distinctions between various models. In addition, the Burkhardt-Cottingham and Efremov-Leader-Teryaev sum rules were evaluated over the measured kinematic region, as well as the d{sub 2} twist-3 matrix element for the proton and neutron.

  8. AC power generation from microbial fuel cells

    Science.gov (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  9. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele...

  10. http://spilplus.journals.ac.za/

    African Journals Online (AJOL)

    intuition and reason, not by perception and induction'. On the Platonist view, because sentences cannot have either spatial or temporal location, they cannot have material properties either. This timeless and 'spaceless' nature of sentences Katz and Postal (1989:7) illustrate with reference http://spilplus.journals.ac.za/ ...

  11. http://spilplus.journals.ac.za/

    African Journals Online (AJOL)

    deficiency, but to boorishness or ill-will. While grammatical error may reveal a speaker to be a less than proficient language- http://spilplus.journals.ac.za/ .... problems of meanlng, language use and the various linguistic aspects of interaction... contrastive analysis without a pragmalinguistic dimension is inadequate.".

  12. http://spilplus.journals.ac.za/

    African Journals Online (AJOL)

    in general terms,. ° what does Gutt see as significant conceptual consequences of his work? Needless to say, the framework for this talk will be Sperber and. Wilson's relevance theory of verbal communication, which was sketched in yesterday's contribution by Melinda Sinclair. Within http://spilplus.journals.ac.za/ ...

  13. Operating experience with factory-made air-insulated 1AC/2AC switchgear systems; Erste Betriebserfahrungen mit fabrikgefertigten, luftisolierten 1AC-/2AC-Schaltanlagen

    Energy Technology Data Exchange (ETDEWEB)

    Northe, J. [Balfour Beatty Rail GmbH, Offenbach (Germany); Loenard, D. [Bombardier Transportation GmbH, Mannheim (Germany)

    2007-07-01

    Today, factory-made air-insulated switchgear systems of the type TracFeed {sup registered} are available for all supply versions of 16.7 Hz and 50 Hz a.c. railways. These are supported by auxiliary equipment to ensure reliable railway operation through specific protective functions and a simplified line test. (orig.)

  14. Modeling of long High Voltage AC Underground

    DEFF Research Database (Denmark)

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.

    2010-01-01

    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and Energinet.dk. The objective of the project is to investigate the accuracy of most up to dat...

  15. Nanosecond KTN varifocal lens without electric field induced phase transition

    Science.gov (United States)

    Zhu, Wenbin; Chao, Ju-Hung; Chen, Chang-Jiang; Campbell, Adrian; Henry, Michael; Yin, Stuart (Shizhuo); Hoffman, Robert C.

    2017-08-01

    This paper presents a nanosecond speed KTN varifocal lens. The tuning principle of varifocal lens is based on the high-speed refractive index modulation from the nanosecond speed tunable electric field. A response time on the order of nanoseconds was experimentally demonstrated, which is the fastest varifocal lens reported so far. The results confirmed that the tuning speed of the KTN varifocal lens could be significantly increased by avoiding the electric field induced phase transition. Such a nanosecond speed varifocal lens can be greatly beneficial for a variety of applications that demand high speed axial scanning, such as high-resolution 3D imaging and high-speed 3D printing.

  16. Acid phosphatase and lipid peroxidation in human cataractous lens epithelium

    Directory of Open Access Journals (Sweden)

    Vasavada Abhay

    1993-01-01

    Full Text Available The anterior lens epithelial cells undergo a variety of degenerative and proliferative changes during cataract formation. Acid phosphatase is primarily responsible for tissue regeneration and tissue repair. The lipid hydroperoxides that are obtained by lipid peroxidation of polysaturated or unsaturated fatty acids bring about deterioration of biological membranes at cellular and tissue levels. Acid phosphatase and lipid peroxidation activities were studied on the lens epithelial cells of nuclear cataract, posterior subcapsular cataract, mature cataract, and mixed cataract. Of these, mature cataractous lens epithelium showed maximum activity for acid phosphatase (516.83 moles of p-nitrophenol released/g lens epithelium and maximum levels of lipid peroxidation (86.29 O.D./min/g lens epithelium. In contrast, mixed cataractous lens epithelium showed minimum activity of acid phosphatase (222.61 moles of p-nitrophenol released/g lens epithelium and minimum levels of lipid peroxidation (54.23 O.D./min/g lens epithelium. From our study, we correlated the maximum activity of acid phosphatase in mature cataractous lens epithelium with the increased areas of superimposed cells associated with the formation of mature cataract. Likewise, the maximum levels of lipid peroxidation in mature cataractous lens epithelium was correlated with increased permeability of the plasma membrane. Conversely, the minimum levels of lipid peroxidation in mixed cataractous lens epithelium makes us presume that factors other than lipid peroxidation may also account for the formation of mixed type of cataract.

  17. Oxygen transport through soft contact lens and cornea: Lens characterization and metabolic modeling

    Science.gov (United States)

    Chhabra, Mahendra

    The human cornea requires oxygen to sustain metabolic processes critical for its normal functioning. Any restriction to corneal oxygen supply from the external environment (e.g., by wearing a low oxygen-permeability contact lens) can lead to hypoxia, which may cause corneal edema (swelling), limbal hyperemia, neovascularization, and corneal acidosis. The need for adequate oxygen to the cornea is a major driving force for research and development of hypertransmissible soft contact lenses (SCLs). Currently, there is no standard technique for measuring oxygen permeability (Dk) of hypertransmissible silicone-hydrogel SCLs. In this work, an electrochemistry-based polarographic apparatus was designed, built, and operated to measure oxygen permeability in hypertransmissible SCLs. Unlike conventional methods where a range of lens thickness is needed for determining oxygen permeabilities of SCLs, this apparatus requires only a single lens thickness. The single-lens permeameter provides a reliable, efficient, and economic tool for measuring oxygen permeabilities of commercial hypertransmissible SCLs. The single-lens permeameter measures not only the product Dk, but, following modification, it measures separately diffusivity, D, and solubility, k, of oxygen in hypertransmissible SCLs. These properties are critical for designing better lens materials that ensure sufficient oxygen supply to the cornea. Metabolism of oxygen in the cornea is influenced by contact-lens-induced hypoxia, diseases such as diabetes, surgery, and drug treatment, Thus, estimation of the in-vivo corneal oxygen consumption rate is essential for gauging adequate oxygen supply to the cornea. Therefore, we have developed an unsteady-state reactive-diffusion model for the cornea-contact-lens system to determine in-vivo human corneal oxygen-consumption rate. Finally, a metabolic model was developed to determine the relation between contact-lens oxygen transmissibility (Dk/L) and corneal oxygen deficiency. A

  18. Subjective assessment of contact lens wear by army aircrew.

    Science.gov (United States)

    Lattimore, M R; Cornum, R L

    1993-07-01

    Because 23% of Army aviators are ametropic, contact lenses have drawn increased attention as a spectacle substitute to solve system compatibility problems. From November 1988 until October 1991, a series of contact lens research protocols were conducted to develop a comprehensive database on contact lens wear in varied environments. Questionnaires were used to assess suitability and acceptability of routine contact lens wear. Responses from 202 subjects were obtained from September 1989 through September 1991. The questions explored operational and safety of flight issues of contact lens wear. Subjects overwhelmingly approved of contact lens use in all settings: 95% expressed greater combat readiness and effectiveness with contact lenses, 98% felt contact lens use (and maintenance) in the cockpit had no adverse impact on safety of flight, and 98% endorsed the routine use of contact lenses. These data highlight Army aircrew acceptance of contact lens use.

  19. Pars Plana Vitrectomy in Treatment of Lens Injury

    Directory of Open Access Journals (Sweden)

    Remzi Avcı

    2013-01-01

    Full Text Available Lens injury due to traumas may present as loss of capsule integrity, cataract, lens subluxation, or lens luxation. In addition, lens subluxation and lens luxation may occur in pseudophakic patients due to trauma. Clear corneal, scleral or sclero-corneal phacoemulsification surgery, pars plana vitrectomy, pars plana vitrectomy with phaco-fragmentation, or pars plana vitrectomy with removal through corneal incision techniques are used in the treatment of lens injury due to traumas. Intraocular lens can be implanted in the bag, sulcus, or anterior chamber during the surgery. Depending on the circumstances, scleral fixated intraocular lenses or iris-claw lenses may also be preferred. Rehabilitation of such patients is not of a great concern today, with the advanced level of vitreoretinal surgery and cataract surgery techniques and with the current state of technology. (Turk J Ophthalmol 2013; 43: 51-4

  20. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  1. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  2. Spontaneous dislocation of lens bag with acrylic lens after uneventful cataract surgery - unusual complication of cataract surgery.

    Science.gov (United States)

    Shah, Mehul A; Shah, Shreya M; Mehta, Ruchir; Shah, Prerna

    2015-01-01

    Spontaneous dislocation of intraocular lens with bag is rare. We report a case of a 56-year-old male who presented with spontaneous anterior dislocation of an in-the-bag intraocular lens 3 years after manual small incision cataract surgery. He had undergone manual small incision cataract surgery with foldable acrylic intraocular lens implantation, and 18 months after cataract surgery ND: YAG capsulotomy with uneventful post capsulotomy follow-up. 17 months after capsulotomy, the patient presented with sudden decrease of vision. On anterior segment examination, the intraocular lens with bag was dislocated into the anterior chamber. It was managed with intraocular lens explantation with bag, anterior vitrectomy and sclera fixated intraocular lens. Spontaneous intraocular lens dislocation with bag is possible after 1.5 years of uneventful surgery which may be managed using different techniques.

  3. Gravitational Lens Time Delays Using Polarization Monitoring

    Directory of Open Access Journals (Sweden)

    Andrew Biggs

    2017-11-01

    Full Text Available Gravitational lens time delays provide a means of measuring the expansion of the Universe at high redshift (and therefore in the ‘Hubble flow’ that is independent of local calibrations. It was hoped that many of the radio lenses found in the JVAS/CLASS survey would yield time delays as these were selected to have flat spectra and are dominated by multiple compact components. However, despite extensive monitoring with the Very Large Array (VLA, time delays have only been measured for three of these systems (out of 22. We have begun a programme to reanalyse the existing VLA monitoring data with the goal of producing light curves in polarized flux and polarization position angle, either to improve delay measurements or to find delays for new sources. Here, we present preliminary results on the lens system B1600+434 which demonstrate the presence of correlated and substantial polarization variability in each image.

  4. Complications caused by contact lens wearing.

    Science.gov (United States)

    Beljan, Jasna; Beljan, Kristina; Beljan, Zdravko

    2013-04-01

    Complications in wearing contact lenses are very rare and caused by poor maintenance, over-extended wear and wearing of contact lenses in a polluted environment. Regular control by a professional person can efficiently reduce the number of complications. This paper describes the most common risks factors for complications, and complications of wearing contact lenses with the classification according to the anatomic parts of the eye: eyelids, tear film, limbus, corneal epithelium, corneal stroma and corneal endothelium. Every complication has been described by the characteristic signs and symptoms, etiology and pathology, as well as therapy and prognosis. The paper describes how to select adequate customers as contact lens users, with proper education in order to ensure minimal incidence of complications due to contact lens wear, thus attracting a lot of satisfied and healthy customers.

  5. Effects of Temperature on Hybrid Lens Performance

    Science.gov (United States)

    Askins, Steve; Victoria, Marta; Herrero, Rebeca; Domínguez, César; Antón, Ignacio; Sala, Gabriel

    2011-12-01

    In hybrid Silicone-on-glass Fresnel lenses, an optical silicone is molded onto a glass substrate and forms the Fresnel structure. These lenses offer a cost effective solution as a primary optical element in point-focus concentrator photovoltaic modules, as well as performance advantages. However, these lenses have a high performance variation with temperature due both to the change in index of refraction of silicone as well as to deformations in the facets caused by coefficient of thermal expansion (CTE) mismatch. In this study we perform measurements of the light flux at the focal plane of a family of SOG lenses, varying temperature and lens-to-receiver distances. The effect of varying silicone cure temperature and the depth of the silicone between the lens and the glass substrate on temperature dependence was investigated. A preliminary computer model of this behavior is presented.

  6. A Tribute to Dr. Willy Lens

    Directory of Open Access Journals (Sweden)

    Maarten Vansteenkiste

    2016-07-01

    Full Text Available Dr. Willy Lens, born on December 10th, 1943, passed away on August 29th, 2014. With his passing, the motivation community has lost a seminal member, a mentor, and a friend. Dr. Lens – a Fellow of the Association for Psychological Science and Founding Fellow of the American Educational Research Association – made fundamental contributions to the study of motivation both through his own work and through his caring and thoughtful mentorship of a large community of scholars. With this tribute, we want to honor Dr. Willy Lens’ significance to psychology and education as well as his positive influence, both personally and professionally, on the lives of dozens of scholars. With his contagious enthusiasm and caring mentorship, Willy was an example for our academic community and with this tribute we express our gratitude for the privilege to have collaborated with him.

  7. Stretched Lens Array Photovoltaic Concentrator Technology Developed

    Science.gov (United States)

    Piszczor, Michael F., Jr.; O'Neill, Mark J.

    2004-01-01

    Solar arrays have been and continue to be the mainstay in providing power to nearly all commercial and government spacecraft. Light from the Sun is directly converted into electrical energy using solar cells. One way to reduce the cost of future space power systems is by minimizing the size and number of expensive solar cells by focusing the sunlight onto smaller cells using concentrator optics. The stretched lens array (SLA) is a unique concept that uses arched Fresnel lens concentrators to focus sunlight onto a line of high-efficiency solar cells located directly beneath. The SLA concept is based on the Solar Concentrator Array with Refractive Linear Element Technology (SCARLET) design that was used on NASA's New Millennium Deep Space 1 mission. The highly successful asteroid/comet rendezvous mission (1998 to 2001) demonstrated the performance and long-term durability of the SCARLET/SLA solar array design and set the foundation for further improvements to optimize its performance.

  8. Intraocular lens implantation in microphthalmic patients.

    Science.gov (United States)

    Sinskey, R M; Amin, P; Stoppel, J

    1992-09-01

    Microphthalmos is a developmental disorder of the eye consisting of a smaller than normal eye. This disorder can present as an isolated condition or associated with other systemic alterations. It is not uncommon for patients with microphthalmos to have congenital cataracts along with other ocular and systemic abnormalities. This paper reports the experience with 11 microphthalmic eyes of seven patients who had primary or secondary intraocular lens (IOL) implantation over a six-year period from 1985 to 1991. In all cases the IOL had a 13.5 mm or 14.0 mm overall diameter and a 6.0 mm or 6.5 mm optic. It was difficult to obtain documentation of objective visual improvement in many of these cases because of the associated nystagmus. However, all patients reported subjective improvements. These results suggest that with proper technique and lens selection microphthalmic patients should be considered for IOL implantation with relative safety and success.

  9. Pulser for the Tevatron electron lens gun

    Energy Technology Data Exchange (ETDEWEB)

    Iouri Terechkine et al.

    2004-05-18

    To compensate for beam-beam interaction in Tevatron, an ''electron lens'' is considered to be an effective instrument. When a bunch of electrons with energy in the range (10-16) kV is overlapping with a bunch of antiprotons, the resulting focusing force for antiprotons can be adjusted by changing the electron beam current and by profiling its radial distribution. There exist several scenarios of how the system must function. According to one of them, an electron gun that supplies electrons must be fed by voltage pulses that follow with the frequency of antiproton bunches circulating in the Tevatron, which is about 2.5 MHz. To provide focusing tailored for each individual antiproton bunch, a modulator of the gun (pulser) must allow pulse-to-pulse voltage change. This report will cover main approaches to a design of a pulser for use with the gun of the Tevatron Electron Lens.

  10. Intraocular Lens Subluxation in Marfan Syndrome

    Science.gov (United States)

    Rodrigo, Bolaños-Jiménez; Paulina, López-Lizárraga E; Francesc, March de R; Eduardo, Telich-Tarriba J; Alejandro, Navas

    2014-01-01

    Purpose : Ectopia lentis (EL) is a major criteria for the diagnosis of Marfan syndrome, it may vary from an asymptomatic mild displacement to a significant subluxation that places the equator of the lens in the pupillary axis. The purpose of this work is to present the case of a patient with Marfan syndrome who received treatment for subluxation at our institution. Case Report : A 51-year-old female diagnosed with Marfan syndrome presented to the emergency department with bilateral eye redness, foreign body sensation and crusting around the eyes on awakening. She had the following history of cardiac and ophthalmologic complications, including: 1. Lens subluxation 2. High myopia 3. Aortic root dilation, 4. Mitral valve prolapse and 5. Tricuspid insufficiency. Conclusion : The ophthalmological management of Marfan patients is challenging and periodical follow-up is needed. Surgical versus conservative management is controversial, each case needs to be evaluated individually to analyze the risks and benefits of the procedures. PMID:25279020

  11. Sterilization potential of contact lens solutions

    OpenAIRE

    Dada Vijay; Mehta Manoj

    1988-01-01

    In a dynamic field of Contact Lens Solutions maintenance of high standards of anti-microbial activity is a must Resterilization Activity Time′ is a universally accepted yardstick for such an evaluation. In this study eight brands of indigenous popular solutions alongwith two FDA approved solutions were tested for their sterilization efficacy: Standardized suspensions of Pseudomonas aeruginosa, Staphylococcus aureus, Candida albicans and Aspergillus fumigatus were used for the purpose. ...

  12. Performance of a Be Refractive Lens

    International Nuclear Information System (INIS)

    Smither, R.K.; Khounsary, A.M.; Mancini, D.C.; Saleem, K. Abu

    2004-01-01

    The performance of a beryllium compound refractive lens (CRL) was tested in the energy range of 11.5 to 8.0 keV. The beryllium refractive lens consists of 50 aligned, 1-mm-diameter, hollow spheres in a solid block of beryllium, 30 mm x 20 mm x 55 mm. The minimum web between each hollow sphere was 0.10 mm. The measured focal length of the lens for x-rays close to the axis of the beam was 147.7 cm +/- 2.0 cm at 10 keV and 120.2 +/- 2.0 cm at 9.1 keV. These values agree well with the theoretical values of 146.6 cm and 121.4 cm, respectively. The diameter of the best focus obtained at 10 keV was 35 μm horizontal and 45 μm vertical. For the modified version of the lens used in the 9.1 keV experiment these values were 25 μm horizontal and 35 μm vertical. The x-ray beam cross section for the 10 keV and the 9.1 keV experiments were 0.50 mm x 0.50 mm and 0.30 mm x 0.30 mm, respectively. The enhancement of the flux (photons per sq. mm) was 50:1 at 10 keV and 80:1 in the 9.1 keV experiment

  13. THE BOSS EMISSION-LINE LENS SURVEY. IV. SMOOTH LENS MODELS FOR THE BELLS GALLERY SAMPLE

    Energy Technology Data Exchange (ETDEWEB)

    Shu, Yiping [National Astronomical Observatories, Chinese Academy of Sciences, 20A Datun Road, Chaoyang District, Beijing 100012 (China); Bolton, Adam S.; Montero-Dorta, Antonio D.; Cornachione, Matthew A.; Zheng, Zheng; Brownstein, Joel R. [Department of Physics and Astronomy, University of Utah, 115 South 1400 East, Salt Lake City, UT 84112 (United States); Mao, Shude [Physics Department and Tsinghua Centre for Astrophysics, Tsinghua University, Beijing 100084 (China); Kochanek, Christopher S. [Department of Astronomy and Center for Cosmology and Astroparticle Physics, Ohio State University, Columbus, OH 43210 (United States); Pérez-Fournon, Ismael; Marques-Chaves, Rui [Instituto de Astrofísica de Canarias, C/Vía Láctea, s/n, E-38205 San Cristóbal de La Laguna, Tenerife (Spain); Oguri, Masamune [Research Center for the Early Universe, University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-0033 (Japan); Ménard, Brice, E-mail: yiping.shu@nao.cas.cn [Department of Physics and Astronomy, Johns Hopkins University, Baltimore, MD 21218 (United States)

    2016-12-20

    We present Hubble Space Telescope F606W-band imaging observations of 21 galaxy-Ly α emitter lens candidates in the Baryon Oscillation Spectroscopic Survey Emission-Line Lens Survey (BELLS) for the GALaxy-Ly α EmitteR sYstems (BELLS GALLERY) survey. Seventeen systems are confirmed to be definite lenses with unambiguous evidence of multiple imaging. The lenses are primarily massive early-type galaxies (ETGs) at redshifts of approximately 0.55, while the lensed sources are Ly α emitters (LAEs) at redshifts from two to three. Although most of the lens systems are well fit by smooth lens models consisting of singular isothermal ellipsoids in an external shear field, a thorough exploration of dark substructures in the lens galaxies is required. The Einstein radii of the BELLS GALLERY lenses are, on average, 60% larger than those of the BELLS lenses because of the much higher source redshifts. This will allow for a detailed investigation of the radius evolution of the mass profile in ETGs. With the aid of the average ∼13× lensing magnification, the LAEs are frequently resolved into individual star-forming knots with a wide range of properties. They have characteristic sizes from less than 100 pc to several kiloparsecs, rest-frame far-UV apparent AB magnitudes from 29.6 to 24.2, and typical projected separations of 500 pc to 2 kpc.

  14. [Congenital lens subluxation: visual acuity outcomes and intraocular lens postoperative position].

    Science.gov (United States)

    Arraes, Caroline; Endriss, Daniela; Lobato, Francisco; Arraes, João; Ventura, Marcelo

    2010-01-01

    To evaluate the visual acuity outcomes and to investigate the intraocular lens (IOL) and endocapsular ring positions with ultrasound biomicroscopy in 17 eyes of 10 patients with congenital lens subluxation who underwent the same surgical technique, by the same surgeon. The study was performed in the ''Hospital de Olhos de Pernambuco'' and ''Fundação Altino Ventura''. The surgical technique consisted of phacoaspiration with implant of endocapsular ring and intraocular lens with one loop haptic amputated. The age varied from 7 to 22 years. Data on visual acuity (VA) before and after surgery, surgery follow-up period, and complications were analyzed. All patients underwent ultrasound biomicroscopy. The mean follow-up period was 2.8 years. There was a VA improvement in 17 (100%) eyes: in 12 eyes (70.6%) the visual acuity was better than 20/40; 4 (23.5%) ranged from 20/40 to 20/100, and 1 (5.9%) had visual acuity worse than 20/100, however better than the preoperative visual acuity. The posterior capsular opacification occurred in 10 eyes (58.9%). Ultrasound biomicroscopy showed that all IOL were partially decentralized, however without surpassing the pupil border limit. Endocapsular ring position was correct and there was a good capsular support in all cases. The evaluated surgical treatment provided good intraocular lens and endocapsular ring position, with VA improvement Thus, this technique is a viable, effective and safe option for the visual rehabilitation of patients with congenital lens subluxation.

  15. CTE Corrections for WFPC2 and ACS

    Science.gov (United States)

    Dolphin, Andrew

    2003-07-01

    The error budget for optical broadband photometry is dominated by three factors: CTE corrections, long-short anomaly corrections, and photometric zero points. Questions about the dependencies of the CTE have largely been resolved, and my CTE corrections have been included in the WFPC2 handbook and tutorial. What remains to be done is the determination of the "final" CTE correction at the end of the WFPC2 mission, which will increase the accuracy of photometry obtained in the final few cycles. The long-short anomaly is still the subject of much debate, as it remains unclear whethere or not this effect is real and, if so, what its size and nature is. Photometric zero points have likewise varied by over 0.05 magnitudes in the literature, and will likely remain unresolved until the long-short anomaly is addressed {given that most calibration exposures are short while most science exposures are long}. It is also becoming apparent that similar issues will affect the accuracy of ACS photometry, and consequently that an ACS CTE study analogous to my WFPC2 work would significantly improve the calibration of ACS. I therefore propose to use archival WFPC2 images of omega Cen and ACS images of 47 Tuc to continue my HST calibration work. I also propose to begin work on "next-generation" CTE corrections, in which corrections are applied to the images based on accurate charge-trapping models rather than to the reduced photometry. This technique will allow for more accurate CTE corrections in certain cases {such as a star above a bright star or on a variable background}, improved PSF-fitting photometry of faint stars, and image restoration for accurate analysis of extended objects.

  16. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

    2015-01-01

    is then added to primary control, compensating the frequency drop caused by the droop mechanism. The proposed controller is fully distributed, meaning that each source exchange information with only its direct neighbors through a sparse communication network. This controller has a unique feature that it does...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  17. Collapse of DNA in ac Electric Fields

    Science.gov (United States)

    Zhou, Chunda; Reisner, Walter W.; Staunton, Rory J.; Ashan, Amir; Austin, Robert H.; Riehn, Robert

    2011-06-01

    We report that double-stranded DNA collapses in the presence of ac electric fields at frequencies of a few hundred Hertz, and does not stretch as commonly assumed. In particular, we show that confinement-stretched DNA can collapse to about one quarter of its equilibrium length. We propose that this effect is based on finite relaxation times of the counterion cloud, and the subsequent partitioning of the molecule into mutually attractive units. We discuss alternative models of those attractive units.

  18. Collapse of DNA in ac electric fields.

    Science.gov (United States)

    Zhou, Chunda; Reisner, Walter W; Staunton, Rory J; Ashan, Amir; Austin, Robert H; Riehn, Robert

    2011-06-17

    We report that double-stranded DNA collapses in the presence of ac electric fields at frequencies of a few hundred Hertz, and does not stretch as commonly assumed. In particular, we show that confinement-stretched DNA can collapse to about one quarter of its equilibrium length. We propose that this effect is based on finite relaxation times of the counterion cloud, and the subsequent partitioning of the molecule into mutually attractive units. We discuss alternative models of those attractive units.

  19. The LHC AC Dipole system: an introduction

    CERN Document Server

    Serrano, J; CERN. Geneva. BE Department

    2010-01-01

    The LHC AC Dipole is an instrument to study properties of the LHC lattice by inducing large transverse displacements in the beam. These displacements are generated by exciting the beam with an oscillating magnetic field at a frequency close to the tune. This paper presents the system requirements and the technical solution chosen to meet them, based of high-power audio amplifiers and a resonant parallel RLC circuit.

  20. Two families of astrophysical diverging lens models

    Science.gov (United States)

    Er, Xinzhong; Rogers, Adam

    2018-03-01

    In the standard gravitational lensing scenario, rays from a background source are bent in the direction of a foreground lensing mass distribution. Diverging lens behaviour produces deflections in the opposite sense to gravitational lensing, and is also of astrophysical interest. In fact, diverging lensing due to compact distributions of plasma has been proposed as an explanation for the extreme scattering events that produce frequency-dependent dimming of extragalactic radio sources, and may also be related to the refractive radio wave phenomena observed to affect the flux density of pulsars. In this work we study the behaviour of two families of astrophysical diverging lenses in the geometric optics limit, the power law, and the exponential plasma lenses. Generally, the members of these model families show distinct behaviour in terms of image formation and magnification, however the inclusion of a finite core for certain power-law lenses can produce a caustic and critical curve morphology that is similar to the well-studied Gaussian plasma lens. Both model families can produce dual radial critical curves, a novel distinction from the tangential distortion usually produced by gravitational (converging) lenses. The deflection angle and magnification of a plasma lens vary with the observational frequency, producing wavelength-dependent magnifications that alter the amplitudes and the shape of the light curves. Thus, multiwavelength observations can be used to physically constrain the distribution of the electron density in such lenses.

  1. Dynamic metasurface lens based on MEMS technology

    Directory of Open Access Journals (Sweden)

    Tapashree Roy

    2018-02-01

    Full Text Available In the recent years, metasurfaces, being flat and lightweight, have been designed to replace bulky optical components with various functions. We demonstrate a monolithic Micro-Electro-Mechanical System (MEMS integrated with a metasurface-based flat lens that focuses light in the mid-infrared spectrum. A two-dimensional scanning MEMS platform controls the angle of the lens along two orthogonal axes by ±9°, thus enabling dynamic beam steering. The device could be used to compensate for off-axis incident light and thus correct for aberrations such as coma. We show that for low angular displacements, the integrated lens-on-MEMS system does not affect the mechanical performance of the MEMS actuators and preserves the focused beam profile as well as the measured full width at half maximum. We envision a new class of flat optical devices with active control provided by the combination of metasurfaces and MEMS for a wide range of applications, such as miniaturized MEMS-based microscope systems, LIDAR scanners, and projection systems.

  2. Adaptive Liquid Lens Actuated by Droplet Movement

    Directory of Open Access Journals (Sweden)

    Chao Liu

    2014-08-01

    Full Text Available In this paper we report an adaptive liquid lens actuated by droplet movement. Four rectangular PMMA (Polymethyl Methacrylate substrates are stacked to form the device structure. Two ITO (Indium Tin Oxide sheets stick on the bottom substrate. One PMMA sheet with a light hole is inserted in the middle of the device. A conductive droplet is placed on the substrate and touches the PMMA sheet to form a small closed reservoir. The reservoir is filled with another immiscible non-conductive liquid. The non-conductive liquid can form a smooth concave interface with the light hole. When the device is applied with voltage, the droplet stretches towards the reservoir. The volume of the reservoir reduces, changing the curvature of the interface. The device can thus achieve the function of an adaptive lens. Our experiments show that the focal length can be varied from −10 to −159 mm as the applied voltage changes from 0 to 65 V. The response time of the liquid lens is ~75 ms. The proposed device has potential applications in many fields such as information displays, imaging systems, and laser scanning systems.

  3. Thin wetting film lens-less imaging

    International Nuclear Information System (INIS)

    Allier, C.P.; Poher, V.; Coutard, J.G.; Hiernard, G.; Dinten, J.M.

    2011-01-01

    Lens-less imaging has recently attracted a lot of attention as a compact, easy-to-use method to image or detect biological objects like cells, but failed at detecting micron size objects like bacteria that often do not scatter enough light. In order to detect single bacterium, we have developed a method based on a thin wetting film that produces a micro-lens effect. Compared with previously reported results, a large improvement in signal to noise ratio is obtained due to the presence of a micro-lens on top of each bacterium. In these conditions, standard CMOS sensors are able to detect single bacterium, e.g. E. coli, Bacillus subtilis and Bacillus thuringiensis, with a large signal to noise ratio. This paper presents our sensor optimization to enhance the SNR; improve the detection of sub-micron objects; and increase the imaging FOV, from 4.3 mm 2 to 12 mm 2 to 24 mm 2 , which allows the detection of bacteria contained in 0.5 μl to 4 μl to 10 μl, respectively. (authors)

  4. Compound refractive X-ray lens

    International Nuclear Information System (INIS)

    Nygren, D.R.; Cahn, R.; Cederstrom, B.; Danielsson, M.; Vestlund, J.

    2000-01-01

    An apparatus and method are disclosed for focusing X-rays. In one embodiment, his invention is a commercial-grade compound refractive X-ray lens. The commercial-grade compound refractive X-ray lens includes a volume of low-Z material. The volume of low-Z material has a first surface which is adapted to receive X-rays of commercially-applicable power emitted from a commercial-grade X-ray source. The volume of low-Z material also has a second surface from which emerge the X-rays of commercially-applicable power which were received at the first surface. Additionally, the commercial-grade compound refractive X-ray lens includes a plurality of openings which are disposed between the first surface and the second surface. The plurality of openings are oriented such that the X-rays of commercially-applicable power which are received at the first surface, pass through the volume of low-Z material and through the plurality openings. In so doing, the X-rays which emerge from the second surface are refracted to a focal point

  5. Laboratory Demonstration of Axicon-Lens Coronagraph

    Science.gov (United States)

    Choi, Jaeho; Jea, Geonho

    2018-01-01

    The results of laboratory based experiments of the proposed coronagraph using axicon-lenses that is conjunction with a method of noninterferometric quantitative phase imaging for direct imaging of exoplanets is will present. The light source is passing through tiny holes drilled on the thin metal plate is used as the simulated stellar and its companions. Those diffracted light at the edge of the holes bears a similarity to the light from the bright stellar. Those images are evaginated about the optical axis after the maximum focal length of the first axicon lens. Then the evaginated images of have cut off using the motorized iris which means the suppressed the central stellar light preferentially. Various length between the holes which represent the angular distance are examined. The laboratory experimental results are shown that the axicon-lens coronagraph has feature of ability to achieve the smaller IWA than l/D and high-contrast direct imaging. The laboratory based axicon-lens coronagraph imaging support the symbolic computation results which has potential in direct imaging for finding exoplanet and various astrophysical activities. The setup of the coronagraph is simple to build and is durable to operate. Moreover it can be transported the planets images to a broadband spectrometric instrument that able to investigate the constituent of the planetary system.

  6. Metasurface axicon lens design at visible wavelengths

    Science.gov (United States)

    Alyammahi, Saleimah; Zhan, Qiwen

    2017-08-01

    The emerging field of metasurfaces is promising to realize novel optical devices with miniaturized flat format and added functionalities. Metasurfaces have been demonstrated to exhibit full control of amplitude, phase and polarization of electromagnetic waves. Using the metasurface, the wavefront of light can be manipulated permitting new functionalities such as focusing and steering of the beams and imaging. One optical component which can be designed using metasurfaces is the axicon. Axicons are conical lenses used to convert Gaussian beams into nondiffraction Bessel beams. These unique devices are utilized in different applications ranging from optical trapping and manipulation, medical imaging, and surgery. In this work, we study axicon lens design comprising of planar metasurfaces which generate non-diffracting Bessel beams at visible wavelengths. Dielectric metasurfaces have been used to achieve high efficiency and low optical loss. We measured the spot size of the resulted beams at different planes to demonstrate the non-diffraction properties of the resulted beams. We also investigated how the spot size is influenced by the axicon aperture. Furthermore, we examined the achromatic properties of the designed axicon. Comparing with the conventional lens, the metasurface axicon lens design enables the creation of flat optical device with wide range of depth of focus along its optical axis.

  7. Radiation dose to the eye lens

    DEFF Research Database (Denmark)

    Baun, Christina; Falch Braas, Kirsten; D. Nielsen, Kamilla

    2015-01-01

    Radiation Dose to the Eye Lens: Does Positioning Really Matter? C. Baun1, K. Falch1, K.D. Nielsen2, S. Shanmuganathan1, O. Gerke1, P.F. Høilund-Carlsen1 1Department of Nuclear Medicine, Odense University Hospital, Odense C, Denmark. 2University College Lillebaelt, Odense, Denmark. Aim: The scan...... field in oncology patients undergoing eyes-to-thighs PET/CT must always include the base of the scull according to department guidelines. The eye lens is sensitive to radiation exposure and if possible it should be avoided to scan the eye. If the patient’s head is kipped backwards during the scan one...... might avoid including the eye in the CT scan without losing sufficient visualization of the scull base. The aim of this study was to evaluate the possibility of decreasing the radiation dose to the eye lens, simply by changing the head position, when doing the PET/CT scan from the base of the scull...

  8. Dynamic metasurface lens based on MEMS technology

    Science.gov (United States)

    Roy, Tapashree; Zhang, Shuyan; Jung, Il Woong; Troccoli, Mariano; Capasso, Federico; Lopez, Daniel

    2018-02-01

    In the recent years, metasurfaces, being flat and lightweight, have been designed to replace bulky optical components with various functions. We demonstrate a monolithic Micro-Electro-Mechanical System (MEMS) integrated with a metasurface-based flat lens that focuses light in the mid-infrared spectrum. A two-dimensional scanning MEMS platform controls the angle of the lens along two orthogonal axes by ±9°, thus enabling dynamic beam steering. The device could be used to compensate for off-axis incident light and thus correct for aberrations such as coma. We show that for low angular displacements, the integrated lens-on-MEMS system does not affect the mechanical performance of the MEMS actuators and preserves the focused beam profile as well as the measured full width at half maximum. We envision a new class of flat optical devices with active control provided by the combination of metasurfaces and MEMS for a wide range of applications, such as miniaturized MEMS-based microscope systems, LIDAR scanners, and projection systems.

  9. Direct amplitude detuning measurement with ac dipole

    Directory of Open Access Journals (Sweden)

    S. White

    2013-07-01

    Full Text Available In circular machines, nonlinear dynamics can impact parameters such as beam lifetime and could result in limitations on the performance reach of the accelerator. Assessing and understanding these effects in experiments is essential to confirm the accuracy of the magnetic model and improve the machine performance. A direct measurement of the machine nonlinearities can be obtained by characterizing the dependency of the tune as a function of the amplitude of oscillations (usually defined as amplitude detuning. The conventional technique is to excite the beam to large amplitudes with a single kick and derive the tune from turn-by-turn data acquired with beam position monitors. Although this provides a very precise tune measurement it has the significant disadvantage of being destructive. An alternative, nondestructive way of exciting large amplitude oscillations is to use an ac dipole. The perturbation Hamiltonian in the presence of an ac dipole excitation shows a distinct behavior compared to the free oscillations which should be correctly taken into account in the interpretation of experimental data. The use of an ac dipole for direct amplitude detuning measurement requires careful data processing allowing one to observe the natural tune of the machine; the feasibility of such a measurement is demonstrated using experimental data from the Large Hadron Collider. An experimental proof of the theoretical derivations based on measurements performed at injection energy is provided as well as an application of this technique at top energy using a large number of excitations on the same beam.

  10. Radiation dose to the lens and cataract formation

    International Nuclear Information System (INIS)

    Henk, J.M.; Whitelocke, R.A.F.; Warrington, A.P.; Bessell, E.M.

    1993-01-01

    The purpose of this work was to determine the radiation tolerance of the lens of the eye and the incidence of radiation-induced lens changes in patients treated by fractionated supervoltage radiation therapy for orbital tumors. Forty patients treated for orbital lymphoma and pseudotumor with tumor doses of 20--40 Gy were studied. The lens was partly shielded using lead cylinders in most cases. The dose to the germinative zone of the lens was estimated by measurements in a tissue equivalent phantom using both film densitometry and thermoluminescent dosimetry. Opthalmological examination was performed at 6 monthly intervals after treatment. The lead shield was found to reduce the dose to the germinative zone of the lens to between 36--50% of the tumor dose for Cobalt beam therapy, and to between 11--18% for 5 MeV x-rays. Consequently, the lens doses were in the range 4.5--30 Gy in 10--20 fractions. Lens opacities first appeared from between 3 and 9 years after irradiation. Impairment of visual acuity ensued in 74% of the patients who developed lens opacities. The incidence of lens changes was strongly dose-related. None was seen after doses of 5 Gy or lower, whereas doses of 16.5 Gy or higher were all followed by lens opacities which impaired visual acuity. The largest number of patients received a maximum lens dose of 15 Gy; in this group the actuarial incidence of lens opacities at 8 years was 57% with visual impairment in 38%. The adult lens can tolerate a total dose of 5 Gy during a fractionated course of supervoltage radiation therapy without showing any changes. Doses of 16.5 Gy or higher will almost invariably lead to visual impairment. The dose which causes a 50% probability of visual impairment is approximately 15 Gy. 10 refs., 4 figs., 1 tab

  11. UARS PEM Level 2 VMAG AC V001

    Data.gov (United States)

    National Aeronautics and Space Administration — The Particle Environment Monitor (PEM) level 2 Vector Magnetometer (VMAG) AC daily product contains the Vector Magnetic Field AC component. PEM was flown on the UARS...

  12. Novel Scanning Lens Instrument for Evaluating Fresnel Lens Performance: Equipment Development and Initial Results (Presentation)

    Energy Technology Data Exchange (ETDEWEB)

    Herrero, R.; Miller, D. C.; Kurtz, S. R.; Anton, I.; Sala, G.

    2013-07-01

    A system dedicated to the optical transmittance characterization of Fresnel lenses has been developed at NREL, in collaboration with the UPM. The system quantifies the optical efficiency of the lens by generating a performance map. The shape of the focused spot may also be analyzed to understand change in the lens performance. The primary instrument components (lasers and CCD detector) have been characterized to confirm their capability for performing optical transmittance measurements. Measurements performed on SoG and PMMA lenses subject to a variety of indoor conditions (e.g., UV and damp heat) identified differences in the optical efficiency of the evaluated lenses, demonstrating the ability of the Scanning Lens Instrument (SLI) to distinguish between the aged lenses.

  13. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær

    2012-01-01

    was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...

  14. A high excitation magnetic quadrupole lens quadruplet incorporating a single octupole lens for a low spherical aberration probe forming lens system

    Science.gov (United States)

    Dou, Yanxin; Jamieson, David N.; Liu, Jianli; Li, Liyi

    2018-03-01

    This paper describes the design of a new probe forming lens system consisting of a high excitation magnetic quadrupole lens quadruplet that incorporates a single magnetic octupole lens. This system achieves both a high demagnification and a low spherical aberration compared to conventional high excitation systems and is intended for deployment for the Harbin 300 MeV proton microprobe for applications in space science and ion beam therapy. This relative simplicity of the ion optical design to include a single octupole lens minimizes the risks associated with the constructional and operational precision usually needed for the probe forming lens system and this system could also be deployed in microprobe systems that operate with less magnetically rigid ions. The design of the new system is validated with reference to two independent ion optical computer codes.

  15. The neutron silicon lens. An update of the thermal neutron lens results

    International Nuclear Information System (INIS)

    Johnson, M.W.; Daymond, M.R.

    2001-01-01

    This paper introduces the concept of the Neutron Silicon Lens (NSL) and provides and update on the experimental results achieved to date. The NSL design is a cylindrical neutron lens based on the use of multiple neutron mirrors supported and separated by silicon wafers. Such lenses would have many applications in both the primary and scattered beams on neutron instruments, and would lead to immediate improvements where the sample to be illuminated is small, as in high pressure or engineering strain scanning instruments. (author)

  16. Forensic Analysis of a Contact Lens in a Murder Case.

    Science.gov (United States)

    Zwerling, Charles S

    2016-03-01

    Contact lenses have had rare relevance in trials and/or investigations. After 5 years of burial, orbital remnants were retrieved from an exhumed body and subsequently identified as a key piece of material evidence in a murder trial. The exhumed case materials were evaluated under laboratory conditions and were determined to be contact lens remnants. Contact lens fracture and burial simulation studies were performed to provide additional corroboration of the physical findings of the exhumed contact lens remnants. This material evidence was instrumental in providing factual proof refuting the defendant's testimony in the murder trial. A brief history of contact lens composition and use is provided for understanding the methods and observational results. This forensic case study represents the first published documentation of a contact lens from an exhumed body being used in a murder investigation and establishes an operational procedure for future forensic contact lens examinations. © 2016 American Academy of Forensic Sciences.

  17. Development of a hardware-based AC microgrid for AC stability assessment

    Science.gov (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  18. Lens regeneration in mice under the influence of vitamin A

    Indian Academy of Sciences (India)

    The effect of vitamin A has been studied on lens regeneration in young (7 days old) as well as adult mice. A longitudinal slit was made under local anesthesia in the cornea over the lens. The lens was extracted intact through the incision. Intraperitonial injection of vitamin A (0.05 ml of 30 IU/ml in young and 0.05 ml of 50 ...

  19. Subcontact Lens Bubble Formation under Low Atmospheric Pressure Conditions.

    Science.gov (United States)

    1986-08-01

    of subcontact lens bubble formation under scleral lenses at altitudes greater than 18,000 ft. Later, after many advances in contact lens fitting and...Reported here are the results of contact lens bubble studies with soft hydrophilic nd rigid gas-permeable lenses . Testing was accomplished in simulated...ccurred at altitudes greater than 20,000 ft. For soft contact lenses , bubble formation was etected in 22 of 92 eyes tested, and occurred at altitudes

  20. Analysis of phakic before intraocular lens implantation for fundus examination

    OpenAIRE

    Juan Chen; Zhong-Ping Chen; Rui-Ling Zhu

    2014-01-01

    AIM:To investigate the findings of the eyes which were examined preoperatively by three mirror contact lens before the implantation of implantable collamer lens(ICL). To analysis the retinal pathological changes and to explore the clinical analysis of early diagnosis and treatment in retinopathy on fundus examination before operation. METHODS:The retrospective case series study included 127 eyes of 64 patients who underwent phakic intraocular lens implantation were received the fundus examina...

  1. Haemophilus influenzae corneal ulcer in a therapeutic contact lens wearer.

    OpenAIRE

    Armstrong, J. R.; Cohen, K. L.; McCarthy, L. R.

    1984-01-01

    Haemophilus influenzae is an unusual corneal pathogen and an unusual cause of corneal ulcers in Western society. In previous reports corneal complications from H. influenzae have been secondary to a conjunctivitis. The first case of a primary H. influenzae corneal ulcer as a complication of therapeutic contact lens wear is presented. Since other uncommon bacteria have been reported as causes of contact lens related corneal ulcers, the bacteriology of contact lens related corneal ulcers is rev...

  2. Disposable contact lenses vs. contact lens maintenance for extended wear.

    Science.gov (United States)

    Josephson, J E; Caffery, B E; Campbell, I; Slomovic, A R

    1990-01-01

    We compared a disposable extended wear contact lens modality with conventional extended wear over a 6-week period. To do so, we refit 31 patients who had successfully worn conventional extended wear contact lenses for more than 1 year. One eye was fit with the AcuvueR disposable contact lens, and a new extended wear lens of the type the patient had been wearing was placed on the other eye. At weekly intervals the disposable lens was discarded and a new disposable lens inserted. At the same time, the conventional lens on the fellow eye was cleaned, disinfected, and reinserted. After 6 weeks the ocular response, subjective impressions, and condition of the lenses in the two eyes were compared. Both lenses were then cultured. Three subjects had to discontinue disposable lens wear because of adverse reactions to trapped cellular debris and corneal microcysts. Although the results were not statistically significant, the Acuvue lens appeared to perform better than or equal to the conventional lens in biomicroscopic observation, visual acuity measurement, and subjective patient preference. Eighty-seven percent of patients preferred to continue with the disposable system. There were no differences found in the type or degree of microbial contamination of the lenses.

  3. Further studies of contact lens motion during blinking.

    Science.gov (United States)

    Conway, H D; Knoll, H A

    1986-10-01

    Contact lens motion is felt to be of increasing importance in connection with debris elimination, particularly in extended wear lenses. Thus an improved analysis is made of a simple model for investigating the initial motion of a hard contact lens over the eye during blinking. It is shown that the assumption of constant tear film thickness is a reasonable one. This greatly simplifies the analysis. Various vertical force vs. time variations are considered and lens velocity/time graphs and maximum lens displacement calculated. These are in good agreement with the results of experiment.

  4. Geometry-invariant gradient refractive index lens: analytical ray tracing.

    Science.gov (United States)

    Bahrami, Mehdi; Goncharov, Alexander V

    2012-05-01

    A new class of gradient refractive index (GRIN) lens is introduced and analyzed. The interior iso-indicial contours mimic the external shape of the lens, which leads to an invariant geometry of the GRIN structure. The lens model employs a conventional surface representation using a coincoid of revolution with a higher-order aspheric term. This model has a unique feature, namely, it allows analytical paraxial ray tracing. The height and the angle of an arbitrary incident ray can be found inside the lens in a closed-form expression, which is used to calculate the main optical characteristics of the lens, including the optical power and third-order monochromatic aberration coefficients. Moreover, due to strong coupling of the external surface shape to the GRIN structure, the proposed GRIN lens is well suited for studying accommodation mechanism in the eye. To show the power of the model, several examples are given emphasizing the usefulness of the analytical solution. The presented geometry-invariant GRIN lens can be used for modeling and reconstructing the crystalline lens of the human eye and other types of eyes featuring a GRIN lens.

  5. Particle swarm optimization applied to automatic lens design

    Science.gov (United States)

    Qin, Hua

    2011-06-01

    This paper describes a novel application of Particle Swarm Optimization (PSO) technique to lens design. A mathematical model is constructed, and merit functions in an optical system are employed as fitness functions, which combined radiuses of curvature, thicknesses among lens surfaces and refractive indices regarding an optical system. By using this function, the aberration correction is carried out. A design example using PSO is given. Results show that PSO as optical design tools is practical and powerful, and this method is no longer dependent on the lens initial structure and can arbitrarily create search ranges of structural parameters of a lens system, which is an important step towards automatic design with artificial intelligence.

  6. [Phacoemulsification of subluxated lens with capsular tension ring implantation].

    Science.gov (United States)

    Dorecka, Mariola; Rokicki, Wojciech; Nita, Malgorzata; Krysik, Katarzyna; Nita, Ewa; Sikorska, Aleksandra; Romaniuk, Wanda

    2007-01-01

    To evaluate long term results of phacoemulsification with PC IOL and capsular tension ring (CTR) implantation in lens subluxation. The study comprised of 134 patients--146 eyes with subluxated lens. In all cases phacoemulsification with PC IOL and CTR implantation was performed. No intaroperative complications has occured. Postoperative complications included: inflammation in the anterior chamber in 3 eyes (2.1%), retinal detachment in 2 eyes (1.4%). In all cases there was no PC IOL decentration. (1) CTR facilitates phacoemulsification with PC IOL implantation in lens subluxation. (2) Phacoemulsification of subluxated lens with PC IOL and CTR implantation seems to be safe and effective procedure.

  7. Acoustic Luneburg lens using orifice-type metamaterial unit cells

    Science.gov (United States)

    Park, Choon Mahn; Lee, Sang Hun

    2018-02-01

    A two-dimensional acoustic Luneburg lens that can be easily expanded into a three-dimensional sphere is fabricated. The required spatial distribution of the refractive index for this Luneburg lens is realized using the characteristics of orifice-type metamaterial unit cells. Typical characteristics of the resulting acoustic Luneburg lens, such as its aberration-free performance and capability for antipodal focusing of the lens for the incident plane waves, are investigated through experiments and simulations with the attenuation loss at frequencies that satisfy the homogeneous medium condition of the metamaterial. With the designed metamaterial, we achieved the minimum spot that lies within the classical diffraction limit at the focal point.

  8. MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-03-01

    Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes

  9. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  10. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  11. GRID-CONNECTECD DOUBLE-STAGE AC-AC POWER CONVERTER FOR CSP RENEWABLE ENERGY SYSTEMS

    OpenAIRE

    Sorrentino, Vincenzo

    2015-01-01

    In the last years the renewable energy sources have known a state of their advanced diffusion considering their advantages compared to the traditional energy sources like fossil fuels. For this reason the combined heat and power (CHP) plant fueled by renewable sources are widely used. The purpose of this Ph.D. thesis is the design of a new Grid-connected Double-Stage AC-DC/DC-AC Power Converter (DSACPC) for a Concentrating Solar plant for Combined generation of Heat and Power (CS-CHP), th...

  12. Comportamento Acústico de Fachadas: Isolamento Acústico versus Permeabilidade ao Ar

    OpenAIRE

    Ferreira, Diogo Miguel do Rosário

    2016-01-01

    Nos dias de hoje, o conforto acústico dos edifícios revela-se como um factor muito importante no contexto da comodidade global dos seus habitantes. Para tanto, contribui de forma relevante o isolamento sonoro que as fachadas dos edifícios possam assegurar. Sendo as fachadas constituídas por uma parte opaca e uma outra translúcida, é esta última a que mais condiciona o isolamento acústico que o elemento fachada proporciona, o qual é influenciado tanto pela janela propriamente dita, como pelas ...

  13. Spontaneous dislocation of lens bag with acrylic lens after uneventful cataract surgery ? unusual complication of cataract surgery

    OpenAIRE

    Shah, Mehul A.; Shah, Shreya M.; Mehta, Ruchir; Shah, Prerna

    2015-01-01

    Introduction: Spontaneous dislocation of intraocular lens with bag is rare.Methods: We report a case of a 56-year-old male who presented with spontaneous anterior dislocation of an in-the-bag intraocular lens 3 years after manual small incision cataract surgery. He had undergone manual small incision cataract surgery with foldable acrylic intraocular lens implantation, and 18 months after cataract surgery ND: YAG capsulotomy with uneventful post capsulotomy follow-up. 17 months after capsul...

  14. LENS - the Low-Energy Neutrino Spectrometer

    International Nuclear Information System (INIS)

    Hahn, Richard L.

    2004-01-01

    Despite the recent successes of SNO and KamLAND, the only detectors sensitive to <1 MeV-neutrinos have been the radiochemical chlorine and gallium solar neutrino experiments. LENS is being developed to measure in real time the charge-current fluxes and energy spectra of the lowest energy solar neutrinos, from the pp and 7Be branches (91% and 7% of solar neutrinos). The detector medium will be a metal-loaded liquid scintillator (M-LS), with indium as the metal, which serves as the target for neutrino capture in the LS. 115In has 95.71% natural abundance and a 114.2-keV neutrino-capture Q-value. Neutrino capture in 115In produces a β particle and preferentially feeds an excited state of 115Sn that de-excites by delayed emission of two γ rays. This triple-coincidence 'tag' in time and space in principle is a very powerful tool to discriminate neutrino-capture events from backgrounds. The International LENS R and D Collaboration is working to develop an In-LS neutrino detector, with special properties, such as high indium content, high light yield, high optical transparency, long-term chemical stability, and good signal-to-background ratio. Success in preparing the In-LS has been achieved via the synthesis of In-carboxylates that are soluble in pseudocumene LS (note that these methods may also be applicable to the preparation of Gd-LS for reactor antineutrino experiments). Testing of some prototype LENS In-LS detector modules has begun recently at the Gran Sasso Laboratory

  15. [Corneal protection in contact lens users].

    Science.gov (United States)

    Egorova, G B; Mitichkina, T S; Shamsudinova, A R

    2014-01-01

    To evaluate the efficacy of corneoprotective agents (Corneregel and Solcoseryl) in contact lens users. A total of 66 long-term contact lens wearers with dry eye symptoms and varying degrees of corneal epitheliopathy were monitored. All patients used artificial tears, which, however, were not effective enough to suppress manifestations of corneal epitheliopathy and to release the associated discomfort. The therapy was supplemented with Corneregel. The following examination methods were applied: biomicroscopy with fluorescent staining, Norn test, Schirmer's test, advanced tearscopy with digital image analysis of the precorneal tear film lipid layer, corneal confocal microscopy. In all cases the assessment was performed prior to starting Corneregel and repeated in 7 days, 14 days and 1 month. Complete corneal re-epithelization and restoration of the most superficial layer of the epithelium were achieved within 7-14 days. In case of severe initial epitheliopathy the effect of Corneregel was not sufficient and epithelium defects remained. These patients additionally received Solcoseryl Eye Gel. After the treatment course the condition of corneal epithelium ameliorated and contact lens wearing comfort increased. A longer precorneal tear film break-up time indicated an increase of tear film stability. The total tear production did not change significantly. The moistening effect of Corneregel and low-viscosity artificial tears together with intensive regeneration of corneal epithelium enables structural recovery of the epithelial membrane and considerable improvement of the anterior corneal stroma. At the first stage of corneoprotective treatment it is appropriate to use preservative-free artificial tears of low and high viscosity. If the effect of tear substitutive therapy is unsatisfactory it is recommended to prescribe Corneregel and Solcoseryl. The regimen is to be adjusted individually.

  16. Annual Site Environmental Report Prepared for the Department of Energy,under contract number DE-AC03-76SF00515 January - December 2001

    International Nuclear Information System (INIS)

    Russak, Hillary M.

    2003-01-01

    This report provides information about environmental programs during 2001 at the Stanford Linear Accelerator Center (SLAC). Also included are seasonal activities that cross calendar-year divisions. Production of the annual site environmental report (ASER) is a requirement established by the US Department of Energy (DOE) for all management and operating (M and O) contractors throughout the DOE complex. SLAC is federally-funded, research development center with Stanford University as the M and O contractor. The most noteworthy information in this report is summarized in this section. This summary demonstrates the effective application of SLAC environmental management in meeting the site's Integrated Safety Management System (ISMS) goals. For normal daily activities, all SLAC managers and supervisors are responsible for ensuring that proper procedures are followed to meet the ISMS goals: Worker safety and health are protected; The environment is protected; and Compliance is assured. Throughout 2001, SLAC focused on these activities through the SLAC management systems. These systems were also the ways SLAC approached implementing the ''Greening of the Government'' initiatives (such as Executive Order 13148). The management systems at SLAC are effective, supporting compliance with all relevant statutory and regulatory requirements. SLAC did not receive any notices of violation during 2001. In addition, many improvements were continued during 2001, including improvements in the storm drain system, improved ground water monitoring capabilities, and enhancements to the system to manage the generation of mixed wastes. Environmental program-specific summary details are shown below

  17. Annual Site Environmental Report Prepared for the Department of Energy,under contract number DE-AC03-76SF00515 January - December 2001

    Energy Technology Data Exchange (ETDEWEB)

    Russak, Hillary M.

    2003-05-06

    This report provides information about environmental programs during 2001 at the Stanford Linear Accelerator Center (SLAC). Also included are seasonal activities that cross calendar-year divisions. Production of the annual site environmental report (ASER) is a requirement established by the US Department of Energy (DOE) for all management and operating (M&O) contractors throughout the DOE complex. SLAC is federally-funded, research development center with Stanford University as the M and O contractor. The most noteworthy information in this report is summarized in this section. This summary demonstrates the effective application of SLAC environmental management in meeting the site's Integrated Safety Management System (ISMS) goals. For normal daily activities, all SLAC managers and supervisors are responsible for ensuring that proper procedures are followed to meet the ISMS goals: Worker safety and health are protected; The environment is protected; and Compliance is assured. Throughout 2001, SLAC focused on these activities through the SLAC management systems. These systems were also the ways SLAC approached implementing the ''Greening of the Government'' initiatives (such as Executive Order 13148). The management systems at SLAC are effective, supporting compliance with all relevant statutory and regulatory requirements. SLAC did not receive any notices of violation during 2001. In addition, many improvements were continued during 2001, including improvements in the storm drain system, improved ground water monitoring capabilities, and enhancements to the system to manage the generation of mixed wastes. Environmental program-specific summary details are shown below.

  18. Lentil (Lens culinaris) Lipid Transfer Protein Len c 3: A Novel Legume Allergen

    NARCIS (Netherlands)

    Akkerdaas, J.; Finkina, E. I.; Balandin, S. V.; Santos Magadán, S.; Knulst, A.; Fernandez-Rivas, M.; Asero, R.; van Ree, R.; Ovchinnikova, T. V.

    2012-01-01

    Background: Lentils are increasingly consumed in many parts of the world. Two allergens, Len c 1 and 2, have been reported previously. Recently, peanut and green bean lipid transfer proteins (LTPs) have been identified as the first two members of an important group of allergens that might be

  19. Abnormal lens morphogenesis and ectopic lens formation in the absence of beta-catenin function

    Czech Academy of Sciences Publication Activity Database

    Krešlová, Jana; Machoň, Ondřej; Růžičková, Jana; Láchová, Jitka; Wawrousek, E.F.; Kemler, R.; Krauss, S.; Piatigorsky, J.; Kozmik, Zbyněk

    2007-01-01

    Roč. 45, č. 4 (2007), s. 157-168 ISSN 1526-954X R&D Projects: GA ČR GA204/04/1358 Institutional research plan: CEZ:AV0Z50520514 Keywords : Wnt * beta-catenin * gene * lens Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.516, year: 2007

  20. SLAH1, a homologue of the slow type anion channel SLAC1, modulates shoot Cl − accumulation and salt tolerance in Arabidopsis thaliana

    KAUST Repository

    Qiu, Jiaen

    2016-06-23

    Salinity tolerance is correlated with shoot chloride (Cl–) exclusion in multiple crops, but the molecular mechanisms of long-distance Cl– transport are poorly defined. Here, we characterize the in planta role of AtSLAH1 (a homologue of the slow type anion channel-associated 1 (SLAC1)). This protein, localized to the plasma membrane of root stelar cells, has its expression reduced by salt or ABA, which are key predictions for a protein involved with loading Cl– into the root xylem. Artificial microRNA knockdown mutants of AtSLAH1 had significantly reduced shoot Cl− accumulation when grown under low Cl–, whereas shoot Cl– increased and the shoot nitrate/chloride ratio decreased following AtSLAH1 constitutive or stelar-specific overexpression when grown in high Cl–. In both sets of overexpression lines a significant reduction in shoot biomass over the null segregants was observed under high Cl– supply, but not low Cl– supply. Further in planta data showed AtSLAH3 overexpression increased the shoot nitrate/chloride ratio, consistent with AtSLAH3 favouring nitrate transport. Heterologous expression of AtSLAH1 in Xenopus laevis oocytes led to no detectible transport, suggesting the need for post-translational modifications for AtSLAH1 to be active. Our in planta data are consistent with AtSLAH1 having a role in controlling root-to-shoot Cl– transport.

  1. Magnetic system of the Tevatron electron lens

    International Nuclear Information System (INIS)

    Bogdanov, I.; Kozub, S.; Pleskach, V.; Sytnik, V.; Tkachenko, L.; Zintchenko, S.; Zubko, V.; Kuznetsov, G.; Sery, A.; Shiltsev, V.

    2000-01-01

    The Tevatron Electron Lens (TEL) system consisting of seven SC and four conventional magnets has been developed and fabricated in IHEP for increase of luminosity in Tevatron. The SC cable tension and preload of SC coils are calculated. The chosen cable design and cooling of the SC magnets ensure sufficient temperature margin for operating of SC magnets and their safety during quench. The system of conventional and SC solenoids create necessary trajectory of magnetic field lines for the TEL electron beam motion. SC dipoles and warm correctors permit to carry out correction of the electron beam motion [ru

  2. Septic lens implantation syndrome in a cat.

    Science.gov (United States)

    Dalesandro, Nicole; Stiles, Jean; Miller, Margaret

    2011-09-01

    A 13-year-old female spayed domestic shorthair cat was presented initially for a change in the appearance of the left eye. On initial examination, a small penetrating wound was suspected as the cause for a corneal scar, an anterior cortical incipient cataract and mild iritis. The cat was not re-presented until 1 year later at which time ocular pain was marked. Severe anterior uveitis and glaucoma were diagnosed and the eye enucleated. Histopathology documented intralenticular coccoid bacteria and septic lens implantation syndrome. © 2011 American College of Veterinary Ophthalmologists.

  3. [Contact lens-associated Paecilomyces lilacinus keratitis].

    Science.gov (United States)

    Mihailovic, N; Alnawaiseh, M; Zumhagen, L; Eter, N

    2017-01-01

    We present the case of a 23-year-old otherwise healthy female patient with contact lens-associated Paecilomyces lilacinus keratitis. The clinical findings stabilized after initial local antimycotic and antibacterial treatment; however, in the further course of local therapy an extensive relapse occurred which required treatment by perforating keratoplasty à chaud due to a penetrating corneal ulcer. The patient responded well to subsequent treatment with systemic and local antimycotic medication. After a few months HLA-matched keratoplasty was performed. During the follow-up time of 14 months there were no signs of recurrence of the infection.

  4. Scleral lens for keratoconus: technology update

    OpenAIRE

    Rathi, Varsha; Taneja,Mukesh; Mandathara,Preeji; Sangwan,Virender; Dumpati,Srikanth

    2015-01-01

    Varsha M Rathi,1 Preeji S Mandathara,2 Mukesh Taneja,1 Srikanth Dumpati,1 Virender S Sangwan1 1L V Prasad Eye Institute, Hyderabad, India; 2School of Optometry and Vision Science, University of New South Wales, Kensington, NSW, Australia Abstract: Scleral lenses are large diameter lenses which rest over the sclera, unlike the conventional contact lenses which rest on the cornea. These lenses are fitted to not touch the cornea and there is a space created between the cornea and the lens. Th...

  5. Scientific performance assessments through a gender lens

    DEFF Research Database (Denmark)

    Nielsen, Mathias Wullum

    2018-01-01

    The focus on excellence and quality assurance in the academy has spawned a signifi cant increase in the use of bibliometric measures in performance assessments of individual researchers. This article investigates the organizational consequences of this development through a gender lens. Based....... They adhere to the prevailing ethos of the academic meritocracy by standardizing the criteria for organizational advancement and ensuring transparency and accountability in the selection process. While bibliometric tools in this sense may lead to the recruitment of scientists with a strong CV and track record...

  6. Polarization response of RHIC electron lens lattices

    Directory of Open Access Journals (Sweden)

    V. H. Ranjbar

    2016-10-01

    Full Text Available Depolarization response for a system of two orthogonal snakes at irrational tunes is studied in depth using lattice independent spin integration. In particular we consider the effect of overlapping spin resonances in this system, to understand the impact of phase, tune, relative location and threshold strengths of the spin resonances. These results are benchmarked and compared to two dimensional direct tracking results for the RHIC e-lens lattice and the standard lattice. Finally we consider the effect of longitudinal motion via chromatic scans using direct six dimensional lattice tracking.

  7. Candidate gravitational microlensing events for future direct lens imaging

    Energy Technology Data Exchange (ETDEWEB)

    Henderson, C. B.; Gould, A.; Gaudi, B. S. [Department of Astronomy, The Ohio State University, 140 West 18th Avenue, Columbus, OH 43210 (United States); Park, H.; Han, C. [Department of Physics, Institute for Astrophysics, Chungbuk National University, Cheongju 371-763 (Korea, Republic of); Sumi, T.; Koshimoto, N. [Department of Earth and Space Science, Osaka University, Osaka 560-0043 (Japan); Udalski, A. [Warsaw University Observatory, Al. Ujazdowskie 4, 00-478 Warszawa (Poland); Tsapras, Y. [Las Cumbres Observatory Global Telescope Network, 6740 Cortona Drive, Suite 102, Goleta, CA 93117 (United States); Bozza, V. [Department of Physics, University of Salerno, I-84084 Fisciano (Italy); Abe, F.; Fukunaga, D.; Itow, Y.; Masuda, K. [Solar-Terrestrial Environment Laboratory, Nagoya University, Nagoya 464-8601 (Japan); Bennett, D. P. [Department of Physics, University of Notre Dame, 225 Nieuwland Science Hall, Notre Dame, IN 46556-5670 (United States); Bond, I. A.; Ling, C. H. [Institute of Information and Mathematical Sciences, Massey University, Private Bag 102-904, North Shore Mail Centre, Auckland 0745 (New Zealand); Botzler, C. S.; Freeman, M. [Department of Physics, University of Auckland, Private Bag 92-019, Auckland 1001 (New Zealand); Fukui, A. [School of Chemical and Physical Sciences, Victoria University, Wellington 6140 (New Zealand); Collaboration: MOA Collaboration; OGLE Collaboration; μFUN Collaboration; RoboNet Collaboration; and others

    2014-10-10

    The mass of the lenses giving rise to Galactic microlensing events can be constrained by measuring the relative lens-source proper motion and lens flux. The flux of the lens can be separated from that of the source, companions to the source, and unrelated nearby stars with high-resolution images taken when the lens and source are spatially resolved. For typical ground-based adaptive optics (AO) or space-based observations, this requires either inordinately long time baselines or high relative proper motions. We provide a list of microlensing events toward the Galactic bulge with high relative lens-source proper motion that are therefore good candidates for constraining the lens mass with future high-resolution imaging. We investigate all events from 2004 to 2013 that display detectable finite-source effects, a feature that allows us to measure the proper motion. In total, we present 20 events with μ ≳ 8 mas yr{sup –1}. Of these, 14 were culled from previous analyses while 6 are new, including OGLE-2004-BLG-368, MOA-2005-BLG-36, OGLE-2012-BLG-0211, OGLE-2012-BLG-0456, MOA-2012-BLG-532, and MOA-2013-BLG-029. In ≲12 yr from the time of each event the lens and source of each event will be sufficiently separated for ground-based telescopes with AO systems or space telescopes to resolve each component and further characterize the lens system. Furthermore, for the most recent events, comparison of the lens flux estimates from images taken immediately to those estimated from images taken when the lens and source are resolved can be used to empirically check the robustness of the single-epoch method currently being used to estimate lens masses for many events.

  8. International survey of contact lens prescribing for extended wear.

    Science.gov (United States)

    Efron, Nathan; Morgan, Philip B; Woods, Craig A

    2012-02-01

    To determine the extent of extended wear (EW) contact lens prescribing worldwide and to characterize the associated demographics and fitting patterns. Up to 1000 survey forms were sent to contact lens fitters in up to 39 countries between January and March every year for five consecutive years (2006-2010). Practitioners were asked to record data relating to the first 10 contact lens fits or refits performed after receiving the survey form. Survey data collected since 1997 was also analyzed to assess EW fitting trends since that time. Details for lens modality were received for 107,094 rigid and soft lens fits of which 88,392 were for soft lens daily wear (DW) and 7470 were for soft lens EW. Overall, EW represents 7.8% of all soft lens fits, ranging from 0.6% in Malaysia to 27% Norway. Compared with DW fittings, EW fittings can be characterized as follows: older age (32.7 ± 13.6 vs. 29.4 ± 12.0 years for DW); males are over-represented; greater proportion of refits; 72% silicone hydrogel; higher proportion of presbyopia and spherical designs; and higher proportion of monthly lens replacement. Of those wearing EW lenses, 80% use multipurpose solutions, whereas 9% do not use any care system. Between 1997 and 1999, the rate of EW prescribing decreased from 5 to 1% of all soft lens fits; it increased to a peak of 12% in 2006, and settled back to 8% by 2010. EW prescribing has failed to break through the "glass ceiling" of 15% and is unlikely to become a mainstream lens wearing modality until the already low risks of ocular complications can be reduced to be equivalent to that for DW.

  9. Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious

    International Nuclear Information System (INIS)

    Fang Minggang; Nie, Yingchao; Theilmann, David A.

    2009-01-01

    Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.

  10. Modeling and reliability analysis of three phase z-source AC-AC converter

    Directory of Open Access Journals (Sweden)

    Prasad Hanuman

    2017-12-01

    Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.

  11. Dose limits to the eye lens

    Energy Technology Data Exchange (ETDEWEB)

    Sion, N.

    2016-09-15

    Protecting the human body from the effects of ionizing radiation is essential to forestall stochastic effects and require placing limits on the effective dose. Dose limits on specific organs are also necessary to reduce the deterministic effects and tissue reactions. The standard for radiation protection was ISO 15382 (2002) which mainly dealt with beta radiation for nuclear power plant workers. Clearly an update is required to allow for new technology and the proliferative use of radiation in medical practices. There is a need for more explicit radiation monitoring to operators and staff. ICRP118 (International Commission on Radiological Protection), Ref. 1, evolved their recommendations to include eye lens doses as a follow on to their publication 103 and to focus on radiation exposures. It provides updated estimates of 'practical' threshold doses for tissue injury at the level of 1% incidence. This paper discusses the current status and the recommendation for a drastic reduction of the dose limit to the eye lens. (author)

  12. Scleral lens for keratoconus: technology update

    Directory of Open Access Journals (Sweden)

    Rathi VM

    2015-10-01

    Full Text Available Varsha M Rathi,1 Preeji S Mandathara,2 Mukesh Taneja,1 Srikanth Dumpati,1 Virender S Sangwan1 1L V Prasad Eye Institute, Hyderabad, India; 2School of Optometry and Vision Science, University of New South Wales, Kensington, NSW, Australia Abstract: Scleral lenses are large diameter lenses which rest over the sclera, unlike the conventional contact lenses which rest on the cornea. These lenses are fitted to not touch the cornea and there is a space created between the cornea and the lens. These lenses are inserted in the eyes after filling with sterile isotonic fluid. Generally, scleral contact lenses are used for high irregular astigmatism as seen in various corneal ectatic diseases such as keratoconus, pellucid marginal degeneration, or/and as liquid bandage in ocular surface disorders. In this article, we review the new developments, that have taken place over the years, in the field of scleral contact lenses as regard to new designs, materials, manufacturing technologies, and fitting strategies particularly for keratoconus. Keywords: keratoconus, scleral lens, technology update, PROSE

  13. Curiosity's Mars Hand Lens Imager (MAHLI) Investigation

    Science.gov (United States)

    Edgett, Kenneth S.; Yingst, R. Aileen; Ravine, Michael A.; Caplinger, Michael A.; Maki, Justin N.; Ghaemi, F. Tony; Schaffner, Jacob A.; Bell, James F.; Edwards, Laurence J.; Herkenhoff, Kenneth E.; Heydari, Ezat; Kah, Linda C.; Lemmon, Mark T.; Minitti, Michelle E.; Olson, Timothy S.; Parker, Timothy J.; Rowland, Scott K.; Schieber, Juergen; Sullivan, Robert J.; Sumner, Dawn Y.; Thomas, Peter C.; Jensen, Elsa H.; Simmonds, John J.; Sengstacken, Aaron J.; Wilson, Reg G.; Goetz, Walter

    2012-01-01

    The Mars Science Laboratory (MSL) Mars Hand Lens Imager (MAHLI) investigation will use a 2-megapixel color camera with a focusable macro lens aboard the rover, Curiosity, to investigate the stratigraphy and grain-scale texture, structure, mineralogy, and morphology of geologic materials in northwestern Gale crater. Of particular interest is the stratigraphic record of a ?5 km thick layered rock sequence exposed on the slopes of Aeolis Mons (also known as Mount Sharp). The instrument consists of three parts, a camera head mounted on the turret at the end of a robotic arm, an electronics and data storage assembly located inside the rover body, and a calibration target mounted on the robotic arm shoulder azimuth actuator housing. MAHLI can acquire in-focus images at working distances from ?2.1 cm to infinity. At the minimum working distance, image pixel scale is ?14 μm per pixel and very coarse silt grains can be resolved. At the working distance of the Mars Exploration Rover Microscopic Imager cameras aboard Spirit and Opportunity, MAHLI?s resolution is comparable at ?30 μm per pixel. Onboard capabilities include autofocus, auto-exposure, sub-framing, video imaging, Bayer pattern color interpolation, lossy and lossless compression, focus merging of up to 8 focus stack images, white light and longwave ultraviolet (365 nm) illumination of nearby subjects, and 8 gigabytes of non-volatile memory data storage.

  14. An adjustable electron achromat for cathode lens microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Tromp, R.M., E-mail: rtromp@us.ibm.com [IBM T.J. Watson Research Center, 1101 Kitchawan Road, Yorktown Heights, NY 10598 (United States); Leiden Institute of Physics, Kamerlingh Onnes Laboratory, Niels Bohrweg 2, 2333 CA Leiden (Netherlands)

    2015-12-15

    Chromatic aberration correction in light optics began with the invention of a two-color-corrected achromatic crown/flint lens doublet by Chester Moore Hall in 1730. Such color correction is necessary because any single glass shows dispersion (i.e. its index of refraction changes with wavelength), which can be counteracted by combining different glasses with different dispersions. In cathode lens microscopes (such as Photo Electron Emission Microscopy – PEEM) we encounter a similar situation, where the chromatic aberration coefficient of the cathode lens shows strong dispersion, i.e. depends (non-linearly) on the energy with which the electrons leave the sample. Here I show how a cathode lens in combination with an electron mirror can be configured as an adjustable electron achromat. The lens/mirror combination can be corrected at two electron energies by balancing the settings of the electron mirror against the settings of the cathode lens. The achromat can be adjusted to deliver optimum performance, depending on the requirements of a specific experiment. Going beyond the achromat, an apochromat would improve resolution and transmission by a very significant margin. I discuss the requirements and outlook for such a system, which for now remains a wish waiting for fulfilment. - Highlights: • The properties of cathode objective lens plus electron mirror are discussed. • In analogy with light-optical achromats, cathode lens plus mirror can be configured as an electron achromat. • Unlike light optics, the electron achromat can be adjusted to best fulfill experimental requirements.

  15. Near UV radiation effect on the lens and retina

    International Nuclear Information System (INIS)

    Zigman, S.

    1987-01-01

    The discussion presented in this paper indicates that the retina of a diurnal animal with a natural UV-absorbing lens (ie: the gray squirrel) is susceptible to near-UV damage from environmental sources only after the lens has been removed. This suggests that it is very important to protect against near-UV exposure of human eyes after cataract surgery

  16. Introduction to designing information and organizations with a positive lens

    NARCIS (Netherlands)

    Avital, M.; Boland, R.J.; Lyytinen, K.

    2009-01-01

    The role and potential contribution of a positive lens to the design of systems and organizations is the focus of this introductory essay. The positive lens refers to a perspective in the social sciences that emphasizes the capacity of people and organizations to construct better work environments,

  17. Isofocusing and immunological investigations on cephalopod lens proteins

    NARCIS (Netherlands)

    Brahma, S.K.; Lancieri, M.

    1979-01-01

    Soluble lens proteins from Octopus vulgaris, Sepia officinalis, and Loligo vulgaris were analyzed by thin-layer isoelectric focusing and compared by various immunochemical methods using antibodies directed against total soluble lens protein antigens from the said three species. The results show

  18. RETINAL BREAKS IN VITRECTOMY FOR RETAINED LENS FRAGMENTS

    NARCIS (Netherlands)

    Tan, H. Stevie; Mura, Marco; Oberstein, Sarit Y. Lesnik; Bijl, Heico M.

    2012-01-01

    Purpose: To describe the incidence and outcome of retinal breaks in vitrectomy for retained lens fragments. Methods: This is a retrospective noncomparative interventional case series. Medical records of consecutive cases of vitrectomy for retained lens fragments over a period of 4 years were

  19. The NNEST lens non native english speakers in TESOL

    CERN Document Server

    Mahboob, Ahmar

    2010-01-01

    The NNEST Lens invites you to imagine how the field of TESOL and applied linguistics can develop if we use the multilingual, multicultural, and multinational perspectives of an NNEST lens to re-examine our assumptions, practices, and theories in the field

  20. The "Youth Lens": Analyzing Adolescence/ts in Literary Texts

    Science.gov (United States)

    Petrone, Robert; Sarigianides, Sophia Tatiana; Lewis, Mark A.

    2014-01-01

    Drawing from interdisciplinary scholarship that re-conceptualizes adolescence as a cultural construct, this article introduces a "Youth Lens." A "Youth Lens" comprises an approach to textual analysis that examines how ideas about adolescence and youth get formed, circulated, critiqued, and revised. Focused specifically on its…

  1. Optimized lens-sparing treatment of retinoblastoma with electron beams

    NARCIS (Netherlands)

    Steenbakkers, RJHM; Altschuler, MD; DAngio, GJ; Goldwein, JW; Kassaee, A

    1997-01-01

    Purpose: The ideal lens-sparing radiotherapy technique for retinoblastoma calls for 100% dose to the entire retina including the ora serrata and zero dose to the lens, Published techniques, most of which use photons, have not accomplished this ideal treatment. We describe here a technique that

  2. A Broadband Metasurface-Based Terahertz Flat-Lens Array

    KAUST Repository

    Wang, Qiu

    2015-02-12

    A metasurface-based terahertz flat-lens array is proposed, comprising C-shaped split-ring resonators exhibiting locally engineerable phase discontinuities. Possessing a high numerical aperture, the planar lens array is flexible, robust, and shows excellent focusing characteristics in a broadband terahertz frequency. It could be an important step towards the development of planar terahertz focusing devices for practical applications.

  3. Prevalence of corneal ulcer among contact lens wearers in Nigeria ...

    African Journals Online (AJOL)

    Corneal Ulceration has been described as the most serious complication of contact lens wear worldwide. The incidence of corneal ulceration in contact lens wearers in Nigeria was determined retrospectively. 1759 case notes of patients who had worn contact lenses for at least one year were obtained from eye clinics in ...

  4. Incidence of contact lens-associated microbial keratitis

    NARCIS (Netherlands)

    Cheng, K.H.; Leung, S.L.; Hoekman, J.W.; Beekhuis, W.H.; Mulder, P.G.H.; Geerards, A.J.M.; Kijlstra, A.

    1999-01-01

    Background. The incidence of contact-lens-associated microbial keratitis is uncertain and its related morbidity in the general population of contact-lens wearers is not known. We examined these issues in a prospective epidemiological study. Methods. We surveyed all practising ophthalmologists in the

  5. Patient acceptability of the Tecnis® multifocal intraocular lens

    Directory of Open Access Journals (Sweden)

    Sood P

    2011-03-01

    Full Text Available Priyanka Sood1, Maria A Woodward21Emory Eye Center, Atlanta, GA, USA; 2Kellogg Eye Center, Ann Arbor, MI, USAAbstract: Cataract surgery has evolved. The goal of the surgeon includes both restoration of vision and refinement of vision. Patients' desire for spectacle independence has driven the market for presbyopia-correcting cataract surgery and development of novel intraocular lens (IOL designs. The Tecnis® Multifocal Intraocular Lens incorporates an aspheric, modified anterior prolate IOL with a diffractive multifocal lens design. The design aims to minimize spherical aberration and improve range of focus. The purpose of this review is to assess patient acceptability of the Tecnis® multifocal intraocular lens.Keywords: Tecnis®, intraocular lens, multifocal, presbyopia 

  6. Composite modified Luneburg model of human eye lens.

    Science.gov (United States)

    Gómez-Correa, J E; Balderas-Mata, S E; Pierscionek, B K; Chávez-Cerda, S

    2015-09-01

    A new lens model based on the gradient-index Luneburg lens and composed of two oblate half spheroids of different curvatures is presented. The spherically symmetric Luneburg lens is modified to create continuous isoindicial contours and to incorporate curvatures that are similar to those found in a human lens. The imaging capabilities of the model and the changes in the gradient index profile are tested for five object distances, for a fixed geometry and for a fixed image distance. The central refractive index decreases with decreasing object distance. This indicates that in order to focus at the same image distance as is required in the eye, a decrease in refractive power is needed for rays from closer objects that meet the lens surface at steeper angles compared to rays from more distant objects. This ensures a highly focused image with no spherical aberration.

  7. Design of LED projector based on gradient-index lens

    Science.gov (United States)

    Qian, Liyong; Zhu, Xiangbing; Cui, Haitian; Wang, Yuanhang

    2018-01-01

    In this study, a new type of projector light path is designed to eliminate the deficits of existing projection systems, such as complex structure and low collection efficiency. Using a three-color LED array as the lighting source, by means of the special optical properties of a gradient-index lens, the complex structure of the traditional projector is simplified. Traditional components, such as the color wheel, relay lens, and mirror, become unnecessary. In this way, traditional problems, such as low utilization of light energy and loss of light energy, are solved. With the help of Zemax software, the projection lens is optimized. The optimized projection lens, LED, gradient-index lens, and digital micromirror device are imported into Tracepro. The ray tracing results show that both the utilization of light energy and the uniformity are improved significantly.

  8. Planar optical correlators integrated with binary optical lens.

    Science.gov (United States)

    Xu, Ping; Hong, Chunquan; Cheng, Guanxiao; Zhou, Liang; Sun, Zhilong

    2015-03-09

    Planar optical correlators (POCs) can achieve smaller volume of optical system and hence have important applications to identify dynamic targets in complex scenarios. POCs, however, generally have serious astigmatism and optical efficiency loss introduced by its refractive lens with a zigzag optical beam. To conquer the disadvantages of POCs, we propose a type of binary optical planar-integrated optical correlator. The correlator incorporates two pieces of reflective binary optical lens as Fourier transform lens and one spatial light modulator as a programmable filter. The off-axis aberrations commonly occurred in POCs can be corrected by using reflective binary optical lens instead of refractive lens. As a model of hybrid numerical-optical correlator using optoelectronic interface, the proposal is helpful to improve the integration and flexibility and robustness of POCs.

  9. Dielectrically embedded flat mesh lens for millimeter waves applications.

    Science.gov (United States)

    Pisano, Giampaolo; Ng, Ming Wah; Ozturk, Fahri; Maffei, Bruno; Haynes, Vic

    2013-04-10

    A flat lens based on subwavelength periodic metal meshes has been developed using photolithographic techniques. These mesh grids are stacked at specific distances and embedded in polypropylene. A code was developed to optimize more than 1000 transmission line circuits required to vary the device phase shift across the lens flat surface, mimicking the behavior of a classical lens. A W-band mesh-lens prototype was successfully manufactured and its RF performance characterized using a vector network analyzer coupled to corrugated horn antennas. Co-polarization far-field beam patterns were measured and compared with finite-element method models. The excellent agreement between data and simulations validated our designing tools and manufacturing procedures. This mesh lens is a low-loss, robust, light, and compact device that has many potential applications including millimeter wave quasi-optical systems for future cosmic microwave background polarization instruments.

  10. Fuzzy efficiency optimization of AC induction motors

    Science.gov (United States)

    Jani, Yashvant; Sousa, Gilberto; Turner, Wayne; Spiegel, Ron; Chappell, Jeff

    1993-01-01

    This paper describes the early states of work to implement a fuzzy logic controller to optimize the efficiency of AC induction motor/adjustable speed drive (ASD) systems running at less than optimal speed and torque conditions. In this paper, the process by which the membership functions of the controller were tuned is discussed and a controller which operates on frequency as well as voltage is proposed. The membership functions for this dual-variable controller are sketched. Additional topics include an approach for fuzzy logic to motor current control which can be used with vector-controlled drives. Incorporation of a fuzzy controller as an application-specific integrated circuit (ASIC) microchip is planned.

  11. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    ) levels are still not seen as possibility, the future expansion of transmission grids are dependent on new solutions with lessened environment impact, especially with regard to the visual impact. In the present Thesis, composite materials and composite based overhead line components are presented...... and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...... impact are analysed with regard to their visual impact reducing design steps. These are used to form the basis for overhead line system design ideas, which are analysed with regard to application of composite materials and components. Composite materials and components, when applied in EHV systems...

  12. Calibration free method for measurement of the AC magnetization loss

    Energy Technology Data Exchange (ETDEWEB)

    Souc, Jan [Institute of Electrical Engineering, Slovak Academy of Sciences, Dubravska cesta 9, 842 39 Bratislava (Slovakia); Goemoery, Fedor [Institute of Electrical Engineering, Slovak Academy of Sciences, Dubravska cesta 9, 842 39 Bratislava (Slovakia); Vojenciak, Michal [Department of Power Electrical Systems, University of Zilina, Vel' ky diel, 010 26 Zilina (Slovakia)

    2005-05-01

    A calibration free measurement method for determination of the magnetization loss of superconducting samples exposed to the external AC magnetic field is presented. The idea is based on the measurement of the part of the power which is supplied by the AC source to the AC magnet generating the magnetic field, in which the sample is located. It uses a coil wound in parallel to the AC field magnet as the measurement coil. To achieve the necessary sensitivity, two identical systems are used, each consisting of an AC magnet and a measurement coil, one of them containing the sample and the other left empty. No measurement and/or calculation of the calibration constant is required. To confirm the suitability of this method, the loss of a Cu sample with known dissipation was measured. The applicability to the AC magnetization loss measurements of superconducting tapes is presented.

  13. Developing the Regulatory Utility of the Exposome: Mapping Exposures for Risk Assessment through Lifestage Exposome Snapshots (LEnS).

    Science.gov (United States)

    Shaffer, Rachel M; Smith, Marissa N; Faustman, Elaine M

    2017-08-07

    Exposome-related efforts aim to document the totality of human exposures across the lifecourse. This field has advanced rapidly in recent years but lacks practical application to risk assessment, particularly for children's health. Our objective was to apply the exposome to children's health risk assessment by introducing the concept of Lifestage Exposome Snapshots (LEnS). Case studies are presented to illustrate the value of the framework. The LEnS framework encourages organization of exposome studies based on windows of susceptibility for particular target organ systems. Such analyses will provide information regarding cumulative impacts during specific critical periods of the life course. A logical extension of this framework is that regulatory standards should analyze exposure information by target organ, rather than for a single chemical only or multiple chemicals grouped solely by mechanism of action. The LEnS concept is a practical refinement to the exposome that accounts for total exposures during particular windows of susceptibility in target organ systems. Application of the LEnS framework in risk assessment and regulation will improve protection of children's health by enhancing protection of sensitive developing organ systems that are critical for lifelong health and well-being. https://doi.org/10.1289/EHP1250.

  14. Force analysis of bacterial transmission from contact lens cases to corneas, with the contact lens as the intermediary

    NARCIS (Netherlands)

    Qu, Wen-wen; Hooymans, Johanna MM; de Vries, Jacob; van der Mei, Henderina; Busscher, Hendrik

    PURPOSE. To determine the probability of transmission of a Staphylococcus aureus strain from a contact lens case, to the contact lens (CL) surfaces, to the cornea, on the basis of bacterial adhesion forces measured by using atomic force microscopy (AFM). METHODS. Adhesion forces between S. aureus

  15. Bacterial transmission from lens storage cases to contact lenses - Effects of lens care solutions and silver impregnation of cases

    NARCIS (Netherlands)

    Vermeltfoort, Pit B. J.; Hooymans, Johanna M. M.; Busscher, Henk J.; van der Mei, Henny C.

    2008-01-01

    The killing efficacies of multipurpose lens care solutions on planktonic and biofilm bacteria grown in polypropylene contact lens storage cases with and without silver impregnation and effects on bacterial transmission from storage cases to silicone hydrogel contact lenses were investigated. For

  16. Design and analysis of an adaptive lens that mimics the performance of the crystalline lens in the human eye

    Science.gov (United States)

    Santiago-Alvarado, Agustin; Cruz-Félix, Angel S.; Iturbide-Jiménez, F.; Martínez-López, M.; Ramírez-Como, M.; Armengol-Cruz, V.; Vásquez-Báez, I.

    2014-09-01

    Tunable lenses are optical systems that have attracted much attention due to their potential applications in such areas like ophthalmology, machine vision, microscopy and laser processing. In recent years we have been working in the analysis and performance of a liquid-filled variable focal length lens, this is a lens that can modify its focal length by changing the amount of water within it. Nowadays we extend our study to a particular adaptive lens known as solid elastic lens (SEL) that it is formed by an elastic main body made of Polydimethylsiloxane (PDMS Sylgard 184). In this work, we present the design, simulation and analysis of an adaptive solid elastic lens that in principle imitates the accommodation process of the crystalline lens in the human eye. For this work, we have adopted the parameters of the schematic eye model developed in 1985 by Navarro et al.; this model represents the anatomy of the eye as close as possible to reality by predicting an acceptable and accurate quantity of spherical and chromatic aberrations without any shape fitting. An opto-mechanical analysis of the accommodation process of the adaptive lens is presented, by simulating a certain amount of radial force applied onto the SEL using the finite element method with the commercial software SolidWorks®. We also present ray-trace diagrams of the simulated compression process of the adaptive lens using the commercial software OSLO®.

  17. Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure

    Directory of Open Access Journals (Sweden)

    Evi Ploumpidou

    2017-12-01

    Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC

  18. Time lens assisted photonic sampling extraction

    Science.gov (United States)

    Petrillo, Keith Gordon

    Telecommunication bandwidth demands have dramatically increased in recent years due to Internet based services like cloud computing and storage, large file sharing, and video streaming. Additionally, sensing systems such as wideband radar, magnetic imaging resonance systems, and complex modulation formats to handle large data transfer in telecommunications require high speed, high resolution analog-to-digital converters (ADCs) to interpret the data. Accurately processing and acquiring the information at next generation data rates from these systems has become challenging for electronic systems. The largest contributors to the electronic bottleneck are bandwidth and timing jitter which limit speed and reduce accuracy. Optical systems have shown to have at least three orders of magnitude increase in bandwidth capabilities and state of the art mode locked lasers have reduced timing jitters into thousands of attoseconds. Such features have encouraged processing signals without the use of electronics or using photonics to assist electronics. All optical signal processing has allowed the processing of telecommunication line rates up to 1.28 Tb/s and high resolution analog-to-digital converters in the 10s of gigahertz. The major drawback to these optical systems is the high cost of the components. The application of all optical processing techniques such as a time lens and chirped processing can greatly reduce bandwidth and cost requirements of optical serial to parallel converters and push photonically assisted ADCs into the 100s of gigahertz. In this dissertation, the building blocks to a high speed photonically assisted ADC are demonstrated, each providing benefits to its own respective application. A serial to parallel converter using a continuously operating time lens as an optical Fourier processor is demonstrated to fully convert a 160-Gb/s optical time division multiplexed signal to 16 10-Gb/s channels with error free operation. Using chirped processing, an

  19. TU-E-201-03: Eye Lens Dosimetry in Radiotherapy Using Contact Lens-Shaped Applicator

    Energy Technology Data Exchange (ETDEWEB)

    Park, J. [Seoul National University Hospital (Korea, Republic of)

    2015-06-15

    Madan M. Rehani, Massachusetts General Hospital and Harvard Medical School, Boston Methods for Eye Lens Dosimetry and Studies On Lens Opacities with Interventionalists Radiation induced cataract is a major threat among staff working in interventional suites. Nearly 16 million interventional procedures are performed annually in USA. Recent studies by the principal investigator’s group, primarily among interventional cardiologists, on behalf of the International Atomic Energy Agency, show posterior subcapsular (PSC) changes in the eye lens in 38–53% of main operators and 21–45% of support staff. These changes have potential to lead to cataract in future years, as per information from A-Bomb survivors. The International Commission on Radiological Protection has reduced dose limit for staff by a factor of 7.5 (from 150 mSv/y to 20 mSv/y). With increasing emphasis on radiation induced cataracts and reduction in threshold dose for eye lens, there is a need to implement strategies for estimating eye lens dose. Unfortunately eye lens dosimetry is at infancy when it comes to routine application. Various approaches are being tried namely direct measurement using active or passive dosimeters kept close to eyes, retrospective estimations and lastly correlating patient dose in interventional procedures with staff eye dose. The talk will review all approaches available and ongoing active research in this area, as well as data from surveys done in Europe on status of eye dose monitoring in interventional radiology and nuclear medicine. The talk will provide update on how good is Hp(10) against Hp(3), estimations from CTDI values, Monte Carlo based simulations and current status of eye lens dosimetry in USA and Europe. The cataract risk among patients is in CT examinations of the head. Since radiation induced cataract predominantly occurs in posterior sub-capsular (PSC) region and is thus distinguishable from age or drug related cataracts and is also preventable, actions on

  20. TU-E-201-01: Methods for Eye Lens Dosimetry and Studies On Lens Opacities with Interventionists

    Energy Technology Data Exchange (ETDEWEB)

    Rehani, M. [Massachusetts General Hospital (United States)

    2015-06-15

    Madan M. Rehani, Massachusetts General Hospital and Harvard Medical School, Boston Methods for Eye Lens Dosimetry and Studies On Lens Opacities with Interventionalists Radiation induced cataract is a major threat among staff working in interventional suites. Nearly 16 million interventional procedures are performed annually in USA. Recent studies by the principal investigator’s group, primarily among interventional cardiologists, on behalf of the International Atomic Energy Agency, show posterior subcapsular (PSC) changes in the eye lens in 38–53% of main operators and 21–45% of support staff. These changes have potential to lead to cataract in future years, as per information from A-Bomb survivors. The International Commission on Radiological Protection has reduced dose limit for staff by a factor of 7.5 (from 150 mSv/y to 20 mSv/y). With increasing emphasis on radiation induced cataracts and reduction in threshold dose for eye lens, there is a need to implement strategies for estimating eye lens dose. Unfortunately eye lens dosimetry is at infancy when it comes to routine application. Various approaches are being tried namely direct measurement using active or passive dosimeters kept close to eyes, retrospective estimations and lastly correlating patient dose in interventional procedures with staff eye dose. The talk will review all approaches available and ongoing active research in this area, as well as data from surveys done in Europe on status of eye dose monitoring in interventional radiology and nuclear medicine. The talk will provide update on how good is Hp(10) against Hp(3), estimations from CTDI values, Monte Carlo based simulations and current status of eye lens dosimetry in USA and Europe. The cataract risk among patients is in CT examinations of the head. Since radiation induced cataract predominantly occurs in posterior sub-capsular (PSC) region and is thus distinguishable from age or drug related cataracts and is also preventable, actions on

  1. [Intraocular lens implantation with one loop haptic amputated: a new propose to the subluxation lens surgical treatment].

    Science.gov (United States)

    Ventura, Marcelo; Endriss, Daniela

    2010-01-01

    To evaluate the postoperative results of congenital lens subluxation corrected by a new technique. Retrospective chart review of 21 eyes of 13 patients with no traumatic lens subluxation who underwent surgery in Altino Ventura Foundation from April, 1999 to April, 2004. The mean age was 8.7 +/- 5.4 years old, and the mean follow-up period was 21.5 +/- 19.3 months. Patients underwent phacoaspiration, endocapsular ring and intraocular lens (IOL) implantation. The implanted IOL had one loop haptic excised and was supported above the ring, inside the capsular bag promoting intraocular lens centralization. Visual acuity improvement was observed in all cases. There was a significant reduction of the spherical equivalent and spherical component comparing the pre and postoperative refraction (psubluxation surgical treatment, promoting lens centralization and postoperative visual acuity improvement.

  2. Control of high-frequency AC link electronic transformer

    OpenAIRE

    Krishnaswami, H; Ramanarayanan, V

    2005-01-01

    An isolated high-frequency link AC/AC converter is termed an electronic transformer.The electronic transformer has size and cost advantages over a conventional transformer because of high-frequency operation of the magnetic core. Of the various topologies of electronic transformer, the high-frequency AC link electronic transformer achieves high-frequency AC power transformation without a DC link. The circuit uses the standard H-bridge, one on either side of the high-frequency transformer. A n...

  3. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  4. AC Own Motion Percentage of Randomly Sampled Cases

    Data.gov (United States)

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  5. Perubahan Sosial Berbasis Tasawuf: Studi Kasus Fethullah Gülen Dan Gülen Movement

    Directory of Open Access Journals (Sweden)

    Sulaiman Sulaiman

    2016-06-01

    Full Text Available Abstract: This article aims at analyzing Fethullah Gülen and the Gülen Movement which have succeeded in performing social change based on the teaching of Sufism. He did Sufism creativity in order that Sufism teaching was able to respond the changes that occur in the modernlife. He believed that, only by reinterpretation and contextualization of Sufism, the spiritual dimension of Islam would be able to perform the transformation or social change among the Muslims. Therefore, by using Max Weber’s theory of social action, this paper will analyze three key teachings of Sufism of Gülen: ascetic (zuhd, inbisat (expansion, and hizmet. Based on the Weber's theory, Gülen occupied a very central and authoritative position: agent/actor, action and meaning. As a source of meaning and interpreter of meaning, the key concepts of Sufism were transformed by Gülen to the internal and external communities so that they had made a move to do social movements and humanity. For the followers of Gülen, the movement was called the Gülen Movement or the Hizmet Movement which was engaged in the fields of education, health care, humanitarian assistance, and the mass media. All forms of movement were entirely based on the spiritual values of Islam that had been formulated by Gülen. الملخص: يهدف هذا البحث إلى تحليل شخصية فتح الله غولن وحركته الذي تمكن من القيام بالتغيير الاجتماعي على أساس التعاليم الصوفية. إن فتح الله غولن قام بإحياء التصوف في صورته الجدّية والحيوية في حياة الإنسان المعاصر. ويعتقد أن إعادة التفسير لتعاليم التصوف مع مراعاة الواقع قادرة على التغيير الاجتماعي بين المسلمين. من أجل ذلك، أن استخدام نظرية ويبر، يمكن تحليل تعاليم التصوف الثلاثة

  6. High gradient lens for charged particle beam

    Science.gov (United States)

    Chen, Yu-Jiuan

    2014-04-29

    Methods and devices enable shaping of a charged particle beam. A dynamically adjustable electric lens includes a series of alternating a series of alternating layers of insulators and conductors with a hollow center. The series of alternating layers when stacked together form a high gradient insulator (HGI) tube to allow propagation of the charged particle beam through the hollow center of the HGI tube. A plurality of transmission lines are connected to a plurality of sections of the HGI tube, and one or more voltage sources are provided to supply an adjustable voltage value to each transmission line of the plurality of transmission lines. By changing the voltage values supplied to each section of the HGI tube, any desired electric field can be established across the HGI tube. This way various functionalities including focusing, defocusing, acceleration, deceleration, intensity modulation and others can be effectuated on a time varying basis.

  7. Accuracy of fish-eye lens models.

    Science.gov (United States)

    Hughes, Ciarán; Denny, Patrick; Jones, Edward; Glavin, Martin

    2010-06-10

    The majority of computer vision applications assumes that the camera adheres to the pinhole camera model. However, most optical systems will introduce undesirable effects. By far, the most evident of these effects is radial lensing, which is particularly noticeable in fish-eye camera systems, where the effect is relatively extreme. Several authors have developed models of fish-eye lenses that can be used to describe the fish-eye displacement. Our aim is to evaluate the accuracy of several of these models. Thus, we present a method by which the lens curve of a fish-eye camera can be extracted using well-founded assumptions and perspective methods. Several of the models from the literature are examined against this empirically derived curve.

  8. Scleral lens for keratoconus: technology update

    Science.gov (United States)

    Rathi, Varsha M; Mandathara, Preeji S; Taneja, Mukesh; Dumpati, Srikanth; Sangwan, Virender S

    2015-01-01

    Scleral lenses are large diameter lenses which rest over the sclera, unlike the conventional contact lenses which rest on the cornea. These lenses are fitted to not touch the cornea and there is a space created between the cornea and the lens. These lenses are inserted in the eyes after filling with sterile isotonic fluid. Generally, scleral contact lenses are used for high irregular astigmatism as seen in various corneal ectatic diseases such as keratoconus, pellucid marginal degeneration, or/and as liquid bandage in ocular surface disorders. In this article, we review the new developments, that have taken place over the years, in the field of scleral contact lenses as regard to new designs, materials, manufacturing technologies, and fitting strategies particularly for keratoconus. PMID:26604671

  9. Hyperbolic metamaterial lens with hydrodynamic nonlocal response

    DEFF Research Database (Denmark)

    Yan, Wei; Mortensen, N. Asger; Wubs, Martijn

    2013-01-01

    We investigate the effects of hydrodynamic nonlocal response in hyperbolic metamaterials (HMMs), focusing on the experimentally realizable parameter regime where unit cells are much smaller than an optical wavelength but much larger than the wavelengths of the longitudinal pressure waves of the f......We investigate the effects of hydrodynamic nonlocal response in hyperbolic metamaterials (HMMs), focusing on the experimentally realizable parameter regime where unit cells are much smaller than an optical wavelength but much larger than the wavelengths of the longitudinal pressure waves...... in the local-response approximation and in the hydrodynamic Drude model can differ considerably. In particular, the optimal frequency for imaging in the nonlocal theory is blueshifted with respect to that in the local theory. Thus, to detect whether nonlocal response is at work in a hyperbolic metamaterial, we...... propose to measure the near-field distribution of a hyperbolic metamaterial lens....

  10. CERN through the lens of Peter Ginter

    CERN Multimedia

    2008-01-01

    This summer, passers-by along the Quai Wilson on the banks of Lake Geneva will be able to enjoy an unusual exhibition of photographs devoted to CERN and the LHC. Fifty images from the work of Peter Ginter, organized into themes, give strollers on the Quai Wilson a glimpse of the unique human and scientific adventure at CERN. An exhibition panel, showing a scientist against the background of ALICE’s huge red electromagnet.CERN will reach an important milestone in 2008 with the start-up of the LHC, opening a new window on our Universe for physicists around the world. To celebrate this event with the people who live around Lake Geneva and visitors to the area, CERN and the city of Geneva are jointly putting on the photography exhibition "CERN through the lens of Peter Ginter", which opens on 29 May. A group of some fifty images taken by the German photo...

  11. Hospitality as lens for migration studies

    DEFF Research Database (Denmark)

    Greve, Anni

    there are limits to its financial resources. What is more, the focus on claim-making and extended rights of the migrant produces a tendency for the language and practice of hospitality to ‘turn’ against the guest today, and notably the construction of the figure of guests who not only fail to fulfil their duties...... (welfare ‘parasites’) but even betray the host. Next, an enquiry of the concept of hospitality as possible lens for migration studies; it implies a twofold analyses with two levels, a macro level, to focus our attention to the modalities of hospitality given by the juridical status of the stranger and its...... influence on civil inclusion (Sassen 2007; Brenner 2011); and a meso level, to focus instead upon hospitality as an inter-subjective relationship between the host and the guest as a way to relate, as an experience and as an ethics (Derrida 2001). Finally the paper gives a short introduction into an on...

  12. Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

    Science.gov (United States)

    Reitan, D. K.

    1973-01-01

    Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

  13. Contrast sensitivity after refractive lens exchange with a multifocal diffractive aspheric intraocular lens

    Directory of Open Access Journals (Sweden)

    Teresa Ferrer-Blasco

    2013-04-01

    Full Text Available PURPOSE: To evaluate distance and near contrast sensitivity (CS under photopic and mesopic conditions before and after refractive lens exchange (RLE and implantation of the aspheric AcrySof®ReSTOR® (SN6AD3 model intraocular lens (IOL. METHODS:Seventy-four eyes of 37 patients after RLE underwent bilateral implantation with the aspheric AcrySof ReSTOR IOL. The patient sample was divided into myopic and hyperopic groups. Monocular uncorrected visual acuity at distance and near (UCVA and UCNVA, respectively and monocular best corrected visual acuity at distance and near (BCVA and BCNVA, respectively were measured before and 6 months postoperatively. Monocular CS function was measured at three different luminance levels (85, 5 and 2.5 cd/m² before and after RLE. Post-implantation results at 6 months were compared with those found before surgery. RESULTS: Our results revealed that patients in both groups obtained good UCVA and BCVA after RLE at distance and near vision in relation to pre-surgery values. No statistically significant differences were found between the values of CS pre and post-RLE at distance and near, at any lighting condition and spatial frequency (p>0.002. CONCLUSIONS: Refractive lens exchange with aspheric AcrySof ReSTOR IOL in myopic and hyperopic population provided good visual function and yield good distance and near CS under photopic and mesopic conditions.

  14. Aspherical Lens Design Using Genetic Algorithm for Reducing Aberrations in Multifocal Artificial Intraocular Lens

    Directory of Open Access Journals (Sweden)

    Chih-Ta Yen

    2015-09-01

    Full Text Available A complex intraocular lens (IOL design involving numerous uncertain variables is proposed. We integrated a genetic algorithm (GA with the commercial optical design software of (CODE V to design a multifocal IOL for the human eye. We mainly used an aspherical lens in the initial state to the crystalline type; therefore, we used the internal human eye model in the software. The proposed optimized algorithm employs a GA method for optimally simulating the focusing function of the human eye; in this method, the thickness and curvature of the anterior lens and the posterior part of the IOL were varied. A comparison of the proposed GA-designed IOLs and those designed using a CODE V built-in optimal algorithm for 550 degrees myopia and 175 degrees astigmatism conditions of the human eye for pupil size 6 mm showed that the proposed IOL design improved the spot size of root mean square (RMS, tangential coma (TCO and modulation transfer function (MTF at a spatial frequency of 30 with a pupil size of 6 mm by approximately 17%, 43% and 35%, respectively. However, the worst performance of spherical aberration (SA was lower than 46%, because the optical design involves a tradeoff between all aberrations. Compared with the traditional CODE V built-in optimal scheme, the proposed IOL design can efficiently improve the critical parameters, namely TCO, RMS, and MTF.

  15. Lens dislocation has a possible relationship with laser iridotomy

    Directory of Open Access Journals (Sweden)

    Mutoh T

    2012-12-01

    Full Text Available Tetsuya Mutoh,1,2 Kevin F Barrette,2 Yukihiro Matsumoto,1 Makoto Chikuda11Department of Ophthalmology, Dokkyo Medical University Koshigaya Hospital, Koshigaya City, Saitama, Japan; 2Department of Ophthalmology, Boston University School of Medicine, Boston, MA, USAAbstract: We report our recent experience of four eyes with spontaneous lens dislocation in four patients with no history of trauma or any systemic disease associated with zonular dialysis. Lens dislocation developed with 0.5 to 6 months following laser iridotomy. All patients were male and two eyes were complicated with acute primary angle closure glaucoma preoperatively. Case 1 showed bilateral lens dislocation, while cases 2 and 3 involved unilateral lens dislocation. Cases 2 and 3 showed lenses completely dislocated into the vitreous cavity. All cases needed lens removal and scleral fixation of intraocular lenses. Final visual acuity was 1.2 in all cases. We suspect that laser iridotomy may induce localized zonular dialysis that results in progressive zonular weakness, leading to lens dislocation.Keywords: lens dislocation, laser iridotomy, primary angle closure glaucoma

  16. c-Myc regulates cell proliferation during lens development.

    Directory of Open Access Journals (Sweden)

    Gabriel R Cavalheiro

    Full Text Available Myc protooncogenes play important roles in the regulation of cell proliferation, growth, differentiation and survival during development. In various developing organs, c-myc has been shown to control the expression of cell cycle regulators and its misregulated expression is detected in many human tumors. Here, we show that c-myc gene (Myc is highly expressed in developing mouse lens. Targeted deletion of c-myc gene from head surface ectoderm dramatically impaired ocular organogenesis, resulting in severe microphtalmia, defective anterior segment development, formation of a lens stalk and/or aphakia. In particular, lenses lacking c-myc presented thinner epithelial cell layer and growth impairment that was detectable soon after its inactivation. Defective development of c-myc-null lens was not caused by increased cell death of lens progenitor cells. Instead, c-myc loss reduced cell proliferation, what was associated with an ectopic expression of Prox1 and p27(Kip1 proteins within epithelial cells. Interestingly, a sharp decrease in the expression of the forkhead box transcription factor Foxe3 was also observed following c-myc inactivation. These data represent the first description of the physiological roles played by a Myc family member in mouse lens development. Our findings support the conclusion that c-myc regulates the proliferation of lens epithelial cells in vivo and may, directly or indirectly, modulate the expression of classical cell cycle regulators in developing mouse lens.

  17. Surgical effect of traumatic lens dislocation with secondary glaucoma

    Directory of Open Access Journals (Sweden)

    Xiao-Dan Zhang

    2014-10-01

    Full Text Available AIM: To retrospectively evaluate the effect of lens extraction combined with vitrectomy to treat traumatic lens dislocation with secondary glaucoma.METHODS:Thirty-one eyes(31 casesof lens dislocation caused by blunt trauma with secondary glaucoma were treated respectively with cataract extraction combined with anterior vitrectomy, trabeculectomy and intraocular lens implantation. The visual acuity and pressure were observed 1wk, 1 and 3mo after operative. RESULTS:Thirty-one eyes were all complete the operation successfully, and 6 eyes were given combined trabeculectomy, 9 eyes were implanted anterior chamber intraocular lens implantation(IOLand 15 eyes were given posterior chamber suture fixation. Sixteen eyes were implanted in one-stage operation, while 8 eyes were implanted in two-stage operation. All intraocular pressure(IOPwere controlled to the normal level after operation and 23 eyes had visual acuity of more than 0.3.CONCLUSION:Lens extraction combined with vitrectomy is an effective method for treatment of lens dislocation with secondary glaucoma. In order to control the IOP and get well visual function, we should choose IOL implantation or trabeculectomy according to the patient's condition.

  18. Hyperelastic modelling of the crystalline lens: Accommodation and presbyopia

    Science.gov (United States)

    Lanchares, Elena; Navarro, Rafael; Calvo, Begoña

    2012-01-01

    Purpose The modification of the mechanical properties of the human crystalline lens with age can be a major cause of presbyopia. Since these properties cannot be measured in vivo, numerical simulation can be used to estimate them. We propose an inverse method to determine age-dependent change in the material properties of the tissues composing the human crystalline lens. Methods A finite element model of a 30-year-old lens in the accommodated state was developed. The force necessary to achieve full accommodation in a 30-year-old lens of known external geometry was computed using this model. Two additional numerical models of the lens corresponding to the ages of 40 and 50 years were then built. Assuming that the accommodative force applied to the lens remains constant with age, the material properties of nucleus and cortex were estimated by inverse analysis. Results The zonular force necessary to reshape the model of a 30-year-old lens from the accommodated to the unaccommodated geometry was 0.078 newton (N). Both nucleus and cortex became stiffer with age. The stiffness of the nucleus increased with age at a higher rate than the cortex. Conclusions In agreement with the classical theory of Helmholtz, on which we based our model, our results indicate that a major cause of presbyopia is that both nucleus and cortex become stiffer with age; therefore, a constant value of the zonular forces with aging does not achieve full accommodation, that is, the accommodation capability decreases.

  19. Effects of x-irradiation on lens reducing systems. [Rabbits

    Energy Technology Data Exchange (ETDEWEB)

    Giblin, F.J.; Chakrapani, B.; Reddy, V.N.

    1978-01-01

    Studies have been made of the effects of x ray on various lens reducing systems including the levels of NADPH and glutathione (GSH), the activity of the hexose monophosphate shunt (HMS), and the activities of certain enzymes including glutathion reductase, glutathione peroxidase, and glucose-6-phosphate dehydrogenase (G-6-PD). It was found that during several weeks following x irradiation but prior to cataract formation there was very little change in the number of reduced -SH groups per unit weight of lens protein but that, with the appearance of cataract, there was a sudden loss of protein -SH groups. In contrast, the concentration of GSH in the x-rayed lens decreased throughout the experimental period. Similarly, the concentration of NADPH in the x-rayed lens was found to decrease significantly relative to controls one week prior to cataract formation and the ratio of NADPH to NADP/sup +/ in the lens shifted at this time period from a value greater than 1.0 in the control lens to less than 1.0 in the x-rayed lens. A corresponding decrease occurred in the activity of the HMS in x-rayed lenses as measured by culture in the presence of 1-/sup 14/C-labelled glucose. G-6-PD was partially inactivated in the x-rayed lens. Of the eight enzymes studied, G-6-PD appeared to be the most sensitive to x-irradiation. The data indicate that x-irradiation results in a steady decrease in the effectiveness of lens reducing systems and that, when these systems reach a critically low point, sudden oxidation of protein -SH groups and formation of high molecular weight protein aggregates may be initiated.

  20. Effects of x-irradiation on lens reducing systems

    International Nuclear Information System (INIS)

    Giblin, F.J.; Chakrapani, B.; Reddy, V.N.

    1978-01-01

    Studies have been made of the effects of x ray on various lens reducing systems including the levels of NADPH and glutathione (GSH), the activity of the hexose monophosphate shunt (HMS), and the activities of certain enzymes including glutathion reductase, glutathione peroxidase, and glucose-6-phosphate dehydrogenase (G-6-PD). It was found that during several weeks following x irradiation but prior to cataract formation there was very little change in the number of reduced -SH groups per unit weight of lens protein but that, with the appearance of cataract, there was a sudden loss of protein -SH groups. In contrast, the concentration of GSH in the x-rayed lens decreased throughout the experimental period. Similarly, the concentration of NADPH in the x-rayed lens was found to decrease significantly relative to controls one week prior to cataract formation and the ratio of NADPH to NADP + in the lens shifted at this time period from a value greater than 1.0 in the control lens to less than 1.0 in the x-rayed lens. A corresponding decrease occurred in the activity of the HMS in x-rayed lenses as measured by culture in the presence of 1- 14 C-labelled glucose. G-6-PD was partially inactivated in the x-rayed lens. Of the eight enzymes studied, G-6-PD appeared to be the most sensitive to x-irradiation. The data indicate that x-irradiation results in a steady decrease in the effectiveness of lens reducing systems and that, when these systems reach a critically low point, sudden oxidation of protein -SH groups and formation of high molecular weight protein aggregates may be initiated