WorldWideScience

Sample records for length decreased bp

  1. Decreased telomere length in children with cartilage-hair hypoplasia.

    Science.gov (United States)

    Kostjukovits, Svetlana; Degerman, Sofie; Pekkinen, Minna; Klemetti, Paula; Landfors, Mattias; Roos, Göran; Taskinen, Mervi; Mäkitie, Outi

    2017-05-01

    Cartilage-hair hypoplasia (CHH) is an autosomal recessive chondrodysplasia caused by RMRP (RNA component of mitochondrial RNA processing endoribonuclease) gene mutations. Manifestations include short stature, variable immunodeficiency, anaemia and increased risk of malignancies, all of which have been described also in telomere biology disorders. RMRP interacts with the telomerase RT (TERT) subunit, but the influence of RMRP mutations on telomere length is unknown. We measured relative telomere length (RTL) in patients with CHH, their first-degree relatives and healthy controls and correlated RTL with clinical and laboratory features. The study cohort included 48 patients with CHH with homozygous (n=36) or compound heterozygous RMRP mutations (median age 38.2 years, range 6.0-70.8 years), 86 relatives (74 with a heterozygous RMRP mutation) and 94 unrelated healthy controls. We extracted DNA from peripheral blood, sequenced the RMRP gene and measured RTL by qPCR. Compared with age-matched and sex-matched healthy controls, median RTL was significantly shorter in patients with CHH (n=40 pairs, 1.05 vs 1.21, p=0.017), but not in mutation carriers (n=48 pairs, 1.16 vs 1.10, p=0.224). RTL correlated significantly with age in RMRP mutation carriers (r=-0.482, pCHH had shorter telomeres than controls (median RTL 1.12 vs 1.26, p=0.008). In patients with CHH, RTL showed no correlation with genotype, clinical or laboratory characteristics. Telomere length was decreased in children with CHH. We found no correlation between RTL and clinical or laboratory parameters. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

  2. Musculoskeletal pain and posture decrease step length in young adults

    Directory of Open Access Journals (Sweden)

    Maria Regina Rachmawati

    2016-02-01

    Full Text Available Pain of the musculoskeletal system, especially low back pain, is one of the most frequent problems with a high risk of disability. The aim of this research study was to determine the existence of an association between low back pain on one hand,  posture and step length on the other. This cross-sectional study was conducted on 77 healthy young adult subjects. Step length was measured with the Biodex Gait Trainer 2 (230 VAC. The study results indicate that 62.3% of the young adult subjects had suffered from low back pain. There was no significant association between gender and pain. In male subjects no significant association was found between pain on one hand and mean difference in step length and posture on the other. However, in female subjects with abnormal posture, there was a highly significant difference in left step length between subjects with back pain and those without (p=0.007.  The results of a multiple regression analysis indicate that posture has the greatest influence on left step length (B=4.135; 95% Confidence Interval 0.292-7.977. It is recommended that in the examination of low back pain an assessment be made of posture, step length and difference in step lengths.

  3. Musculoskeletal pain and posture decrease step length in young adults

    Directory of Open Access Journals (Sweden)

    Maria Regina Rachmawati

    2009-08-01

    Full Text Available Pain of the musculoskeletal system, especially low back pain, is one of the most frequent problems with a high risk of disability. The aim of this research study was to determine the existence of an association between low back pain on one hand, posture and step length on the other. This cross-sectional study was conducted on 77 healthy young adult subjects. Step length was measured with the Biodex Gait Trainer 2 (230 VAC. The study results indicate that 62.3% of the young adult subjects had suffered from low back pain. There was no significant association between gender and pain. In male subjects no significant association was found between pain on one hand and mean difference in step length and posture on the other. However, in female subjects with abnormal posture, there was a highly significant difference in left step length between subjects with back pain and those without (p=0.007. The results of a multiple regression analysis indicate that posture has the greatest influence on left step length (B=4.135; 95% Confidence Interval 0.292-7.977. It is recommended that in the examination of low back pain an assessment be made of posture, step length and difference in step lengths.

  4. Does Reproductive Investment Decrease Telomere Length in Menidia menidia?

    Directory of Open Access Journals (Sweden)

    Jin Gao

    Full Text Available Given finite resources, intense investment in one life history trait is expected to reduce investment in others. Although telomere length appears to be strongly tied to age in many taxa, telomere maintenance requires energy. We therefore hypothesize that telomere maintenance may trade off against other life history characters. We used natural variation in laboratory populations of Atlantic silversides (Menidia menidia to study the relationship between growth, fecundity, life expectancy, and relative telomere length. In keeping with several other studies on fishes, we found no clear dependence of telomere length on age. However, we did find that more fecund fish tended to have both reduced life expectancy and shorter telomeres. This result is consistent with the hypothesis that there is a trade-off between telomere maintenance and reproductive output.

  5. Musculoskeletal pain and posture decrease step length in young adults

    OpenAIRE

    Maria Regina Rachmawati; Diana Samara; Purnamawati Tjhin; Magdalena Wartono; Yefta Bastian

    2016-01-01

    Pain of the musculoskeletal system, especially low back pain, is one of the most frequent problems with a high risk of disability. The aim of this research study was to determine the existence of an association between low back pain on one hand, posture and step length on the other. This cross-sectional study was conducted on 77 healthy young adult subjects. Step length was measured with the Biodex Gait Trainer 2 (230 VAC). The study results indicate that 62.3% of the young adult subjects ha...

  6. Does Limiting Oral Contrast Decrease Emergency Department Length of Stay?

    Directory of Open Access Journals (Sweden)

    Erik Barton

    2012-12-01

    Full Text Available Introduction: The purpose of this study was to examine the impact on emergency department (EDlength of stay (LOS of a new protocol for intravenous (IV-contrast only abdominal/pelvic computedtomography (ABCT compared to historical controls.Methods: This was a retrospective case-controlled study performed at a single academic medicalcenter. Patients ≥ 18 undergoing ABCT imaging for non-traumatic abdominal pain were included inthe study. We compared ED LOS between historical controls undergoing ABCT imaging with PO/IVcontrast and study patients undergoing an IV-contrast-only protocol. Imaging indications were thesame for both groups and included patients with clinical suspicion for appendicitis, diverticulitis, smallbowel obstruction, or perforation. We identified all patients from the hospital’s electronic storehouse(imaging code, ordering department, imaging times, and we abstracted ED LOS and dispositionfrom electronic medical records.Results: Two hundred and eleven patients who underwent PO/IV ABCT prep were compared to 184patients undergoing IV-contrast only ABCT prep. ED LOS was shorter for patients imaged with theIV-contrast only protocol (4:35 hrs vs. 6:39 hrs, p < 0.0001.Conclusion: Implementation of an IV-contrast only ABCT prep for select ED patients presentingfor evaluation of acute abdominal pain significantly decreased ED LOS.

  7. BAMBOO: Accelerating Closed Itemset Mining by Deeply Pushing the Length-Decreasing Support Constraint

    National Research Council Canada - National Science Library

    Wang, Jianyong; Karypis, George

    2003-01-01

    Previous study has shown that mining frequent patterns with length-decreasing support constraint is very helpful in removing some uninteresting patterns based on the observation that short patterns...

  8. Decreasing Emergency Department Walkout Rate and Boarding Hours by Improving Inpatient Length of Stay.

    Science.gov (United States)

    Artenstein, Andrew W; Rathlev, Niels K; Neal, Douglas; Townsend, Vernette; Vemula, Michael; Goldlust, Sheila; Schmidt, Joseph; Visintainer, Paul

    2017-10-01

    Patient progress, the movement of patients through a hospital system from admission to discharge, is a foundational component of operational effectiveness in healthcare institutions. Optimal patient progress is a key to delivering safe, high-quality and high-value clinical care. The Baystate Patient Progress Initiative (BPPI), a cross-disciplinary, multifaceted quality and process improvement project, was launched on March 1, 2014, with the primary goal of optimizing patient progress for adult patients. The BPPI was implemented at our system's tertiary care, academic medical center, a high-volume, high-acuity hospital that serves as a regional referral center for western Massachusetts. The BPPI was structured as a 24-month initiative with an oversight group that ensured collaborative goal alignment and communication of operational teams. It was organized to address critical aspects of a patient's progress through his hospital stay and to create additional inpatient capacity. The specific goal of the BPPI was to decrease length of stay (LOS) on the inpatient adult Hospital Medicine service by optimizing an interdisciplinary plan of care and promoting earlier departure of discharged patients. Concurrently, we measured the effects on emergency department (ED) boarding hours per patient and walkout rates. The BPPI engaged over 300 employed clinicians and non-clinicians in the work. We created increased inpatient capacity by implementing daily interdisciplinary bedside rounds to proactively address patient progress; during the 24 months, this resulted in a sustained rate of discharge orders written before noon of more than 50% and a decrease in inpatient LOS of 0.30 days (coefficient: -0.014, 95% CI [-0.023, -0.005] Pboarding hours per patient decreased by approximately 2.1 hours (coefficient: -0.09; 95% CI [-0.15, -0.02] P = 0.007). Concurrently, ED walkout rates decreased by nearly 32% to a monthly mean of 0.4 patients (coefficient: 0.4; 95% CI [-0.7, -0.1] P= 0

  9. Reduction in laboratory turnaround time decreases emergency room length of stay

    Directory of Open Access Journals (Sweden)

    Kaushik N

    2018-04-01

    Full Text Available Nitin Kaushik,1 Victor S Khangulov,2 Matthew O’Hara,2 Ramy Arnaout3,4 1Becton, Dickinson and Company, Franklin Lakes, NJ, USA; 2Department of Health Economics and Outcomes Research, Boston Strategic Partners, Inc., Boston, MA, USA; 3Department of Pathology, 4Division of Biomedical Informatics, Department of Medicine, Beth Israel Deaconess Medical Center, Boston, MA USA Objective: Laboratory tests are an important contributor to treatment decisions in the emergency department (ED. Rapid turnaround of laboratory tests can optimize ED throughout by reducing the length of stay (LOS and improving patient outcomes. Despite evidence supporting the effect of shorter turnaround time (TAT on LOS and outcomes, there is still a lack of large retrospective studies examining these associations. Here, we evaluated the effect of a reduction in laboratory TAT on ED LOS using retrospective analysis of Electronic Health Records (EHR. Materials and methods: Retrospective analysis of ED encounters from a large, US-based, de-identified EHR database and a separate analysis of ED encounters from the EHR of an ED at a top-tier tertiary care center were performed. Additionally, an efficiency model calculating the cumulative potential LOS time savings and resulting financial opportunity due to laboratory TAT reduction was created, assuming other factors affecting LOS are constant. Results: Multivariate regression analysis of patients from the multisite study showed that a 1-minute decrease in laboratory TAT was associated with 0.50 minutes of decrease in LOS. The single-site analysis confirmed our findings from the multisite analysis that a positive correlation between laboratory TAT and ED LOS exists in the ED population as a whole, as well as across different patient acuity levels. In addition, based on the calculations from the efficiency model, for a 5-, 10- and 15-minute TAT reduction, the single-site ED can potentially admit a total of 127, 256 and 386 additional

  10. Telemedicine Use Decreases Rural Emergency Department Length of Stay for Transferred North Dakota Trauma Patients.

    Science.gov (United States)

    Mohr, Nicholas M; Vakkalanka, J Priyanka; Harland, Karisa K; Bell, Amanda; Skow, Brian; Shane, Dan M; Ward, Marcia M

    2018-03-01

    Telemedicine has been proposed as one strategy to improve local trauma care and decrease disparities between rural and urban trauma outcomes. This study was conducted to describe the effect of telemedicine on management and clinical outcomes for trauma patients in North Dakota. Cohort study of adult (age ≥18 years) trauma patients treated in North Dakota Critical Access Hospital (CAH) Emergency Departments (EDs) from 2008 to 2014. Records were linked to a telemedicine network's call records, indicating whether telemedicine was available and/or used at the institution at the time of the care. Multivariable generalized estimating equations were developed to identify associations between telemedicine consultation and availability and outcomes such as transfer, timeliness of care, trauma imaging, and mortality. Of the 7,500 North Dakota trauma patients seen in CAH, telemedicine was consulted for 11% of patients in telemedicine-capable EDs and 4% of total trauma patients. Telemedicine utilization was independently associated with decreased initial ED length of stay (LOS) (30 min, 95% confidence interval [CI] 14-45 min) for transferred patients. Telemedicine availability was associated with an increase in the probability of interhospital transfer (adjusted odds ratio [aOR] 1.2, 95% CI 1.1-1.4). Telemedicine availability was associated with increased total ED LOS (15 min, 95% CI 10-21 min), and computed tomography scans (aOR 1.6, 95% CI 1.3-1.9). ED-based telemedicine consultation is requested for the most severely injured rural trauma patients. Telemedicine consultation was associated with more rapid interhospital transfer, and telemedicine availability is associated with increased radiography use and transfer. Future work should evaluate how telemedicine could target patients likely to benefit from telemedicine consultation.

  11. Molecular typing of Iranian mycobacteria isolates by polymerase chain reaction-restriction fragment length polymorphism analysis of 360-bp rpoB gene.

    Science.gov (United States)

    Hadifar, Shima; Moghim, Sharareh; Fazeli, Hossein; GhasemianSafaei, Hajieh; Havaei, Seyed Asghar; Farid, Fariba; Esfahani, Bahram Nasr

    2015-01-01

    Diagnosis and typing of Mycobacterium genus provides basic tools for investigating the epidemiology and pathogenesis of this group of bacteria. Polymerase chain reaction (PCR)-restriction fragment length polymorphism analysis (PRA) is an accurate method providing diagnosis and typing of species of mycobacteria. The present study is conducted by the purpose of determining restriction fragment profiles of common types of mycobacteria by PRA method of rpoB gene in this geographical region. Totally 60 clinical and environmental isolates from February to October, 2013 were collected and subcultured and identified by phenotypic methods. A 360 bp fragment of the rpoB gene amplified by PCR and products were digested by MspI and HaeIII enzymes. In the present study, of all mycobacteria isolates identified by PRA method, 13 isolates (21.66%) were Mycobacterium tuberculosis, 34 isolates (56.66%) were rapidly growing Nontuberculosis Mycobacteria (NTM) that including 26 clinical isolates (43.33%) and 8 environmental isolates (13.33%), 11 isolates (18.33%) were clinical slowly growing NTM. among the clinical NTM isolates, Mycobacterium fortuitum Type I with the frequency of 57.77% was the most prevalent type isolates. Furthermore, an unrecorded of the PRA pattern of Mycobacterium conceptionense (HeaIII: 120/90/80, MspI: 120/105/80) was found. This study demonstrated that the PRA method was high discriminatory power for identification and typing of mycobacteria species and was able to identify 96.6% of all isolates. Based on the result of this study, rpoB gene could be a potentially useful tool for identification and investigation of molecular epidemiology of mycobacterial species.

  12. Does the use of bedside pelvic ultrasound decrease length of stay in the emergency department?

    Science.gov (United States)

    Thamburaj, Ravi; Sivitz, Adam

    2013-01-01

    Diagnostic ultrasounds by emergency medicine (EM) and pediatric emergency medicine (PEM) physicians have increased because of ultrasonography training during residency and fellowship. The availability of ultrasound in radiology departments is limited or difficult to obtain especially during nighttime hours. Studies have shown that EM physicians can accurately perform goal-directed ultrasound after appropriate training. The goal of this study was to compare the length of stay for patients receiving an ultrasound to confirm intrauterine pregnancies. The hypothesis of this study is that a bedside ultrasound by a trained EM/PEM physician can reduce length of stay in the emergency department (ED) by 1 hour. This was a case cohort retrospective review for patients aged 13 to 21 years who received pelvic ultrasounds in the ED during 2007. Each patient was placed into 1 of 2 groups. Group 1 received bedside ultrasounds done by institutionally credentialed EM/PEM attending physicians. Group 2 received radiology department ultrasound only. Each group had subanalysis done including chief complaint, time of presentation, time to completion of ultrasound, length of stay, diagnosis, and disposition. Daytime was defined as presentation between 7 AM and 9 PM when radiology ultrasound technologists were routinely available. We studied 330 patients, with 244 patients (74%) in the bedside ultrasound group. The demographics of both groups showed no difference in age, presenting complaints, discharge diagnoses, and ultimate disposition. Group 1 had a significant reduction (P ultrasound compared with group 2 (mean, 82 minutes [range, 1-901 minutes] vs 149 minutes [range, 7-506 minutes]) and length of stay (142 [16-2268] vs. 230 [16-844]). Of those presenting during the day (66%), group 1 showed a significant reduction in length of stay (P ultrasound by trained EM/PEM physicians produced a significant reduction in length of stay in the ED, regardless of radiology ultrasound technologist

  13. Telomere length of circulating leukocytes is decreased in patients with chronic heart failure

    NARCIS (Netherlands)

    van der Harst, Pim; van der Steege, Gerrit; de Boer, Rudolf A.; Voors, Adriaan A.; Hall, Alistair S.; Mulder, Marcel J.; van Gilst, Wiek H.; van Veldhuisen, Dirk J.

    2007-01-01

    Objectives This study sought to test the hypothesis that patients with chronic heart failure (CHF) have shorter telonneres compared with age-balanced and gender-balanced healthy individuals. Background Telomere length is considered to be a marker of biological aging. Chronic heart failure might be

  14. Decrease in effective electron mobility in the channel of a metal-oxide-semiconductor transistor as the gate length is decreased

    International Nuclear Information System (INIS)

    Frantsuzov, A. A.; Boyarkina, N. I.; Popov, V. P.

    2008-01-01

    Effective electron mobility μ eff in channels of metal-oxide-semiconductor transistors with a gate length L in the range of 3.8 to 0.34 μm was measured; the transistors were formed on wafers of the silicon-oninsulator type. It was found that μ eff decreases as L is decreased. It is shown that this decrease can be accounted for by the effect of series resistances of the source and drain only if it is assumed that there is a rapid increase in these resistances as the gate voltage is decreased. This assumption is difficult to substantiate. A more realistic model is suggested; this model accounts for the observed decrease in μ eff as L is decreased. The model implies that zones with a mobility lower than that in the middle part of the channel originate at the edges of the gate. An analysis shows that, in this case, the plot of the dependence of 1/μ eff on 1/L should be linear, which is exactly what is observed experimentally. The use of this plot makes it possible to determine both the electron mobility μ 0 in the middle part of the channel and the quantity A that characterizes the zones with lowered mobility at the gate’s edges.

  15. Does surgical decompression in Ludwig's angina decrease hospital length of stay?

    Science.gov (United States)

    Rowe, David Phillip; Ollapallil, Jacob

    2011-03-01

    Ludwig's angina (LA) is an uncommon and potentially life-threatening condition of the upper aero-digestive tract that often requires the coordinated efforts of the surgical, anesthetic and intensive care teams to optimize management. The purpose of the present study was to investigate the documented clinical features and the surgical and airway management of LA at Alice Springs Hospital for the purpose of assessing surgical outcomes with particular reference to length of stay (LOS). Retrospective chart review from January 1998 to January 2008 examined patients admitted with LA at Alice Springs Hospital. Documented clinical features, interventions, and operative findings including floor of mouth swelling, Mallampati score, and airway compromise were collected. Outcomes, with particular respect to LOS, for those who received intravenous (IV) or inhalational induction and those that received awake fibre-optic intubations were compared. Of 30 patients with LA, 28 (93%) were managed with operative drainage with a LOS in the intensive care unit (ICU) of 2 days and a hospital LOS of 5 days. Seven received awake fibre-optic intubation and 21 had IV or inhalational anesthesia with none requiring tracheotomy. There was no statistical difference in LOS between those patients whose microbiological culture results showed no growth and those whose cultures had positive growth. Management was generally operative decompression with IV antibiotics. LOS is not affected by the presence or absence of culture positive infection. It is proposed that operative intervention is safe, effective, and is associated with shorter patient stays in the intensive care unit and the hospital overall. © 2010 The Authors. ANZ Journal of Surgery © 2010 Royal Australasian College of Surgeons.

  16. Pediatric Ethics and Communication Excellence (PEACE) Rounds: Decreasing Moral Distress and Patient Length of Stay in the PICU.

    Science.gov (United States)

    Wocial, Lucia; Ackerman, Veda; Leland, Brian; Benneyworth, Brian; Patel, Vinit; Tong, Yan; Nitu, Mara

    2017-03-01

    This paper describes a practice innovation: the addition of formal weekly discussions of patients with prolonged PICU stay to reduce healthcare providers' moral distress and decrease length of stay for patients with life-threatening illnesses. We evaluated the innovation using a pre/post intervention design measuring provider moral distress and comparing patient outcomes using retrospective historical controls. Physicians and nurses on staff in our pediatric intensive care unit in a quaternary care children's hospital participated in the evaluation. There were 60 patients in the interventional group and 66 patients in the historical control group. We evaluated the impact of weekly meetings (PEACE rounds) to establish goals of care for patients with longer than 10 days length of stay in the ICU for a year. Moral distress was measured intermittently and reported moral distress thermometer (MDT) scores fluctuated. "Clinical situations" represented the most frequent contributing factor to moral distress. Post intervention, overall moral distress scores, measured on the moral distress scale revised (MDS-R), were lower for respondents in all categories (non-significant), and on three specific items (significant). Patient outcomes before and after PEACE intervention showed a statistically significant decrease in PRISM indexed LOS (4.94 control vs 3.37 PEACE, p = 0.015), a statistically significant increase in both code status changes DNR (11 % control, 28 % PEACE, p = 0.013), and in-hospital death (9 % control, 25 % PEACE, p = 0.015), with no change in patient 30 or 365 day mortality. The addition of a clinical ethicist and senior intensivist to weekly inter-professional team meetings facilitated difficult conversations regarding realistic goals of care. The study demonstrated that the PEACE intervention had a positive impact on some factors that contribute to moral distress and can shorten PICU length of stay for some patients.

  17. Loss of PiT-2 results in abnormal bone development and decreased bone mineral density and length in mice.

    Science.gov (United States)

    Yamada, Shunsuke; Wallingford, Mary C; Borgeia, Suhaib; Cox, Timothy C; Giachelli, Cecilia M

    2018-01-01

    Normal bone mineralization requires phosphate oversaturation in bone matrix vesicles, as well as normal regulation of phosphate metabolism via the interplay among bone, intestine, and kidney. In turn, derangement of phosphate metabolism greatly affects bone function and structure. The type III sodium-dependent phosphate transporters, PiT-1 and PiT-2, are believed to be important in tissue phosphate metabolism and physiological bone formation, but their requirement and molecular roles in bone remain poorly investigated. In order to decipher the role of PiT-2 in bone, we examined normal bone development, growth, and mineralization in global PiT-2 homozygous knockout mice. PiT-2 deficiency resulted in reduced vertebral column, femur, and tibia length as well as mandibular dimensions. Micro-computed tomography analysis revealed that bone mineral density in the mandible, femur, and tibia were decreased, indicating that maintenance of bone function and structure is impaired in both craniofacial and long bones of PiT-2 deficient mice. Both cortical and trabecular thickness and mineral density were reduced in PiT-2 homozygous knockout mice compared with wild-type mice. These results suggest that PiT-2 is involved in normal bone development and growth and plays roles in cortical and trabecular bone metabolism feasibly by regulating local phosphate transport and mineralization processes in the bone. Further studies that evaluate bone cell-specific loss of PiT-2 are now warranted and may yield insight into complex mechanisms of bone development and growth, leading to identification of new therapeutic options for patients with bone diseases. Copyright © 2017 Elsevier Inc. All rights reserved.

  18. Proximal stress shielding is decreased with a short stem compared with a traditional-length stem in total shoulder arthroplasty.

    Science.gov (United States)

    Denard, Patrick J; Noyes, Matthew P; Walker, J Brock; Shishani, Yousef; Gobezie, Reuben; Romeo, Anthony A; Lederman, Evan

    2018-01-01

    This study compared the outcome and radiographic humeral adaptations after placement of a traditional-length (TL) or short-stem (SS) humeral component during total shoulder arthroplasty (TSA). The hypothesis was there would be no difference in outcome or radiographic adaptations. A multicenter retrospective review was performed of primary TSAs performed with a TL or SS press-fit humeral component. The stems were identical in geometry and coating, with the only variable being stem length. Functional outcome and radiographs were reviewed at a minimum of 2 years postoperatively in 58 TL stems and 56 SSs. There were significant improvements in all range of motion and functional outcome from baseline (P  .05). TL stems were placed in anatomic alignment 98% of the time compared with 86% of the SS cases (P = .015), but alignment did not influence outcome. Cortical thinning was more common in the medial metaphysis with the TL stem (74%) than with the SS (50%; P = .008). Partial calcar osteolysis was seen in 31% of TL stems and in 23% of SSs (P = .348). There was no difference in loosening or shift between the 2 groups. There is no difference in functional outcome at short-term follow-up between a TL stem and a SS in TSA. The pattern of radiographic adaptations may differ based on stem length. Further study is needed to evaluate the mid- to long-term differences, particularly with regard to calcar osteolysis. Copyright © 2017 Journal of Shoulder and Elbow Surgery Board of Trustees. Published by Elsevier Inc. All rights reserved.

  19. Initial Cholecystectomy with Cholangiography Decreases Length of Stay Compared to Preoperative MRCP or ERCP in the Management of Choledocholithiasis.

    Science.gov (United States)

    Lin, Christine; Collins, Jay N; Britt, Rebecca C; Britt, Lunzy D

    2015-07-01

    There are several treatments available for choledocholithiasis, but the optimal treatment is highly debated. Some advocate preoperative endoscopic retrograde cholangiopancreatography (ERCP) followed by laparoscopic cholecystectomy (LC) with cholangiography (IOC). Others advocate initial LC + IOC followed by common bile duct exploration or ERCP. The purpose of this study was to determine whether initial LC + IOC had a shorter length of stay (LOS) compared with preoperative magnetic resonance cholangiopancreatography (MRCP) or ERCP. Patients who underwent cholecystectomy between 2012 and 2013 at two institutions were reviewed. Patients were selected if they had suspected choledocholithiasis, indicated by dilated CBD and/or elevated bilirubin, or confirmed choledocholithiasis. They were excluded if they had pancreatitis or cholangitis. There were 126 patients with suspected choledocholithiasis in this study. Of these, 97 patients underwent initial LC ± IOC with an average LOS of 3.9 days. IOC was negative in 47.4 per cent patients, and they had a shorter LOS compared with positive IOC patients (2.93 vs 4.82, P choledocholithiasis.

  20. BP's emissions trading system

    International Nuclear Information System (INIS)

    Victor, David G.; House, Joshua C.

    2006-01-01

    Between 1998 and 2001, BP reduced its emissions of greenhouse gases by more than 10%. BP's success in cutting emissions is often equated with its use of an apparently market-based emissions trading program. However no independent study has ever examined the rules and operation of BP's system and the incentives acting on managers to reduce emissions. We use interviews with key managers and with traders in several critical business units to explore the bound of BP's success with emissions trading. No money actually changed hands when permits were traded, and the main effect of the program was to create awareness of money-saving emission controls rather than strong price incentives. We show that the trading system did not operate like a 'textbook' cap and trade scheme. Rather, the BP system operated much like a 'safety valve' trading system, where managers let the market function until the cost of doing so surpassed what the company was willing to tolerate

  1. AcEST: BP919751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_G01 537 Adiantum capillus-veneris mRNA. clone: YMU001_000128_G01. BP919751 - Show BP9197...is mRNA. clone: YMU001_000128_G01. Accession BP919751 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197...N=TP53BP1 PE=1 SV=2 Length = 1972 Score = 33.9 bits (76), Expect = 0.51 Identitie...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919751|Adiantum capillus-veneris mRNA, clone:

  2. AcEST: BP920006 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_H08 454 Adiantum capillus-veneris mRNA. clone: YMU001_000131_H08. BP92000...6 CL749Contig1 Show BP920006 Clone id YMU001_000131_H08 Library YMU01 Length 454 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000131_H08. Accession BP920006 Tissue type prothallium Developmental stage...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920006|Adiantum capillus-...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920006|Adiantum capillus-ve

  3. AcEST: BP920002 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_G12 513 Adiantum capillus-veneris mRNA. clone: YMU001_000131_G12. BP92000...2 CL642Contig1 Show BP920002 Clone id YMU001_000131_G12 Library YMU01 Length 513 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000131_G12. Accession BP920002 Tissue type prothallium Developmental stage...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92000...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920002|Adiantu

  4. AcEST: BP918402 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B01 496 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B01. BP9184...02 CL402Contig1 Show BP918402 Clone id YMU001_000113_B01 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000113_B01. Accession BP918402 Tissue type prothallium Developmental stage...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918402|A

  5. AcEST: BP913184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000027_D12 485 Adiantum capillus-veneris mRNA. clone: YMU001_000027_D12. BP913184... CL748Contig1 Show BP913184 Clone id YMU001_000027_D12 Library YMU01 Length 485 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000027_D12. Accession BP913184 Tissue type prothallium Developmental stage...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913184|Ad...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP913184|Adiantum capillus-ve

  6. AcEST: BP918421 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_C09 541 Adiantum capillus-veneris mRNA. clone: YMU001_000113_C09. BP9184...21 CL2140Contig1 Show BP918421 Clone id YMU001_000113_C09 Library YMU01 Length 541 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_C09. Accession BP918421 Tissue type prothallium Developmental stag...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918421|Adiantum capillus-ve

  7. AcEST: BP918425 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_D02 396 Adiantum capillus-veneris mRNA. clone: YMU001_000113_D02. BP9184...25 CL2176Contig1 Show BP918425 Clone id YMU001_000113_D02 Library YMU01 Length 396 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_D02. Accession BP918425 Tissue type prothallium Developmental stag...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918425|Ad...ic Acids Res. 25:3389-3402. Query= BP918425|Adiantum capillus-veneris mRNA, clone

  8. AcEST: BP918411 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B11 488 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B11. BP9184...11 CL3724Contig1 Show BP918411 Clone id YMU001_000113_B11 Library YMU01 Length 488 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_B11. Accession BP918411 Tissue type prothallium Developmental stag...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918411|Adiantum capillus-...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  9. AcEST: BP918431 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_D08 339 Adiantum capillus-veneris mRNA. clone: YMU001_000113_D08. BP9184...31 CL1749Contig1 Show BP918431 Clone id YMU001_000113_D08 Library YMU01 Length 339 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_D08. Accession BP918431 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918431|Adiantum capillus-v...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  10. AcEST: BP911842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_G09 574 Adiantum capillus-veneris mRNA. clone: YMU001_000009_G09. BP91184...2 CL578Contig1 Show BP911842 Clone id YMU001_000009_G09 Library YMU01 Length 574 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000009_G09. Accession BP911842 Tissue type prothallium Developmental stage...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911842|...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91184

  11. AcEST: BP918184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E05 469 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E05. BP918184... CL72Contig1 Show BP918184 Clone id YMU001_000110_E05 Library YMU01 Length 469 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000110_E05. Accession BP918184 Tissue type prothallium Developmental stage ...ic Acids Res. 25:3389-3402. Query= BP918184|Adiantum capillus-veneris mRNA, clone... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918184|Adiantum capillus-veneris mRNA, clone: YM

  12. AcEST: BP918458 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_G01 479 Adiantum capillus-veneris mRNA. clone: YMU001_000113_G01. BP9184...58 CL2714Contig1 Show BP918458 Clone id YMU001_000113_G01 Library YMU01 Length 479 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_G01. Accession BP918458 Tissue type prothallium Developmental stag... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918458|Adian...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918458|Adiantum capillus-v

  13. AcEST: BP918441 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_E08 487 Adiantum capillus-veneris mRNA. clone: YMU001_000113_E08. BP9184...41 CL3521Contig1 Show BP918441 Clone id YMU001_000113_E08 Library YMU01 Length 487 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_E08. Accession BP918441 Tissue type prothallium Developmental stag...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918441|Adiant...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918441|Adiantum capillus-vener

  14. AcEST: BP914061 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D09 599 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D09. BP91406...1 CL1730Contig1 Show BP914061 Clone id YMU001_000039_D09 Library YMU01 Length 599 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D09. Accession BP914061 Tissue type prothallium Developmental stag... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adia...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adiantum capillus-veneris mRNA, c

  15. AcEST: BP914064 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D12 560 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D12. BP91406...4 CL532Contig1 Show BP914064 Clone id YMU001_000039_D12 Library YMU01 Length 560 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_D12. Accession BP914064 Tissue type prothallium Developmental stage...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adiantum capillus-vener...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adi

  16. AcEST: BP912406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_F09 348 Adiantum capillus-veneris mRNA. clone: YMU001_000018_F09. BP912406... CL1894Contig1 Show BP912406 Clone id YMU001_000018_F09 Library YMU01 Length 348 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_F09. Accession BP912406 Tissue type prothallium Developmental stag...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406|Adiantum capillus-veneris mRNA...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406

  17. AcEST: BP916406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000087_D01 556 Adiantum capillus-veneris mRNA. clone: YMU001_000087_D01. BP916406... CL1913Contig1 Show BP916406 Clone id YMU001_000087_D01 Library YMU01 Length 556 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000087_D01. Accession BP916406 Tissue type prothallium Developmental stag...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capill...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capillus-veneris mRNA, c

  18. AcEST: BP917406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_D10 492 Adiantum capillus-veneris mRNA. clone: YMU001_000100_D10. BP917406... CL2033Contig1 Show BP917406 Clone id YMU001_000100_D10 Library YMU01 Length 492 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_D10. Accession BP917406 Tissue type prothallium Developmental stag...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917406...Nucleic Acids Res. 25:3389-3402. Query= BP917406|Adiantum capillus-veneris mRNA,

  19. AcEST: BP914406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_E09 562 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E09. BP914406... CL513Contig1 Show BP914406 Clone id YMU001_000058_E09 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000058_E09. Accession BP914406 Tissue type prothallium Developmental stage...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406|Adiantum capillus...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406

  20. AcEST: BP911984 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_F07 566 Adiantum capillus-veneris mRNA. clone: YMU001_000011_F07. BP911984... CL2332Contig1 Show BP911984 Clone id YMU001_000011_F07 Library YMU01 Length 566 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000011_F07. Accession BP911984 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911984|Adiantum capillus-veneris mR...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911984

  1. AcEST: BP919843 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G09 473 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G09. BP91984...3 CL2697Contig1 Show BP919843 Clone id YMU001_000129_G09 Library YMU01 Length 473 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_G09. Accession BP919843 Tissue type prothallium Developmental stag...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919843|Ad...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919843|Adiantum capillus-veneris

  2. AcEST: BP919791 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_C01 537 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C01. BP9197...91 CL2749Contig1 Show BP919791 Clone id YMU001_000129_C01 Library YMU01 Length 537 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_C01. Accession BP919791 Tissue type prothallium Developmental stag...Nucleic Acids Res. 25:3389-3402. Query= BP919791|Adiantum capillus-veneris mRNA, clone: YMU001_000129_C01. (...ams, Nucleic Acids Res. 25:3389-3402. Query= BP919791|Adiantum capillus-veneris m

  3. AcEST: BP918197 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_F07 474 Adiantum capillus-veneris mRNA. clone: YMU001_000110_F07. BP918197... CL3144Contig1 Show BP918197 Clone id YMU001_000110_F07 Library YMU01 Length 474 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000110_F07. Accession BP918197 Tissue type prothallium Developmental stag...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918197...25:3389-3402. Query= BP918197|Adiantum capillus-veneris mRNA, clone: YMU001_000110_F07. (474 letters) Databa

  4. AcEST: BP916197 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000084_D10 446 Adiantum capillus-veneris mRNA. clone: YMU001_000084_D10. BP916197... CL1434Contig1 Show BP916197 Clone id YMU001_000084_D10 Library YMU01 Length 446 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000084_D10. Accession BP916197 Tissue type prothallium Developmental stag...ds Res. 25:3389-3402. Query= BP916197|Adiantum capillus-veneris mRNA, clone: YMU0...grams, Nucleic Acids Res. 25:3389-3402. Query= BP916197|Adiantum capillus-veneris mRNA, clone: YMU001_000084

  5. AcEST: BP919704 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_B12 260 Adiantum capillus-veneris mRNA. clone: YMU001_000128_B12. BP9197...04 CL1786Contig1 Show BP919704 Clone id YMU001_000128_B12 Library YMU01 Length 260 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000128_B12. Accession BP919704 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP919704|Adiantum capillus-veneris mRNA, clone: YMU001_0001...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919704|Adia

  6. AcEST: BP919708 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_C04 482 Adiantum capillus-veneris mRNA. clone: YMU001_000128_C04. BP9197...08 CL642Contig1 Show BP919708 Clone id YMU001_000128_C04 Library YMU01 Length 482 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000128_C04. Accession BP919708 Tissue type prothallium Developmental stage...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP919708|Adiantum capillus-veneri...ds Res. 25:3389-3402. Query= BP919708|Adiantum capillus-veneris mRNA, clone: YMU001_000128_C04. (482 letters

  7. AcEST: BP919749 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_F11 461 Adiantum capillus-veneris mRNA. clone: YMU001_000128_F11. BP9197...49 CL155Contig1 Show BP919749 Clone id YMU001_000128_F11 Library YMU01 Length 461 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000128_F11. Accession BP919749 Tissue type prothallium Developmental stage... programs, Nucleic Acids Res. 25:3389-3402. Query= BP919749|Adiantum capillus-ven... programs, Nucleic Acids Res. 25:3389-3402. Query= BP919749|Adiantum capillus-veneris mRNA, clone: YMU001_00

  8. AcEST: BP919729 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_E02 423 Adiantum capillus-veneris mRNA. clone: YMU001_000128_E02. BP9197...29 CL3847Contig1 Show BP919729 Clone id YMU001_000128_E02 Library YMU01 Length 423 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000128_E02. Accession BP919729 Tissue type prothallium Developmental stag.... 25:3389-3402. Query= BP919729|Adiantum capillus-veneris mRNA, clone: YMU001_000...Res. 25:3389-3402. Query= BP919729|Adiantum capillus-veneris mRNA, clone: YMU001_

  9. AcEST: BP919794 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_C04 349 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C04. BP9197...94 CL2626Contig1 Show BP919794 Clone id YMU001_000129_C04 Library YMU01 Length 349 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_C04. Accession BP919794 Tissue type prothallium Developmental stag... programs, Nucleic Acids Res. 25:3389-3402. Query= BP919794|Adiantum capillus-veneris mRNA, clone: YMU001_00...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197

  10. AcEST: BP914197 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000056_B07 509 Adiantum capillus-veneris mRNA. clone: YMU001_000056_B07. BP914197... CL4229Contig1 Show BP914197 Clone id YMU001_000056_B07 Library YMU01 Length 509 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000056_B07. Accession BP914197 Tissue type prothallium Developmental stag...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914197...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914197|Adiantum ca

  11. AcEST: BP919774 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_A06 275 Adiantum capillus-veneris mRNA. clone: YMU001_000129_A06. BP9197...74 CL74Contig1 Show BP919774 Clone id YMU001_000129_A06 Library YMU01 Length 275 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000129_A06. Accession BP919774 Tissue type prothallium Developmental stage ...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919774|Adiantum capillus-veneris mR...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919774|Adiantum capillus-veneris

  12. AcEST: BP918439 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_E06 535 Adiantum capillus-veneris mRNA. clone: YMU001_000113_E06. BP9184...39 CL1216Contig1 Show BP918439 Clone id YMU001_000113_E06 Library YMU01 Length 535 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_E06. Accession BP918439 Tissue type prothallium Developmental stag...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918439|Adiantum capillus-veneris mRNA,...A Trafficking protein particle complex subunit 5 OS=Plasmodium falciparum PE=3 SV=1 Length = 184 Score = 81.

  13. Standardizing documentation and the clinical approach to apnea of prematurity reduces length of stay, improves staff satisfaction, and decreases hospital cost.

    Science.gov (United States)

    Butler, T Jeffrey; Firestone, Kimberly S; Grow, Jennifer L; Kantak, Anand D

    2014-06-01

    Apnea of prematurity, a common disorder, can severely compromise an infant's condition unless correctly diagnosed and treated. Infants with a history of apnea of prematurity can be discharged home but then be rehospitalized for an apneic event, an apparent life-threatening event, or sudden infant death syndrome. The definition of a clinically significant cardiopulmonary event, such events' documentation, and the treatment approach were standardized, and discharge criteria were refined. A prospective, single-center comparison was conducted between a group of premature infants before and after implementation of the standard approach. Data were collected prospectively from August 1, 2005, through July 21, 2006, for the prestandard-approach group and from August 1, 2006, through September 16, 2007, for the standard-approach group. Twenty-two (35%) of the 63 infants in the prestandard-approach group experienced discharge delays because of poor documentation, whereby the clinician could not determine the safety of discharge. This resulted in 59 additional hospital days (mean length-of-stay [LOS] increase, 5.7 days). The standard-approach group of 72 infants experienced no discharge delays and no additional hospital days, and LOS decreased (all p apnea of prematurity occurred for 5 (7.9%) of the prestandard-approach group but none of the standard-approach group (p = .0203). Overall compliance with the standardization process has been maintained at > or = 96%. Implementation of a standard approach to the definition of apnea of prematurity and its treatment and documentation decreases LOS and reduces cost.

  14. CtBP1 overexpression in keratinocytes perturbs skin homeostasis.

    Science.gov (United States)

    Deng, Hui; Li, Fulun; Li, Hong; Deng, Yu; Liu, Jing; Wang, Donna; Han, Gangwen; Wang, Xiao-Jing; Zhang, Qinghong

    2014-05-01

    Carboxyl-terminal-binding protein-1 (CtBP1) is a transcriptional corepressor with multiple in vitro targets, but its in vivo functions are largely unknown. We generated keratinocyte-specific CtBP1 transgenic mice with a keratin-5 promoter (K5.CtBP1) to probe the pathological roles of CtBP1. At transgene expression levels comparable to endogenous CtBP1 in acute skin wounds, the K5.CtBP1 epidermis displayed hyperproliferation, loss of E-cadherin, and failed terminal differentiation. Known CtBP1 target genes associated with these processes, e.g., p21, Brca1, and E-cadherin, were downregulated in K5.CtBP1 skin. Surprisingly, K5.CtBP1 pups also exhibited a hair loss phenotype. We found that expression of the Distal-less 3 (Dlx3), a critical regulator of hair follicle differentiation and cycling, was decreased in K5.CtBP1 mice. Molecular studies revealed that CtBP1 directly suppressed Dlx3 transcription. Consistently, K5.CtBP1 mice displayed abnormal hair follicles with decreased expression of Dlx3 downstream targets Gata3, Hoxc13, and hair keratins. In summary, this CtBP1 transgenic model provides in vivo evidence for certain CtBP1 functions predicted from in vitro studies, reveals--to our knowledge--previously unreported functions and transcriptional activities of CtBP1 in the context of epithelial-mesenchymal interplay, and suggests that CtBP1 has a pathogenic role in hair follicle morphogenesis and differentiation.

  15. AcEST: BP918404 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B04 576 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B04. BP9184...04 CL3745Contig1 Show BP918404 Clone id YMU001_000113_B04 Library YMU01 Length 576 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_B04. Accession BP918404 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918404|Adiantum capillus-v...(39%), Gaps = 4/151 (2%) Frame = +2 Query: 5 QQDRSTIQQPHKASHSQRLKQKN*TLKNFLKVCETDLMTLPIAAGTYIRKSSLCFQPSYN 184

  16. AcEST: BP918456 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_F11 456 Adiantum capillus-veneris mRNA. clone: YMU001_000113_F11. BP9184...56 CL2911Contig1 Show BP918456 Clone id YMU001_000113_F11 Library YMU01 Length 456 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_F11. Accession BP918456 Tissue type prothallium Developmental stag...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918456|Adiantum c...2 +EI+ ++DSDPRAAYFRQA+ G+YIRMA Sbjct: 2184 NEISREIDSDPRAAYFRQAEYGMYIRMA 2211 TrEMBL (release 39.9) Link to B

  17. AcEST: BP918499 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000114_C01 514 Adiantum capillus-veneris mRNA. clone: YMU001_000114_C01. BP9184...99 CL2926Contig1 Show BP918499 Clone id YMU001_000114_C01 Library YMU01 Length 514 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000114_C01. Accession BP918499 Tissue type prothallium Developmental stag...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2...es. 25:3389-3402. Query= BP918499|Adiantum capillus-veneris mRNA, clone: YMU001_0

  18. AcEST: BP912612 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_H07 512 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H07. BP912612 - Show BP912612... Clone id YMU001_000020_H07 Library YMU01 Length 512 Definition Adiantum capillus-vener...is mRNA. clone: YMU001_000020_H07. Accession BP912612 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912612|Adiantum cap...illus-veneris mRNA, clone: YMU001_000020_H07. (512 letters) Database: uniprot_sprot.fasta 412,525 sequences;

  19. AcEST: BP912126 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D08 484 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D08. BP912126 CL412...4Contig1 Show BP912126 Clone id YMU001_000015_D08 Library YMU01 Length 484 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D08. Accession BP912126 Tissue type prothallium Developmental stage - Contig ID CL412...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. ...25:3389-3402. Query= BP912126|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D08. (484 letters) Databa

  20. AcEST: BP912212 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D11 457 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D11. BP912212... CL1085Contig1 Show BP912212 Clone id YMU001_000016_D11 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_D11. Accession BP912212 Tissue type prothallium Developmental stag...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912212...|Adiantum capillus-veneris mRNA, clone: YMU001_000016_D11. (457 letters) Database: uniprot_sprot.fasta 412

  1. AcEST: BP912312 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000017_F01 489 Adiantum capillus-veneris mRNA. clone: YMU001_000017_F01. BP912312... CL1779Contig1 Show BP912312 Clone id YMU001_000017_F01 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000017_F01. Accession BP912312 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912312...|Adiantum capillus-veneris mRNA, clone: YMU001_000017_F01. (489 letters) Database: uniprot_sprot.fasta 412

  2. AcEST: BP912128 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D10 477 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D10. BP91212...8 CL2328Contig1 Show BP912128 Clone id YMU001_000015_D10 Library YMU01 Length 477 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D10. Accession BP912128 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...8|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D10. (461 letters) Database: uniprot_sprot.fasta 412

  3. AcEST: BP912012 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_A06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A06. BP912012... CL2421Contig1 Show BP912012 Clone id YMU001_000012_A06 Library YMU01 Length 542 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_A06. Accession BP912012 Tissue type prothallium Developmental stag...rams, Nucleic Acids Res. 25:3389-3402. Query= BP912012|Adiantum capillus-veneris ...mRNA, clone: YMU001_000012_A06. (542 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 t

  4. AcEST: BP912123 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D05 496 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D05. BP91212...3 CL498Contig1 Show BP912123 Clone id YMU001_000015_D05 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D05. Accession BP912123 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...3|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D05. (478 letters) Database: uniprot_sprot.fasta 412

  5. AcEST: BP912912 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000024_C05 413 Adiantum capillus-veneris mRNA. clone: YMU001_000024_C05. BP912912... CL1433Contig1 Show BP912912 Clone id YMU001_000024_C05 Library YMU01 Length 413 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000024_C05. Accession BP912912 Tissue type prothallium Developmental stag... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912912|Adiantum capillus-ven...eris mRNA, clone: YMU001_000024_C05. (413 letters) Database: uniprot_sprot.fasta 412

  6. AcEST: BP919745 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_F07 520 Adiantum capillus-veneris mRNA. clone: YMU001_000128_F07. BP9197...45 CL4239Contig1 Show BP919745 Clone id YMU001_000128_F07 Library YMU01 Length 520 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000128_F07. Accession BP919745 Tissue type prothallium Developmental stag.... 25:3389-3402. Query= BP919745|Adiantum capillus-veneris mRNA, clone: YMU001_000128_F07. (520 letters) Data...NSLETYVYNMKNTINDKDKLAVXXXXXXXXXXXXXXXXXXXXXXENQSAEKEDYDEKL 340 ARNSLETYVYNM+N INDKDKLA +NQSAEKEDY+EKL Sbjct: 197

  7. Early nutritional support is associated with decreased length of hospitalization in dogs with septic peritonitis: A retrospective study of 45 cases (2000-2009).

    Science.gov (United States)

    Liu, Debra T; Brown, Dorothy C; Silverstein, Deborah C

    2012-08-01

    To determine whether the timing and route of nutritional support strategy affect length of hospitalization in dogs with naturally occurring septic peritonitis. Retrospective study encompassing cases from 2000 to 2009. University teaching hospital. Forty-five dogs that survived septic peritonitis. None. Nutritional strategy for each dog was categorized as either enteral nutrition (EN: free choice voluntary eating or assisted tube feeding) or central parenteral nutrition (CPN). Early nutritional support was defined as consistent caloric intake initiated within 24 hours postoperatively. Consistent caloric intake occurring after 24 hours was defined as delayed nutritional support. Data reflective of nutritional status included body condition score, serum albumin concentration, and duration of inappetence before and during hospitalization. Body weight change from the beginning to the end of hospitalization was calculated. A modified Survival Prediction Index 2 score was calculated for each dog at admission. Additional clinical data recorded for comparison of illness severity included indicators of severe inflammation (eg, presence of toxic changes in neutrophils and immature neutrophils), coagulopathy (eg, prolonged prothrombin time and activated partial thromboplastin time), the use of vasopressors and blood transfusions, and presence of concurrent illnesses. Nutrition-related complications were classified as mechanical, metabolic, or septic complications. Multivariate linear regression analyses were used to determine the relationship of nutritional strategy with hospitalization length, while considering the presence of nutrition-related complications, the nutritional status- and illness severity-related variables. While controlling for other variables, dogs that received early nutrition had significantly shorter hospitalization length (by 1.6 days). No statistically significant association was found between route of nutrition and hospitalization length. The presence

  8. AcEST: BP912000 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_H04 558 Adiantum capillus-veneris mRNA. clone: YMU001_000011_H04. BP912000... CL1118Contig1 Show BP912000 Clone id YMU001_000011_H04 Library YMU01 Length 558 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000011_H04. Accession BP912000 Tissue type prothallium Developmental stag... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912000...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP912000|Adiantum capillus-veneris mRNA, clone: YMU001_00001

  9. AcEST: BP920001 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_G11 534 Adiantum capillus-veneris mRNA. clone: YMU001_000131_G11. BP92000...1 CL197Contig1 Show BP920001 Clone id YMU001_000131_G11 Library YMU01 Length 534 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000131_G11. Accession BP920001 Tissue type prothallium Developmental stage... Nucleic Acids Res. 25:3389-3402. Query= BP920001|Adiantum capillus-veneris mRNA, clone: YMU001_000131_G11. ...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92000

  10. AcEST: BP920007 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_H09 516 Adiantum capillus-veneris mRNA. clone: YMU001_000131_H09. BP92000...7 CL346Contig1 Show BP920007 Clone id YMU001_000131_H09 Library YMU01 Length 516 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000131_H09. Accession BP920007 Tissue type prothallium Developmental stage... Nucleic Acids Res. 25:3389-3402. Query= BP920007|Adiantum capillus-veneris mRNA, clone: YMU001_000131_H09. ...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920007|Adiantum capillus-veneris

  11. AcEST: BP920005 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_H07 540 Adiantum capillus-veneris mRNA. clone: YMU001_000131_H07. BP92000...5 CL654Contig1 Show BP920005 Clone id YMU001_000131_H07 Library YMU01 Length 540 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000131_H07. Accession BP920005 Tissue type prothallium Developmental stage...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920005|Adiantum capillus-veneris mRNA, clone: YMU001_0001...s. 25:3389-3402. Query= BP920005|Adiantum capillus-veneris mRNA, clone: YMU001_00

  12. AcEST: BP920003 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_H02 477 Adiantum capillus-veneris mRNA. clone: YMU001_000131_H02. BP920003 - Show BP92000...is mRNA. clone: YMU001_000131_H02. Accession BP920003 Tissue type prothallium Developmental stage - Contig I...ids Res. 25:3389-3402. Query= BP920003|Adiantum capillus-veneris mRNA, clone: YMU...s Res. 25:3389-3402. Query= BP920003|Adiantum capillus-veneris mRNA, clone: YMU001_000131_H02. (477 letters)...SCAF14633, whole genome shotgun sequence OS=Tetraodon nigroviridis GN=GSTENG00019920001 PE=4 SV=1 Length = 2

  13. AcEST: BP920009 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_H11 521 Adiantum capillus-veneris mRNA. clone: YMU001_000131_H11. BP92000...9 CL2261Contig1 Show BP920009 Clone id YMU001_000131_H11 Library YMU01 Length 521 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000131_H11. Accession BP920009 Tissue type prothallium Developmental stag...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920009|Adiantum capillus-veneris mRNA, cl...ms, Nucleic Acids Res. 25:3389-3402. Query= BP920009|Adiantum capillus-veneris mRNA, clone: YMU001_000131_H1

  14. AcEST: BP918424 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_D01 540 Adiantum capillus-veneris mRNA. clone: YMU001_000113_D01. BP918424 - Show BP9184...is mRNA. clone: YMU001_000113_D01. Accession BP918424 Tissue type prothallium Developmental stage - Contig I...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP918424|Adiantum capillus-veneris mRNA, clone: YMU001_0001...component response regulator-like APRR3 OS=Arabidopsis thaliana GN=APRR3 PE=1 SV=1 Length = 495 Score = 75.5 bits (184...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918424|Ad

  15. AcEST: BP918428 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_D05 431 Adiantum capillus-veneris mRNA. clone: YMU001_000113_D05. BP9184...28 CL2013Contig1 Show BP918428 Clone id YMU001_000113_D05 Library YMU01 Length 431 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_D05. Accession BP918428 Tissue type prothallium Developmental stag...s. 25:3389-3402. Query= BP918428|Adiantum capillus-veneris mRNA, clone: YMU001_00...c Acids Res. 25:3389-3402. Query= BP918428|Adiantum capillus-veneris mRNA, clone: YMU001_000113_D05. (431 le

  16. AcEST: BP918414 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_C02 507 Adiantum capillus-veneris mRNA. clone: YMU001_000113_C02. BP9184...14 CL2905Contig1 Show BP918414 Clone id YMU001_000113_C02 Library YMU01 Length 507 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_C02. Accession BP918414 Tissue type prothallium Developmental stag...cleic Acids Res. 25:3389-3402. Query= BP918414|Adiantum capillus-veneris mRNA, clone: YMU001_000113_C02. (50...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918414|Adiantum capillus

  17. AcEST: BP916184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000084_C08 242 Adiantum capillus-veneris mRNA. clone: YMU001_000084_C08. BP916184... CL2444Contig1 Show BP916184 Clone id YMU001_000084_C08 Library YMU01 Length 242 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000084_C08. Accession BP916184 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916184|Adiantum capillus-veneris mR... Acids Res. 25:3389-3402. Query= BP916184|Adiantum capillus-veneris mRNA, clone: YMU001_000084_C08. (242 let

  18. AcEST: BP918410 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B10 582 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B10. BP9184...10 CL3949Contig1 Show BP918410 Clone id YMU001_000113_B10 Library YMU01 Length 582 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_B10. Accession BP918410 Tissue type prothallium Developmental stag...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  19. AcEST: BP918434 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_D12 545 Adiantum capillus-veneris mRNA. clone: YMU001_000113_D12. BP9184...34 CL3700Contig1 Show BP918434 Clone id YMU001_000113_D12 Library YMU01 Length 545 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_D12. Accession BP918434 Tissue type prothallium Developmental stag...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184... Acids Res. 25:3389-3402. Query= BP918434|Adiantum capillus-veneris mRNA, clone: YMU001_000113_D12. (545 let

  20. AcEST: BP918429 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_D06 512 Adiantum capillus-veneris mRNA. clone: YMU001_000113_D06. BP9184...29 CL402Contig1 Show BP918429 Clone id YMU001_000113_D06 Library YMU01 Length 512 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000113_D06. Accession BP918429 Tissue type prothallium Developmental stage...ms, Nucleic Acids Res. 25:3389-3402. Query= BP918429|Adiantum capillus-veneris mRNA, clone: YMU001_000113_D0...ic Acids Res. 25:3389-3402. Query= BP918429|Adiantum capillus-veneris mRNA, clone: YMU001_000113_D06. (512 l

  1. AcEST: BP918422 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_C10 543 Adiantum capillus-veneris mRNA. clone: YMU001_000113_C10. BP9184...22 CL2380Contig1 Show BP918422 Clone id YMU001_000113_C10 Library YMU01 Length 543 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_C10. Accession BP918422 Tissue type prothallium Developmental stag...ams, Nucleic Acids Res. 25:3389-3402. Query= BP918422|Adiantum capillus-veneris mRNA, clone: YMU001_000113_C... Res. 25:3389-3402. Query= BP918422|Adiantum capillus-veneris mRNA, clone: YMU001_000113_C10. (543 letters)

  2. AcEST: BP918455 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_F10 230 Adiantum capillus-veneris mRNA. clone: YMU001_000113_F10. BP9184...55 CL2414Contig1 Show BP918455 Clone id YMU001_000113_F10 Library YMU01 Length 230 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_F10. Accession BP918455 Tissue type prothallium Developmental stag...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  3. AcEST: BP918419 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_C07 404 Adiantum capillus-veneris mRNA. clone: YMU001_000113_C07. BP9184...19 CL2365Contig1 Show BP918419 Clone id YMU001_000113_C07 Library YMU01 Length 404 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_C07. Accession BP918419 Tissue type prothallium Developmental stag...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918419|Adiantum capillus-veneris mRNA, clo

  4. AcEST: BP918446 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_F01 537 Adiantum capillus-veneris mRNA. clone: YMU001_000113_F01. BP9184...46 CL722Contig1 Show BP918446 Clone id YMU001_000113_F01 Library YMU01 Length 537 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000113_F01. Accession BP918446 Tissue type prothallium Developmental stage... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918446|Adiantum capillus-veneris mRNA, clone: YM...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918446|Adiantum capillus-veneris mRNA, c

  5. AcEST: BP918426 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_D03 504 Adiantum capillus-veneris mRNA. clone: YMU001_000113_D03. BP9184...26 CL2Contig2 Show BP918426 Clone id YMU001_000113_D03 Library YMU01 Length 504 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000113_D03. Accession BP918426 Tissue type prothallium Developmental stage -...c Acids Res. 25:3389-3402. Query= BP918426|Adiantum capillus-veneris mRNA, clone: YMU001_000113_D03. (504 le...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  6. AcEST: BP918485 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000114_A10 537 Adiantum capillus-veneris mRNA. clone: YMU001_000114_A10. BP9184...85 CL964Contig1 Show BP918485 Clone id YMU001_000114_A10 Library YMU01 Length 537 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000114_A10. Accession BP918485 Tissue type prothallium Developmental stage...s, Nucleic Acids Res. 25:3389-3402. Query= BP918485|Adiantum capillus-veneris mRNA, clone: YMU001_000114_A10...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  7. AcEST: BP918418 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_C06 558 Adiantum capillus-veneris mRNA. clone: YMU001_000113_C06. BP9184...18 CL2832Contig1 Show BP918418 Clone id YMU001_000113_C06 Library YMU01 Length 558 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_C06. Accession BP918418 Tissue type prothallium Developmental stag...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918418|Adiantum capillus-veneris mRNA, clone:...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918418|Adiantum capillus-veneris mRNA, clone: YMU0

  8. AcEST: BP914065 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_E01 548 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E01. BP91406...5 CL604Contig1 Show BP914065 Clone id YMU001_000039_E01 Library YMU01 Length 548 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_E01. Accession BP914065 Tissue type prothallium Developmental stage...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU0...cids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU001_000039_E01. (548 lette

  9. AcEST: BP914069 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_E05 368 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E05. BP91406...9 CL2761Contig1 Show BP914069 Clone id YMU001_000039_E05 Library YMU01 Length 368 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_E05. Accession BP914069 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001_0000...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001

  10. AcEST: BP914060 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D08 539 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D08. BP91406...0 CL1835Contig1 Show BP914060 Clone id YMU001_000039_D08 Library YMU01 Length 539 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D08. Accession BP914060 Tissue type prothallium Developmental stag...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris ...Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris mRNA, clone: YMU001_000039_D08. (539 lett

  11. AcEST: BP919846 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G12 545 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G12. BP91984...6 CL2640Contig1 Show BP919846 Clone id YMU001_000129_G12 Library YMU01 Length 545 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_G12. Accession BP919846 Tissue type prothallium Developmental stag...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919846|Adiantum capillus-veneris mRNA...cleic Acids Res. 25:3389-3402. Query= BP919846|Adiantum capillus-veneris mRNA, clone: YMU001_000129_G12. (54

  12. AcEST: BP919844 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G10 527 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G10. BP91984...4 CL4143Contig1 Show BP919844 Clone id YMU001_000129_G10 Library YMU01 Length 527 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_G10. Accession BP919844 Tissue type prothallium Developmental stag... Nucleic Acids Res. 25:3389-3402. Query= BP919844|Adiantum capillus-veneris mRNA, clone: YMU001_000129_G10. ...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9198

  13. AcEST: BP920182 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A06 426 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A06. BP92018...2 CL587Contig1 Show BP920182 Clone id YMU001_000134_A06 Library YMU01 Length 426 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000134_A06. Accession BP920182 Tissue type prothallium Developmental stage...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92018...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920182|Adiantum capillus-veneris mRNA, clone:

  14. AcEST: BP920185 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A09 543 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A09. BP92018...5 CL2147Contig1 Show BP920185 Clone id YMU001_000134_A09 Library YMU01 Length 543 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000134_A09. Accession BP920185 Tissue type prothallium Developmental stag...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920185|Adiantum capillus-veneris...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92018

  15. AcEST: BP920188 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_B01 399 Adiantum capillus-veneris mRNA. clone: YMU001_000134_B01. BP92018...8 CL3114Contig1 Show BP920188 Clone id YMU001_000134_B01 Library YMU01 Length 399 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000134_B01. Accession BP920188 Tissue type prothallium Developmental stag...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92018... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92018

  16. AcEST: BP920181 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A05 379 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A05. BP92018...1 CL3929Contig1 Show BP920181 Clone id YMU001_000134_A05 Library YMU01 Length 379 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000134_A05. Accession BP920181 Tissue type prothallium Developmental stag...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920181|Adiantum capillus-veneris m...apped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92018

  17. AcEST: BP919792 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_C02 517 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C02. BP9197...92 CL23Contig1 Show BP919792 Clone id YMU001_000129_C02 Library YMU01 Length 517 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000129_C02. Accession BP919792 Tissue type prothallium Developmental stage ...ms, Nucleic Acids Res. 25:3389-3402. Query= BP919792|Adiantum capillus-veneris mRNA, clone: YMU001_000129_C0...eic Acids Res. 25:3389-3402. Query= BP919792|Adiantum capillus-veneris mRNA, clon

  18. AcEST: BP919710 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_C06 540 Adiantum capillus-veneris mRNA. clone: YMU001_000128_C06. BP9197...10 CL1009Contig1 Show BP919710 Clone id YMU001_000128_C06 Library YMU01 Length 540 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000128_C06. Accession BP919710 Tissue type prothallium Developmental stag...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919710|Adiantum capillus-veneris mRNA, clone:...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919710|Adiantum capillus-vener

  19. AcEST: BP919709 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_C05 470 Adiantum capillus-veneris mRNA. clone: YMU001_000128_C05. BP919709 - Show BP9197...is mRNA. clone: YMU001_000128_C05. Accession BP919709 Tissue type prothallium Developmental stage - Contig I...Res. 25:3389-3402. Query= BP919709|Adiantum capillus-veneris mRNA, clone: YMU001_000128_C05. (454 letters) D... 25:3389-3402. Query= BP919709|Adiantum capillus-veneris mRNA, clone: YMU001_000128_C05. (454 letters) Datab...va subsp. indica PE=2 SV=1 Length = 197 Score = 133 bits (335), Expect = 4e-30 Identities = 63/104 (60%), Po

  20. AcEST: BP919778 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_A11 511 Adiantum capillus-veneris mRNA. clone: YMU001_000129_A11. BP9197...78 CL23Contig1 Show BP919778 Clone id YMU001_000129_A11 Library YMU01 Length 511 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000129_A11. Accession BP919778 Tissue type prothallium Developmental stage ...cleic Acids Res. 25:3389-3402. Query= BP919778|Adiantum capillus-veneris mRNA, clone: YMU001_000129_A11. (51...c Acids Res. 25:3389-3402. Query= BP919778|Adiantum capillus-veneris mRNA, clone:

  1. AcEST: BP919769 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_H11 500 Adiantum capillus-veneris mRNA. clone: YMU001_000128_H11. BP9197...69 CL2Contig4 Show BP919769 Clone id YMU001_000128_H11 Library YMU01 Length 500 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000128_H11. Accession BP919769 Tissue type prothallium Developmental stage -...ids Res. 25:3389-3402. Query= BP919769|Adiantum capillus-veneris mRNA, clone: YMU001_000128_H11. (500 letter...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197

  2. AcEST: BP918415 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_C03 548 Adiantum capillus-veneris mRNA. clone: YMU001_000113_C03. BP9184...15 CL1357Contig1 Show BP918415 Clone id YMU001_000113_C03 Library YMU01 Length 548 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_C03. Accession BP918415 Tissue type prothallium Developmental stag...s, Nucleic Acids Res. 25:3389-3402. Query= BP918415|Adiantum capillus-veneris mRNA, clone: YMU001_000113_C03...ate Australia) PE=3 SV=1 Length = 1844 Score = 31.6 bits (70), Expect = 2.6 Ident

  3. AcEST: BP912122 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D04 544 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D04. BP91212...2 CL3363Contig1 Show BP912122 Clone id YMU001_000015_D04 Library YMU01 Length 544 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D04. Accession BP912122 Tissue type prothallium Developmental stag...obium aromaticivorans (strain DSM 12444) Align length 58 Score (bit) 33.1 E-value 0.89 Report BLASTX 2.2.19 ...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912122|Adiantum

  4. AcEST: BP919790 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_B12 515 Adiantum capillus-veneris mRNA. clone: YMU001_000129_B12. BP9197...90 CL1946Contig1 Show BP919790 Clone id YMU001_000129_B12 Library YMU01 Length 515 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_B12. Accession BP919790 Tissue type prothallium Developmental stag...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919790|Adiantum capillus-veneris mRNA, cl...at-containing protein At1g19720 OS=Arabidopsis thaliana GN=DYW7 PE=2 SV=1 Length = 894 Score = 86.7 bits (21

  5. The Smallest Valid Extension-Based Efficient, Rare Graph Pattern Mining, Considering Length-Decreasing Support Constraints and Symmetry Characteristics of Graphs

    Directory of Open Access Journals (Sweden)

    Unil Yun

    2016-05-01

    Full Text Available Frequent graph mining has been proposed to find interesting patterns (i.e., frequent sub-graphs from databases composed of graph transaction data, which can effectively express complex and large data in the real world. In addition, various applications for graph mining have been suggested. Traditional graph pattern mining methods use a single minimum support threshold factor in order to check whether or not mined patterns are interesting. However, it is not a sufficient factor that can consider valuable characteristics of graphs such as graph sizes and features of graph elements. That is, previous methods cannot consider such important characteristics in their mining operations since they only use a fixed minimum support threshold in the mining process. For this reason, in this paper, we propose a novel graph mining algorithm that can consider various multiple, minimum support constraints according to the types of graph elements and changeable minimum support conditions, depending on lengths of graph patterns. In addition, the proposed algorithm performs in mining operations more efficiently because it can minimize duplicated operations and computational overheads by considering symmetry features of graphs. Experimental results provided in this paper demonstrate that the proposed algorithm outperforms previous mining approaches in terms of pattern generation, runtime and memory usage.

  6. 'Length'at Length

    Indian Academy of Sciences (India)

    Admin

    He was interested to know how `large' is the set of numbers x for which the series is convergent. Here large refers to its length. But his set is not in the class ♢. Here is another problem discussed by Borel. Consider .... have an infinite collection of pairs of new shoes and want to choose one shoe from each pair. We have an ...

  7. Evaluation of fungal- and photo-degradation as potential treatments for the removal of sunscreens BP3 and BP1

    International Nuclear Information System (INIS)

    Gago-Ferrero, Pablo; Badia-Fabregat, Marina; Olivares, Alba; Piña, Benjamin; Blánquez, Paqui; Vicent, Teresa; Caminal, Gloria; Díaz-Cruz, M. Silvia

    2012-01-01

    Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: ► Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. ► BP3 is not degraded under simulated sunlight. ► Glycoconjugates have been identified as the main intermediate metabolites. ► Decrease in endocrine activity was found in both photodegradation and biodegradation.

  8. Evaluation of fungal- and photo-degradation as potential treatments for the removal of sunscreens BP3 and BP1

    Energy Technology Data Exchange (ETDEWEB)

    Gago-Ferrero, Pablo, E-mail: pablo.gago@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Badia-Fabregat, Marina, E-mail: marina.badia@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Olivares, Alba, E-mail: esalba.olivares@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Pina, Benjamin, E-mail: benjami.pina@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Blanquez, Paqui, E-mail: paqui.blanquez@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Vicent, Teresa, E-mail: teresa.vicent@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Caminal, Gloria, E-mail: gloria.caminal@uab.cat [Unitat de Biocatalisi Aplicada associada al IQAC (CSIC-UAB). Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Diaz-Cruz, M. Silvia, E-mail: silvia.diaz@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); and others

    2012-06-15

    Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: Black-Right-Pointing-Pointer Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. Black-Right-Pointing-Pointer BP3 is not degraded under simulated sunlight. Black-Right-Pointing-Pointer Glycoconjugates have been identified as the main intermediate metabolites. Black-Right-Pointing-Pointer Decrease in endocrine activity

  9. AcEST: BP911844 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_G11 340 Adiantum capillus-veneris mRNA. clone: YMU001_000009_G11. BP911844 - Show BP91184...is mRNA. clone: YMU001_000009_G11. Accession BP911844 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP911844|Adiantum capillus-veneris mRNA, clone: YMU001_000009_G11. (340 letters) Data...|SE1BA_DANRE Histone-lysine N-methyltransferase SETD1B-A OS=Danio rerio GN=setd1ba PE=1 SV=2 Length = 1844 S...KFPIE 1826 Query: 155 NKEVPCLCGADTCR 114 ++++PCLCGA+ CR Sbjct: 1827 DEKIPCLCGAENCR 1840 >sp|Q24742|TRX_DROVI

  10. AcEST: BP918448 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_F03 604 Adiantum capillus-veneris mRNA. clone: YMU001_000113_F03. BP9184...48 CL1738Contig1 Show BP918448 Clone id YMU001_000113_F03 Library YMU01 Length 604 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_F03. Accession BP918448 Tissue type prothallium Developmental stag...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP918448|Adiantum capillus-veneris mRNA, clone: YMU001_0...1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res.

  11. AcEST: BP918469 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_H01 435 Adiantum capillus-veneris mRNA. clone: YMU001_000113_H01. BP9184...69 CL28Contig1 Show BP918469 Clone id YMU001_000113_H01 Library YMU01 Length 435 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000113_H01. Accession BP918469 Tissue type prothallium Developmental stage ...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184...L (release 39.9) Link to BlastX Result : TrEMBL tr_hit_id B4J7L9 Definition tr|B4J7L9|B4J7L9_DROGR GH21844 O

  12. AcEST: BP912124 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D06 531 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D06. BP91212...4 CL2988Contig1 Show BP912124 Clone id YMU001_000015_D06 Library YMU01 Length 531 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D06. Accession BP912124 Tissue type prothallium Developmental stag...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912124|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D06. (531 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total

  13. AcEST: BP912120 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D01 500 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D01. BP912120 - Show BP91212...is mRNA. clone: YMU001_000015_D01. Accession BP912120 Tissue type prothallium Developmental stage - Contig I...elated Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum Align length 130 Score (bit) 124.0 E-va...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...0|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D01. (500 letters) Database: uniprot_sprot.fasta 412

  14. AcEST: BP912812 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000023_B07 575 Adiantum capillus-veneris mRNA. clone: YMU001_000023_B07. BP912812... CL2610Contig1 Show BP912812 Clone id YMU001_000023_B07 Library YMU01 Length 575 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000023_B07. Accession BP912812 Tissue type prothallium Developmental stag... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912812|Adiant...um capillus-veneris mRNA, clone: YMU001_000023_B07. (575 letters) Database: uniprot_sprot.fasta 412,525 sequ

  15. AcEST: BP912112 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_C08 546 Adiantum capillus-veneris mRNA. clone: YMU001_000015_C08. BP912112 - Show BP912112...is mRNA. clone: YMU001_000015_C08. Accession BP912112 Tissue type prothallium Developmental stage - Contig I...Arabidopsis thaliana Align length 171 Score (bit) 121.0 E-value 3.0e-27 Report BLASTX 2.2.19 [Nov-02-2008] R... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912112|Adiantum capillus-veneri...s mRNA, clone: YMU001_000015_C08. (546 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765

  16. AcEST: BP912412 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_G03 551 Adiantum capillus-veneris mRNA. clone: YMU001_000018_G03. BP912412... CL4248Contig1 Show BP912412 Clone id YMU001_000018_G03 Library YMU01 Length 551 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_G03. Accession BP912412 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912412|Adiantum capillus-veneris mR...NA, clone: YMU001_000018_G03. (551 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tot

  17. AcEST: BP912512 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000019_D01 513 Adiantum capillus-veneris mRNA. clone: YMU001_000019_D01. BP912512... CL17Contig1 Show BP912512 Clone id YMU001_000019_D01 Library YMU01 Length 513 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000019_D01. Accession BP912512 Tissue type prothallium Developmental stage ...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP912512|Adiantum capillus-veneris mRNA, clone: YMU0...01_000019_D01. (489 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Sear

  18. AcEST: BP912129 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D11 268 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D11. BP91212...9 CL691Contig1 Show BP912129 Clone id YMU001_000015_D11 Library YMU01 Length 268 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D11. Accession BP912129 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912129|Adiantum capillus-veneris mRNA, clo...ne: YMU001_000015_D11. (268 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total lett

  19. AcEST: BP912121 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D03 516 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D03. BP912121 - Show BP91212...is mRNA. clone: YMU001_000015_D03. Accession BP912121 Tissue type prothallium Developmental stage - Contig I...ATH Cysteine proteinase inhibitor 6 OS=Arabidopsis thaliana Align length 122 Score (bit) 85.5 E-value 1.0e-1...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...1|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D03. (516 letters) Database: uniprot_sprot.fasta 412

  20. AcEST: BP919754 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_G04 524 Adiantum capillus-veneris mRNA. clone: YMU001_000128_G04. BP9197...54 CL899Contig1 Show BP919754 Clone id YMU001_000128_G04 Library YMU01 Length 524 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000128_G04. Accession BP919754 Tissue type prothallium Developmental stage...eic Acids Res. 25:3389-3402. Query= BP919754|Adiantum capillus-veneris mRNA, clone: YMU001_000128_G04. (501 ...KSTLLKLLAWRQIPVPKNI 95 KDI I++F + G+ +L NA L +S G RYGLV NG GKSTLL+ L+ R++ VPK++ Sbjct: 197 KDIHIDTFDLYVGDGQR

  1. AcEST: BP919789 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_B11 548 Adiantum capillus-veneris mRNA. clone: YMU001_000129_B11. BP9197...89 CL1910Contig1 Show BP919789 Clone id YMU001_000129_B11 Library YMU01 Length 548 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_B11. Accession BP919789 Tissue type prothallium Developmental stag... Swiss-Prot sp_hit_id P29197 Definition sp|P29197|CH60A_ARATH Chaperonin CPN60, mitochondrial OS=Arabidopsis...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919789|Adiantum capillus-veneris mRNA, clo

  2. AcEST: BP919797 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_C07 464 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C07. BP919797... CL111Contig1 Show BP919797 Clone id YMU001_000129_C07 Library YMU01 Length 464 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000129_C07. Accession BP919797 Tissue type prothallium Developmental stage...se cytoplasmic isozyme OS=Oryza sativa subsp. japonica Align length 97 Score (bit) 141.0 E-value 1.0e-33 Rep...nghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generat

  3. Effect of sieving polymer concentration on separation of 100 bp DNA Ladder by capillary gel electrophoresis

    Science.gov (United States)

    Nakazumi, T.; Hara, Y.

    2017-09-01

    We studied the effect of sieving polymer concentration on separation of a 100 bp DNA Ladder by capillary gel electrophoresis (CGE) using hydroxyethyl cellulose (HEC) with a molecular size of 1000 k. For measurement purposes, we selected a fused silica capillary with total length of 15 cm and effective length of 7.5 cm; this was applied to compact CGE equipment for a Point-Care-Testing (POCT) system. Measurement results of the 100 bp DNA Ladder sample indicated that small DNA separation was significantly affected by HEC sieving polymer concentration. This was due to the level of entanglement between small DNA molecules and the sieving polymer chain significantly influencing migration time, mobility, and resolution length of the CGE process. We concluded that 1.0 w/v % HEC sieving polymer concentration was optimal for CGE separation of DNA ≥1000bp in the 100 bp DNA Ladder (100–1500 bp) when using the short-length capillary.

  4. Climatic forcing before, during, and after the 8.2 Kyr BP global ...

    Indian Academy of Sciences (India)

    The flood of melt water in the N. Atlantic from glacial lakes during the demise of the Laurentide ice sheet, starting at ∼8.5Kyr B.P., adds to the atmospheric cooling. Climatic forcing events occurred at 8.5Kyr B.P., at 8.2Kyr B.P. and finally at 8.06Kyr B.P., leading to concurrent increases or decreases in the atmospheric 14C ...

  5. CtBP1 over-expression in keratinocytes perturbs skin homeostasis

    Science.gov (United States)

    Deng, Hui; Li, Fulun; Li, Hong; Deng, Yu; Liu, Jing; Wang, Donna; Han, Gangwen; Wang, Xiao-Jing; Zhang, Qinghong

    2015-01-01

    Carboxyl-terminal binding protein-1 (CtBP1) is a transcriptional co-repressor with multiple in vitro targets, but its in vivo functions are largely unknown. We generated keratinocyte-specific CtBP1 transgenic mice with a keratin 5 promoter (K5.CtBP1) to probe the pathological roles of CtBP1. At transgene expression levels comparable with endogenous CtBP1 in acute skin wounds, K5.CtBP1 epidermis displayed hyperproliferation, loss of E-cadherin, and failed terminal differentiation. Known CtBP1 target genes associated with these processes, e.g., p21, Brca1, and E-cadherin were down-regulated in K5.CtBP1 skin. Surprisingly, K5.CtBP1 pups also exhibited a hair loss phenotype. We found that expression of the Distal-less 3 (Dlx3), a critical regulator of hair follicle differentiation and cycling, was decreased in K5.CtBP1 mice. Molecular studies revealed that CtBP1 directly suppressed Dlx3 transcription. Consistently, K5.CtBP1 mice displayed abnormal hair follicles with decreased expression of Dlx3 downstream targets Gata3, Hoxc13, and hair keratins. In sum, this first CtBP1 transgenic model provides in vivo evidence for certain CtBP1 functions predicted from in vitro studies, reveals to our knowledge previously unreported functions and transcriptional activities of CtBP1 in the context of epithelial-mesenchymal interplay, and suggest CtBP1 has a pathogenesis role in hair follicle morphogenesis and differentiation. PMID:24280726

  6. Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication

    Energy Technology Data Exchange (ETDEWEB)

    Kanginakudru, Sriramana, E-mail: skangina@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); DeSmet, Marsha, E-mail: mdesmet@iupui.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Thomas, Yanique, E-mail: ysthomas@umail.iu.edu [Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States); Morgan, Iain M., E-mail: immorgan@vcu.edu [VCU Philips Institute for Oral Health Research, Virginia Commonwealth University, Richmond, Virginia (United States); Androphy, Elliot J., E-mail: eandro@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States)

    2015-04-15

    The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication.

  7. Short fetal leukocyte telomere length and preterm prelabor rupture of the membranes.

    Directory of Open Access Journals (Sweden)

    Ramkumar Menon

    Full Text Available BACKGROUND: Rupture of the fetal membranes is a common harbinger of imminent labor and delivery. Telomere shortening is a surrogate for oxidative stress (OS and senescence. Fetal leukocyte and placental membrane DNA telomere lengths were evaluated to determine their association with preterm prelabor rupture of the membranes (pPROM or spontaneous preterm births with intact membranes (PTB, compared to term birth. METHODS: Telomere lengths were quantified in cord blood leukocytes (n = 133 from three major groups: 1 pPROM (n = 28, 2 PTB (n = 69 and 3 uncomplicated full term births (controls, n = 35, using real-time quantitative PCR. Placental membrane specimens (n = 18 were used to correlate fetal leukocyte and placental telomere lengths. Telomere length differences among the groups were analyzed by ANOVA. Pearson correlation coefficients determined relationships between leukocyte and placental membrane telomere lengths. RESULTS: In pregnancies with intact membranes, fetal leukocyte telomere length was inversely proportional to gestational age. The mean telomere length decreased as gestation progressed, with the shortest at term. pPROM had telomere lengths (9962 ± 3124 bp that were significantly shorter than gestational age-matched PTB (11546 ± 4348 bp, p = 0.04, but comparable to term births (9011 ± 2497 bp, p = 0.31. Secondary analyses revealed no effects of race (African American vs. Caucasian or intraamniotic infection on telomere length. A strong Pearson's correlation was noted between fetal leukocyte and placental membrane telomere lengths (ρ = 0.77; p<0.01. CONCLUSIONS: Fetal leukocyte telomere length is reduced in pPROM compared to PTB but is similar to term births. pPROM represents a placental membrane disease likely mediated by OS-induced senescence.

  8. Fundamental length and relativistic length

    International Nuclear Information System (INIS)

    Strel'tsov, V.N.

    1988-01-01

    It si noted that the introduction of fundamental length contradicts the conventional representations concerning the contraction of the longitudinal size of fast-moving objects. The use of the concept of relativistic length and the following ''elongation formula'' permits one to solve this problem

  9. RanBP2 modulates Cox11 and hexokinase I activities and haploinsufficiency of RanBP2 causes deficits in glucose metabolism.

    Directory of Open Access Journals (Sweden)

    Azamat Aslanukov

    2006-10-01

    Full Text Available The Ran-binding protein 2 (RanBP2 is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/- are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/- mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.

  10. Flame Length

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Flame length was modeled using FlamMap, an interagency fire behavior mapping and analysis program that computes potential fire behavior characteristics. The tool...

  11. Functional interaction between type III-secreted protein IncA of Chlamydophila psittaci and human G3BP1.

    Science.gov (United States)

    Borth, Nicole; Litsche, Katrin; Franke, Claudia; Sachse, Konrad; Saluz, Hans Peter; Hänel, Frank

    2011-01-31

    Chlamydophila (Cp.) psittaci, the causative agent of psittacosis in birds and humans, is the most important zoonotic pathogen of the family Chlamydiaceae. These obligate intracellular bacteria are distinguished by a unique biphasic developmental cycle, which includes proliferation in a membrane-bound compartment termed inclusion. All Chlamydiaceae spp. possess a coding capacity for core components of a Type III secretion apparatus, which mediates specific delivery of anti-host effector proteins either into the chlamydial inclusion membrane or into the cytoplasm of target eukaryotic cells. Here we describe the interaction between Type III-secreted protein IncA of Cp. psittaci and host protein G3BP1 in a yeast two-hybrid system. In GST-pull down and co-immunoprecipitation experiments both in vitro and in vivo interaction between full-length IncA and G3BP1 were shown. Using fluorescence microscopy, the localization of G3BP1 near the inclusion membrane of Cp. psittaci-infected Hep-2 cells was demonstrated. Notably, infection of Hep-2 cells with Cp. psittaci and overexpression of IncA in HEK293 cells led to a decrease in c-Myc protein concentration. This effect could be ascribed to the interaction between IncA and G3BP1 since overexpression of an IncA mutant construct disabled to interact with G3BP1 failed to reduce c-Myc concentration. We hypothesize that lowering the host cell c-Myc protein concentration may be part of a strategy employed by Cp. psittaci to avoid apoptosis and scale down host cell proliferation.

  12. Fundamental length

    International Nuclear Information System (INIS)

    Pradhan, T.

    1975-01-01

    The concept of fundamental length was first put forward by Heisenberg from purely dimensional reasons. From a study of the observed masses of the elementary particles known at that time, it is sumrised that this length should be of the order of magnitude 1 approximately 10 -13 cm. It was Heisenberg's belief that introduction of such a fundamental length would eliminate the divergence difficulties from relativistic quantum field theory by cutting off the high energy regions of the 'proper fields'. Since the divergence difficulties arise primarily due to infinite number of degrees of freedom, one simple remedy would be the introduction of a principle that limits these degrees of freedom by removing the effectiveness of the waves with a frequency exceeding a certain limit without destroying the relativistic invariance of the theory. The principle can be stated as follows: It is in principle impossible to invent an experiment of any kind that will permit a distintion between the positions of two particles at rest, the distance between which is below a certain limit. A more elegant way of introducing fundamental length into quantum theory is through commutation relations between two position operators. In quantum field theory such as quantum electrodynamics, it can be introduced through the commutation relation between two interpolating photon fields (vector potentials). (K.B.)

  13. Decreased Libido

    Science.gov (United States)

    ... causes decreased libido? Decreased libido often accompanies other sexual disorders. Although most men with erectile dysfunction do not complain of decreased libido, after time, persistent failure with erections and sexual performance can lead to reduced sex drive in ...

  14. APP-BP1 inhibits Aβ42 levels by interacting with Presenilin-1

    Directory of Open Access Journals (Sweden)

    Neve Rachael L

    2007-02-01

    Full Text Available Abstract Background The β-amyloid precursor protein (APP is sequentially cleaved by the β- and then γ-secretase to generate the amyloid β-peptides Aβ40 and Aβ42. Increased Aβ42/Aβ40 ratios trigger amyloid plaque formations in Alzheimer's disease (AD. APP binds to APP-BP1, but the biological consequence is not well understood. Results We report that when the endogenous APP-BP1 was suppressed by small interfering RNAs (siRNAs, cell-associated Aβ42 was dramatically increased in APP695 expressing primary neurons. The accumulation of Aβ42 was accompanied by significant increases in APP and APP-CTF in APP-BP1 siRNA expressing neurons. In contrast, APP-BP1 overexpression in primary neurons significantly decreased the levels of Aβ and endogenous APP but not APLPs. We also investigated the potential mechanism of APP-BP1-mediated APP processing. APP-BP1 co-precipitated with Presenilin-1 (PS1 in native rat brain extracts, co-migrated with the γ-secretase components in brain membrane extracts in glycerol gradient centrifugation, and colocalized in primary neurons. Further, the endogenous PS1-CTF was significantly downregulated by APP-BP1 expression. Conclusion Our data suggest that APP-BP1 may inhibit Aβ42 production by interacting with PS1 under physiological conditions.

  15. Based on BP Neural Network Stock Prediction

    Science.gov (United States)

    Liu, Xiangwei; Ma, Xin

    2012-01-01

    The stock market has a high profit and high risk features, on the stock market analysis and prediction research has been paid attention to by people. Stock price trend is a complex nonlinear function, so the price has certain predictability. This article mainly with improved BP neural network (BPNN) to set up the stock market prediction model, and…

  16. Cinnamaldehyde and eugenol change the expression folds of AKT1 and DKC1 genes and decrease the telomere length of human adipose-derived stem cells (hASCs: An experimental and in silico study

    Directory of Open Access Journals (Sweden)

    Abdorrahim Absalan

    2017-03-01

    Full Text Available Objective(s: To investigate the effect of cinnamaldehyde and eugenol on the telomere-dependent senescence of stem cells. In addition, to search the probable targets of mentioned phytochemicals between human telomere interacting proteins (TIPs using in silico studies. Materials and Methods: Human adipose derived stem cells (hASCs were studied under treatments with 2.5 µM/ml cinnamaldehyde, 0.1 µg/ml eugenol, 0.01% DMSO or any additive. The expression of TERT, AKT1 and DKC1 genes and the telomere length were assessed over 48-hr treatment. In addition, docking study was conducted to show probable ways through which phytochemicals interact with TIPs. Results: Treated and untreated hASCs had undetectable TERT expression, but they did affect the AKT1 and DKC1 expression levels (CI=0.95; P

  17. AcEST: BP911840 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_G07 495 Adiantum capillus-veneris mRNA. clone: YMU001_000009_G07. BP911840 - Show BP91184...is mRNA. clone: YMU001_000009_G07. Accession BP911840 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91184...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP911840|Adiantum capillu

  18. AcEST: BP918406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B06 468 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B06. BP918406 - Show BP918406...is mRNA. clone: YMU001_000113_B06. Accession BP918406 Tissue type prothallium Developmental stage - Contig I...programs, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-vene...ams, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-veneris m

  19. AcEST: BP919841 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G06 496 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G06. BP919841 - Show BP91984...is mRNA. clone: YMU001_000129_G06. Accession BP919841 Tissue type prothallium Developmental stage - Contig I...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919841|Adiantum ca...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919841|Adiantum capi

  20. AcEST: BP920186 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A11 504 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A11. BP920186 - Show BP92018...is mRNA. clone: YMU001_000134_A11. Accession BP920186 Tissue type prothallium Developmental stage - Contig I...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92018...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920186|Adiantu

  1. Morning Report Presentation with Literature Search Associated with Decreased Length of Hospital Stay. A Review of: Banks, Daniel E., Runhus Shi, Donna F. Timm, Kerri Ann Christopher, David Charles Duggar, Marianne Comegys, and Jerry McLarty. “Decreased Hospital Length of Stay Associated with Presentation of Cases at Morning Report with Librarian Support.” Journal of the Medical Library Association 95.4 (Oct. 2007: 381-87.

    Directory of Open Access Journals (Sweden)

    Jennie Kelson

    2008-09-01

    Full Text Available Objective – To determine whether hospital charges, length of stay or 30-day readmission rates were affected by case discussion at residents’ morning report (MR, accompanied by librarian-provided literature search results, within 24 hours of admission. Design – Case-control study and survey.Setting – Louisiana State University School of Medicine.Subjects – MR cases presented during the study period August 2004 to March 2005 matched with one to three cases (controls of patients who were hospitalised in the period January 2000 to July 2005. House officers who presented the MR cases during the study period were the subjects for the survey.Methods – MR cases were presented between 8:00am and 9:00am, five days a week, and only one case was presented at each MR. During the study period, August 2004 to March 2005, the presenting house officer selected independently a case for presentation at MR from patients admitted during the previous 24 hours. The selection was made without guidance as to which cases or illnesses to choose and without the knowledge or involvement of the attending physician or investigators. The term “house officer” is not defined in the article so it is not clear whether this refers to medical residents only, or if it includes interns. The faculty librarian, with clinical input from the chief resident or the chair of the Department of Medicine, conducted a search of the medical literature immediately following the MR to identify articles or citations that would answer two questions posed at the end of the presentation. The chair of the department or chief resident selected the articles that provided the most clinically sound answers to the questions. By 10:00 am, copies of the selected articles were hand-delivered to the presenting house officer and shared with members of the ward team.For the case-control component, the MR cases presented during the study period were matched against a comparison group of patients who

  2. Water Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  3. Air Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  4. Waste Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  5. Air Monitoring Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  6. Surface Water Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  7. Sediment Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  8. Short cervical length dilemma.

    Science.gov (United States)

    Suhag, Anju; Berghella, Vincenzo

    2015-06-01

    Preterm birth (PTB) is a leading cause of neonatal morbidity and mortality. With research efforts, the rate of PTB decreased to 11.4% in 2013. Transvaginal ultrasound (TVU) cervical length (CL) screening predicts PTB. In asymptomatic singletons without prior spontaneous PTB (sPTB), TVU CL screening should be done. If the cervix is 20 mm or less, vaginal progesterone is indicated. In asymptomatic singletons with prior sPTB, serial CL screening is indicated. In multiple gestations, routine cervical screening is not indicated. In symptomatic women with preterm labor, TVU CL screening and fetal fibronectin testing is recommended. Copyright © 2015 Elsevier Inc. All rights reserved.

  9. AcEST: BP911846 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_H02 62 Adiantum capillus-veneris mRNA. clone: YMU001_000009_H02. BP911846 - Show BP91184... mRNA. clone: YMU001_000009_H02. Accession BP911846 Tissue type prothallium Developmental stage - Contig ID

  10. AcEST: BP919848 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H02 84 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H02. BP919848 - Show BP91984... mRNA. clone: YMU001_000129_H02. Accession BP919848 Tissue type prothallium Developmental stage - Contig ID

  11. Constitutive expression of transgenes encoding derivatives of the synthetic antimicrobial peptide BP100: impact on rice host plant fitness.

    Science.gov (United States)

    Nadal, Anna; Montero, Maria; Company, Nuri; Badosa, Esther; Messeguer, Joaquima; Montesinos, Laura; Montesinos, Emilio; Pla, Maria

    2012-09-04

    The Biopeptide BP100 is a synthetic and strongly cationic α-helical undecapeptide with high, specific antibacterial activity against economically important plant-pathogenic bacteria, and very low toxicity. It was selected from a library of synthetic peptides, along with other peptides with activities against relevant bacterial and fungal species. Expression of the BP100 series of peptides in plants is of major interest to establish disease-resistant plants and facilitate molecular farming. Specific challenges were the small length, peptide degradation by plant proteases and toxicity to the host plant. Here we approached the expression of the BP100 peptide series in plants using BP100 as a proof-of-concept. Our design considered up to three tandemly arranged BP100 units and peptide accumulation in the endoplasmic reticulum (ER), analyzing five BP100 derivatives. The ER retention sequence did not reduce the antimicrobial activity of chemically synthesized BP100 derivatives, making this strategy possible. Transformation with sequences encoding BP100 derivatives (bp100der) was over ten-fold less efficient than that of the hygromycin phosphotransferase (hptII) transgene. The BP100 direct tandems did not show higher antimicrobial activity than BP100, and genetically modified (GM) plants constitutively expressing them were not viable. In contrast, inverted repeats of BP100, whether or not elongated with a portion of a natural antimicrobial peptide (AMP), had higher antimicrobial activity, and fertile GM rice lines constitutively expressing bp100der were produced. These GM lines had increased resistance to the pathogens Dickeya chrysanthemi and Fusarium verticillioides, and tolerance to oxidative stress, with agronomic performance comparable to untransformed lines. Constitutive expression of transgenes encoding short cationic α-helical synthetic peptides can have a strong negative impact on rice fitness. However, GM plants expressing, for example, BP100 based on inverted

  12. Constitutive expression of transgenes encoding derivatives of the synthetic antimicrobial peptide BP100: impact on rice host plant fitness

    Directory of Open Access Journals (Sweden)

    Nadal Anna

    2012-09-01

    Full Text Available Abstract Background The Biopeptide BP100 is a synthetic and strongly cationic α-helical undecapeptide with high, specific antibacterial activity against economically important plant-pathogenic bacteria, and very low toxicity. It was selected from a library of synthetic peptides, along with other peptides with activities against relevant bacterial and fungal species. Expression of the BP100 series of peptides in plants is of major interest to establish disease-resistant plants and facilitate molecular farming. Specific challenges were the small length, peptide degradation by plant proteases and toxicity to the host plant. Here we approached the expression of the BP100 peptide series in plants using BP100 as a proof-of-concept. Results Our design considered up to three tandemly arranged BP100 units and peptide accumulation in the endoplasmic reticulum (ER, analyzing five BP100 derivatives. The ER retention sequence did not reduce the antimicrobial activity of chemically synthesized BP100 derivatives, making this strategy possible. Transformation with sequences encoding BP100 derivatives (bp100der was over ten-fold less efficient than that of the hygromycin phosphotransferase (hptII transgene. The BP100 direct tandems did not show higher antimicrobial activity than BP100, and genetically modified (GM plants constitutively expressing them were not viable. In contrast, inverted repeats of BP100, whether or not elongated with a portion of a natural antimicrobial peptide (AMP, had higher antimicrobial activity, and fertile GM rice lines constitutively expressing bp100der were produced. These GM lines had increased resistance to the pathogens Dickeya chrysanthemi and Fusarium verticillioides, and tolerance to oxidative stress, with agronomic performance comparable to untransformed lines. Conclusions Constitutive expression of transgenes encoding short cationic α-helical synthetic peptides can have a strong negative impact on rice fitness. However, GM

  13. Magnetoresistance Effect in NiFe/BP/NiFe Vertical Spin Valve Devices

    Directory of Open Access Journals (Sweden)

    Leilei Xu

    2017-01-01

    Full Text Available Two-dimensional (2D layered materials such as graphene and transition metal dichalcogenides are emerging candidates for spintronic applications. Here, we report magnetoresistance (MR properties of a black phosphorus (BP spin valve devices consisting of thin BP flakes contacted by NiFe ferromagnetic (FM electrodes. The spin valve effect has been observed from room temperature to 4 K, with MR magnitudes of 0.57% at 4 K and 0.23% at 300 K. In addition, the spin valve resistance is found to decrease monotonically as temperature is decreased, indicating that the BP thin film works as a conductive interlayer between the NiFe electrodes.

  14. BP-5 Remedial Investigation Slug-Test Characterization Results for Well 699-52-55A

    Energy Technology Data Exchange (ETDEWEB)

    Newcomer, Darrell R.

    2008-07-21

    Pacific Northwest National Laboratory conducted slug-test characterization at the final, completed BP-5 Remedial Investigation well 699-52-55A near the 200-East Area at the Hanford Site on April 22, 2008. The slug-test characterization was in support of the BP-5 Remedial Investigation. The portion of the unconfined aquifer tested is composed of sediments of the lower Ringold Formation and the underlying Elephant Mountain basalt flowtop. The basalt flowtop unit was included as part of the effective test-interval length for the slug-test analysis because the flowtop unit is hydraulically communicative with the unconfined aquifer. Estimates of hydraulic conductivity for the effective test-interval length represent composite values for the lower Ringold Formation and the underlying Elephant Mountain basalt flow top.

  15. AcEST: BP920008 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_H10 566 Adiantum capillus-veneris mRNA. clone: YMU001_000131_H10. BP920008 - Show BP92000...is mRNA. clone: YMU001_000131_H10. Accession BP920008 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920008|Adiantum capillus-veneris mRNA,...Acids Res. 25:3389-3402. Query= BP920008|Adiantum capillus-veneris mRNA, clone: YMU001_000131_H10. (566 lett

  16. AcEST: BP920004 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_H06 151 Adiantum capillus-veneris mRNA. clone: YMU001_000131_H06. BP920004 - Show BP92000...is mRNA. clone: YMU001_000131_H06. Accession BP920004 Tissue type prothallium Developmental stage - Contig I...ds Res. 25:3389-3402. Query= BP920004|Adiantum capillus-veneris mRNA, clone: YMU0...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920004|

  17. AcEST: BP920000 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_G10 490 Adiantum capillus-veneris mRNA. clone: YMU001_000131_G10. BP920000 - Show BP92000...is mRNA. clone: YMU001_000131_G10. Accession BP920000 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92000...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920000|Adiantum capil

  18. AcEST: BP918489 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000114_B02 201 Adiantum capillus-veneris mRNA. clone: YMU001_000114_B02. BP918489 - Show BP9184...is mRNA. clone: YMU001_000114_B02. Accession BP918489 Tissue type prothallium Developmental stage - Contig I...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918489|Adiantum capillus-veneris m

  19. AcEST: BP918412 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B12 606 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B12. BP918412 - Show BP9184...is mRNA. clone: YMU001_000113_B12. Accession BP918412 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918412|Adiantum capillus-veneris mRNA, clone: YMU0

  20. AcEST: BP915184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_E05 573 Adiantum capillus-veneris mRNA. clone: YMU001_000067_E05. BP915184 - Show BP915184...is mRNA. clone: YMU001_000067_E05. Accession BP915184 Tissue type prothallium Developmental stage - Contig I...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915184|Adiantum capillus-veneris mRN...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP915184|Adiantum capillus-veneris mRNA, clone: YMU0

  1. AcEST: BP918451 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_F06 261 Adiantum capillus-veneris mRNA. clone: YMU001_000113_F06. BP918451 - Show BP9184...is mRNA. clone: YMU001_000113_F06. Accession BP918451 Tissue type prothallium Developmental stage - Contig I...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918451|Adiantum capillus-veneris mRNA, clone: YMU001_...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918451|Adiantum capillus-veneris mRNA, clo

  2. AcEST: BP918444 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_E11 570 Adiantum capillus-veneris mRNA. clone: YMU001_000113_E11. BP918444 - Show BP9184...is mRNA. clone: YMU001_000113_E11. Accession BP918444 Tissue type prothallium Developmental stage - Contig I...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918444|Adiantum capillus...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918444|Adiantum capillus-veneris mRNA, clone

  3. AcEST: BP918475 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_H07 490 Adiantum capillus-veneris mRNA. clone: YMU001_000113_H07. BP918475 - Show BP9184...is mRNA. clone: YMU001_000113_H07. Accession BP918475 Tissue type prothallium Developmental stage - Contig I...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918475|Adiantum capillus-vene...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  4. AcEST: BP918435 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_E01 558 Adiantum capillus-veneris mRNA. clone: YMU001_000113_E01. BP918435 - Show BP9184...is mRNA. clone: YMU001_000113_E01. Accession BP918435 Tissue type prothallium Developmental stage - Contig I...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP918435|Adiantum capillus-veneris mRNA, clone: YMU001_0... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  5. AcEST: BP911848 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_H04 372 Adiantum capillus-veneris mRNA. clone: YMU001_000009_H04. BP911848 - Show BP91184...is mRNA. clone: YMU001_000009_H04. Accession BP911848 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911848|Adiantum capillus-veneris...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911848|Adiantum capillus-ve

  6. AcEST: BP918468 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_G12 202 Adiantum capillus-veneris mRNA. clone: YMU001_000113_G12. BP918468 - Show BP9184...is mRNA. clone: YMU001_000113_G12. Accession BP918468 Tissue type prothallium Developmental stage - Contig I...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918468|Ad...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918468|Adiantum capillus

  7. AcEST: BP918449 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_F04 232 Adiantum capillus-veneris mRNA. clone: YMU001_000113_F04. BP918449 - Show BP9184...is mRNA. clone: YMU001_000113_F04. Accession BP918449 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918449|Adiantum cap...s. 25:3389-3402. Query= BP918449|Adiantum capillus-veneris mRNA, clone: YMU001_000113_F04. (232 letters) Dat

  8. AcEST: BP918459 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_G02 467 Adiantum capillus-veneris mRNA. clone: YMU001_000113_G02. BP918459 - Show BP9184...is mRNA. clone: YMU001_000113_G02. Accession BP918459 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918459|Adiantum c..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  9. AcEST: BP911843 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_G10 434 Adiantum capillus-veneris mRNA. clone: YMU001_000009_G10. BP911843 - Show BP91184...is mRNA. clone: YMU001_000009_G10. Accession BP911843 Tissue type prothallium Developmental stage - Contig I...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91184...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP911843|Adiantum capillus-veneris mRNA, clone: YMU0

  10. AcEST: BP911847 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_H03 495 Adiantum capillus-veneris mRNA. clone: YMU001_000009_H03. BP911847 - Show BP91184...is mRNA. clone: YMU001_000009_H03. Accession BP911847 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911847|...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911847|Adiantum capillus-veneris...ogen synthase kinase-3 beta OS=Homo sa... 80 7e-15 sp|P51136|GSK3_DICDI Glycogen synthase kinase-3 OS=Dictyo

  11. AcEST: BP917184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_D02 514 Adiantum capillus-veneris mRNA. clone: YMU001_000097_D02. BP917184 - Show BP917184...is mRNA. clone: YMU001_000097_D02. Accession BP917184 Tissue type prothallium Developmental stage - Contig I...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917184...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917184|Adiantum capillus-veneris mRNA, clone: Y

  12. AcEST: BP918416 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_C04 557 Adiantum capillus-veneris mRNA. clone: YMU001_000113_C04. BP918416 - Show BP9184...is mRNA. clone: YMU001_000113_C04. Accession BP918416 Tissue type prothallium Developmental stage - Contig I...ms, Nucleic Acids Res. 25:3389-3402. Query= BP918416|Adiantum capillus-veneris mRNA, clone: YMU001_000113_C0...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  13. AcEST: BP919184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_B11 566 Adiantum capillus-veneris mRNA. clone: YMU001_000122_B11. BP919184 - Show BP919184...is mRNA. clone: YMU001_000122_B11. Accession BP919184 Tissue type prothallium Developmental stage - Contig I...eic Acids Res. 25:3389-3402. Query= BP919184|Adiantum capillus-veneris mRNA, clone: YMU001_000122_B11. (566 ...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919184|Adiantum capillu

  14. AcEST: BP919406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_G04 562 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G04. BP919406 - Show BP919406...is mRNA. clone: YMU001_000124_G04. Accession BP919406 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-...ucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-veneris mRNA, c

  15. AcEST: BP914068 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_E04 420 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E04. BP914068 - Show BP91406...is mRNA. clone: YMU001_000039_E04. Accession BP914068 Tissue type prothallium Developmental stage - Contig I...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91406...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914068|Adiantum capillus-veneris mRNA, clone:

  16. AcEST: BP913406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000029_H06 570 Adiantum capillus-veneris mRNA. clone: YMU001_000029_H06. BP913406 - Show BP913406...is mRNA. clone: YMU001_000029_H06. Accession BP913406 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capillus-veneris mRNA, clone: YMU00...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capil...LDVTRGLVNGARGVVVAFES--GKHG---------------LPH 406 Query: 387 VRFACNRAEIVIGPDRQTVESGGMQVARRIQVPLILAWALSVHKCQGM

  17. AcEST: BP915406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000071_B11 433 Adiantum capillus-veneris mRNA. clone: YMU001_000071_B11. BP915406 - Show BP915406...is mRNA. clone: YMU001_000071_B11. Accession BP915406 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: Y...leic Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: YMU001_000071_B11. (433

  18. AcEST: BP919847 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H01 512 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H01. BP919847 - Show BP91984...is mRNA. clone: YMU001_000129_H01. Accession BP919847 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91984...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP919847|Adiantum capillus-veneris mRNA, clone: YMU0

  19. AcEST: BP919842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G07 567 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G07. BP919842 - Show BP91984...is mRNA. clone: YMU001_000129_G07. Accession BP919842 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919842|Adiantum capillus-veneris m...c Acids Res. 25:3389-3402. Query= BP919842|Adiantum capillus-veneris mRNA, clone: YMU001_000129_G07. (567 le

  20. AcEST: BP919840 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G05 476 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G05. BP919840 - Show BP91984...is mRNA. clone: YMU001_000129_G05. Accession BP919840 Tissue type prothallium Developmental stage - Contig I...Res. 25:3389-3402. Query= BP919840|Adiantum capillus-veneris mRNA, clone: YMU001_...es. 25:3389-3402. Query= BP919840|Adiantum capillus-veneris mRNA, clone: YMU001_0

  1. AcEST: BP919849 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H04 454 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H04. BP919849 - Show BP91984...is mRNA. clone: YMU001_000129_H04. Accession BP919849 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP919849|Adiantum capillus-veneris mRNA, clone: YMU001_00...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP919849|Adiantum capillus-veneris mRNA, clone: YMU001_0001

  2. AcEST: BP919845 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G11 376 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G11. BP919845 - Show BP91984...is mRNA. clone: YMU001_000129_G11. Accession BP919845 Tissue type prothallium Developmental stage - Contig I...ms, Nucleic Acids Res. 25:3389-3402. Query= BP919845|Adiantum capillus-veneris mRNA, clone: YMU001_000129_G1...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919845|Adiantum capillus

  3. AcEST: BP920183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A07 427 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A07. BP920183 - Show BP92018...is mRNA. clone: YMU001_000134_A07. Accession BP920183 Tissue type prothallium Developmental stage - Contig I...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920183...programs, Nucleic Acids Res. 25:3389-3402. Query= BP920183|Adiantum capillus-veneris mRNA, clone: YMU001_000

  4. AcEST: BP920180 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A04 428 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A04. BP920180 - Show BP92018...is mRNA. clone: YMU001_000134_A04. Accession BP920180 Tissue type prothallium Developmental stage - Contig I... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920180|Adia... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92018

  5. AcEST: BP920184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A08 470 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A08. BP920184 - Show BP92018...is mRNA. clone: YMU001_000134_A08. Accession BP920184 Tissue type prothallium Developmental stage - Contig I...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP920184|Adiantum capillus-veneri...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920184|Adiantum capill

  6. AcEST: BP912018 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_B01 519 Adiantum capillus-veneris mRNA. clone: YMU001_000012_B01. BP912018 - Show BP912018...is mRNA. clone: YMU001_000012_B01. Accession BP912018 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912018.... 25:3389-3402. Query= BP912018|Adiantum capillus-veneris mRNA, clone: YMU001_000012_B01. (519 letters) Data

  7. AcEST: BP920187 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A12 506 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A12. BP920187 - Show BP92018...is mRNA. clone: YMU001_000134_A12. Accession BP920187 Tissue type prothallium Developmental stage - Contig I...programs, Nucleic Acids Res. 25:3389-3402. Query= BP920187|Adiantum capillus-vene...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP920187|Adiantum capillus-veneris mRNA, clone: YMU001_00013

  8. AcEST: BP913467 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000030_E10 288 Adiantum capillus-veneris mRNA. clone: YMU001_000030_E10. BP913467 - Show BP913467...is mRNA. clone: YMU001_000030_E10. Accession BP913467 Tissue type prothallium Developmental stage - Contig I... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913467|Adiantum capillus-veneris mRNA, ...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913467|Adiantum capillus-vene

  9. AcEST: BP919765 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_H07 531 Adiantum capillus-veneris mRNA. clone: YMU001_000128_H07. BP919765 - Show BP9197...is mRNA. clone: YMU001_000128_H07. Accession BP919765 Tissue type prothallium Developmental stage - Contig I... Res. 25:3389-3402. Query= BP919765|Adiantum capillus-veneris mRNA, clone: YMU001_000128_H07. (516 letters) ...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919765|Adiantum capillus-veneris mRNA, clone

  10. AcEST: BP919795 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_C05 446 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C05. BP919795 - Show BP9197...is mRNA. clone: YMU001_000129_C05. Accession BP919795 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP919795|Adiantum capillus-veneris mRNA, clone: YMU001_000129_C05. (446 lett...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197

  11. AcEST: BP919705 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_C01 300 Adiantum capillus-veneris mRNA. clone: YMU001_000128_C01. BP919705 - Show BP9197...is mRNA. clone: YMU001_000128_C01. Accession BP919705 Tissue type prothallium Developmental stage - Contig I...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919705|Adiantum capillu..., Positives = 31/61 (50%) Frame = +3 Query: 18 YSLVVVVGAQKLSYFLNFAQSLIPHQSVAFFLGS*YWKIPQGVHLQSLCLKLLQPPLMII 197...es. 25:3389-3402. Query= BP919705|Adiantum capillus-veneris mRNA, clone: YMU001_000128_C01. (300 letters) Da

  12. AcEST: BP919748 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_F10 483 Adiantum capillus-veneris mRNA. clone: YMU001_000128_F10. BP919748 - Show BP9197...is mRNA. clone: YMU001_000128_F10. Accession BP919748 Tissue type prothallium Developmental stage - Contig I...c Acids Res. 25:3389-3402. Query= BP919748|Adiantum capillus-veneris mRNA, clone:...ams, Nucleic Acids Res. 25:3389-3402. Query= BP919748|Adiantum capillus-veneris mRNA, clone: YMU001_000128_F

  13. AcEST: BP919757 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_G07 557 Adiantum capillus-veneris mRNA. clone: YMU001_000128_G07. BP919757 - Show BP9197...is mRNA. clone: YMU001_000128_G07. Accession BP919757 Tissue type prothallium Developmental stage - Contig I...rams, Nucleic Acids Res. 25:3389-3402. Query= BP919757|Adiantum capillus-veneris mRNA, clone: YMU001_000128_...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919757|Adia

  14. AcEST: BP912197 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_C05 570 Adiantum capillus-veneris mRNA. clone: YMU001_000016_C05. BP912197 - Show BP912197...is mRNA. clone: YMU001_000016_C05. Accession BP912197 Tissue type prothallium Developmental stage - Contig I...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912197|Adiantum capillus-veneris mRNA, clo...grams, Nucleic Acids Res. 25:3389-3402. Query= BP912197|Adiantum capillus-veneris mRNA, clone: YMU001_000016...+T+SL G IAA ++S KG T Sbjct: 197 SDTWVAEYRKWMDKVGHGMPYHFGHRTISLPKVPPVVEHAPAGLIAALS

  15. AcEST: BP919724 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_D08 331 Adiantum capillus-veneris mRNA. clone: YMU001_000128_D08. BP919724 - Show BP9197...is mRNA. clone: YMU001_000128_D08. Accession BP919724 Tissue type prothallium Developmental stage - Contig I...s Res. 25:3389-3402. Query= BP919724|Adiantum capillus-veneris mRNA, clone: YMU001_000128_D08. (331 letters)...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919724|Adiantum capi

  16. AcEST: BP919725 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_D09 385 Adiantum capillus-veneris mRNA. clone: YMU001_000128_D09. BP919725 - Show BP9197...is mRNA. clone: YMU001_000128_D09. Accession BP919725 Tissue type prothallium Developmental stage - Contig I...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919725|Adiantum capillus-veneris mRNA, clone: Y...P A GR+ YA S++ Sbjct: 2 SGASNDGYGQYPPQQP--GDHQQQPPYPDQAYDNAAPVAPGHAADHGRKKKRQYAASAFD 59 Query: 197 ATQGGHVKQ...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919725|Adiantum capillus-veneris mRNA, clone: YMU

  17. AcEST: BP919707 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_C03 461 Adiantum capillus-veneris mRNA. clone: YMU001_000128_C03. BP919707 - Show BP9197...is mRNA. clone: YMU001_000128_C03. Accession BP919707 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP919707|Adiantum capillus-veneris mRNA, clone: YMU001_000128...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197

  18. AcEST: BP919700 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_B06 521 Adiantum capillus-veneris mRNA. clone: YMU001_000128_B06. BP919700 - Show BP9197...is mRNA. clone: YMU001_000128_B06. Accession BP919700 Tissue type prothallium Developmental stage - Contig I...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP919700|Adiantum capillus-veneris mRNA, clone: YMU001_0...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197

  19. AcEST: BP919730 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_E03 520 Adiantum capillus-veneris mRNA. clone: YMU001_000128_E03. BP919730 - Show BP9197...is mRNA. clone: YMU001_000128_E03. Accession BP919730 Tissue type prothallium Developmental stage - Contig I... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197

  20. AcEST: BP919775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_A08 507 Adiantum capillus-veneris mRNA. clone: YMU001_000129_A08. BP919775 - Show BP9197...is mRNA. clone: YMU001_000129_A08. Accession BP919775 Tissue type prothallium Developmental stage - Contig I...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP919775|Adiantum capillus-ve... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919775|Adiantum capillus-veneris mRNA,

  1. AcEST: BP919721 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_D05 520 Adiantum capillus-veneris mRNA. clone: YMU001_000128_D05. BP919721 - Show BP9197...is mRNA. clone: YMU001_000128_D05. Accession BP919721 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP919721|Adiantum capillus-veneris mRNA, clone: YMU001_0

  2. AcEST: BP919770 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_A01 565 Adiantum capillus-veneris mRNA. clone: YMU001_000129_A01. BP919770 - Show BP9197...is mRNA. clone: YMU001_000129_A01. Accession BP919770 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP919770|Adiantum capillus-veneris mRNA, clone: YMU001_000129_A01. (5...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919770|Adiantum capillus-veneris mRNA

  3. Oxygen-dependent acetylation and dimerization of the corepressor CtBP2 in neural stem cells

    Energy Technology Data Exchange (ETDEWEB)

    Karaca, Esra; Lewicki, Jakub; Hermanson, Ola, E-mail: Ola.Hermanson@ki.se

    2015-03-01

    The transcriptional corepressor CtBP2 is essential for proper development of the nervous system. The factor exerts its repression by interacting in complexes with chromatin-modifying factors such as histone deacetylases (HDAC) 1/2 and the histone demethylase LSD1/KDM1. Notably, the histone acetyl transferase p300 acetylates CtBP2 and this is an important regulatory event of the activity and subcellular localization of the protein. We recently demonstrated an essential role for CtBPs as sensors of microenvironmental oxygen levels influencing the differentiation potential of neural stem cells (NSCs), but it is not known whether oxygen levels influence the acetylation levels of CtBP factors. Here we show by using proximity ligation assay (PLA) that CtBP2 acetylation levels increased significantly in undifferentiated, proliferating NSCs under hypoxic conditions. CtBP2 interacted with the class III HDAC Sirt1 but this interaction was unaltered in hypoxic conditions, and treatment with the Sirt1 inhibitor Ex527 did not result in any significant change in total CtBP2 acetylation levels. Instead, we revealed a significant decrease in PLA signal representing CtBP2 dimerization in NSCs under hypoxic conditions, negatively correlating with the acetylation levels. Our results suggest that microenvironmental oxygen levels influence the dimerization and acetylation levels, and thereby the activity, of CtBP2 in proliferating NSCs.

  4. Face recognition based on improved BP neural network

    Directory of Open Access Journals (Sweden)

    Yue Gaili

    2017-01-01

    Full Text Available In order to improve the recognition rate of face recognition, face recognition algorithm based on histogram equalization, PCA and BP neural network is proposed. First, the face image is preprocessed by histogram equalization. Then, the classical PCA algorithm is used to extract the features of the histogram equalization image, and extract the principal component of the image. And then train the BP neural network using the trained training samples. This improved BP neural network weight adjustment method is used to train the network because the conventional BP algorithm has the disadvantages of slow convergence, easy to fall into local minima and training process. Finally, the BP neural network with the test sample input is trained to classify and identify the face images, and the recognition rate is obtained. Through the use of ORL database face image simulation experiment, the analysis results show that the improved BP neural network face recognition method can effectively improve the recognition rate of face recognition.

  5. Continuously variable focal length lens

    Science.gov (United States)

    Adams, Bernhard W; Chollet, Matthieu C

    2013-12-17

    A material preferably in crystal form having a low atomic number such as beryllium (Z=4) provides for the focusing of x-rays in a continuously variable manner. The material is provided with plural spaced curvilinear, optically matched slots and/or recesses through which an x-ray beam is directed. The focal length of the material may be decreased or increased by increasing or decreasing, respectively, the number of slots (or recesses) through which the x-ray beam is directed, while fine tuning of the focal length is accomplished by rotation of the material so as to change the path length of the x-ray beam through the aligned cylindrical slows. X-ray analysis of a fixed point in a solid material may be performed by scanning the energy of the x-ray beam while rotating the material to maintain the beam's focal point at a fixed point in the specimen undergoing analysis.

  6. Evaluation of HLA-G 14 bp Ins/Del and +3142G>C Polymorphism with Susceptibility and Early Disease Activity in Rheumatoid Arthritis

    Directory of Open Access Journals (Sweden)

    Mohammad Hashemi

    2016-01-01

    Full Text Available Purpose/Background. Mounting evidence designates that HLA-G plays a role in the regulation of inflammatory processes and autoimmune diseases. There are controversial reports concerning the impact of HLA-G gene polymorphism on rheumatoid arthritis (RA. This study was aimed at examining the impact of 14 bp ins/del and +3142G>C polymorphism with susceptibility and early disease activity in RA patients in a sample of the Iranian population. Methods. This case-control study was done on 194 patients with RA and 158 healthy subjects. The HLA-G rs1063320 (+3142G>C and rs66554220 (14 bp ins/del variants were genotype by polymerase chain reaction-restriction fragment length polymorphism (PCR-RFP and PCR method, respectively. Results. The HLA-G +3142G>C polymorphism significantly decreased the risk of RA in codominant (OR = 0.61, 95% CI = 0.38–0.97, p=0.038, GC versus GG; OR = 0.36, 95% CI = 0.14–0.92, p=0.034, CC versus GG, dominant (OR = 0.56, 95% CI = 0.36–0.87, p=0.011, GC + CC versus GG, and allele (OR = 0.58, 95% CI = 0.41–0.84, p=0.004, C versus G inheritance models tested. Our finding did not support an association between HLA-G 14 bp ins/del variant and risk/protection of RA. In addition, no significant association was found between the polymorphism and early disease activity. Conclusion. In summary, our results showed that HLA-G +3142G>C gene polymorphism significantly decreased the risk of RA in a sample of the Iranian population.

  7. AcEST: BP918438 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_E05 620 Adiantum capillus-veneris mRNA. clone: YMU001_000113_E05. BP918438 - Show BP9184...is mRNA. clone: YMU001_000113_E05. Accession BP918438 Tissue type prothallium Developmental stage - Contig I... Res. 25:3389-3402. Query= BP918438|Adiantum capillus-veneris mRNA, clone: YMU001_000113_E05. (620 letters) ...jct: 125 MMNSGISPDKYTFPFGLSACAKSRAKGNGIQIHGLIVKMGYAKDLFVQNSLVHFYAECGE 184 Query: ...LVKGLEPDEFSVTTALTACAQVGALAQGK 238 Query: 184 QHFENMINHGIVPTVEHV-NCLSELLSRSGCLKEAEKILQSMPASGDVAGWVSLLTACKA 8

  8. AcEST: BP921843 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_G09 483 Adiantum capillus-veneris mRNA. clone: YMU001_000154_G09. BP921843 - Show BP92184...is mRNA. clone: YMU001_000154_G09. Accession BP921843 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP921843|Adiantum capillus-veneris mRNA, clone: YMU001_000...RLDEAEQLALKGGKK---QIQKLETRIRELEFELEGEQKRNTESVKGLRK 1843 Query: 190 REAELSDLKASQDELVDSIVSCRQCMDKLRMEAVSYKR 30...3 E + +L +E +++ + +DKL+++ SYKR Sbjct: 1844 YERRVKELTYQSEEDRKNVLRLQDLVDKLQVKVKSYKR 1881 >sp|P13541|MYH3_MOUSE

  9. AcEST: BP918436 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_E02 514 Adiantum capillus-veneris mRNA. clone: YMU001_000113_E02. BP918436 - Show BP9184...is mRNA. clone: YMU001_000113_E02. Accession BP918436 Tissue type prothallium Developmental stage - Contig I...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184... + Sbjct: 1782 EVLPIKIKLDYKPKRVDYNLLRQGKTIELMNFFHFEGSEMVLRHVTLRGINGWARLFDTL 1841 ... EQY +D R+L+G+++GA Sbjct: 1842 NDIWTPDVKANQLADFLSGLGPIRSLVNVGAGLADLVLLPIEQYHKD-GRVLRGVQRGAA 1900 Query: 147

  10. AcEST: BP912712 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000022_A07 476 Adiantum capillus-veneris mRNA. clone: YMU001_000022_A07. BP912712 - Show BP912712...is mRNA. clone: YMU001_000022_A07. Accession BP912712 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP912712|Adiantum capillus-veneris mRNA, cl...one: YMU001_000022_A07. (476 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total let...8%), Positives = 39/69 (56%), Gaps = 4/69 (5%) Frame = +3 Query: 123 TSRRKSNHDQY--LPNYKVGTVHLLLGVKDQHLVSKIDI

  11. AcEST: BP919734 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_E07 512 Adiantum capillus-veneris mRNA. clone: YMU001_000128_E07. BP919734 - Show BP9197...is mRNA. clone: YMU001_000128_E07. Accession BP919734 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197...N+ +QP+E+HIP+LLQ+ IDYNL GM ++L+ +KFR+ K+ N + Sbjct: 141 QSGAIMNKFYQPHEAHIPYLLQLFIDYNLYGMNLINLAAVKFRKARRKS---NTLHATGS 197...SSSSPSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 199 Query: 197 LRHNISIRLPIANRAS 244 + S +PI + S

  12. AcEST: BP919728 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_E01 528 Adiantum capillus-veneris mRNA. clone: YMU001_000128_E01. BP919728 - Show BP9197...is mRNA. clone: YMU001_000128_E01. Accession BP919728 Tissue type prothallium Developmental stage - Contig I... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197...YQDAHMQEGFLPRIYLTGDKLFEAGRCWEDISDAISAARIFIYIAGWSV 197 F+QRR C V LYQDAH+ F+P+I L G...376 FTQRRRCHVKLYQDAHMQEGFLPRIYLTGDKLFEAGRCWEDISDAISAARIFIYIAGWSV 197 F+QR+ C V LYQ AH+ + F+P+I L G K +E RCWE

  13. Identification of beef using restriction fragment length polymorphism–

    Directory of Open Access Journals (Sweden)

    R. A. Al-Sanjary

    2009-01-01

    Full Text Available To differentiate the beef from other types of meat consumed by human, DNA markers based on polymerase chain reaction restriction fragment length polymorphism technique is performed by using universal primers designed on mitochondrial cytochrome b gene to obtain amplified band 359 bp, then digested with some of restriction enzymes like Tru91, RsaI, Hinf I, Hae III, Alu I, Taq I, Mob I. The result revealed that, the Hinf I enzyme produce three bands 198, 117, 44 bp and the Hae III enzyme revealed two band 285, 74 bp, the Alu I enzyme also produced two band but the molecular weight are 190, 169 bp. The other enzymes did not reveal any digestion of the amplified bands and this result is a characteristic unique to beef compared with other types of meat when using same enzymes.

  14. AcEST: BP918400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_A11 368 Adiantum capillus-veneris mRNA. clone: YMU001_000113_A11. BP918400 - Show BP9184...is mRNA. clone: YMU001_000113_A11. Accession BP918400 Tissue type prothallium Developmental stage - Contig I...ms, Nucleic Acids Res. 25:3389-3402. Query= BP918400|Adiantum capillus-veneris mRNA, clone: YMU001_000113_A1...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184...aining ... 62 1e-08 tr|A2FI37|A2FI37_TRIVA SNF2 family N-terminal domain containing ... 58 2e-07 tr|O61845|O6184

  15. AcEST: BP919798 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_C08 534 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C08. BP919798 - Show BP9197...is mRNA. clone: YMU001_000129_C08. Accession BP919798 Tissue type prothallium Developmental stage - Contig I... Res. 25:3389-3402. Query= BP919798|Adiantum capillus-veneris mRNA, clone: YMU001_000129_C08. (534 letters) ...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP919798|Adiantum capillus-veneris mRNA, clone: YMU0...racterized protein OS=Toxop... 49 2e-04 tr|Q91973|Q91973_COTCO Slow myosin heavy chain 3 OS=Coturnix cot...

  16. AcEST: BP911976 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_E10 538 Adiantum capillus-veneris mRNA. clone: YMU001_000011_E10. BP911976 - Show BP91197...is mRNA. clone: YMU001_000011_E10. Accession BP911976 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP911976|Adiantum capillus-veneris mRNA, clone: YMU001_000011_E10. (538 lett...DIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGF 1978 Query: 155 TG 150 G Sbjct: 1979 LG 1980 >sp|Q96L73|NSD1_HUMAN Histon...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP911976|Adiantum capillus-veneris mRNA, clone: YMU00

  17. Expanding the BP1-BP2 15q11.2 Microdeletion Phenotype: Tracheoesophageal Fistula and Congenital Cataracts

    Directory of Open Access Journals (Sweden)

    D. Wong

    2013-01-01

    Full Text Available The proximal q arm of chromosome 15 contains breakpoint regions BP1–BP5 with the classic deletion of BP1–BP3 best known to be associated with Prader-Willi and Angelman syndromes. The region is approximately 500 kb and microdeletions within the BP1-BP2 region have been reported in patients with developmental delay, behavioral abnormalities, and motor apraxia as well as dysmorphic features including hypertelorism, cleft or narrow palate, ear abnormalities, and recurrent upper airway infections. We report two patients with unique, never-before-reported 15q11.2 BP1-2 microdeletion syndrome findings, one with proximal esophageal atresia and distal tracheoesophageal fistula (type C and one with congenital cataracts. Cataracts have been described in Prader-Willi syndrome but we could not find any description of cataracts in Angelman syndrome. Esophageal atresia and tracheoesophageal fistula have not been reported to our knowledge in either syndrome. A chance exists that both cases are sporadic birth defects; however, the findings of the concomitant microdeletion cannot be overlooked as a possible cause. Based on our review of the literature and the presentation of our patients, we recommend that esophageal atresia and distal tracheoesophageal fistula as well as congenital cataracts be included in the phenotypic spectrum of 15q11.2 BP1-2 microdeletion syndrome.

  18. Clinical correlates of ambulatory BP monitoring among patients with CKD.

    Science.gov (United States)

    Iimuro, Satoshi; Imai, Enyu; Watanabe, Tsuyoshi; Nitta, Kosaku; Akizawa, Tadao; Matsuo, Seiichi; Makino, Hirofumi; Ohashi, Yasuo; Hishida, Akira

    2013-05-01

    Ambulatory BP monitoring (ABPM) allows a better risk stratification than office BP in hypertensive patients. However, the clinical relevance of ABPM has not been extensively investigated in the CKD population. Within the Chronic Kidney Disease Japan Cohort study, 2977 patients enrolled (62% men, aged 60.8±11.6 years) and ABPM was conducted in a subgroup of patients from September 2007 to April 2010. Data from 1075 patients (682 men) were analyzed to determine BP control and factors associated with the ABPM parameters. The prevalence of masked hypertension was 30.9%, whereas that of white-coat hypertension was 5.6%. With advancing CKD stage, the percentage of persistent hypertension increased from 21.7% to 36.1%. Diabetes, antihypertensive medicine use, and low estimated GFR (eGFR) were significantly associated with the difference between office BP and ambulatory BP (1.7 mmHg, 2.6 mmHg, and 0.6 mmHg per 10 ml/min per 1.73 m(2), respectively). There tended to be fewer nondippers and risers in stage 3 than in stages 4 and 5. In the nocturia-negative group, low eGFR, diabetes, and summer season were identified as factors associated with lower nocturnal BP change (-0.5 mmHg, -2.0 mmHg, and -2.8 mmHg, respectively). Morning BP change was greater with older age (0.2 mmHg per 10 years) and higher body mass index (0.6 mmHg per 1 kg/m(2)), and in winter (4.5 mmHg) versus summer. Various factors including eGFR, diabetes, antihypertensive medication use, and season are associated with higher BP and abnormal BP patterns in CKD patients.

  19. IgG autoantibodies from bullous pemphigoid (BP) patients bind antigenic sites on both the extracellular and the intracellular domains of the BP antigen 180.

    Science.gov (United States)

    Perriard, J; Jaunin, F; Favre, B; Büdinger, L; Hertl, M; Saurat, J H; Borradori, L

    1999-02-01

    Bullous pemphigoid (BP) and gestational pemphigoid (PG) are subepidermal blistering disorders associated with autoantibodies directed against two components of hemidesmosomes: the BP antigen 180 (BP180) and the BP antigen 230 (BP230). Autoantibodies against the extracellular domain (ECD) of BP180 are thought to play an initiatory role in subepidermal blister formation. To characterize the targeted antigenic sites on BP180, we have assessed the reactivity of sera from BP and PG patients against eukaryotic recombinant proteins encompassing various portions of the ECD and the intracellular domain (ICD) of BP180. Twenty-two of 22 (100%) BP sera that immunoblotted BP180 in keratinocyte extracts, bound a mutant form consisting of the entire ECD of BP180, whereas only three of these 22 sera (14%) reacted against the ECD of BP180 lacking the NC16A membrane proximal region. Thirteen out of the 22 (59%) BP sera recognized the ICD of BP180. Circulating IgG from a representative BP patient that was affinity purified against the ECD of BP180 did not bind the ICD when reblotted, indicating that there was no antigenic cross-reactivity between the ECD and the ICD of BP180. Reactivity against the ICD of BP180 was further ascertained by immunofluorescence microscopy studies showing that nine of the 22 (41%) BP sera stained COS-7 cells expressing the ICD of BP180. Using deletion mutants of the ICD of BP180, the majority of the sera was found to recognize the central region of the ICD of BP180. Specifically, an immunodominant region was localized to an 87-amino acid segment located towards the NH2-terminus of BP180. In contrast to BP sera, five of six (83%) PG sera contained IgG that recognized exclusively the NC16A region, whereas none bound to the ICD of BP180. Together, the results indicate that in BP, autoantibody reactivity to BP180 is not exclusively restricted to the NC16A region, but that additional antigenic determinants exist on the ICD of BP180. The observed heterogeneous

  20. Modelling and Analysis of Dynamic Reconfiguration in BP-Calculus

    DEFF Research Database (Denmark)

    Abouzaid, Faisal; Mullins, John; Mazzara, Manuel

    2012-01-01

    The BP-calculus is a formalism based on the π-calculus and encoded in WS-BPEL. The BP-calculus is intended to specificaly model and verify Service Oriented Applications. One important feature of SOA is the ability to compose services that may dynamically evolve along runtime. Dynamic...... reconfiguration of services increases their availability, but puts accordingly, heavy demands for validation, verification, and evaluation. In this paper we formally model and analyze dynamic reconfigurations and their requirements in BP-calculus and show how reconfigurable components can be modeled using...

  1. AcEST: BP914184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000056_A06 602 Adiantum capillus-veneris mRNA. clone: YMU001_000056_A06. BP914184 - Show BP914184...is mRNA. clone: YMU001_000056_A06. Accession BP914184 Tissue type prothallium Developmental stage - Contig I...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914184|Adiantum capillus-veneris mRNA, clo...ycf2-A P... 31 4.2 sp|Q09FP8|YCF2_NANDO Protein ycf2 OS=Nandina domestica GN=ycf2-A... 31 5.5 sp|O18400|PITX...HDLLHRSSI 116 D S +LP+L + N +++FHD++H S I Sbjct: 1254 DTFSDLLPILSSSQNFVSIFHDIMHGSDI 1282 >sp|O184

  2. AcEST: BP914040 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_B12 523 Adiantum capillus-veneris mRNA. clone: YMU001_000039_B12. BP914040 - Show BP914040...is mRNA. clone: YMU001_000039_B12. Accession BP914040 Tissue type prothallium Developmental stage - Contig I...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucl...eic Acids Res. 25:3389-3402. Query= BP914040|Adiantum capillus-veneris mRNA, clone: YMU001_000039_B12. (523 ... ... 33 1.1 sp|Q758T8|SWC3_ASHGO SWR1-complex protein 3 OS=Ashbya gossypii G... 32 1.8 sp|P32583|SRP40_YEAST

  3. BP Spill in the Gulf of Mexico Sediment Data

    Data.gov (United States)

    U.S. Environmental Protection Agency — In response to the BP oil spill, EPA monitored sediment near the spill. While emergency response data collection has ended, results continue to be available on this...

  4. AcEST: BP912125 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D07 558 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D07. BP912125 - Show BP91212...is mRNA. clone: YMU001_000015_D07. Accession BP912125 Tissue type prothallium Developmental stage - Contig I...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912125|Adiantum capillus-veneris mRN...A, clone: YMU001_000015_D07. (558 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...copeptide repeat-containing protein At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12

  5. AcEST: BP921212 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_A09 361 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A09. BP921212 - Show BP921212...is mRNA. clone: YMU001_000147_A09. Accession BP921212 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921212|Adiantum capillus-veneris... mRNA, clone: YMU001_000147_A09. (361 letters) Database: uniprot_sprot.fasta 412,...itol-4,5-bisphosphate 3-ki... 30 2.9 sp|O14338|YB33_SCHPO Uncharacterized serine-rich protein C2F12.0... 29

  6. AcEST: BP912127 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D09 582 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D09. BP912127 - Show BP91212...is mRNA. clone: YMU001_000015_D09. Accession BP912127 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912127|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D09. (582 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total ...p|P42825|DNAJ2_ARATH Chaperone protein dnaJ 2 OS=Arabidopsis th... 79 2e-14 sp|Q09912|PSI1_SCHPO Protein psi

  7. AcEST: BP913939 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_B01 468 Adiantum capillus-veneris mRNA. clone: YMU001_000038_B01. BP913939 - Show BP913939...is mRNA. clone: YMU001_000038_B01. Accession BP913939 Tissue type prothallium Developmental stage - Contig I...Nucleic Acids Res. 25:3389-3402. Query= BP913939|Adiantum capillus-veneris mRNA, ... F member 3... 86 9e-17 sp|Q66H39|ABCF3_RAT ATP-binding cassette sub-family F member 3 O... 85 1e-16 sp|Q5R9...aracterized ABC transporter ATP-binding... 56 6e-08 sp|P63390|YHES_ECO57 Uncharacterized ABC transporter ATP

  8. Evaluation of the Specificity of BP3385 for Bordetella pertussis

    Science.gov (United States)

    BP3385 has been proposed as a diagnostic PCR target for discriminating between Bordetella pertussis and other Bordetella species that also infect humans. Our results demonstrate this gene is also present in some strains of Bordetella hinzii and Bordetella bronchiseptica....

  9. AcEST: BP919750 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_F12 507 Adiantum capillus-veneris mRNA. clone: YMU001_000128_F12. BP919750 - Show BP9197...is mRNA. clone: YMU001_000128_F12. Accession BP919750 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197...-protein kinase W... 30 4.4 sp|Q2M197|PYRG_DROPS CTP synthase OS=Drosophila pseudoobscura ps... 30 5.7 sp|Q5...0 Identities = 24/95 (25%), Positives = 40/95 (42%) Frame = +2 Query: 197 AACLHNFWSLSHSLQYVCKMQLSRRQ*PCTYYID

  10. AcEST: BP919033 [AcEST

    Lifescience Database Archive (English)

    Full Text Available eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919033|Adiantum cap...(1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs

  11. AcEST: BP917547 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917547|Adiantum c

  12. AcEST: BP920739 [AcEST

    Lifescience Database Archive (English)

    Full Text Available J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic ...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9207

  13. AcEST: BP913125 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. ...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913125|Adiantum

  14. AcEST: BP917518 [AcEST

    Lifescience Database Archive (English)

    Full Text Available of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91... David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, N

  15. Assessing Specific Oligonucleotides and Small Molecule Antibiotics for the Ability to Inhibit the CRD-BP-CD44 RNA Interaction

    Science.gov (United States)

    Thomsen, Dana; Lee, Chow H.

    2014-01-01

    Studies on Coding Region Determinant-Binding Protein (CRD-BP) and its orthologs have confirmed their functional role in mRNA stability and localization. CRD-BP is present in extremely low levels in normal adult tissues, but it is over-expressed in many types of aggressive human cancers and in neonatal tissues. Although the exact role of CRD-BP in tumour progression is unclear, cumulative evidence suggests that its ability to physically associate with target mRNAs is an important criterion for its oncogenic role. CRD-BP has high affinity for the 3′UTR of the oncogenic CD44 mRNA and depletion of CRD-BP in cells led to destabilization of CD44 mRNA, decreased CD44 expression, reduced adhesion and disruption of invadopodia formation. Here, we further characterize the CRD-BP-CD44 RNA interaction and assess specific antisense oligonucleotides and small molecule antibiotics for their ability to inhibit the CRD-BP-CD44 RNA interaction. CRD-BP has a high affinity for binding to CD44 RNA nts 2862–3055 with a Kd of 645 nM. Out of ten antisense oligonucleotides spanning nts 2862–3055, only three antisense oligonucleotides (DD4, DD7 and DD10) were effective in competing with CRD-BP for binding to 32P-labeled CD44 RNA. The potency of DD4, DD7 and DD10 in inhibiting the CRD-BP-CD44 RNA interaction in vitro correlated with their ability to specifically reduce the steady-state level of CD44 mRNA in cells. The aminoglycoside antibiotics neomycin, paramomycin, kanamycin and streptomycin effectively inhibited the CRD-BP-CD44 RNA interaction in vitro. Assessing the potential inhibitory effect of aminoglycoside antibiotics including neomycin on the CRD-BP-CD44 mRNA interaction in cells proved difficult, likely due to their propensity to non-specifically bind nucleic acids. Our results have important implications for future studies in finding small molecules and nucleic acid-based inhibitors that interfere with protein-RNA interactions. PMID:24622399

  16. The human element of right-sizing. BP experiences

    Energy Technology Data Exchange (ETDEWEB)

    Hollis, J.W. [BP Norge (Norway)

    1994-12-31

    BP (British Petroleum) Exploration has been engaged in a world-wide repositioning exercise to improve its business performance. Despite a 40% fall in average oil price, the profitability and revenues have both grown, while the workforce has more than halved. BP is now able to test itself against price assumptions as low as $ 14 a barrel and make as good a return as it was near to $ 20. The paper discusses such a process of repositioning

  17. BP/Mobil. Joint-venture directions for use

    International Nuclear Information System (INIS)

    Anon.

    1997-01-01

    This paper analyzes the economical reasons which have led BP and Mobil companies to join their forces in 1996. Thanks to their complementarity and to their European implantation, the two companies could win the first or second position in petroleum products marketing in 8 European countries. The cumulated petrol sales and the number of petrol stations of the BP/Mobil joint venture are the highest in Europe (800 petrol stations in France). (J.S.)

  18. The human element of right-sizing. BP experiences

    International Nuclear Information System (INIS)

    Hollis, J.W.

    1994-01-01

    BP (British Petroleum) Exploration has been engaged in a world-wide repositioning exercise to improve its business performance. Despite a 40% fall in average oil price, the profitability and revenues have both grown, while the workforce has more than halved. BP is now able to test itself against price assumptions as low as $ 14 a barrel and make as good a return as it was near to $ 20. The paper discusses such a process of repositioning

  19. 4977-bp mitochondrial DNA deletion in infertile patients with varicocele.

    Science.gov (United States)

    Gashti, N G; Salehi, Z; Madani, A H; Dalivandan, S T

    2014-04-01

    Varicocele is the abnormal inflexion and distension of veins of the pampiniform plexus within spermatic cord and is one of the amendable causes of male infertility. It can increase reactive oxygen species (ROS) production in semen and cause oxidative stress. The purpose of this study was to analyse spermatozoa mtDNA 4977-bp deletion in infertile men with varicocele. To detect 4977-bp deletion in spermatozoa mtDNA, semen samples of 60 infertile patients with clinical varicocele and 90 normal men from northern Iran were prepared. After extraction of spermatozoa total DNA, Gap polymerase chain reaction (Gap PCR) was performed. 4977-bp deletion was observed in 81.66% of patients with varicocele, while approximately 15.55% of controls had this deletion. As spermatozoa from patients with varicocele had a high frequency of occurrence of 4977-bp deletion in mtDNA [OR = 24.18, 95% confidence interval (CI) = 10.15-57.57, P deletion in spermatozoa and cause infertility in north Iranian men. However, to determine the relation between sperm mtDNA 4977-bp deletion and varicocele-induced infertility, larger population-based studies are needed. It is concluded that there is an association between sperm mtDNA 4977-bp deletion and varicocele-induced infertility in the population studied. © 2013 Blackwell Verlag GmbH.

  20. Characterization of a phiBP endolysin encoded by the Paenibacillus polymyxa CCM 7400 phage.

    Science.gov (United States)

    Ugorcakova, Jana; Medzova, Livia; Solteszova, Barbora; Bukovska, Gabriela

    2015-07-01

    Endolysin (gp1.2) from the Paenibacillus polymyxa CCM 7400 temperate phage phiBP has a modular structure consisting of an N-terminal region with a catalytic glycosyl hydrolase 25 domain and a C-terminal cell wall-binding domain. The entire gene of this endolysin and fragments containing its catalytic and binding domains separately were cloned into expression vectors and the corresponding recombinant proteins were expressed in Escherichia coli and purified by affinity chromatography. The lytic activities of endolysin and its catalytic domain were tested on cell wall substrates from paenibacilli, bacilli, corynebacteria and E. coli. The presence of a cell wall-binding domain was found to be essential, as the phiBP endolysin was fully active only as a full-length protein. The binding ability of the cell wall-binding domain alone and in fusion with green fluorescent protein was demonstrated by specific binding assays to the cell surface of P. polymyxa CCM 7400 and to those of other Paenibacillus strains. Thus the ability of phiBP endolysin to hydrolyze the paenibacilli cell wall was confirmed. © FEMS 2015. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  1. Telomere length analysis.

    Science.gov (United States)

    Canela, Andrés; Klatt, Peter; Blasco, María A

    2007-01-01

    Most somatic cells of long-lived species undergo telomere shortening throughout life. Critically short telomeres trigger loss of cell viability in tissues, which has been related to alteration of tissue function and loss of regenerative capabilities in aging and aging-related diseases. Hence, telomere length is an important biomarker for aging and can be used in the prognosis of aging diseases. These facts highlight the importance of developing methods for telomere length determination that can be employed to evaluate telomere length during the human aging process. Telomere length quantification methods have improved greatly in accuracy and sensitivity since the development of the conventional telomeric Southern blot. Here, we describe the different methodologies recently developed for telomere length quantification, as well as their potential applications for human aging studies.

  2. Angiogenenic effects of BpLec, a C-type lectin isolated from Bothrops pauloensis snake venom.

    Science.gov (United States)

    Castanheira, Letícia Eulalio; Lopes, Daiana Silva; Gimenes, Sarah Natalie Cirilo; Deconte, Simone Ramos; Ferreira, Bruno Antônio; Alves, Patricia Terra; Filho, Luiz Ricardo Goulart; Tomiosso, Tatiana Carla; Rodrigues, Renata Santos; Yoneyama, Kelly Aparecida Geraldo; Araújo, Fernanda de Assis; Rodrigues, Veridiana de Melo

    2017-09-01

    The present work reports the effects of a C-type lectin (BpLec) isolated from Bothrops pauloensis snake venom upon in vitro and in vivo angiogenesis models. Initially, we noted that BpLec was not cytotoxic to endothelial cells (tEnd) in doses up to 40μg/mL, but lower doses (2.5μg/mL, 5μg/mL, 10μg/mL and 20μg/mL) reduced tEnd cells adhesion to some extracellular matrix proteins and inhibited the in vitro vessel formation in Matrigel assay stimulated by bFGF. β-galactosides (d-lactose, N-acetyl-d-galactosamine and d-galactose) at 400mM reversed the effect of BpLec on tEnd cells adhesion, whereas d-galactose (400mM) partially reversed BpLec property of inhibiting vessel formation by tEnd cells in Matrigel. In vivo assays showed that BpLec increased hemoglobin content and capillary vessels number in polyether-polyurethane sponge discs subcutaneously implanted into dorsal skin mice. Additionally, BpLec also reduced collagen deposition and did not induce a pro-inflammatory response, as demonstrated by the decreased the secretion of some inflammatory cytokines, whereas myeloperoxidase (MPO) and N-acetylglucosaminidase (NAG) activities were not altered by BpLec. Taken together, our results indicate that BpLec might represent an interesting angiogenesis and inflammatory modulator that could also be used for searching possible therapeutic targets involved in these processes. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Telomere length and depression

    DEFF Research Database (Denmark)

    Wium-Andersen, Marie Kim; Ørsted, David Dynnes; Rode, Line

    2017-01-01

    BACKGROUND: Depression has been cross-sectionally associated with short telomeres as a measure of biological age. However, the direction and nature of the association is currently unclear. AIMS: We examined whether short telomere length is associated with depression cross-sectionally as well...... as prospectively and genetically. METHOD: Telomere length and three polymorphisms, TERT, TERC and OBFC1, were measured in 67 306 individuals aged 20-100 years from the Danish general population and associated with register-based attendance at hospital for depression and purchase of antidepressant medication....... RESULTS: Attendance at hospital for depression was associated with short telomere length cross-sectionally, but not prospectively. Further, purchase of antidepressant medication was not associated with short telomere length cross-sectionally or prospectively. Mean follow-up was 7.6 years (range 0...

  4. Myofilament length dependent activation

    Energy Technology Data Exchange (ETDEWEB)

    de Tombe, Pieter P.; Mateja, Ryan D.; Tachampa, Kittipong; Mou, Younss Ait; Farman, Gerrie P.; Irving, Thomas C. (IIT); (Loyola)

    2010-05-25

    The Frank-Starling law of the heart describes the interrelationship between end-diastolic volume and cardiac ejection volume, a regulatory system that operates on a beat-to-beat basis. The main cellular mechanism that underlies this phenomenon is an increase in the responsiveness of cardiac myofilaments to activating Ca{sup 2+} ions at a longer sarcomere length, commonly referred to as myofilament length-dependent activation. This review focuses on what molecular mechanisms may underlie myofilament length dependency. Specifically, the roles of inter-filament spacing, thick and thin filament based regulation, as well as sarcomeric regulatory proteins are discussed. Although the 'Frank-Starling law of the heart' constitutes a fundamental cardiac property that has been appreciated for well over a century, it is still not known in muscle how the contractile apparatus transduces the information concerning sarcomere length to modulate ventricular pressure development.

  5. Upper Extremity Length Equalization

    OpenAIRE

    DeCoster, Thomas A.; Ritterbusch, John; Crawford, Mark

    1992-01-01

    Significant upper extremity length inequality is uncommon but can cause major functional problems. The ability to position and use the hand may be impaired by shortness of any of the long bones of the upper extremity. In many respects upper and lower extremity length problems are similar. They most commonly occur after injury to a growing bone and the treatment modalities utilized in the lower extremity may be applied to the upper extremity. These treatment options include epiphysiodesis, sho...

  6. Preliminary Geological Findings on the BP-1 Simulant

    Science.gov (United States)

    Stoeser, D. B.; Rickman, D. L.; Wilson, S.

    2010-01-01

    A waste material from an aggregate producing quarry has been used to make an inexpensive lunar simulant called BP-1. The feedstock is the Black Point lava flow in northern Arizona. Although this is part of the San Francisco volcanic field, which is also the source of the JSC-1 series feedstock, BP-1 and JSC-1 are distinct. Chemically, the Black Point flow is an amygdaloidal nepheline-bearing basalt. The amygdules are filled with secondary minerals containing opaline silica, calcium carbonate, and ferric iron minerals. X-ray diffraction (XRD) detected approximately 3% quartz, which is in line with tests done by the Kennedy Space Center Industrial Hygiene Office. Users of this material should use appropriate protective equipment. XRD also showed the presence of significant halite and some bassanite. Both are interpreted to be evaporative residues due to recycling of wash water at the quarry. The size distribution of BP-1 may be superior to some other simulants for some applications.

  7. 200-BP-5 operable unit treatability test report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-04-01

    The 200-BP-5 Operable Unit was established in response to recommendations presented in the 200 East Groundwater Aggregate Area Management Study Report (AAMSR) (DOE-RL 1993a). Recognizing different approaches to remediation, the groundwater AAMSR recommended separating groundwater from source and vadose zone operable units and subdividing 200 East Area groundwater into two operable units. The division between the 200-BP-5 and 200-PO-1 Operable Units was based principally on source operable unit boundaries and distribution of groundwater plumes derived from either B Plant or Plutonium/Uranium Extraction (PUREX) Plant liquid waste disposal sites.

  8. Acute Toxicity and Ecological Risk Assessment of Benzophenone-3 (BP-3 and Benzophenone-4 (BP-4 in Ultraviolet (UV-Filters

    Directory of Open Access Journals (Sweden)

    Yang Du

    2017-11-01

    Full Text Available Ultraviolet (UV-absorbing chemicals (UV filters are used in personal care products for the protection of human skin and hair from damage by UV radiation. Although these substances are released into the environment in the production and consumption processes, little is known about their ecotoxicology effects. The acute toxicity and potential ecological risk of UV filters benzophenone-3 (BP-3 and benzophenone-4 (BP-4 on Chlorella vulgaris, Daphnia magna, and Brachydanio rerio were analyzed in the present study. The EC50 values (96 h of BP-3 and BP-4 on C. vulgaris were 2.98 and 201.00 mg/L, respectively. The 48 h-LC50 of BP-3 and BP-4 on D. magna were 1.09 and 47.47 mg/L, respectively. The 96 h-LC50 of BP-3 and BP-4 on B. rerio were 3.89 and 633.00 mg/L, respectively. The toxicity of a mixture of BP-3 and BP-4 on C. vulgaris, D. magna, and B. rerio all showed antagonistic effects. The induced predicted no-effect concentrations of BP-3 and BP-4 by the assessment factor method were 1.80 × 10−3 and 0.47 mg/L, respectively, by assessment factor (AF method, which were both lower than the concentrations detected in the environment at present, verifying that BP-3 and BP-4 remain low-risk chemicals to the aquatic ecosystem.

  9. Acute Toxicity and Ecological Risk Assessment of Benzophenone-3 (BP-3) and Benzophenone-4 (BP-4) in Ultraviolet (UV)-Filters.

    Science.gov (United States)

    Du, Yang; Wang, Wen-Qian; Pei, Zhou-Tao; Ahmad, Fahmi; Xu, Rou-Rou; Zhang, Yi-Min; Sun, Li-Wei

    2017-11-19

    Ultraviolet (UV)-absorbing chemicals (UV filters) are used in personal care products for the protection of human skin and hair from damage by UV radiation. Although these substances are released into the environment in the production and consumption processes, little is known about their ecotoxicology effects. The acute toxicity and potential ecological risk of UV filters benzophenone-3 (BP-3) and benzophenone-4 (BP-4) on Chlorella vulgaris , Daphnia magna , and Brachydanio rerio were analyzed in the present study. The EC 50 values (96 h) of BP-3 and BP-4 on C. vulgaris were 2.98 and 201.00 mg/L, respectively. The 48 h-LC 50 of BP-3 and BP-4 on D. magna were 1.09 and 47.47 mg/L, respectively. The 96 h-LC 50 of BP-3 and BP-4 on B. rerio were 3.89 and 633.00 mg/L, respectively. The toxicity of a mixture of BP-3 and BP-4 on C. vulgaris , D. magna , and B. rerio all showed antagonistic effects. The induced predicted no-effect concentrations of BP-3 and BP-4 by the assessment factor method were 1.80 × 10 -3 and 0.47 mg/L, respectively, by assessment factor (AF) method, which were both lower than the concentrations detected in the environment at present, verifying that BP-3 and BP-4 remain low-risk chemicals to the aquatic ecosystem.

  10. Mitotic protein kinase CDK1 phosphorylation of mRNA translation regulator 4E-BP1 Ser83 may contribute to cell transformation

    Energy Technology Data Exchange (ETDEWEB)

    Velasquez, Celestino; Cheng, Erdong; Shuda, Masahiro; Lee-Oesterreich, Paula J.; Pogge von Strandmann, Lisa; Gritsenko, Marina A.; Jacobs, Jon M.; Moore, Patrick S.; Chang, Yuan

    2016-07-11

    mTOR-directed 4E-BP1 phosphorylation promotes cap-dependent translation and tumorigen-esis. During mitosis, CDK1 substitutes for mTOR and fully phosphorylates 4E-BP1 at canoni-cal as well a non-canonical S83 site resulting in a mitosis-specific hyperphosphorylated δ isoform. Colocalization studies with a phospho-S83 specific antibody indicate that 4E-BP1 S83 phosphorylation accumulates at centrosomes during prophase, peaks at metaphase, and decreases through telophase. While S83 phosphorylation of 4E-BP1 does not affect in vitro cap-dependent translation, nor eIF4G/4E-BP1 cap-binding, expression of an alanine substitution mutant 4E-BP1.S83A partially reverses rodent cell transformation induced by Merkel cell polyomavirus (MCV) small T (sT) antigen viral oncoprotein. In contrast to inhibitory mTOR 4E-BP1 phosphorylation, these findings suggest that mitotic CDK1-directed phosphorylation of δ-4E-BP1 may yield a gain-of-function, distinct from translation regulation, that may be important in tumorigenesis and mitotic centrosome function.

  11. Relativistic Length Agony Continued

    Science.gov (United States)

    Redzic, D. V.

    2014-06-01

    We made an attempt to remedy recent confusing treatments of some basic relativistic concepts and results. Following the argument presented in an earlier paper (Redzic 2008b), we discussed the misconceptions that are recurrent points in the literature devoted to teaching relativity such as: there is no change in the object in Special Relativity, illusory character of relativistic length contraction, stresses and strains induced by Lorentz contraction, and related issues. We gave several examples of the traps of everyday language that lurk in Special Relativity. To remove a possible conceptual and terminological muddle, we made a distinction between the relativistic length reduction and relativistic FitzGerald-Lorentz contraction, corresponding to a passive and an active aspect of length contraction, respectively; we pointed out that both aspects have fundamental dynamical contents. As an illustration of our considerations, we discussed briefly the Dewan-Beran-Bell spaceship paradox and the 'pole in a barn' paradox.

  12. Telomere Length and Mortality

    DEFF Research Database (Denmark)

    Kimura, Masayuki; Hjelmborg, Jacob V B; Gardner, Jeffrey P

    2008-01-01

    Leukocyte telomere length, representing the mean length of all telomeres in leukocytes, is ostensibly a bioindicator of human aging. The authors hypothesized that shorter telomeres might forecast imminent mortality in elderly people better than leukocyte telomere length. They performed mortality...... telomeres predicted the death of the first co-twin better than the mTRFL did (mTRFL: 0.56, 95% confidence interval (CI): 0.49, 0.63; mTRFL(50): 0.59, 95% CI: 0.52, 0.66; mTRFL(25): 0.59, 95% CI: 0.52, 0.66; MTRFL: 0.60, 95% CI: 0.53, 0.67). The telomere-mortality association was stronger in years 3-4 than...

  13. Cabinet chooses TNK-BP, but doors remain open

    Index Scriptorium Estoniae

    2005-01-01

    Leedu valitsus alustab Vene-Suurbritannia ühisfirmaga TNK-BP läbirääkimisi Mazeikiu Nafta aktsiaenamuse omandamiseks. Kuid samal ajal on võimalik alustada läbirääkimisi ka teiste võimalike investoritega

  14. PM : Cabinet likely to choose TNK-BP

    Index Scriptorium Estoniae

    2005-01-01

    Tõenäoliselt saab Mazeikiu Nafta aktsiate ostjaks Suurbritannia-Vene ettevõte TNK-BP. Endiselt soovib ka Leedu Jukose osa naftakompaniist osta, kuid selleks raha laenamine võib mõjutada riigi majandust ja üleminekut eurole

  15. Antiplasmodial Activity of Bp16524 and Su 2242 Against ...

    African Journals Online (AJOL)

    ... activity but was not effective against established infection. Significant (p<0.05) activity was observed in SU 2242 (both for early and established infections). Keywords: BP16524, SU 2242, Plasmodium berghei, early and established infections. West African Journal of Pharmacology and Drug Research Vol. 22/23 2007: pp.

  16. EST Table: BP123885 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP123885 epV31590 10/09/28 57 %/174 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 55 %/163 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1

  17. EST Table: BP125106 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP125106 fbpv0387 10/09/28 58 %/165 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 56 %/165 aa FBpp0212871|DsimGD14469-PA 10/08/28 n.h 10/09/1

  18. EST Table: BP123135 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP123135 epV30626 10/09/28 55 %/243 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 51 %/241 aa FBpp0127246|DanaGF24054-PA 10/08/28 n.h 10/09/1

  19. EST Table: BP125521 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP125521 fbpv0944 10/09/28 59 %/165 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 56 %/164 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1

  20. TopBP1-mediated DNA processing during mitosis.

    Science.gov (United States)

    Gallina, Irene; Christiansen, Signe Korbo; Pedersen, Rune Troelsgaard; Lisby, Michael; Oestergaard, Vibe H

    2016-01-01

    Maintenance of genome integrity is crucial to avoid cancer and other genetic diseases. Thus faced with DNA damage, cells mount a DNA damage response to avoid genome instability. The DNA damage response is partially inhibited during mitosis presumably to avoid erroneous processing of the segregating chromosomes. Yet our recent study shows that TopBP1-mediated DNA processing during mitosis is highly important to reduce transmission of DNA damage to daughter cells. (1) Here we provide an overview of the DNA damage response and DNA repair during mitosis. One role of TopBP1 during mitosis is to stimulate unscheduled DNA synthesis at underreplicated regions. We speculated that such genomic regions are likely to hold stalled replication forks or post-replicative gaps, which become the substrate for DNA synthesis upon entry into mitosis. Thus, we addressed whether the translesion pathways for fork restart or post-replicative gap filling are required for unscheduled DNA synthesis in mitosis. Using genetics in the avian DT40 cell line, we provide evidence that unscheduled DNA synthesis in mitosis does not require the translesion synthesis scaffold factor Rev1 or PCNA ubiquitylation at K164, which serve to recruit translesion polymerases to stalled forks. In line with this finding, translesion polymerase η foci do not colocalize with TopBP1 or FANCD2 in mitosis. Taken together, we conclude that TopBP1 promotes unscheduled DNA synthesis in mitosis independently of the examined translesion polymerases.

  1. EST Table: BP182279 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP182279 NRPG0386 10/09/28 100 %/161 aa ref|NP_001040402.1| preimplantation protein... [Bombyx mori] gb|ABF51322.1| preimplantation protein [Bombyx mori] 10/08/29 87 %/162 aa FBpp0252287|DwilGK2

  2. EST Table: BP179826 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP179826 ovS307E02f 10/09/28 41 %/156 aa ref|XP_969699.1| PREDICTED: similar to fuzzy...-PA 10/09/10 41 %/156 aa gi|91081315|ref|XP_969699.1| PREDICTED: similar to fuzzy CG13396-PA [Tribolium castaneum] CK514734 ovS3 ...

  3. Note: Primer Amysat 001; Fragment size is 211bp

    Indian Academy of Sciences (India)

    Renuka

    Bhandara : Lanes 1–14 represent different strains of Bhandara Ecorace. Note: Primer Amysat 001; Fragment size is 211bp. Fig. 1. SSR profiles generated from genomic DNA of 16 strains from different individuals of (A.L, D. TV, D. BV, Modal, Sukinda, Raily, Bhandara) ecoraces of tasar silk worm, Antheraea mylitta using the.

  4. AcEST: BP914165 [AcEST

    Lifescience Database Archive (English)

    Full Text Available and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query=...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914165|Adiantum capillus-veneris mR..., and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of pro

  5. AcEST: BP912141 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Que...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912141|Adiantum capillus-veneris

  6. AcEST: BP921159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921159|Adiantum cap

  7. AcEST: BP921102 [AcEST

    Lifescience Database Archive (English)

    Full Text Available BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402.... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921102|Adiantum capillus-ven

  8. AcEST: BP914485 [AcEST

    Lifescience Database Archive (English)

    Full Text Available d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= B...and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search progra...ms, Nucleic Acids Res. 25:3389-3402. Query= BP914485|Adiantum capillus-veneris mRNA

  9. AcEST: BP913047 [AcEST

    Lifescience Database Archive (English)

    Full Text Available generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913047|Adiantum ca...Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs

  10. AcEST: BP911682 [AcEST

    Lifescience Database Archive (English)

    Full Text Available eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911682|Adiantum cap...iller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs

  11. AcEST: BP913736 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sociated histidine-rich protein OS=Plasmodium falciparum (isolate NF7 / Ghana) Align length 85 Score (bit) 3...modium falciparum (isolate NF7 / Ghana) GN=SD17 PE=4 SV=1 Length = 657 Score = 32

  12. The dependence of scattering length on van der Waals interaction ...

    Indian Academy of Sciences (India)

    2016-06-16

    Jun 16, 2016 ... DOI 10.1007/s12043-016-1221-y. The dependence of scattering length on van der Waals interaction and reduced mass of the system in two-atomic collision at cold energies. HASI RAY1,2,3,4. 1Study Centre, S-1/407/6, B.P. Township, Kolkata 700 094, India. 2Department of Physics, New Alipore College, ...

  13. The mitochondrial DNA 4,977-bp deletion and its implication in copy number alteration in colorectal cancer

    Science.gov (United States)

    2011-01-01

    Background Qualitative and quantitative changes in human mitochondrial DNA (mtDNA) have been implicated in various cancer types. A 4,977 bp deletion in the major arch of the mitochondrial genome is one of the most common mutations associated with a variety of human diseases and aging. Methods We conducted a comprehensive study on clinical features and mtDNA of 104 colorectal cancer patients in the Wenzhou area of China. In particular, using a quantitative real time PCR method, we analyzed the 4,977 bp deletion and mtDNA content in tumor tissues and paired non-tumor areas from these patients. Results We found that the 4,977 bp deletion was more likely to be present in patients of younger age (≤65 years, p = 0.027). In patients with the 4,977 bp deletion, the deletion level decreased as the cancer stage advanced (p = 0.031). Moreover, mtDNA copy number in tumor tissues of patients with this deletion increased, both compared with that in adjacent non-tumor tissues and with in tumors of patients without the deletion. Such mtDNA content increase correlated with the levels of the 4,977 bp deletion and with cancer stage (p deletion may play a role in the early stage of colorectal cancer, and it is also implicated in alteration of mtDNA content in cancer cells. PMID:21232124

  14. Increased 4E-BP1 Expression Protects against Diet-Induced Obesity and Insulin Resistance in Male Mice

    Directory of Open Access Journals (Sweden)

    Shih-Yin Tsai

    2016-08-01

    Full Text Available Obesity is a major risk factor driving the global type II diabetes pandemic. However, the molecular factors linking obesity to disease remain to be elucidated. Gender differences are apparent in humans and are also observed in murine models. Here, we link these differences to expression of eukaryotic translation initiation factor 4E binding protein 1 (4E-BP1, which, upon HFD feeding, becomes significantly reduced in the skeletal muscle and adipose tissue of male but not female mice. Strikingly, restoring 4E-BP1 expression in male mice protects them against HFD-induced obesity and insulin resistance. Male 4E-BP1 transgenic mice also exhibit reduced white adipose tissue accumulation accompanied by decreased circulating levels of leptin and triglycerides. Importantly, transgenic 4E-BP1 male mice are also protected from aging-induced obesity and metabolic decline on a normal diet. These results demonstrate that 4E-BP1 is a gender-specific suppressor of obesity that regulates insulin sensitivity and energy metabolism.

  15. Full Length Research Article

    African Journals Online (AJOL)

    Administrator

    Out of the 320 male sheep examined, 87(27.2%) were infected, while 9(19.1%) of the 47 females examined were infected (Table 2). Infection varied from one abattoir to another. Age related distribution of P. cervi is shown in Table 3. Out of 356 adult sheep (>2yrs) examined, 35. Full Length Research Article. 12 ...

  16. Protein phosphatase PPM1G regulates protein translation and cell growth by dephosphorylating 4E binding protein 1 (4E-BP1).

    Science.gov (United States)

    Liu, Jianyu; Stevens, Payton D; Eshleman, Nichole E; Gao, Tianyan

    2013-08-09

    Protein translation initiation is a tightly controlled process responding to nutrient availability and mitogen stimulation. Serving as one of the most important negative regulators of protein translation, 4E binding protein 1 (4E-BP1) binds to translation initiation factor 4E and inhibits cap-dependent translation in a phosphorylation-dependent manner. Although it has been demonstrated previously that the phosphorylation of 4E-BP1 is controlled by mammalian target of rapamycin in the mammalian target of rapamycin complex 1, the mechanism underlying the dephosphorylation of 4E-BP1 remains elusive. Here, we report the identification of PPM1G as the phosphatase of 4E-BP1. A coimmunoprecipitation experiment reveals that PPM1G binds to 4E-BP1 in cells and that purified PPM1G dephosphorylates 4E-BP1 in vitro. Knockdown of PPM1G in 293E and colon cancer HCT116 cells results in an increase in the phosphorylation of 4E-BP1 at both the Thr-37/46 and Ser-65 sites. Furthermore, the time course of 4E-BP1 dephosphorylation induced by amino acid starvation or mammalian target of rapamycin inhibition is slowed down significantly in PPM1G knockdown cells. Functionally, the amount of 4E-BP1 bound to the cap-dependent translation initiation complex is decreased when the expression of PPM1G is depleted. As a result, the rate of cap-dependent translation, cell size, and protein content are increased in PPM1G knockdown cells. Taken together, our study has identified protein phosphatase PPM1G as a novel regulator of cap-dependent protein translation by negatively controlling the phosphorylation of 4E-BP1.

  17. Gap length distributions by PEPR

    International Nuclear Information System (INIS)

    Warszawer, T.N.

    1980-01-01

    Conditions guaranteeing exponential gap length distributions are formulated and discussed. Exponential gap length distributions of bubble chamber tracks first obtained on a CRT device are presented. Distributions of resulting average gap lengths and their velocity dependence are discussed. (orig.)

  18. Length of excitable knots

    Science.gov (United States)

    Maucher, Fabian; Sutcliffe, Paul

    2017-07-01

    In this paper, we present extensive numerical simulations of an excitable medium to study the long-term dynamics of knotted vortex strings for all torus knots up to crossing number 11. We demonstrate that FitzHugh-Nagumo evolution preserves the knot topology for all the examples presented, thereby providing a field theory approach to the study of knots. Furthermore, the evolution yields a well-defined minimal length for each knot that is comparable to the ropelength of ideal knots. We highlight the role of the medium boundary in stabilizing the length of the knot and discuss the implications beyond torus knots. We also show that there is not a unique attractor within a given knot topology.

  19. Pion nucleus scattering lengths

    International Nuclear Information System (INIS)

    Huang, W.T.; Levinson, C.A.; Banerjee, M.K.

    1971-09-01

    Soft pion theory and the Fubini-Furlan mass dispersion relations have been used to analyze the pion nucleon scattering lengths and obtain a value for the sigma commutator term. With this value and using the same principles, scattering lengths have been predicted for nuclei with mass number ranging from 6 to 23. Agreement with experiment is very good. For those who believe in the Gell-Mann-Levy sigma model, the evaluation of the commutator yields the value 0.26(m/sub σ//m/sub π/) 2 for the sigma nucleon coupling constant. The large dispersive corrections for the isosymmetric case implies that the basic idea behind many of the soft pion calculations, namely, slow variation of matrix elements from the soft pion limit to the physical pion mass, is not correct. 11 refs., 1 fig., 3 tabs

  20. Length-weight and length-length relationships of freshwater wild ...

    African Journals Online (AJOL)

    Length-weight and length-length relationships of freshwater wild catfish Mystus bleekeri from Nala Daik, Sialkot, Pakistan. ... Linear regression analysis was used, first to compute the degree of relationship between length and weight and then among total (TL), standard (SL) and fork lengths (FL). LWR exhibited a highly ...

  1. Relativistic length agony continued

    Directory of Open Access Journals (Sweden)

    Redžić D.V.

    2014-01-01

    Full Text Available We made an attempt to remedy recent confusing treatments of some basic relativistic concepts and results. Following the argument presented in an earlier paper (Redžić 2008b, we discussed the misconceptions that are recurrent points in the literature devoted to teaching relativity such as: there is no change in the object in Special Relativity, illusory character of relativistic length contraction, stresses and strains induced by Lorentz contraction, and related issues. We gave several examples of the traps of everyday language that lurk in Special Relativity. To remove a possible conceptual and terminological muddle, we made a distinction between the relativistic length reduction and relativistic FitzGerald-Lorentz contraction, corresponding to a passive and an active aspect of length contraction, respectively; we pointed out that both aspects have fundamental dynamical contents. As an illustration of our considerations, we discussed briefly the Dewan-Beran-Bell spaceship paradox and the ‘pole in a barn’ paradox. [Projekat Ministarstva nauke Republike Srbije, br. 171028

  2. BP-Mobil partnership. The common network takes place

    International Nuclear Information System (INIS)

    Anon.

    1997-01-01

    After the partnership between BP and Mobil was signed, the program of transformation of the petrol stations network started in November 1996 in the UK and concern 3300 stations in Europe and 800 stations in France. About 9100 stations will be transformed by the end of 1998. BP France is the operator for petroleum products (petrol, fuel, bitumens, LPG..) with a 70% share holding (30% for Mobil) while Mobil is the major shareholder (51%) for the lubricants and special products activities. The chemical, aviation nd maritime activities are not concerned. Thanks to the fusion of their down-file activities in Europe, the benefits of the partnership should reach 600 to 700 million of US Dollars each year. However the restructuring cost should reach 740 millions of US Dollars in two years, which doubles the initial estimation. Short paper. (J.S.)

  3. Baroreflex Sensitivity Decreases During 90-Day Bed Rest

    Science.gov (United States)

    Stenger, M. B.; Arzeno, N. M.; Platts, S. H.

    2008-01-01

    Baroreflex sensitivity (BRS) decreases during spaceflight and simulated spaceflight (head down bed rest [BR]). However, previous studies have only examined BRS in response to a limited blood pressure (BP) range or to a single sudden change in BP. PURPOSE: The purpose of this study was to examine BRS during 90 days of 6deg head-down tilt BR over a broad range of BP perturbations. METHODS: Nineteen normal volunteers (12M, 7F) were tested one day before BR, and then near BR days 30, 60 and 90. BP was pharmacologically altered by continuous infusions of phenylephrine (PE) and sodium nitroprusside (SNP). Electrocardiogram and continuous BP were collected during 10 min of normal saline (NS), followed by increasing concentrations of PE (10 min each of 0.4, 0.8 and 1.6 micro-g/kg/min). After a 20 min break, NS was infused again for 10 min, followed by increasing concentrations of SNP (10 min each of 0.4, 0.8, 1.2 micro-g/kg/min). Baroreceptor sensitivity was measured as the slope of a sequence of 3 or more beats in which the systolic BP and following R-R interval (RR) both increased or decreased. Spectral heart rate variability (HRV) and mean RR were analyzed using data from only the NS infusions. Two-way repeated-measures analysis of variance was performed to examine the effects of BR and gender. RESULTS: RR decreased (pbaroreflex slope, our measure of BRS, increased with PE and decreased with SNP across BR (pbaroreflex sensitivity decrease during 90 days of BR, and BRS tends to diminish more in women than in men.

  4. Validation of the Welch Allyn SureBP (inflation) and StepBP (deflation) algorithms by AAMI standard testing and BHS data analysis.

    Science.gov (United States)

    Alpert, Bruce S

    2011-04-01

    We evaluated two new Welch Allyn automated blood pressure (BP) algorithms. The first, SureBP, estimates BP during cuff inflation; the second, StepBP, does so during deflation. We followed the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard for testing and data analysis. The data were also analyzed using the British Hypertension Society analysis strategy. We tested children, adolescents, and adults. The requirements of the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard were fulfilled with respect to BP levels, arm sizes, and ages. Association for the Advancement of Medical Instrumentation SP10 Method 1 data analysis was used. The mean±standard deviation for the device readings compared with auscultation by paired, trained, blinded observers in the SureBP mode were -2.14±7.44 mmHg for systolic BP (SBP) and -0.55±5.98 mmHg for diastolic BP (DBP). In the StepBP mode, the differences were -3.61±6.30 mmHg for SBP and -2.03±5.30 mmHg for DBP. Both algorithms achieved an A grade for both SBP and DBP by British Hypertension Society analysis. The SureBP inflation-based algorithm will be available in many new-generation Welch Allyn monitors. Its use will reduce the time it takes to estimate BP in critical patient care circumstances. The device will not need to inflate to excessive suprasystolic BPs to obtain the SBP values. Deflation is rapid once SBP has been determined, thus reducing the total time of cuff inflation and reducing patient discomfort. If the SureBP fails to obtain a BP value, the StepBP algorithm is activated to estimate BP by traditional deflation methodology.

  5. Bank Organizational Structure Choice Dilemma. Case of PKO BP

    Directory of Open Access Journals (Sweden)

    Adam Szafarczyk

    2008-06-01

    Full Text Available Organizational structures are differing for different banks. They depend on individual bank economic situation, its technology, strategy and form of competition struggle. Usually the biggest EU banks are consists from formally or really independent divisions. The most common divisions are Retail Banking, Corporate Banking, Treasury and Investment, sometimes Insurance. PKO BP, the biggest Polish Bank, ought to change its structure due to implementation new IT system.

  6. EST Table: BP125370 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available 10 56 %/150 aa gi|189241063|ref|XP_967018.2| PREDICTED: similar to restin (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] FS906662 fbpv ... ...n (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] 10/08/29 55...BP125370 fbpv0758 10/09/28 56 %/150 aa ref|XP_967018.2| PREDICTED: similar to resti

  7. Predialysis Systolic BP Variability and Outcomes in Hemodialysis Patients

    Science.gov (United States)

    Sozio, Stephen M.; Bandeen-Roche, Karen J.; Ephraim, Patti L.; Luly, Jason R.; St. Peter, Wendy L.; McDermott, Aidan; Scialla, Julia J.; Crews, Deidra C.; Tangri, Navdeep; Miskulin, Dana C.; Michels, Wieneke M.; Jaar, Bernard G.; Herzog, Charles A.; Zager, Philip G.; Meyer, Klemens B.; Wu, Albert W.; Boulware, L. Ebony

    2014-01-01

    BP variability (BPV) is an important predictor of outcomes in the general population, but its association with clinical outcomes in hemodialysis patients is not clear. We identified 11,291 patients starting dialysis in 2003–2008 and followed them through December 31, 2008 (median=22 months). Predialysis systolic BPV was assessed over monthly intervals. Outcomes included factors associated with BPV, mortality (all-cause and cardiovascular), and first cardiovascular event (cardiovascular death or hospitalization). Patients' mean age was 62 years, 55% of patients were men, and 58% of patients were white. Modifiable factors associated with higher BPV included obesity, higher calcium–phosphate product levels, and lower hemoglobin concentration; factors associated with lower BPV included greater fluid removal, achievement of prescribed dry weight during dialysis, higher hemoglobin concentration, and antihypertensive regimens without β-blockers or renin-angiotensin system blocking agents. In total, 3200 deaths occurred, including 1592 cardiovascular deaths. After adjustment for demographics, comorbidities, and clinical factors, higher predialysis BPV was associated with increased risk of all-cause mortality (hazard ratio [HR], 1.18; 95% confidence interval [95% CI] per 1 SD increase in BPV, 1.13 to 1.22), cardiovascular mortality (HR, 1.18; 95% CI, 1.12 to 1.24), and first cardiovascular event (HR, 1.11; 95% CI, 1.07 to 1.15). Results were similar when BPV was categorized in tertiles and patients were stratified by baseline systolic BP. In summary, predialysis systolic BPV is an important, potentially modifiable risk factor for death and cardiovascular outcomes in incident hemodialysis patients. Studies of BP management in dialysis patients should focus on both absolute BP and BPV. PMID:24385593

  8. AcEST: BP921126 [AcEST

    Lifescience Database Archive (English)

    Full Text Available and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query=...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921126|Adiantum capillus-veneris mR...g, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of pro

  9. The fibrinogen-binding protein (FgBP) of Streptococcus equi subsp. equi additionally binds IgG and contributes to virulence in a mouse model.

    Science.gov (United States)

    Meehan, M; Lynagh, Y; Woods, C; Owen, P

    2001-12-01

    The major cell-wall-associated protein of the equine pathogen Streptococcus equi subsp. equi is an M-like fibrinogen-binding protein (FgBP) which binds equine fibrinogen (Fg) avidly, through residues located at the extreme N-terminus of the molecule. In this study, it is shown that FgBP additionally binds equine IgG-Fc. When tested against polyclonal IgG from ten other animal species, it was found that FgBP binds human, rabbit, pig and cat IgG, but does not bind mouse, rat, goat, sheep, cow or chicken IgG. Through the use of a panel of recombinant FgBP truncates containing defined deletions of sequence, it was shown that residues in the central regions of FgBP are important in IgG binding. An fbp knockout mutant which does not express FgBP on the cell surface was also constructed. Mutant cells failed to autoaggregate, bound no detectable equine Fg or IgG-Fc, were rapidly killed in horse blood, and showed greatly decreased virulence in a mouse model. Results suggest that FgBP is the major surface structure responsible for binding either Fg or IgG, that the molecule has pronounced antiphagocytic properties, and that it is a likely factor contributing to the virulence of wild-type S. equi subsp. equi.

  10. Further phenotypic expansion of 15q11.2 BP1-BP2 microdeletion (Burnside-Butler) syndrome.

    Science.gov (United States)

    Jerkovich, Adria M; Butler, Merlin G

    2014-01-01

    We report a 10-year-old Caucasian male identified with copy number variation detected by microarray analysis including a maternally inherited 15q11.2 microdeletion involving 4 genes, paternally inherited 13q12.2 microdeletion with 10 genes, and a de novo 2q14.3 duplication involving 4 genes. He had a history of speech delay, cognitive deficits, attention deficit hyperactivity disorder and a posterior lenticonus cataract removed at 5 yr of age. The genes on chromosomes 2 and 13 are not known to be involved with cataract formation, which lends further support of the role of the 15q11.2 region and additional evidence for phenotypic expansion of the 15q11.2 BP1-BP2 microdeletion (termed Burnside-Butler) syndrome.

  11. Short Rayleigh length free electron laser: Experiments and simulations

    Directory of Open Access Journals (Sweden)

    P. P. Crooker

    2008-09-01

    Full Text Available We report experiments at Jefferson National Accelerator Facility (Jlab and computer simulations performed at the Naval Postgraduate School (NPS designed to probe the small Rayleigh length regime. We compare the gain, power, and sensitivity to mirror and electron beam misalignments as a function of decreasing Rayleigh length. The agreement is quite good, with experiments and simulations showing comparable trends as the Rayleigh length is decreased. In particular, we find that the gain and power do not decrease substantially at short Rayleigh length, contrary to a common Gaussian-mode filling factor argument. Within currently achievable alignment tolerances, the gain and power are still acceptable for FEL operation.

  12. discouraged by queue length

    Directory of Open Access Journals (Sweden)

    P. R. Parthasarathy

    2001-01-01

    Full Text Available The transient solution is obtained analytically using continued fractions for a state-dependent birth-death queue in which potential customers are discouraged by the queue length. This queueing system is then compared with the well-known infinite server queueing system which has the same steady state solution as the model under consideration, whereas their transient solutions are different. A natural measure of speed of convergence of the mean number in the system to its stationarity is also computed.

  13. Primary length standard adjustment

    Science.gov (United States)

    Ševčík, Robert; Guttenová, Jana

    2007-04-01

    This paper deals with problems and techniques connected with primary length standard adjusting, which includes disassembling of the device and by use of the secondary laser with collimated beam and diffraction laws successively reassembling of the laser. In the reassembling process the device was enhanced with substituting the thermal grease cooling of cold finger by copper socket cooler. This improved external cooling system enables more effective cooling of molecular iodine in the cell, which allows better pressure stability of iodine vapor and easier readjustment of the system.

  14. AcEST: BP920265 [AcEST

    Lifescience Database Archive (English)

    Full Text Available S=Escherichia coli (strain UTI89 / UPEC) GN=macB PE=3 SV=1 Length = 648 Score = 31.6 bits (70), Expect = 1.5...i O6:K15:H31 (strain 536 / UPEC) GN=macB PE=3 SV=1 Length = 648 Score = 31.6 bits (70), Expect = 1.5 Identit

  15. AcEST: BP913277 [AcEST

    Lifescience Database Archive (English)

    Full Text Available protein crl OS=Escherichia coli (strain UTI89 / UPEC) GN=crl PE=3 SV=3 Length = 133 Score = 33.1 bits (74),... crl OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=crl PE=3 SV=3 Length = 133 Score = 33.1 bits (74)

  16. AcEST: BP915327 [AcEST

    Lifescience Database Archive (English)

    Full Text Available D OS=Escherichia coli (strain UTI89 / UPEC) Align length 36 Score (bit) 30.8 E-value 2.2 Report BLASTX 2.2.1...i-adapter protein iraD OS=Escherichia coli (strain UTI89 / UPEC) GN=iraD PE=3 SV=1 Length = 127 Score = 30.8

  17. AcEST: BP913771 [AcEST

    Lifescience Database Archive (English)

    Full Text Available crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 Length = 51...a coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 Length = 517 Score = 30.0 bits (66), Expect = 9.4 Id

  18. AcEST: BP912467 [AcEST

    Lifescience Database Archive (English)

    Full Text Available oreductase OS=Escherichia coli (strain UTI89 / UPEC) GN=uxaB PE=3 SV=1 Length = 483 Score = 29.6 bits (65), ...=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=uxaB PE=3 SV=1 Length = 483 Score = 29.6 bits (65), Expe

  19. AcEST: BP913587 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tein OS=Rattus norvegicus GN=Tpbg PE=2 SV=1 Length = 426 Score = 29.6 bits (65), ... Trophoblast glycoprotein OS=Mus musculus GN=Tpbg PE=2 SV=2 Length = 426 Score = 29.6 bits (65), Expect = 5.

  20. AcEST: BP917499 [AcEST

    Lifescience Database Archive (English)

    Full Text Available NI_CHLNI Troponin I OS=Chlamys nipponensis akazara Align length 90 Score (bit) 30...Troponin I OS=Chlamys nipponensis akazara P... 31 2.2 sp|Q13127|REST_HUMAN RE1-si...NNI_CHLNI Troponin I OS=Chlamys nipponensis akazara PE=1 SV=2 Length = 292 Score = 30.8 bits (68), Expect =

  1. AcEST: BP919299 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tive uncharacterized protein OS=Xylella fastidiosa (strain M12) GN=Xfasm12_1332 PE=4 SV=1 Length = 223 Score...tein OS=Xylella fastidiosa (strain M12) GN=Xfasm12_1313 PE=4 SV=1 Length = 232 Score = 33.9 bits (76), Expec

  2. AcEST: BP912989 [AcEST

    Lifescience Database Archive (English)

    Full Text Available icase polyprotein 1ab OS=Beet yellows virus (isolate Ukraine) Align length 37 Score (bit) 31.6 E-value 1.3 R...534|R1AB_BYVU Replicase polyprotein 1ab OS=Beet yellows virus (isolate Ukraine) GN=1a-1b PE=1 SV=2 Length =

  3. Tropical response to the 8200 yr B.P. cold event? Speleothem isotopes indicate a weakened early Holocene monsoon in Costa Rica

    Science.gov (United States)

    Lachniet, Matthew S.; Asmerom, Yemane; Burns, Stephen J.; Patterson, William P.; Polyak, Victor J.; Seltzer, Geoffrey O.

    2004-11-01

    A δ18O monsoon rainfall proxy record from a U-Th dated Costa Rican stalagmite (8840 4920 yr B.P.) documents an early Holocene dry period correlative with the high-latitude 8200 yr B.P. cold event. High δ18O values between ca. 8300 and 8000 yr B.P. demonstrate reduced rainfall and a weaker monsoon in Central America. A relatively wetter and more stable monsoon was established ca. 7600 yr B.P. The early Holocene dry event suggests a tropical-extratropical teleconnection to the 8200 yr B.P. cold event and a possible association of isthmian rainfall anomalies with high-latitude climate changes. The likely source of such a tropical anomaly is a decrease in Atlantic thermohaline circulation and atmospheric perturbations associated with drainage of proglacial lakes and freshwater discharge into the North Atlantic. A weaker monsoon at 8200 yr B.P. may be linked to wetland contraction and a decrease in methane observed in Greenland ice cores.

  4. Multiple-site mutations of phage Bp7 endolysin improves its activities against target bacteria.

    Science.gov (United States)

    Zhang, Can; Wang, Yuanchao; Sun, Huzhi; Ren, Huiying

    2015-10-01

    The widespread use of antibiotics has caused serious drug resistance. Bacteria that were once easily treatable are now extremely difficult to treat. Endolysin can be used as an alternative to antibiotics for the treatment of drug-resistant bacteria. To analyze the antibacterial activity of the endolysin of phage Bp7 (Bp7e), a 489-bp DNA fragment of endolysin Bp7e was PCR-amplified from a phage Bp7 genome and cloned, and then a pET28a-Bp7e prokaryotic expression vector was constructed. Two amino acids were mutated (L99A, M102E) to construct pET28a-Bp7Δe, with pET28a-Bp7e as a template. Phylogenetic analysis suggested that BP7e belongs to a T4-like phage endolysin group. Bp7e and its mutant Bp7Δe were expressed in Escherichia coli BL21(DE3) as soluble proteins. They were purified by affinity chromatography, and then their antibacterial activities were analyzed. The results demonstrated that the recombinant proteins Bp7e and Bp7Δe showed obvious antibacterial activity against Micrococcus lysodeikticus but no activity against Staphylococcus aureus. In the presence of malic acid, Bp7e and Bp7Δe exhibited an effect on most E. coli strains which could be lysed by phage Bp7, but no effect on Salmonella paratyphi or Pseudomonas aeruginosa. Moreover, Bp7Δe with double-site mutations showed stronger antibacterial activity and a broader lysis range than Bp7e.

  5. Dissociation of eIF4E-binding protein 2 (4E-BP2 from eIF4E independent of Thr37/Thr46 phosphorylation in the ischemic stress response.

    Directory of Open Access Journals (Sweden)

    María I Ayuso

    Full Text Available Eukaryotic initiation factor (eIF 4E-binding proteins (4E-BPs are translational repressors that bind specifically to eIF4E and are critical in the control of protein translation. 4E-BP2 is the predominant 4E-BP expressed in the brain, but their role is not well known. Here, we characterized four forms of 4E-BP2 detected by two-dimensional gel electrophoresis (2-DGE in brain. The form with highest electrophoretic mobility was the main form susceptible to phosphorylation at Thr37/Thr46 sites, phosphorylation that was detected in acidic spots. Cerebral ischemia and subsequent reperfusion induced dephosphorylation and phosphorylation of 4E-BP2 at Thr37/Thr46, respectively. The induced phosphorylation was in parallel with the release of 4E-BP2 from eIF4E, although two of the phosphorylated 4E-BP2 forms were bound to eIF4E. Upon long-term reperfusion, there was a decrease in the binding of 4E-BP2 to eIF4E in cerebral cortex, demonstrated by cap binding assays and 4E-BP2-immunoprecipitation experiments. The release of 4E-BP2 from eIF4E was without changes in 4E-BP2 phosphorylation or other post-translational modification recognized by 2-DGE. These findings demonstrated specific changes in 4E-BP2/eIF4E association dependent and independent of 4E-BP2 phosphorylation. The last result supports the notion that phosphorylation may not be the uniquely regulation for the binding of 4E-BP2 to eIF4E under ischemic stress.

  6. Feasibility study report for the 200-BP-1 operable unit

    Energy Technology Data Exchange (ETDEWEB)

    1993-06-01

    This feasibility study examines a range of alternatives and provides recommendations for selecting a preferred alternative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965--1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area, groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-levels of contamination with cesium-137, radium-226, strontium-90, thorium-228, and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9{times}10{sup {minus}5}.

  7. Feasibility study report for the 200-BP-1 operable unit

    International Nuclear Information System (INIS)

    1993-06-01

    This feasibility study examines a range of alternatives and provides recommendations for selecting a preferred alternative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965--1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area, groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-levels of contamination with cesium-137, radium-226, strontium-90, thorium-228, and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9x10 -5

  8. Feasibility study report for the 200-BP-1 operable unit

    International Nuclear Information System (INIS)

    1994-01-01

    This feasibility study (FS) examines a range of alternatives and provides recommendations for selecting a preferred altemative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965-1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-:levels of contamination with cesium-137, radium-226, strontium-90, thorium-228 and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9 x 10 5

  9. BP floats on top of the German oil market

    Energy Technology Data Exchange (ETDEWEB)

    1980-02-01

    An excerpt from the background report of the Deutsche BP AG summarizing the situation in 1979 shows the developments on the German energy market in the year 1979. The report discusses the shift in the proportions of energy generated from the various energy sources as well the causes and consequences of the mineral oil shortage on the world market, especially the reactions of the Federal Government, the petroleum companies, and the consumers. The outlook on the near future points out that world-wide petroleum supply still remains uncertain and that more serious efforts have to be made in order to put an end to wasting mineral oil.

  10. BP and sustainable development and biodiversity in Azerbaijan

    International Nuclear Information System (INIS)

    Grant, Vidrine; Askerov, Faig

    2002-01-01

    Full text: BP takes its commitment to the environmental extremely seriously. BP believes it is essential to ensure that our operations and activities comply with the environmental standards in our PSAs and with the laws of Azerbaijan. To achieve this we have developed Environmental Operating Procedures. These procedures are currently being audited and we expect to receive ISO 14001 certification for all of our operations. Together with our Emergency Response and Oil Spill Response Plans we are able to manage our operations to ensure minimum impact and regulatory compliance. Additional, AIOC contributed to opening the Caspian Environmental Laboratory in 1999 to provide on a commercial basis, environmental services in Azerbaijan of an internationally recognized standard. We have conducted many other activities to promote biodiversity. In absence of the appropriate infrastructure we have built a waste management site at Serenja where we are currently disposing of synthetic based muds from our offshore drilling operations. We have also developed and implemented a Research and Monitoring Program in co-operation with representatives from SOCAR, Academy of Sciences, Azgipromorneftegaz and State Committee of Ecology. We have conducted Seals mortality investigation, Birds monitoring, Fish monitoring, Offshore surveys studying macrobenthos, water chemistry, sediments, groundwater monitoring, re-vegetation, etc. In developing our overall strategy BP has set some long term environmental aspirations or expectations: stop the use of halocarbons; to reduce Green House Gases by 10% by 20 lOin comparison with baseline data for 1990; stop venting and flaring; stop discharges to water of synthetic and oil based muds. BP recognizes that this is a goal. It is something we commit to and aspire to achieve and something we are wise enough to realize cannot be achieved overnight. None-the-less, it is something we constantly work towards. We also realize that this goal cannot be achieved in

  11. EST Table: BP183486 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available n (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] 10/08/29 56...43 aa gnl|Amel|GB30360-PB 10/09/10 54 %/174 aa gi|189241063|ref|XP_967018.2| PREDICTED: similar to restin (Reed-Steinberg cell-expres...sed intermediate filament-associated protein) [Tribolium castaneum] FS906662 NRPG ... ...BP183486 NRPG1970 10/09/28 54 %/174 aa ref|XP_967018.2| PREDICTED: similar to resti

  12. Risk assessment of logistics outsourcing based on BP neural network

    Science.gov (United States)

    Liu, Xiaofeng; Tian, Zi-you

    The purpose of this article is to evaluate the risk of the enterprises logistics outsourcing. To get this goal, the paper first analysed he main risks existing in the logistics outsourcing, and then set up a risk evaluation index system of the logistics outsourcing; second applied BP neural network into the logistics outsourcing risk evaluation and used MATLAB to the simulation. It proved that the network error is small and has strong practicability. And this method can be used by enterprises to evaluate the risks of logistics outsourcing.

  13. AcEST: BP921052 [AcEST

    Lifescience Database Archive (English)

    Full Text Available disease virus 2 (strain Australia) Align length 55 Score (bit) 32.0 E-value 2.1 Report BLASTX 2.2.19 [Nov-0... VP3 OS=Epizootic hemorrhagic disease virus 2 (strain Australia) GN=S3 PE=3 SV=1 Length = 899 Score = 32.0 b...608|VP3_BTV1A Core protein VP3 OS=Bluetongue virus 1 (isolate Australia) GN=S3 PE=3 SV=1 Length = 901 Score

  14. Effect of turmeric and curcumin on BP-DNA adducts.

    Science.gov (United States)

    Mukundan, M A; Chacko, M C; Annapurna, V V; Krishnaswamy, K

    1993-03-01

    Many human cancers that are widely prevalent today can be prevented through modifications in life-styles, of which diet appears to be an important agent. Several dietary constituents modulate the process of carcinogenesis and prevent genotoxicity. Many plant constituents including turmeric appear to be potent antimutagens and antioxidants. Therefore the modulatory effects of turmeric and curcumin on the levels of benzo[a]pyrene induced DNA adducts in the livers of rats were studied by the newly developed 32P-postlabelling assay method. Turmeric when fed at 0.1, 0.5 and 3% and the active principle of turmeric (curcumin) when fed at a level of 0.03% in the diet for 4 weeks significantly reduced the level of BP-DNA adducts including the major adduct dG-N2-BP, formed within 24 h in response to a single i.p. injection of benzo[a]pyrene. The significance of these effects in terms of the potential anticarcinogenic effects of turmeric is discussed. Further, these results strengthen the various other biological effects of turmeric which have direct relevance to anticarcinogenesis and chemoprevention.

  15. Research on AHP decision algorithms based on BP algorithm

    Science.gov (United States)

    Ma, Ning; Guan, Jianhe

    2017-10-01

    Decision making is the thinking activity that people choose or judge, and scientific decision-making has always been a hot issue in the field of research. Analytic Hierarchy Process (AHP) is a simple and practical multi-criteria and multi-objective decision-making method that combines quantitative and qualitative and can show and calculate the subjective judgment in digital form. In the process of decision analysis using AHP method, the rationality of the two-dimensional judgment matrix has a great influence on the decision result. However, in dealing with the real problem, the judgment matrix produced by the two-dimensional comparison is often inconsistent, that is, it does not meet the consistency requirements. BP neural network algorithm is an adaptive nonlinear dynamic system. It has powerful collective computing ability and learning ability. It can perfect the data by constantly modifying the weights and thresholds of the network to achieve the goal of minimizing the mean square error. In this paper, the BP algorithm is used to deal with the consistency of the two-dimensional judgment matrix of the AHP.

  16. SPECTROPOLARIMETRY OF THE CLASSICAL T TAURI STAR BP TAU

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Wei; Johns-Krull, Christopher M., E-mail: wc2@rice.edu, E-mail: cmj@rice.edu [Department of Physics and Astronomy, Rice University, Houston, TX 77005 (United States)

    2013-10-20

    We implement a least-squares deconvolution (LSD) code to study magnetic fields on cool stars. We first apply our code to high-resolution optical echelle spectra of 53 Cam (a magnetic Ap star) and three well-studied cool stars (Arcturus, 61 Cyg A, and ξ Boo A) as well as the Sun (by observing the asteroid Vesta) as tests of the code and the instrumentation. Our analysis is based on several hundred photospheric lines spanning the wavelength range 5000 Å to 9000 Å. We then apply our LSD code to six nights of data on the Classical T Tauri Star BP Tau. A maximum longitudinal field of 370 ± 80 G is detected from the photospheric lines on BP Tau. A 1.8 kG dipole tilted at 129° with respect to the rotation axis and a 1.4 kG octupole tilted at 104° with respect to the rotation axis, both with a filling factor of 0.25, best fit our LSD Stokes V profiles. Measurements of several emission lines (He I 5876 Å, Ca II 8498 Å, and 8542 Å) show the presence of strong magnetic fields in the line formation regions of these lines, which are believed to be the base of the accretion footpoints. The field strength measured from these lines shows night-to-night variability consistent with rotation of the star.

  17. AcEST: BP912733 [AcEST

    Lifescience Database Archive (English)

    Full Text Available C and casein kinase substrate in neurons protein 1 OS=Mus musculus GN=Pacsin1 PE...se substrate in neurons protein 1 OS=Rattus norvegicus GN=Pacsin1 PE=1 SV=1 Length = 441 Score = 32.3 bits (...e in neurons protein 1 OS=Pongo abelii GN=Pacsin1 PE=2 SV=1 Length = 444 Score = 32.0 bits (71), Expect = 2.

  18. AcEST: BP918833 [AcEST

    Lifescience Database Archive (English)

    Full Text Available um falciparum (isolate NF7 / Ghana) GN=SD17 PE=4 SV=1 Length = 657 Score = 31.2 b...ot sp_hit_id P06719 Definition sp|P06719|KNOB_PLAFN Knob-associated histidine-rich protein OS=Plasmodium fal...ciparum (isolate NF7 / Ghana) Align length 39 Score (bit) 31.2 E-value 1.7 Report BLASTX 2.2.19 [Nov-02-2008

  19. AcEST: BP921078 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|O48901|DPOD1_SOYBN DNA polymerase delta catalytic subunit OS=Glycine max GN=POLD...|P28339|DPOD1_BOVIN DNA polymerase delta catalytic subunit OS=Bos taurus GN=POLD1 PE=1 SV=1 Length = 1106 Sc...|DPOD1_HUMAN DNA polymerase delta catalytic subunit OS=Homo sapiens GN=POLD1 PE=1 SV=2 Length = 1107 Score =

  20. Weathered Oil and Tar Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  1. Transcriptional signature of accessory cells in the lateral line, using the Tnk1bp1:EGFP transgenic zebrafish line.

    Science.gov (United States)

    Behra, Martine; Gallardo, Viviana E; Bradsher, John; Torrado, Aranza; Elkahloun, Abdel; Idol, Jennifer; Sheehy, Jessica; Zonies, Seth; Xu, Lisha; Shaw, Kenna M; Satou, Chie; Higashijima, Shin-ichi; Weinstein, Brant M; Burgess, Shawn M

    2012-01-24

    Because of the structural and molecular similarities between the two systems, the lateral line, a fish and amphibian specific sensory organ, has been widely used in zebrafish as a model to study the development/biology of neuroepithelia of the inner ear. Both organs have hair cells, which are the mechanoreceptor cells, and supporting cells providing other functions to the epithelium. In most vertebrates (excluding mammals), supporting cells comprise a pool of progenitors that replace damaged or dead hair cells. However, the lack of regenerative capacity in mammals is the single leading cause for acquired hearing disorders in humans. In an effort to understand the regenerative process of hair cells in fish, we characterized and cloned an egfp transgenic stable fish line that trapped tnks1bp1, a highly conserved gene that has been implicated in the maintenance of telomeres' length. We then used this Tg(tnks1bp1:EGFP) line in a FACsorting strategy combined with microarrays to identify new molecular markers for supporting cells. We present a Tg(tnks1bp1:EGFP) stable transgenic line, which we used to establish a transcriptional profile of supporting cells in the zebrafish lateral line. Therefore we are providing a new set of markers specific for supporting cells as well as candidates for functional analysis of this important cell type. This will prove to be a valuable tool for the study of regeneration in the lateral line of zebrafish in particular and for regeneration of neuroepithelia in general.

  2. msBP: An R Package to Perform Bayesian Nonparametric Inference Using Multiscale Bernstein Polynomials Mixtures

    Directory of Open Access Journals (Sweden)

    Antonio Canale

    2017-06-01

    Full Text Available msBP is an R package that implements a new method to perform Bayesian multiscale nonparametric inference introduced by Canale and Dunson (2016. The method, based on mixtures of multiscale beta dictionary densities, overcomes the drawbacks of Pólya trees and inherits many of the advantages of Dirichlet process mixture models. The key idea is that an infinitely-deep binary tree is introduced, with a beta dictionary density assigned to each node of the tree. Using a multiscale stick-breaking characterization, stochastically decreasing weights are assigned to each node. The result is an infinite mixture model. The package msBP implements a series of basic functions to deal with this family of priors such as random densities and numbers generation, creation and manipulation of binary tree objects, and generic functions to plot and print the results. In addition, it implements the Gibbs samplers for posterior computation to perform multiscale density estimation and multiscale testing of group differences described in Canale and Dunson (2016.

  3. Fault Diagnosis Method of Polymerization Kettle Equipment Based on Rough Sets and BP Neural Network

    Directory of Open Access Journals (Sweden)

    Shu-zhi Gao

    2013-01-01

    Full Text Available Polyvinyl chloride (PVC polymerizing production process is a typical complex controlled object, with complexity features, such as nonlinear, multivariable, strong coupling, and large time-delay. Aiming at the real-time fault diagnosis and optimized monitoring requirements of the large-scale key polymerization equipment of PVC production process, a real-time fault diagnosis strategy is proposed based on rough sets theory with the improved discernibility matrix and BP neural networks. The improved discernibility matrix is adopted to reduct the attributes of rough sets in order to decrease the input dimensionality of fault characteristics effectively. Levenberg-Marquardt BP neural network is trained to diagnose the polymerize faults according to the reducted decision table, which realizes the nonlinear mapping from fault symptom set to polymerize fault set. Simulation experiments are carried out combining with the industry history datum to show the effectiveness of the proposed rough set neural networks fault diagnosis method. The proposed strategy greatly increased the accuracy rate and efficiency of the polymerization fault diagnosis system.

  4. Optimization of steel casting feeding system based on BP neural network and genetic algorithm

    Directory of Open Access Journals (Sweden)

    Xue-dan Gong

    2016-05-01

    Full Text Available The trial-and-error method is widely used for the current optimization of the steel casting feeding system, which is highly random, subjective and thus inefficient. In the present work, both the theoretical and the experimental research on the modeling and optimization methods of the process are studied. An approximate alternative model is established based on the Back Propagation (BP neural network and experimental design. The process parameters of the feeding system are taken as the input, the volumes of shrinkage cavities and porosities calculated by simulation are simultaneously taken as the output. Thus, a mathematical model is established by the BP neural network to combine the input variables with the output response. Then, this model is optimized by the nonlinear optimization function of the genetic algorithm. Finally, a feeding system optimization of a steel traveling wheel is conducted. No shrinkage cavities and porosities are induced through the optimization. Compared to the initial design scheme, the process yield is increased by 4.1% and the volume of the riser is decreased by 5.48×106 mm3.

  5. Correlation lengths of electrostatic turbulence

    International Nuclear Information System (INIS)

    Guiziou, L.; Garbet, X.

    1995-01-01

    This document deals with correlation length of electrostatic turbulence. First, the model of drift waves turbulence is presented. Then, the radial correlation length is determined analytically with toroidal coupling and non linear coupling. (TEC). 5 refs

  6. Performance of RC columns with partial length corrosion

    International Nuclear Information System (INIS)

    Wang Xiaohui; Liang Fayun

    2008-01-01

    Experimental and analytical studies on the load capacity of reinforced concrete (RC) columns with partial length corrosion are presented, where only a fraction of the column length was corroded. Twelve simply supported columns were eccentrically loaded. The primary variables were partial length corrosion in tensile or compressive zone and the corrosion level within this length. The failure of the corroded column occurs in the partial length, mainly developed from or located nearby or merged with the longitudinal corrosion cracks. For RC column with large eccentricity, load capacity of the column is mainly influenced by the partial length corrosion in tensile zone; while for RC column with small eccentricity, load capacity of the column greatly decreases due to the partial length corrosion in compressive zone. The destruction of the longitudinally mechanical integrality of the column in the partial length leads to this great reduction of the load capacity of the RC column

  7. Lamin A/C-dependent interaction with 53BP1 promotes cellular responses to DNA damage

    DEFF Research Database (Denmark)

    Gibbs-Seymour, Ian; Markiewicz, Ewa; Bekker-Jensen, Simon

    2015-01-01

    damage. Lamins A/C regulate 53BP1 levels and consequently lamin A/C-null HDF display a 53BP1 null-like phenotype. Our data favour a model in which lamins A/C maintain a nucleoplasmic pool of 53BP1 in order to facilitate its rapid recruitment to sites of DNA damage and could explain why an absence...

  8. Correlation lengths of electrostatic turbulence

    International Nuclear Information System (INIS)

    Guiziou, L.; Garbet, X.

    1995-01-01

    In this paper, the radial correlation length of an electrostatic drift wave turbulence is analytically determined in various regimes. The analysis relies on the calculation of a range of mode non linear interaction, which is an instantaneous correlation length. The link with the usual correlation length has not been investigated yet. (TEC). 5 refs

  9. Decreasing relative risk premium

    DEFF Research Database (Denmark)

    Hansen, Frank

    2007-01-01

    such that the corresponding relative risk premium is a decreasing function of present wealth, and we determine the set of associated utility functions. We find a new characterization of risk vulnerability and determine a large set of utility functions, closed under summation and composition, which are both risk vulnerable...... and have decreasing relative risk premium. We finally introduce the notion of partial risk neutral preferences on binary lotteries and show that partial risk neutrality is equivalent to preferences with decreasing relative risk premium...

  10. Silencing effect of shRNA expression vectors with stem length of 21 ...

    African Journals Online (AJOL)

    In this study, shRNA vectors having different stem length were constructed and their silencing effect was tested in mouse embryonic fibroblast and in vivo. Interfering RNAs were designed with stems of 21, 27, and 29 bp. The enhanced green fluorescent protein gene was used as target gene. The synthesized single strands ...

  11. BP and Mobil present a united front in Europe

    International Nuclear Information System (INIS)

    Jackson, Kim.

    1997-01-01

    BP and Mobil announced the pooling of their European refining, marketing and lubricants businesses in February last year in an unprecedented step to cut costs and improve their competitive position in what is becoming an increasingly cut-throat market. Like their competitors, the two companies had been battling to contented with the continuing surplus refining capacity throughout Europe as well as significantly reduced profit margins on gasoline and other products sold at the pumps. This was particularly the case in the United Kingdom which is still reeling from the effects of the petrol pump price war waged over the past year and in France, too, where the hypermarkets are fiercely battling to retain their market share. (author)

  12. BP Cherry Point Cogeneration Project, Draft Environmental Impact Statement

    Energy Technology Data Exchange (ETDEWEB)

    N/A

    2003-09-19

    BP West Coast Products, LLC (BP or the Applicant) proposes to construct and operate a nominal 720-megawatt (MW), natural-gas-fired, combined-cycle cogeneration facility next to the existing BP Cherry Point Refinery in Whatcom County, Washington. The Applicant also owns and operates the refinery, but the cogeneration facility and the refinery would be operated as separate business units. The cogeneration facility and its ancillary infrastructure would provide steam and 85 MW of electricity to meet the operating needs of the refinery and 635 MW of electrical power for local and regional consumption. The proposed cogeneration facility would be located between Ferndale and Blaine in northwestern Whatcom County, Washington. The Canadian border is approximately 8 miles north of the proposed project site. The Washington State Energy Facility Site Evaluation Council (EFSEC) has jurisdiction over the evaluation of major energy facilities including the proposed project. As such, EFSEC will recommend approval or denial of the proposed cogeneration facility to the governor of Washington after an environmental review. On June 3, 2002, the Applicant filed an Application for Site Certification (ASC No. 2002-01) with EFSEC in accordance with Washington Administrative Code (WAC) 463-42. On April 22, 2003, the Applicant submitted an amended ASC that included, among other things, a change from air to water cooling. With the submission of the ASC and in accordance with the State Environmental Policy Act (SEPA) (WAC 463-47), EFSEC is evaluating the siting of the proposed project and conducting an environmental review with this Environmental Impact Statement (EIS). Because the proposed project requires federal agency approvals and permits, this EIS is intended to meet the requirements under both SEPA and the National Environmental Policy Act (NEPA). The Bonneville Power Administration (Bonneville) and U.S. Army Corps of Engineers (Corps) also will use this EIS as part of their

  13. Characterization of the Particulate Emissions from the BP ...

    Science.gov (United States)

    Opportunistic particle samples were gathered from the sail of a tethered aerostat during at-sea plume sampling of the purposely-burned surface oil during the BP Deepwater Horizon disaster in the Gulf of Mexico. Particles were analyzed for polycyclic aromatic hydrocarbons (PAHs), organic carbon (OC), elemental carbon (EC), metals, and polychlorinated dibenzodioxins/dibenzofurans (PCDDs/PCDFs). Emission factors were calculated using previous sampling values of background-adjusted CO2 and particulate matter (PM)-bound C. The mean of five thermal-optical analyses indicated that the burned crude oil particulate matter was 93% carbon (w/w) with the predominance being refractory elemental carbon (82% w/w) on average. PAHs accounted for roughly 60 ug/g of the PM mass or 4.5 mg/kg oil burned, at least an order of magnitude less than earlier laboratory based studies. Microscopy indicates that the soot from the in situ oil burns is distinct from more common soot by its aggregate size, primary particle size, and nanostructure within the primary particles. The PCDD/PCDF concentration of the PM was 1.5 to 3.3 ng toxic equivalency (TEQ)/kg PM sampled, about 10-fold lower than from a previous dedicated gas/solid sample, indicating loss of small particle-bound and more volatile PCDD/PCDF congeners through the aerostat sail. This work presents an analysis of smoke particles opportunistically caught during the in situ surface oil burns during the 2010 BP Deepwater Horizon di

  14. RanBP3 influences interactions between CRM1 and its nuclear protein export substrates

    OpenAIRE

    Englmeier, Ludwig; Fornerod, Maarten; Bischoff, F. Ralf; Petosa, Carlo; Mattaj, Iain W.; Kutay, Ulrike

    2001-01-01

    We investigated the role of RanBP3, a nuclear member of the Ran-binding protein 1 family, in CRM1-mediated protein export in higher eukaryotes. RanBP3 interacts directly with CRM1 and also forms a trimeric complex with CRM1 and RanGTP. However, RanBP3 does not bind to CRM1 like an export substrate. Instead, it can stabilize CRM1–export substrate interaction. Nuclear RanBP3 stimulates CRM1-dependent protein export in permeabilized cells. These data indicate that RanBP3 functions by a novel mec...

  15. AcEST: BP917159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available e synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ECP_1970 PE=3 SV=1 Length = 2154 Score = 32...ia coli (strain UTI89 / UPEC) GN=UTI89_C2213 PE=3 SV=1 Length = 2154 Score = 32.7 bits (73), Expect = 9.2 Id...L 288 S+ + L +L Sbjct: 1071 SLNLTLFNRL 1080 >tr|Q1RAD3|Q1RAD3_ECOUT Putative peptide synthetase OS=Escherich

  16. AcEST: BP917305 [AcEST

    Lifescience Database Archive (English)

    Full Text Available _ECOUT Sensor protein OS=Escherichia coli (strain UTI89 / UPEC) GN=UTI89_C4639 PE=4 SV=1 Length = 606 Score ...6:K15:H31 (strain 536 / UPEC) GN=ECP_4282 PE=4 SV=1 Length = 606 Score = 34.3 bits (77), Expect = 3.6 Identi... VNLTNSGVD 96 V L N ++ Sbjct: 467 VALLNHSME 475 >tr|Q0T9Z9|Q0T9Z9_ECOL5 Sensor protein OS=Escherichia coli O

  17. AcEST: BP915660 [AcEST

    Lifescience Database Archive (English)

    Full Text Available t_id Q80QL5 Definition sp|Q80QL5|CAPSD_PCV1 Capsid protein OS=Porcine circovirus 1 Align length 25 Score (bi...its) Value sp|Q80QL5|CAPSD_PCV1 Capsid protein OS=Porcine circovirus 1 GN=C... 33 1.2 sp|P10978|POLX_TOBAC R...max... 30 7.9 >sp|Q80QL5|CAPSD_PCV1 Capsid protein OS=Porcine circovirus 1 GN=Cap PE=3 SV=1 Length = 233 Sco

  18. AcEST: BP912219 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |Q4V8J4|PLCH_RAT 1-acyl-sn-glycerol-3-phosphate acyltransferase theta OS=Rattus norvegicus GN=Agpat9 PE=2 SV...CH_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase theta OS=Mus musculus GN=Agpat9 PE=1 SV=1 Length = 4...DGCYAMVGQVH 251 >sp|Q68F37|PLCH_XENLA 1-acyl-sn-glycerol-3-phosphate acyltransferase theta OS=Xenopus laevis GN=agpat9...acyl-sn-glycerol-3-phosphate acyltransferase theta OS=Danio rerio GN=agpat9 PE=2 SV=1 Length = 449 Score = 4

  19. AcEST: BP912775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9VIRU L protein OS=Lymphocytic choriomeningitis... 33 10.0 >tr|Q672V4|Q672V4_ASPFL Monooxygenase OS=Aspergil...N 162 >tr|A2SUM3|A2SUM3_9VIRU L protein OS=Lymphocytic choriomeningitis virus GN=L PE=4 SV=1 Length = 2209 S...: 261 LSLGKWLKPVGNKGVRAAVTPSGQAIALVEEKG-KRASSVFVARPAGMD 308 >sp|P14240|L_LYCVA RNA-directed RNA polymerase OS=Lymphocytic choriomenin...gitis virus (strain Armstrong) GN=L PE=1 SV=1 Length = 2210 Score = 30.8 bits (68),

  20. The Immune Signaling Adaptor LAT Contributes to the Neuroanatomical Phenotype of 16p11.2 BP2-BP3 CNVs

    NARCIS (Netherlands)

    Loviglio, Maria Nicla; Arbogast, Thomas; Jønch, Aia Elise; Collins, Stephan C.; Popadin, Konstantin; Bonnet, Camille S.; Giannuzzi, Giuliana; Maillard, Anne M.; Jacquemont, Sébastien; Loviglio, Maria Nicla; Jønch, Aia Elise; Popadin, Konstantin; Giannuzzi, Giuliana; Maillard, Anne M.; Fagerberg, Christina; Andersen, Charlotte Brasch; Doco-Fenzy, Martine; Delrue, Marie-Ange; Faivre, Laurence; Arveiler, Benoit; Geneviève, David; Schneider, Anouck; Gerard, Marion; Andrieux, Joris; El Chehadeh, Salima; Schaefer, Elise; Depienne, Christel; Van Haelst, Mieke; Brilstra, Eva H.; Van Binsbergen, Ellen; van Harssel, Jeske; van der Veken, Lars T.; Gusella, James F; Shen, Yiping; Mitchell, Elyse; Kini, Usha; Hawkes, Lara; Campbell, Carolyn; Butschi, Florence Niel; Addor, Marie Claude; Beckmann, Jacques S.; Jacquemont, Sébastien; Reymond, Alexandre; Yalcin, Binnaz; Katsanis, Nicholas; Golzio, Christelle; Reymond, Alexandre

    2017-01-01

    Copy-number changes in 16p11.2 contribute significantly to neuropsychiatric traits. Besides the 600 kb BP4-BP5 CNV found in 0.5%–1% of individuals with autism spectrum disorders and schizophrenia and whose rearrangement causes reciprocal defects in head size and body weight, a second distal 220 kb

  1. The reproducibility of the circadian BP rhythm in treated hypertensive patients with polycystic kidney disease and mild chronic renal impairment--a prospective ABPM study.

    Science.gov (United States)

    Covic, Adrian; Mititiuc, Irina; Gusbeth-Tatomir, Paul; Goldsmith, David J

    2002-01-01

    Diurnal BP rhythm is known to be abnormal (reduced BP fall with sleep) in chronic renal failure, dialysis and renal transplantation patients. In subjects with primary hypertension and with reduced diurnal BP fall with sleep there is consistent evidence of increased target-organ damage. However, the few studies that have addressed the reproducibility of diurnal rhythm in normal or hypertensive subjects have concluded that the BP fall with sleep is poorly reproducible. It is not known whether the same is true for patients with renal disease. In 30 subjects with autosomal polycystic kidney disease (ADPKD), mild chronic renal failure and normal office BP levels on standardised anti-hypertensive treatment, ambulatory blood pressure monitoring (ABPM) was done three times over a twelve month period to assess the reproducibility of blood pressure fall with sleep. When comparing ABPM 2 with the ABPM 1 recording (3 months difference between measurements) only 43.3% of the patients maintained the initial dipping category (defined by quartiles of the ABPM 1 diurnal BP distribution). The same proportion of subjects had a similar dipping category, when ABPM 3 was compared to ABPM 1 (9 months difference between measurements), but a large (24%) subset of patients had dramatic shifts in their amplitude in nocturnal BP fall, significantly greater than those recorded after a shorter inter-measurement interval. Equally important, our study reveals the fact that, with time, there is no tendency to decrease circadian variation: a similar proportion (a quarter to one third) of patients increased or decreased their amplitude in nocturnal BP fall, at 3 and 9 months. When several ABPM measurements are repeated for the same patients, the repeatability is even worse, since only 36.6% of our study population maintained the initial dipping category across all three ABPM determinations (ABPM 1 and ABPM 2 and ABPM 3). There is a widespread abnormality in diurnal BP rhythm in ADPKD patients with

  2. Designing and constructing an 100 bp DNA Ladder by combining PCR and enzyme digestion methods

    Directory of Open Access Journals (Sweden)

    Saidijam M

    2011-05-01

    Full Text Available "n Normal 0 false false false EN-US X-NONE AR-SA MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:Arial; mso-bidi-theme-font:minor-bidi;} Background: Molecular DNA markers are one of the most important tools in molecular biology labs. The size of DNA molecules is determined by comparing them with known bands of markers during gel electrophoresis. There are many different protocols to produce these kinds of molecular markers. In this study we have suggested an efficient strategy to produce molecular weight markers in industrial proportions."n"nMethods : To achieve the desired sizes of DNA fragments, a combination of two previously known methods, restriction enzyme digestion and polymerase chain reaction (PCR, were used. The enzymatic digestion process was based on designing and constructing plasmids which equaled in size with the desired length of DNA fragments and produced the desired DNA fragment upon linearization. In the PCR method, the desired length of DNA fragments were cloned in multiple cloning sites of pTZ57R plasmid and in a PCR reaction, the new constructed plasmid was used as a template to produce the final fragment."n"nResults : Upon application of this strategy, 2000 and 3000 bp DNA fragments were produced by enzymatic digestion of plasmids of the same size. Moreover, 100 to 1500 bp fragments were produced during PCR using only a set of

  3. Amplified-fragment length polymorphism fingerprinting of Mycoplasma species

    DEFF Research Database (Denmark)

    Kokotovic, Branko; Friis, N.F.; Jensen, J.S.

    1999-01-01

    Amplified-fragment length polymorphism (AFLP) is a whole-genome fingerprinting method based on selective amplification of restriction fragments. The potential of the method for the characterization of mycoplasmas was investigated in a total of 50 strains of human and animal origin, including......I restriction endonucleases and subsequent ligation of corresponding site-specific adapters. The amplification of AFLP templates with a single set of nonselective primers resulted in reproducible fingerprints of approximately 60 to 80 fragments in the size range of 50 to 500 bp, The method was able...

  4. AcEST: BP918026 [AcEST

    Lifescience Database Archive (English)

    Full Text Available enzyme OS=Escherichia coli (strain UTI89 / UPEC) GN=hofD PE=3 SV=1 Length = 225 S...n-like proteins leader peptide processing enzyme OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ECP_3

  5. AcEST: BP912545 [AcEST

    Lifescience Database Archive (English)

    Full Text Available cherichia coli (strain UTI89 / UPEC) GN=pspA PE=4 SV=1 Length = 222 Score = 35.8 bits (81), Expect = 1.1 Ide... >tr|Q0TI62|Q0TI62_ECOL5 Phage shock protein OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ECP_1356

  6. AcEST: BP915498 [AcEST

    Lifescience Database Archive (English)

    Full Text Available homolog OS=Escherichia coli (strain UTI89 / UPEC) GN=ftsB PE=3 SV=1 Length = 103 Score = 29.6 bits (65), Exp...VAAQQATNAKLKAR 49 >sp|Q0TEB0|FTSB_ECOL5 Cell division protein ftsB homolog OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC

  7. AcEST: BP917326 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rase, cytosolic OS... 29 6.3 sp|Q9QSP1|VGLG_ABLVB Glycoprotein G OS=Australian bat lyssavirus... 29 8.2 >sp|...9QSP1|VGLG_ABLVB Glycoprotein G OS=Australian bat lyssavirus (isolate Bat/AUS/1996) GN=G PE=1 SV=1 Length =

  8. AcEST: BP919010 [AcEST

    Lifescience Database Archive (English)

    Full Text Available _MAIZE Putative copia-like retrotransposon Hopsc... 147 1e-41 tr|Q53MM3|Q53MM3_ORYSJ Retrotransposon protein...X9_MAIZE Putative copia-like retrotransposon Hopscotch polyprotein OS=Zea mays GN=Z178A11.9 PE=4 SV=1 Length

  9. AcEST: BP921068 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |L_PIRVV RNA-directed RNA polymerase OS=Pirital virus (isolate Rat/Venezuela/VAV-488/1995) Align length 54 S...L_PIRVV RNA-directed RNA polymerase OS=Pirital virus (isolate Rat/Venezuela/VAV-488/1995) GN=L PE=3 SV=1 Len

  10. AcEST: BP915681 [AcEST

    Lifescience Database Archive (English)

    Full Text Available en 175 OS=Plasmodium falciparum (isolate Camp / Malaysia) Align length 209 Score (bit) 36.6 E-value 0.097 Re...0 9.1 >sp|P19214|EBA1_PLAFC Erythrocyte-binding antigen 175 OS=Plasmodium falciparum (isolate Camp / Malaysia

  11. AcEST: BP919127 [AcEST

    Lifescience Database Archive (English)

    Full Text Available DB_G0286591 OS=Di... 32 2.1 sp|P36304|POLR_KYMVJ RNA replicase polyprotein OS=Kennedy...RNA replicase polyprotein OS=Kennedya yellow mosaic virus (strain Jervis bay) PE=3 SV=1 Length = 1874 Score

  12. AcEST: BP918549 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=Mus musculus GN=Vwf... 31 3.4 sp|P04155|TFF1_HUMAN Trefoil factor 1 OS=Homo sa...PPGLYQDER 698 >sp|P04155|TFF1_HUMAN Trefoil factor 1 OS=Homo sapiens GN=TFF1 PE=1 SV=1 Length = 84 Score = 3

  13. AcEST: BP919070 [AcEST

    Lifescience Database Archive (English)

    Full Text Available -associated... 32 2.9 sp|Q7X2N3|SYV_SPHEL Valyl-tRNA synthetase OS=Sphingomonas elodea...nthetase OS=Sphingomonas elodea GN=valS PE=3 SV=1 Length = 811 Score = 30.4 bits (67), Expect = 6.5 Identiti

  14. AcEST: BP913196 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3_HUMAN Reticulon-3 OS=Homo sapiens GN=RTN3 PE=1 SV=2 33 0.71 sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation...ERQVEKS 759 >sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 Length

  15. AcEST: BP915052 [AcEST

    Lifescience Database Archive (English)

    Full Text Available nition tr|Q94QQ3|Q94QQ3_9BIVA ATP synthase subunit a OS=Inversidens japanensis Al... synthase subunit a OS=Inversidens japanensis GN=ATP6 PE=3 SV=1 Length = 220 Score = 33.1 bits (74), Expect(

  16. AcEST: BP917921 [AcEST

    Lifescience Database Archive (English)

    Full Text Available NNI_CHLNI Troponin I OS=Chlamys nipponensis akazara P... 30 4.8 sp|Q93971|TRPG_CA...DDSGLHGARPVPQESSRK 1045 >sp|Q7M3Y3|TNNI_CHLNI Troponin I OS=Chlamys nipponensis akazara PE=1 SV=2 Length = 2

  17. AcEST: BP917903 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Uncharacterized protein KIAA2012 homolog O... 40 0.005 sp|Q7M3Y3|TNNI_CHLNI Troponin I OS=Chlamys nipponensis akazara...RQWQEEEERRQ 610 >sp|Q7M3Y3|TNNI_CHLNI Troponin I OS=Chlamys nipponensis akazara PE=1 SV=2 Length = 292 Score

  18. AcEST: BP914944 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ntromere-associated protein OS=Parascaris univalens Align length 142 Score (bit) 48.1 E-value 2.0e-05 Report...nd centromere-associated protein OS=Parascaris univalens GN=PUMA1 PE=2 SV=1 Lengt

  19. AcEST: BP915100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available t : Swiss-Prot sp_hit_id O61308 Definition sp|O61308|PUMA_PARUN 227 kDa spindle- and centromere-associated protein OS=Parascaris...dle- and centromere-associated protein OS=Parascaris univalens GN=PUMA1 PE=2 SV=1 Length = 1955 Score = 44.7

  20. AcEST: BP919443 [AcEST

    Lifescience Database Archive (English)

    Full Text Available m I... 29 6.6 sp|P55953|MT_STENE Metallothionein OS=Sterechinus neumayeri PE=3... 29 6.8 sp|Q8TC36|SPA4L_HUM... Metallothionein OS=Sterechinus neumayeri PE=3 SV=1 Length = 64 Score = 29.3 bits (64), Expect = 6.8 Identit

  1. AcEST: BP911525 [AcEST

    Lifescience Database Archive (English)

    Full Text Available delta catalytic subunit OS=Plasmodium falciparum (isolate K1 / Thailand) GN=POLD...RATH DNA polymerase delta catalytic subunit OS=Arabidopsis thaliana GN=POLD1 PE=2 SV=1 Length = 1081 Score =...YLLRFMIDCDVVGMNWIHLPASKYQ 258 >sp|O48901|DPOD1_SOYBN DNA polymerase delta catalytic subunit OS=Glycine max GN=POLD

  2. AcEST: BP916146 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 19 + D Sbjct: 847 ILVDRD 852 >sp|P97283|DPOD1_MESAU DNA polymerase delta catalytic subunit OS=Mesocricetus auratus GN=POLD... subunit OS=Bos taurus GN=POLD1 PE=1 SV=1 Length = 1106 Score = 87.4 bits (215), Expect = 4e-17 Identities =

  3. AcEST: BP917612 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=Mesocricetus auratus GN=POLD1 PE=2 SV=1 Length = 1103 Score = 68.2 bits (165), Expect(2) = 3e-16 Identiti...0 + KE+ Sbjct: 877 LVITKEL 883 >sp|P28339|DPOD1_BOVIN DNA polymerase delta catalytic subunit OS=Bos taurus GN=POLD

  4. AcEST: BP916028 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CVKTMNRRGKSTQPCEYYFRVFHSLCPI--SWV---QRWNEQIKQ 81 >sp|P27502|POL_RTBVP Polyprotein P3 OS=Rice tungro bacilliform virus (isolate Philip...pines) PE=1 SV=1 Length = 1675 Score = 29.3 bits (64), Expect = 7.1 Identities = 10

  5. AcEST: BP912285 [AcEST

    Lifescience Database Archive (English)

    Full Text Available utative uncharacterized protein YHR217C OS... 31 4.6 sp|P08411|POLN_SFV Non-structural polyprotein OS=Semliki forest...ural polyprotein OS=Semliki forest virus PE=1 SV=2 Length = 2432 Score = 30.0 bits (66), Expect = 7.9 Identi

  6. AcEST: BP914009 [AcEST

    Lifescience Database Archive (English)

    Full Text Available n-containing protein C16orf63 ho... 30 5.8 sp|P29182|TXW8_NAJNA Weak neurotoxin 8 OS=Naja naja PE=1 SV=1 30 ...HLSWKPS 144 >sp|P29182|TXW8_NAJNA Weak neurotoxin 8 OS=Naja naja PE=1 SV=1 Length

  7. AcEST: BP913530 [AcEST

    Lifescience Database Archive (English)

    Full Text Available lue sp|P04540|NU5M_TRYBB NADH-ubiquinone oxidoreductase chain 5 OS=T... 34 0.47 sp|P14612|NXLH_PSEAU Long neurotoxin...FWYRFFA 160 >sp|P14612|NXLH_PSEAU Long neurotoxin homolog Pa ID OS=Pseudechis australis PE=1 SV=1 Length = 6

  8. AcEST: BP919465 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 211 SLA 213 >sp|A7H5D0|ACPS_CAMJD Holo-[acyl-carrier-protein] synthase OS=Campylobacter jejuni subsp. doy...lei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=acpS PE=3 SV=1 Length = 115 Score =

  9. AcEST: BP915480 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ol polyprotein OS=Gibbon ape leukemia virus ... 37 0.070 sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala ret...|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 Length = 1127 Score = 34.3 bit

  10. AcEST: BP918352 [AcEST

    Lifescience Database Archive (English)

    Full Text Available QELRKKQAEIMEMQKNQVMEMINAQSGSRKKLRRTQTGPW 489 >tr|Q1HGG1|Q1HGG1_9ROSI Abscisic acid responsive element-bindin...g protein 2 OS=Populus suaveolens GN=ABF2 PE=2 SV=1 Length = 406 Score = 46.6 bits (109), Expect = 7e-04 Ide

  11. AcEST: BP916219 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Q069K5|Q069K5_9SOLA Adenosylhomocysteinase OS=Nicotiana suave... 60 8e-08 tr|A8IXE0|A8IXE0_CHLRE Adenosylhom...5|Q069K5_9SOLA Adenosylhomocysteinase OS=Nicotiana suaveolens GN=SAHH PE=2 SV=1 Length = 485 Score = 60.1 bi

  12. AcEST: BP919673 [AcEST

    Lifescience Database Archive (English)

    Full Text Available SGYKDWILWISFAISCFLLCVVL 531 >sp|P16994|HEMA_I72A0 Hemagglutinin OS=Influenza A virus (strain A/Equine/Algi...ers/1972 H3N8) GN=HA PE=3 SV=2 Length = 565 Score = 30.0 bits (66), Expect = 3.7 Id

  13. AcEST: BP917133 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 775_CUPTR Putative PROPIONYL-COA CARBOXYLASE (BETA SUBUNIT) PROTEIN OS=Cupriavidus taiwan...TA SUBUNIT) PROTEIN OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=RALTA_A2850 PE=4 SV=1 Length = 533

  14. AcEST: BP918420 [AcEST

    Lifescience Database Archive (English)

    Full Text Available D 180 >sp|A8AC98|APGM_IGNH4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ignicoccus hosp...italis (strain KIN4/I / DSM 18386 / JCM 14125) GN=apgM PE=3 SV=1 Length = 416 Score

  15. AcEST: BP921491 [AcEST

    Lifescience Database Archive (English)

    Full Text Available . 32 3.4 sp|Q1PDC4|L_MABVR Large structural protein OS=Lake Victoria marb... 30 9.8 >sp|Q56A10|ZN608_MOUSE Z...e structural protein OS=Lake Victoria marburgvirus (strain Ravn-87) GN=L PE=3 SV=1 Length = 2327 Score = 30.

  16. Decreasing Relative Risk Premium

    DEFF Research Database (Denmark)

    Hansen, Frank

    We consider the risk premium demanded by a decision maker with wealth x in order to be indifferent between obtaining a new level of wealth y1 with certainty, or to participate in a lottery which either results in unchanged present wealth or a level of wealth y2 > y1. We define the relative risk...... premium as the quotient between the risk premium and the increase in wealth y1–x which the decision maker puts on the line by choosing the lottery in place of receiving y1 with certainty. We study preferences such that the relative risk premium is a decreasing function of present wealth, and we determine...... relative risk premium in the small implies decreasing relative risk premium in the large, and decreasing relative risk premium everywhere implies risk aversion. We finally show that preferences with decreasing relative risk premium may be equivalently expressed in terms of certain preferences on risky...

  17. Decreasing serial cost sharing

    DEFF Research Database (Denmark)

    Hougaard, Jens Leth; Østerdal, Lars Peter Raahave

    2009-01-01

    The increasing serial cost sharing rule of Moulin and Shenker (Econometrica 60:1009-1037, 1992) and the decreasing serial rule of de Frutos (J Econ Theory 79:245-275, 1998) are known by their intuitive appeal and striking incentive properties. An axiomatic characterization of the increasing serial...... rule was provided by Moulin and Shenker (J Econ Theory 64:178-201, 1994). This paper gives an axiomatic characterization of the decreasing serial rule....

  18. Decreasing Serial Cost Sharing

    DEFF Research Database (Denmark)

    Hougaard, Jens Leth; Østerdal, Lars Peter

    The increasing serial cost sharing rule of Moulin and Shenker [Econometrica 60 (1992) 1009] and the decreasing serial rule of de Frutos [Journal of Economic Theory 79 (1998) 245] have attracted attention due to their intuitive appeal and striking incentive properties. An axiomatic characterization...... of the increasing serial rule was provided by Moulin and Shenker [Journal of Economic Theory 64 (1994) 178]. This paper gives an axiomatic characterization of the decreasing serial rule...

  19. Bunch length and the 102/90 degrees optics

    CERN Document Server

    Lamont, M

    1998-01-01

    The bunch length in LEP has become a cause for concern, particularly in the ramp to high energies. Short bunch lengths excite higher order modes which can cause heating of the inter-cavity bellows a nd may be picked up by antennae cables causing burning. The bunch length is also important from a cryogenics viewpoint; HOM losses go up with shorter bunches and more cryogenics power is required. Measurements made during 1997 show that it is strongly advisable to maintain bunch lengths above 9 mm particularly with high bunch currents. The use of a low emittance lattice such as 102/90 degr ees exacerbates the problem; because of the decreased momentum compaction the bunch lengths are naturally shorter. This paper quantifies the bunch lengths to be expected at various stages of ope ration in 1998 and presents recommendations for the avoidance of bunch lengths shorter than 9 mm.

  20. BRCA1 Directs the Repair Pathway to Homologous Recombination by Promoting 53BP1 Dephosphorylation

    Directory of Open Access Journals (Sweden)

    Mayu Isono

    2017-01-01

    Full Text Available BRCA1 promotes homologous recombination (HR by activating DNA-end resection. By contrast, 53BP1 forms a barrier that inhibits DNA-end resection. Here, we show that BRCA1 promotes DNA-end resection by relieving the 53BP1-dependent barrier. We show that 53BP1 is phosphorylated by ATM in S/G2 phase, promoting RIF1 recruitment, which inhibits resection. 53BP1 is promptly dephosphorylated and RIF1 released, despite remaining unrepaired DNA double-strand breaks (DSBs. When resection is impaired by CtIP/MRE11 endonuclease inhibition, 53BP1 phosphorylation and RIF1 are sustained due to ongoing ATM signaling. BRCA1 depletion also sustains 53BP1 phosphorylation and RIF1 recruitment. We identify the phosphatase PP4C as having a major role in 53BP1 dephosphorylation and RIF1 release. BRCA1 or PP4C depletion impairs 53BP1 repositioning, EXO1 recruitment, and HR progression. 53BP1 or RIF1 depletion restores resection, RAD51 loading, and HR in PP4C-depleted cells. Our findings suggest that BRCA1 promotes PP4C-dependent 53BP1 dephosphorylation and RIF1 release, directing repair toward HR.

  1. [Construction and identification of a full-length cDNA library from Spirometra erinaceieuropaei].

    Science.gov (United States)

    Lv, Gang; Lu, Ya-Jun; Fan, Zhi-Gang; Shi, Da-Zhong; Gan, Xiu-Feng; Zhong, Sai-Feng

    2010-10-30

    The full-length pBluescript II SK cDNA library of adult Spirometra erinaceieuropaei was constructed by using the SMART method. Data showed that 95.5% of the library was recombinant and the titer of the library was 1.06 x 10(6). The average insert size of the library was about 1.4 kb. Forty-eight randomly selected clones were sequenced. A set of 36 effective expressed sequence tags (ESTs) with the average size of 674 bp was obtained after excluding clones shorter than 450 bp. The unigenes occupied 58.3% of the 36 ESTs. The rate of full-length cDNAs were 57.7% (15/26). The high-quality of full-length cDNA library could be used for large scale EST sequencing.

  2. Intensive Versus Standard Blood Pressure Control in SPRINT-Eligible Participants of ACCORD-BP.

    Science.gov (United States)

    Buckley, Leo F; Dixon, Dave L; Wohlford, George F; Wijesinghe, Dayanjan S; Baker, William L; Van Tassell, Benjamin W

    2017-12-01

    We sought to determine the effect of intensive blood pressure (BP) control on cardiovascular outcomes in participants with type 2 diabetes mellitus (T2DM) and additional risk factors for cardiovascular disease (CVD). This study was a post hoc, multivariate, subgroup analysis of ACCORD-BP (Action to Control Cardiovascular Risk in Diabetes Blood Pressure) participants. Participants were eligible for the analysis if they were in the standard glucose control arm of ACCORD-BP and also had the additional CVD risk factors required for SPRINT (Systolic Blood Pressure Intervention Trial) eligibility. We used a Cox proportional hazards regression model to compare the effect of intensive versus standard BP control on CVD outcomes. The "SPRINT-eligible" ACCORD-BP participants were pooled with SPRINT participants to determine whether the effects of intensive BP control interacted with T2DM. The mean baseline Framingham 10-year CVD risk scores were 14.5% and 14.8%, respectively, in the intensive and standard BP control groups. The mean achieved systolic BP values were 120 and 134 mmHg in the intensive and standard BP control groups ( P control reduced the composite of CVD death, nonfatal myocardial infarction (MI), nonfatal stroke, any revascularization, and heart failure (hazard ratio 0.79; 95% CI 0.65-0.96; P = 0.02). Intensive BP control also reduced CVD death, nonfatal MI, and nonfatal stroke (hazard ratio 0.69; 95% CI 0.51-0.93; P = 0.01). Treatment-related adverse events occurred more frequently in participants receiving intensive BP control (4.1% vs. 2.1%; P = 0.003). The effect of intensive BP control on CVD outcomes did not differ between patients with and without T2DM ( P > 0.62). Intensive BP control reduced CVD outcomes in a cohort of participants with T2DM and additional CVD risk factors. © 2017 by the American Diabetes Association.

  3. Mid-wavelength infrared unipolar nBp superlattice photodetector

    Science.gov (United States)

    Kazemi, Alireza; Myers, Stephen; Taghipour, Zahra; Mathews, Sen; Schuler-Sandy, Ted; Lee, Seunghyun; Cowan, Vincent M.; Garduno, Eli; Steenbergen, Elizabeth; Morath, Christian; Ariyawansa, Gamini; Scheihing, John; Krishna, Sanjay

    2018-01-01

    We report a Mid-Wavelength Infrared (MWIR) barrier photodetector based on the InAs/GaSb/AlSb type-II superlattice (T2SL) material system. The nBp design consists of a single unipolar barrier (InAs/AlSb SL) placed between a 4 μm thick p-doped absorber (InAs/GaSb SL) and an n-type contact layer (InAs/GaSb SL). At 80 K, the device exhibited a 50% cut-off wavelength of 5 μm, was fully turned-ON at zero bias and the measured QE was 50% (front side illumination with no AR coating) at 4.5 μm with a dark current density of 4.7 × 10-6 A/cm2 at Vb = 50 mV. At 150 K and Vb = 50 mV, the 50% cut-off wavelength increased to 5.3 μm, and the QE was 54% at 4.5 μm with a dark current of 5.0 × 10-4 A/cm2.

  4. AcEST: BP921355 [AcEST

    Lifescience Database Archive (English)

    Full Text Available : (bits) Value sp|Q8CIZ9|NOX1_MOUSE NADPH oxidase 1 OS=Mus musculus GN=Nox1 PE=... 35 0.15 sp|Q9ES45|DUOX2_R...OX1_HUMAN NADPH oxidase 1 OS=Homo sapiens GN=NOX1 PE=... 32 1.3 sp|Q9WV87|NOX1_RAT NADPH oxidase 1 OS=Rattus norvegicus GN=Nox...H oxidase 1 OS=Mus musculus GN=Nox1 PE=1 SV=1 Length = 563 Score = 34.7 bits (78)...ase 1 OS=Rattus norvegicus GN=Nox1 PE=2 SV=1 Length = 563 Score = 31.2 bits (69),

  5. AcEST: BP921299 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 209 >sp|Q9IGQ0|NRAM_I76AI Neuraminidase OS=Influenza A virus (strain A/Swine/New Jersey/11/1976 H1N1...M_I76A7 Neuraminidase OS=Influenza A virus (strain A/New Jersey/8/1976 H1N1) GN=N...RAM_I83A1 Neuraminidase OS=Influenza A virus (strain A/Chile/1/1983 H1N1) GN=NA PE=3 SV=1 Length = 470 Score...luenza A virus (strain A/Kiev/59/1979 H1N1) GN=NA PE=3 SV=1 Length = 470 Score = 30.4 bits (67), Expect = 4....CMRPCFWVELIRGRPREKTTIWTSGSSISFC 447 >sp|P03469|NRAM_I77AB Neuraminidase OS=Influenza A virus (strain A/USSR/90/1977 H1N1

  6. AcEST: BP912804 [AcEST

    Lifescience Database Archive (English)

    Full Text Available E G-protein coupled receptor moody OS=Drosop... 30 5.6 sp|Q2NEW2|RLA0_METST Acidic ribosomal protein P0 homo...+DQC Sbjct: 43 RNPAPFLTSDCSDESSFIDAANKSAKTCVSDPVGLDQC 80 >sp|Q9W534|MOODY_DROME G-protein coupled receptor mood...y OS=Drosophila melanogaster GN=moody PE=2 SV=2 Length = 670 Score = 29.6 bits (65), Expect = 5.6 Identit

  7. AcEST: BP912503 [AcEST

    Lifescience Database Archive (English)

    Full Text Available n sp|Q96JI7|SPTCS_HUMAN Spatacsin OS=Homo sapiens Align length 47 Score (bit) 32.....................done Score E Sequences producing significant alignments: (bits) Value sp|Q96JI7|SPTCS_HUMAN Spatacsi...e transporter-like protein 3 OS=Bos t... 30 6.4 >sp|Q96JI7|SPTCS_HUMAN Spatacsin OS=Homo sapiens GN=SPG11 PE

  8. AcEST: BP917535 [AcEST

    Lifescience Database Archive (English)

    Full Text Available efinition sp|Q1R6S0|TTDA_ECOUT L(+)-tartrate dehydratase subunit alpha OS=Escherichia coli (strain UTI89 / UPEC...(+)-tartrate dehydratase subunit alpha OS=Escherichia coli (strain UTI89 / UPEC) ...alpha OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ttdA PE=2 SV=1 Length

  9. AcEST: BP917372 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ot sp_hit_id Q1R2J0 Definition sp|Q1R2J0|IRAD_ECOUT Anti-adapter protein iraD OS=Escherichia coli (strain UTI89 / UPEC..._ECOUT Anti-adapter protein iraD OS=Escherichia coli (strain UTI89 / UPEC) GN=iraD PE=3 SV=1 Length = 127 Sc

  10. AcEST: BP919953 [AcEST

    Lifescience Database Archive (English)

    Full Text Available VU RNA-directed RNA polymerase OS=Whitewater arroyo virus (isolate Rat/United Sta...XB6|SO2B1_MOUSE Solute carrier organic anion transporter f... 29 9.8 >sp|B2ZDY2|L_WWAVU RNA-directed RNA polymerase OS=Whitewater arr...oyo virus (isolate Rat/United States/AV 9310135/1995) GN=L PE=3 SV=1 Length = 2219

  11. AcEST: BP915326 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9ACAR NADH dehydrogenase subunit 4 OS=Unionicola foili Align length 54 Score (bit...W617_9ACAR NADH dehydrogenase subunit 4 OS=Unionicol... 33 9.2 tr|A7E3I5|A7E3I5_B...OMMO Odorant receptor 44 (Fragment) OS=Bombyx ... 33 9.2 >tr|B3W617|B3W617_9ACAR NADH dehydrogenase subunit 4 OS=Union

  12. AcEST: BP911830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available SYKGLTVQETGVNKAVLKGTNYHVSPAHVDDYQDCTHQPANLG 1453 >sp|Q6DFA8|GLD2B_XENLA Poly(A) RNA polymerase GLD2-B OS=Xenopus laevis GN=papd4...LD2A_XENLA Poly(A) RNA polymerase GLD2-A OS=Xenopus laevis GN=papd4-A PE=1 SV=1 Length = 509 Score = 29.6 bi

  13. AcEST: BP912266 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AHDRMDCKGLEAVRR 830 >sp|Q9LRE6|DPOD1_ORYSJ DNA polymerase delta catalytic subunit OS=Oryza sativa subsp. japonica GN=POLD...e delta catalytic subunit OS=Plasmodium falciparum (isolate K1 / Thailand) GN=POLD1 PE=3 SV=1 Length = 1094 ... 831 >sp|P97283|DPOD1_MESAU DNA polymerase delta catalytic subunit OS=Mesocricetus auratus GN=POLD1 PE=2 SV=

  14. AcEST: BP913782 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0 4.8 sp|P0C2S8|TX36B_PHONI Neurotoxin Pn3-6B OS=Phoneutria nigrivente... 29 6.3 sp|P83901|TX34_PHORI Probable neurotoxin...9 >sp|P83901|TX34_PHORI Probable neurotoxin PRTx34C2 OS=Phoneutria reidyi PE=1 SV=1 Length = 58 Score = 28.9

  15. AcEST: BP918718 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 06_9POAL NADH dehydrogenase subunit B OS=Danthonia... 118 2e-25 tr|O03150|O03150_OSMCL NdhB protein (Fragment) OS=Osmunda clay...n (Fragment) OS=Osmunda claytoniana GN=ndhB PE=2 SV=1 Length = 148 Score = 117 bits (294), Expect = 2e-25 Id...QMYNSPG--ISIALIFITVGLGFKLSLAPFHQWTPDVYEGS 242 >tr|O03150|O03150_OSMCL NdhB protei

  16. AcEST: BP912998 [AcEST

    Lifescience Database Archive (English)

    Full Text Available r sakazakii ... 31 1.7 sp|Q9TTC2|GAG_KORV Gag polyprotein OS=Koala retrovirus GN=gag PE... 31 2.2 sp|P10978|...EQ 428 >sp|Q9TTC2|GAG_KORV Gag polyprotein OS=Koala retrovirus GN=gag PE=3 SV=3 Length = 521 Score = 30.8 bi

  17. AcEST: BP912490 [AcEST

    Lifescience Database Archive (English)

    Full Text Available V NSP1 OS=Italian lapine rotavirus 30/96 GN... 35 2.4 tr|A7QGY9|A7QGY9_VITVI Chromosome chr3 scaffold_95, wh...tr|Q1WK43|Q1WK43_9REOV NSP1 OS=Italian lapine rotavirus 30/96 GN=NSP1 PE=4 SV=1 Length = 492 Score = 34.7 bi

  18. AcEST: BP919523 [AcEST

    Lifescience Database Archive (English)

    Full Text Available damage checkpoint protein 1... 30 3.7 sp|P31956|PAC_ARTVI Penicillin G acylase OS=Arthrobacter viscosu... 30 4.8 sp|Q06106|MRD1...QKLSSAVIKASEKVGKERENFVQSSEELGLPLKIGSNAA 269 >sp|Q06106|MRD1_YEAST Multiple RNA-binding domain-containing pro...tein 1 OS=Saccharomyces cerevisiae GN=MRD1 PE=1 SV=1 Length = 887 Score = 29.3 bits (64), Expect = 6.3 Ident

  19. AcEST: BP921752 [AcEST

    Lifescience Database Archive (English)

    Full Text Available _CIOSA Protocadherin OS=Ciona savignyi Align length 83 Score (bit) 36.2 E-value 1.............done Score E Sequences producing significant alignments: (bits) Value tr|Q95YK1|Q95YK1_CIOSA Protocadherin OS=Ciona savigny... Predicted protein OS=Coprinopsis cinerea ... 33 9.8 >tr|Q95YK1|Q95YK1_CIOSA Protocadherin OS=Ciona savignyi

  20. SH3BP2 cherubism mutation potentiates TNF-α-induced osteoclastogenesis via NFATc1 and TNF-α-mediated inflammatory bone loss

    Science.gov (United States)

    Mukai, Tomoyuki; Ishida, Shu; Ishikawa, Remi; Yoshitaka, Teruhito; Kittaka, Mizuho; Gallant, Richard; Lin, Yi-Ling; Rottapel, Robert; Brotto, Marco; Reichenberger, Ernst J.; Ueki, Yasuyoshi

    2014-01-01

    Cherubism (OMIM#118400) is a genetic disorder with excessive jawbone resorption caused by mutations in the signaling adaptor protein SH3BP2. Studies on the mouse model for cherubism carrying a P416R knock-in mutation have revealed that mutant SH3BP2 enhances TNF-α production and RANKL-induced osteoclast differentiation in myeloid cells. TNF-α is expressed in human cherubism lesions, which contain a large number of TRAP-positive multinucleated cells, and TNF-α plays a critical role in inflammatory bone destruction in homozygous cherubism mice (Sh3bp2KI/KI). The data suggest a pathophysiological relationship between mutant SH3BP2 and TNF-α-mediated bone loss by osteoclasts. Therefore, we investigated whether P416R mutant SH3BP2 is involved in TNF-α-mediated osteoclast formation and bone loss. Here, we show that bone marrow-derived M-CSF-dependent macrophages (BMMs) from the heterozygous cherubism mutant (Sh3bp2KI/+) mice are highly responsive to TNF-α and can differentiate into osteoclasts independently of RANKL in vitro by a mechanism that involves SYK and PLCγ2 phosphorylation, leading to increased nuclear translocation of NFATc1. The heterozygous cherubism mutation exacerbates bone loss with increased osteoclast formation in a mouse calvarial TNF-α injection model as well as in a human TNF-α transgenic mouse model (hTNFtg). SH3BP2 knockdown in RAW264.7 cells results in decreased TRAP-positive multinucleated cell formation. These findings suggest that the SH3BP2 cherubism mutation can cause jawbone destruction by promoting osteoclast formation in response to TNF-α expressed in cherubism lesions and that SH3BP2 is a key regulator for TNF-α-induced osteoclastogenesis. Inhibition of SH3BP2 expression in osteoclast progenitors could be a potential strategy for the treatment of bone loss in cherubism as well as in other inflammatory bone disorders. PMID:24916406

  1. 7 Length-weight relationship

    African Journals Online (AJOL)

    Administrator

    Length-weight measurements were taken from well-preserved fish specimens from which stomachs were extracted for the analysis of the food contents, using frequency of occurrence, numerical and gravimetric methods, as well as index of relative importance. The length-frequency analysis showed a size distribution with a ...

  2. Comparison of fiber length analyzers

    Science.gov (United States)

    Don Guay; Nancy Ross Sutherland; Walter Rantanen; Nicole Malandri; Aimee Stephens; Kathleen Mattingly; Matt Schneider

    2005-01-01

    In recent years, several fiber new fiber length analyzers have been developed and brought to market. The new instruments provide faster measurements and the capability of both laboratory and on-line analysis. Do the various fiber analyzers provide the same length, coarseness, width, and fines measurements for a given fiber sample? This paper provides a comparison of...

  3. Decreasing asthma morbidity

    African Journals Online (AJOL)

    1994-12-12

    Dec 12, 1994 ... Apart from the optimal use of drugs, various supplementary methods have been tested to decrease asthma morbidity, usually in patients from reiatively affluent socio-economic backgrounds. A study of additional measures taken in a group of moderate to severe adult asthmatics from very poor socio- ...

  4. New plasma diagnosis by coherence length spectroscopy

    International Nuclear Information System (INIS)

    Poolyarat, N.; Kim, Y.W.

    2008-01-01

    A new methodology and instrumentation have been developed for diagnosis of dense high temperature plasmas. In a plasma medium, collision processes shorten the optical coherence length at a given emission wavelength. By measuring the coherence length, the rate of collisions a radiating particle experiences can be determined. A map of the collision rates throughout the plasma can speak volumes about the atomic and thermal state of the plasma. Both the time-integrated and time-resolved interference fringes are obtained using emissions due to the transition between 3s 2 3p 5 ( 2 P o 3/2 )4p and 3s 2 3p 5 ( 2 P o 3/2 )7d. We have observed that the coherence length indeed decreases with increasing collision rate, and in addition, as a function of time as a result of cumulative collisions. The coherence length was found to be 4200±800 nm at 50 torr where the collision frequency is 2.14x10 11 s -1 , and 2400±130 nm at 140 torr where the collision frequency is 8.13x10 11 s -1 . We have also discovered that the coherence length varies with the direction of the viewing line of sight into the discharge plasma. The anisotropy results from the non-uniform structure in the discharge current, and this is further investigated by intentionally deforming the tip of the cathode. A photographic examination of both the cathode and the anode disc confirms the non-axis-symmetric structure of the plasma, which leads to the asymmetry in the plasma, in agreement with the angular dependence of the coherence length. (author)

  5. Bioenergetic consequences of accumulating the common 4977-bp mitochondrial DNA deletion.

    Science.gov (United States)

    Porteous, W K; James, A M; Sheard, P W; Porteous, C M; Packer, M A; Hyslop, S J; Melton, J V; Pang, C Y; Wei, Y H; Murphy, M P

    1998-10-01

    Mutations and deletions in mitochondrial DNA (mtDNA) lead to a number of human diseases characterized by neuromuscular degeneration. Accumulation of truncated mtDNA molecules (delta-mtDNA) lacking a specific 4977-bp fragment, the common deletion, leads to three related mtDNA diseases: Pearson's syndrome; Kearns-Sayre syndrome; and chronic progressive external ophthalmoplegia (CPEO). In addition, the proportion of delta-mtDNA present increases with age in a range of tissues. Consequently, there is considerable interest in the effects of the accumulation of delta-mtDNA on cell function. The 4977-bp deletion affects genes encoding 7 polypeptide components of the mitochondrial respiratory chain, and 5 of the 22 tRNAs necessary for mitochondrial protein synthesis. To determine how the accumulation of delta-mtDNA affects oxidative phosphorylation we constructed a series of cybrids by fusing a human osteosarcoma cell line depleted of mtDNA (rho0) with enucleated skin fibroblasts from a CPEO patient. The ensuing cybrids contained 0-86% delta-mtDNA and all had volumes, protein contents, plasma-membrane potentials and mitochondrial contents similar to those of the parental cell line. The bioenergetic consequences of accumulating delta-mtDNA were assessed by measuring the mitochondrial membrane potential, rate of ATP synthesis and ATP/ADP ratio. In cybrids containing less than 50-55% delta-mtDNA, these bioenergetic functions were equivalent to those of cybrids with intact mtDNA. However, once the proportion of delta-mtDNA exceeded this threshold, the mitochondrial membrane potential, rate of ATP synthesis, and cellular ATP/ADP ratio decreased. These bioenergetic deficits will contribute to the cellular pathology associated with the accumulation of delta-mtDNA in the target tissues of patients with mtDNA diseases.

  6. A new BP Fourier algorithm and its application in English teaching evaluation

    Science.gov (United States)

    Pei, Xuehui; Pei, Guixin

    2017-08-01

    BP neural network algorithm has wide adaptability and accuracy when used in complicated system evaluation, but its calculation defects such as slow convergence have limited its practical application. The paper tries to speed up the calculation convergence of BP neural network algorithm with Fourier basis functions and presents a new BP Fourier algorithm for complicated system evaluation. First, shortages and working principle of BP algorithm are analyzed for subsequent targeted improvement; Second, the presented BP Fourier algorithm adopts Fourier basis functions to simplify calculation structure, designs new calculation transfer function between input and output layers, and conducts theoretical analysis to prove the efficiency of the presented algorithm; Finally, the presented algorithm is used in evaluating university English teaching and the application results shows that the presented BP Fourier algorithm has better performance in calculation efficiency and evaluation accuracy and can be used in evaluating complicated system practically.

  7. Probing the Conformational Distributions of Sub-Persistence Length DNA

    Energy Technology Data Exchange (ETDEWEB)

    Mastroianni, Alexander; Sivak, David; Geissler, Phillip; Alivisatos, Paul

    2009-06-08

    We have measured the bending elasticity of short double-stranded DNA (dsDNA) chains through small-angle X-ray scattering from solutions of dsDNA-linked dimers of gold nanoparticles. This method, which does not require exertion of external forces or binding to a substrate, reports on the equilibrium distribution of bending fluctuations, not just an average value (as in ensemble FRET) or an extreme value (as in cyclization), and in principle provides a more robust data set for assessing the suitability of theoretical models. Our experimental results for dsDNA comprising 42-94 basepairs (bp) are consistent with a simple worm-like chain model of dsDNA elasticity, whose behavior we have determined from Monte Carlo simulations that explicitly represent nanoparticles and their alkane tethers. A persistence length of 50 nm (150 bp) gave a favorable comparison, consistent with the results of single-molecule force-extension experiments on much longer dsDNA chains, but in contrast to recent suggestions of enhanced flexibility at these length scales.

  8. Crisis strategies in BP's Deepwater Horizon response : An image repair and situational crisis communication study

    OpenAIRE

    Johansson, Mikael

    2017-01-01

    The BP Deepwater Horizon crisis in 2010 was one the largest catastrophes in the history of the oil industry. BP was sued over the disaster, and lost several billion dollars. This study examines the crisis response strategies and/or image repair strategies, which can be found in BP's press releases following the Deepwater Horizon crisis. In particular, the study looks closer at what established crisis communication strategies could be discerned in the material, and how they are used discursive...

  9. Restoration of microRNA-708 sensitizes ovarian cancer cells to cisplatin via IGF2BP1/Akt pathway.

    Science.gov (United States)

    Qin, Xuying; Sun, Linlin; Wang, Jing

    2017-10-01

    A previous study has shown that microRNA-708 (miR-708) functions as a metastasis suppressor in ovarian cancer. In this study, we aimed to explore its implication in regulating cisplatin sensitivity in ovarian cancer cells. To this end, ovarian cancer cells were transfected with miR-708-expressing plasmids or vector before treatment with different concentrations of cisplatin for 48 h. The 50% inhibitory concentration (IC 50 ) value was calculated. Apoptosis was analyzed by measuring caspase-3 activity. The target gene mediating the function of miR-708 was identified. Ectopic expression of miR-708 sensitized SKOV3 and A2780 cells to cisplatin, decreasing the IC 50 value by two- to threefold. miR-708 overexpression significantly augmented cisplatin-induced apoptosis in ovarian cancer cells, which was coupled with increased caspase-3 activity by two- to fourfold. Similarly, overexpression of miR-708 increased the sensitivity of cisplatin-resistant SKOV3/DDP and A2780/DDP cells to cisplatin-induced toxicity, reducing the IC 50 by three- and fivefold, respectively. Delivery of miR-708 enhanced cisplatin-induced elevation in caspase-3 activity in both cisplatin-resistant and parental ovarian cancer cells. Mechanistically, miR-708 downregulated the expression of insulin-like growth factor 2 mRNA-binding protein 1 (IGF2BP1) and suppressed Akt phosphorylation. Silencing of IGF2BP1 markedly blocked the phosphorylation of Akt. Overexpression of IGF2BP1 restored cisplatin resistance and Akt phosphorylation in miR-708-overexpressing ovarian cancer cells. Collectively, miR-708 increases the susceptibility of ovarian cancer cells to cisplatin by targeting IGF2BP1 and inhibiting Akt signaling. Delivery of miR-708 may represent a promising strategy for improving cisplatin chemotherapy. © 2017 International Federation for Cell Biology.

  10. A 50 bp deletion in the SOD1 promoter lowers enzyme expression but is not associated with ALS in Sweden.

    Science.gov (United States)

    Ingre, Caroline; Wuolikainen, Anna; Marklund, Stefan L; Birve, Anna; Press, Rayomand; Andersen, Peter M

    2016-01-01

    Mutations in the superoxide dismutase (SOD1) gene have been linked to amyotrophic lateral sclerosis (ALS). A 50 base pair (bp) deletion of SOD1 has been suggested to reduce transcription and to be associated with later disease onset in ALS. This study was aimed to reveal if the 50 bp deletion influenced SOD1 enzymatic activity, occurrence and phenotype of the disease in a Swedish ALS/control cohort. Blood samples from 512 Swedish ALS patients and 354 Swedish controls without coding SOD1 mutations were analysed for the 50 bp deletion allele. The enzymatic activity of SOD1 in erythrocytes was analysed and genotype-phenotype correlations were assessed. Results demonstrated that the genotype frequencies of the 50 bp deletion were all found to be in Hardy-Weinberg equilibrium. No significant differences were found for age of onset, disease duration or site of onset. SOD1 enzymatic activity showed a statistically significant decreasing trend in the control group, in which the allele was associated with a 5% reduction in SOD1 activity. The results suggest that the 50 bp deletion has a moderate reducing effect on SOD1 synthesis. No modulating effects, however, were found on ALS onset, phenotype and survival in the Swedish population.

  11. AcEST: BP913364 [AcEST

    Lifescience Database Archive (English)

    Full Text Available nition sp|P0C6A2|MAMD1_MOUSE Mastermind-like domain-containing protein 1 OS=Mus musculus Align length 73 Sco...nts: (bits) Value sp|P0C6A2|MAMD1_MOUSE Mastermind-like domain-containing protein ... 33 0.55 sp|Q9QZA1|PHLA... 7.9 >sp|P0C6A2|MAMD1_MOUSE Mastermind-like domain-containing protein 1 OS=Mus mu

  12. AcEST: BP916191 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ber 5... 30 8.2 >sp|Q6UY61|L_SABVB RNA-directed RNA polymerase OS=Sabia virus (isolate Human/Brasil...a virus (isolate Human/Brasil/SPH114202/1990) Align length 29 Score (bit) 30.0 E-value 8.2 Report BLASTX 2.2...BlastX Result : Swiss-Prot sp_hit_id Q6UY61 Definition sp|Q6UY61|L_SABVB RNA-directed RNA polymerase OS=Sabi

  13. AcEST: BP916642 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ides f... 35 0.20 sp|Q9NRI5|DISC1_HUMAN Disrupted in schizophrenia 1 protein OS=Ho... 34 0.34 sp|O94386|YGS9...EL----QAHADEVEELRRKMAQ-KISEYEEQLEALLNKCSSLEKQKSR 258 Query: 145 L 143 L Sbjct: 259 L 259 >sp|Q9NRI5|DISC1_HUMAN Disrupted in schizoph...renia 1 protein OS=Homo sapiens GN=DISC1 PE=1 SV=3 Length = 854 Score = 34.3 bits (

  14. AcEST: BP921082 [AcEST

    Lifescience Database Archive (English)

    Full Text Available B Pol polyprotein (Fragment) OS=Cas-Br-E murin... 52 1e-06 sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation... muri... 52 1e-06 sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation muri...LLLPLALYRARN 431 >sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 Le...N Sbjct: 75 ADLLGIDWKLHCAYRPQSSGQVERMNRTIKETLTKLTLATGSRDWVLLLPLALYRARN 132 >sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiati...on murine leukemia virus (strain Kaplan) GN=pol PE=3 SV=1 Length = 581 Score = 52.0

  15. AcEST: BP914638 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ion muri... 38 0.037 sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukem...27|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 ...+ +SP+ Q AHL Y++ E Sbjct: 149 PPPLVNFPDPDMTRVTNSPSLQ------AHLQALYLVQHE 182 >sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiati...yprotein (Fragment) OS=Cas-Br-E murin... 38 0.029 sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiat...on murine leukemia virus (strain Kaplan) GN=pol PE=3 SV=1 Length = 581 Score = 37.7

  16. AcEST: BP916724 [AcEST

    Lifescience Database Archive (English)

    Full Text Available chysandra termina... 125 8e-28 tr|Q43231|Q43231_UROPA Carbonic anhydrase 1 OS=Urochloa panicoid... 125 1e-27... tr|Q43230|Q43230_UROPA Carbonic anhydrase 2 OS=Urochloa panicoid... 125 1e-27 tr|Q5NE20|Q5NE20_SOLLC Carbon...SWSVD 406 YYDFVN +FE W +D Sbjct: 301 YYDFVNGSFELWGLD 315 >tr|Q43231|Q43231_UROPA Carbonic anhydrase 1 OS=Urochloa panico...2 HYDFVKGAFVTW 213 >tr|Q43230|Q43230_UROPA Carbonic anhydrase 2 OS=Urochloa panicoides PE=2 SV=1 Length = 24

  17. AcEST: BP915765 [AcEST

    Lifescience Database Archive (English)

    Full Text Available euron 2 protein OS=Ho... 31 2.0 sp|Q13428|TCOF_HUMAN Treacle protein OS=Homo sapiens GN=TCOF1 PE... 31 2.6 s...CNLCTCLGGFVTCGRRP 755 Query: 25 CDALSCDH 2 C+ C H Sbjct: 756 CEPPGCSH 763 >sp|Q13428|TCOF_HUMAN Treacle prot...ein OS=Homo sapiens GN=TCOF1 PE=1 SV=2 Length = 1488 Score = 30.8 bits (68), Expect = 2.6 Identities = 15/31

  18. AcEST: BP915195 [AcEST

    Lifescience Database Archive (English)

    Full Text Available -25 tr|O04792|O04792_9ROSI Acyl-ACP thioesterase OS=Garcinia mangost... 119 1e-25 tr|B8BDB0|B8BDB0_ORYSI Put...04793_9ROSI Acyl-ACP thioesterase OS=Garcinia mangost... 117 3e-25 tr|B8LS31|B8LS31_PICSI Putative uncharact...tr|O04792|O04792_9ROSI Acyl-ACP thioesterase OS=Garcinia mangostana GN=FatA1 PE=2 SV=1 Length = 352 Score =

  19. AcEST: BP921395 [AcEST

    Lifescience Database Archive (English)

    Full Text Available A polymerase eta OS=Homo sapiens GN=POLH ... 157 2e-38 sp|Q9JJN0|POLH_MOUSE DNA polymerase eta OS=Mus musculus GN=Polh...SADLLPSTYIEGLPQ 152 >sp|Q9JJN0|POLH_MOUSE DNA polymerase eta OS=Mus musculus GN=Polh PE=1 SV=1 Length = 694 ...t) OS=Nematoste... 179 1e-43 tr|B6LRM6|B6LRM6_BRAFL Putative uncharacterized protein (Fragmen... 169 1e-40 tr|Q6DCL9|Q6DCL9_XENLA Pol

  20. AcEST: BP913891 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus Align length 75 Score (bit) 57.4 E-value 4.0e-08 Repo..._KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pr... 57 4e-08 sp|Q9UR07|RTF23_SCHPO Retrotransposable elem...0.026 sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing... 38 0.026 >sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala

  1. AcEST: BP913643 [AcEST

    Lifescience Database Archive (English)

    Full Text Available on tr|Q0GK55|Q0GK55_9CLOS Polyprotein 1a OS=Strawberry chlorotic fleck associated virus Align length 45 Scor...nments: (bits) Value tr|Q0GK55|Q0GK55_9CLOS Polyprotein 1a OS=Strawberry chloroti...c fl... 33 9.2 >tr|Q0GK55|Q0GK55_9CLOS Polyprotein 1a OS=Strawberry chlorotic fleck associated virus PE=4 SV

  2. AcEST: BP913048 [AcEST

    Lifescience Database Archive (English)

    Full Text Available inition tr|A0SPV6|A0SPV6_9MAGN Maturase K OS=Manekia naranjoana Align length 98 Score (bit) 34.7 E-value 2.5...A0SPV6|A0SPV6_9MAGN Maturase K OS=Manekia naranjoana GN=matK ... 35 2.5 tr|A0SPV5|A0SPV5_9MAGN Maturase K OS...utative uncharacterized protein OS=Parvi... 33 9.3 >tr|A0SPV6|A0SPV6_9MAGN Maturase K OS=Manekia naranjoana

  3. AcEST: BP919313 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |O65001|TE1_MAIZE Protein terminal ear1 OS=Zea mays GN=TE1 PE=... 125 1e-28 sp|Q4PC17|MRD1...rrier family 22 member 15-like OS... 31 2.7 sp|Q6CEW9|MRD1_YARLI Multiple RNA-binding domain-containing prot... E + P Sbjct: 558 DSDEYLPVAFSPARDGKELTDPVP 581 >sp|Q4PC17|MRD1_USTMA Multiple RNA-binding domain-containing ...protein 1 OS=Ustilago maydis GN=MRD1 PE=3 SV=1 Length = 858 Score = 38.1 bits (87

  4. BP1 Homeoprotein Enhances Metastatic Potential in ER-negative Breast Cancer

    Science.gov (United States)

    Fu, Yebo; Lian, Yi; Kim, Kyung Soon; Zhang, Lei; Hindle, A. Katharine; Brody, Fred; Siegel, Robert S.; McCaffrey, Timothy A.; Fu, Sidney W.

    2010-01-01

    Tumor invasion and metastasis remain a major cause of mortality in breast cancer patients. It was reported that BP1, a homeobox isoform of DLX4, is overexpressed in 80% of breast cancer patients and in 100% of estrogen receptor negative (ER-) tumors. The prevalence of BP1 positive cells and the intensity of BP1 immunoreactivity increased with the extent of ductal proliferation and tumorigenesis. These findings imply that BP1 may play an important role in ER- breast cancer. We sought to determine the effects and mechanisms of BP1 on cell proliferation and metastasis using ER- Hs578T cells as a model. Cells were transfected with either pcDNA3.2 plasmid containing BP1 gene, or pcDNA3.2 vector, then selected and cloned. Overexpression of BP1 increased cell proliferation rate by 2-5 fold (p=2.0. Of those genes, 49 were up-regulated and 22 were down-regulated. Significant pathways were identified involving cell proliferation and metastasis. These data demonstrated that overexpression of BP1 significantly enhanced cell proliferation and metastatic potential in ER- Hs578T cells. Further analysis with more ER- cell lines and patient samples is warranted to establish BP1 as a therapeutic target for ER- breast cancer. PMID:20842225

  5. Research on wind field algorithm of wind lidar based on BP neural network and grey prediction

    Science.gov (United States)

    Chen, Yong; Chen, Chun-Li; Luo, Xiong; Zhang, Yan; Yang, Ze-hou; Zhou, Jie; Shi, Xiao-ding; Wang, Lei

    2018-01-01

    This paper uses the BP neural network and grey algorithm to forecast and study radar wind field. In order to reduce the residual error in the wind field prediction which uses BP neural network and grey algorithm, calculating the minimum value of residual error function, adopting the residuals of the gray algorithm trained by BP neural network, using the trained network model to forecast the residual sequence, using the predicted residual error sequence to modify the forecast sequence of the grey algorithm. The test data show that using the grey algorithm modified by BP neural network can effectively reduce the residual value and improve the prediction precision.

  6. Association of Autoantibodies to BP180 with Disease Activity in Greek Patients with Bullous Pemphigoid

    Directory of Open Access Journals (Sweden)

    Aikaterini Patsatsi

    2012-01-01

    Full Text Available 39 bullous pemphigoid (BP patients were studied to assess the clinical significance of anti-BP180 and anti-BP230 circulating autoantibodies of BP and correlate their titers with the clinical scores of the BP Disease Area Index (BPDAI and the Autoimmune Bullous Skin Disorder Intensity Score (ABSIS as well as with the intensity of pruritus measured by the BPDAI pruritus component. All parameters were evaluated by the time of diagnosis (baseline, month 3, and month 6. Titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with BPDAI component for the intensity of pruritus (, at baseline. At month 3, titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with the BPDAI component for the intensity of pruritus (, . At month 6, titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with the BPDAI component for the intensity of pruritus (, . There was no statistically significant correlation between titers of anti-BP230 autoantibodies and the BPDAI, ABSIS, and BPDAI component for the intensity of pruritus at the same time points.

  7. Prediction of Industrial Electric Energy Consumption in Anhui Province Based on GA-BP Neural Network

    Science.gov (United States)

    Zhang, Jiajing; Yin, Guodong; Ni, Youcong; Chen, Jinlan

    2018-01-01

    In order to improve the prediction accuracy of industrial electrical energy consumption, a prediction model of industrial electrical energy consumption was proposed based on genetic algorithm and neural network. The model use genetic algorithm to optimize the weights and thresholds of BP neural network, and the model is used to predict the energy consumption of industrial power in Anhui Province, to improve the prediction accuracy of industrial electric energy consumption in Anhui province. By comparing experiment of GA-BP prediction model and BP neural network model, the GA-BP model is more accurate with smaller number of neurons in the hidden layer.

  8. TopBP1 associates with NBS1 and is involved in homologous recombination repair

    International Nuclear Information System (INIS)

    Morishima, Ken-ichi; Sakamoto, Shuichi; Kobayashi, Junya; Izumi, Hideki; Suda, Tetsuji; Matsumoto, Yoshiyuki; Tauchi, Hiroshi; Ide, Hiroshi; Komatsu, Kenshi; Matsuura, Shinya

    2007-01-01

    TopBP1 is involved in DNA replication and DNA damage checkpoint. Recent studies have demonstrated that TopBP1 is a direct positive effecter of ATR. However, it is not known how TopBP1 recognizes damaged DNA. Here, we show that TopBP1 formed nuclear foci after exposure to ionizing radiation, but such TopBP1 foci were abolished in Nijmegen breakage syndrome cells. We also show that TopBP1 physically associated with NBS1 in vivo. These results suggested that NBS1 might regulate TopBP1 recruitment to the sites of DNA damage. TopBP1-depleted cells showed hypersensitivity to Mitomycin C and ionizing radiation, an increased frequency of sister-chromatid exchange level, and a reduced frequency of DNA double-strand break induced homologous recombination repair. Together, these results suggested that TopBP1 might be a mediator of DNA damage signaling from NBS1 to ATR and promote homologous recombination repair

  9. BP reactivity to public speaking in stage 1 hypertension: influence of different task scenarios.

    Science.gov (United States)

    Palatini, Paolo; Bratti, Paolo; Palomba, Daniela; Bonso, Elisa; Saladini, Francesca; Benetti, Elisabetta; Casiglia, Edoardo

    2011-10-01

    To investigate the blood pressure (BP) reaction to public speaking performed according to different emotionally distressing scenarios in stage 1 hypertension. METHODS. We assessed 64 hypertensive and 30 normotensive subjects. They performed three speech tasks with neutral, anger and anxiety scenarios. BP was assessed with the Finometer beat-to-beat non-invasive recording system throughout the test procedure. For all types of speech, the systolic BP response was greater in the hypertensive than the normotensive subjects (all p public speaking is increased in stage 1 hypertension. A speech with anxiety or anger scenario elicits a greater diastolic BP reaction than tasks with neutral content.

  10. Nuclear Enterprises portable dose rate meter type PDR4 and external probes types BP1/1, BP8 and GP9

    International Nuclear Information System (INIS)

    Burgess, P.H.; Iles, W.J.

    1979-08-01

    The performance characteristics of Nuclear Enterprises Portable Dose Rate Meter Type PDR4 are evaluated under the headings: general description, facilities and controls, radiation characteristics, electrical characteristics, environmental characteristics, mechanical characteristics, the manual, summary of performance, and conclusions. Results of an investigation of the radiation characteristics of the external probes Type BP1/1, Type BP8, and Type GP9 are also detailed. (U.K.)

  11. Sperm length evolution in the fungus-growing ants

    DEFF Research Database (Denmark)

    Baer, B.; Dijkstra, M. B.; Mueller, U. G.

    2009-01-01

    Eusocial insects offer special opportunities for the comparative study of sperm traits because sperm competition is absent (in species with obligatory monandry) or constrained (in lineages where queens mate multiply but never remate later in life). We measured sperm length in 19 species of fungus......-growing ants, representing 9 of the 12 recognized genera, and mapped these onto the ant phylogeny. We show that average sperm length across species is highly variable and decreases with mature colony size in basal genera with singly mated queens, suggesting that sperm production or storage constraints affect...... the evolution of sperm length. Sperm length does not decrease further in multiply mating leaf-cutting ants, despite substantial further increases in colony size. In a combined analysis, sexual dimorphism explained 63.1% of the variance in sperm length between species. As colony size was not a significant...

  12. Time step length versus efficiency of Monte Carlo burnup calculations

    International Nuclear Information System (INIS)

    Dufek, Jan; Valtavirta, Ville

    2014-01-01

    Highlights: • Time step length largely affects efficiency of MC burnup calculations. • Efficiency of MC burnup calculations improves with decreasing time step length. • Results were obtained from SIE-based Monte Carlo burnup calculations. - Abstract: We demonstrate that efficiency of Monte Carlo burnup calculations can be largely affected by the selected time step length. This study employs the stochastic implicit Euler based coupling scheme for Monte Carlo burnup calculations that performs a number of inner iteration steps within each time step. In a series of calculations, we vary the time step length and the number of inner iteration steps; the results suggest that Monte Carlo burnup calculations get more efficient as the time step length is reduced. More time steps must be simulated as they get shorter; however, this is more than compensated by the decrease in computing cost per time step needed for achieving a certain accuracy

  13. Transcriptional signature of accessory cells in the lateral line, using the Tnk1bp1:EGFP transgenic zebrafish line

    Directory of Open Access Journals (Sweden)

    Behra Martine

    2012-01-01

    Full Text Available Abstract Background Because of the structural and molecular similarities between the two systems, the lateral line, a fish and amphibian specific sensory organ, has been widely used in zebrafish as a model to study the development/biology of neuroepithelia of the inner ear. Both organs have hair cells, which are the mechanoreceptor cells, and supporting cells providing other functions to the epithelium. In most vertebrates (excluding mammals, supporting cells comprise a pool of progenitors that replace damaged or dead hair cells. However, the lack of regenerative capacity in mammals is the single leading cause for acquired hearing disorders in humans. Results In an effort to understand the regenerative process of hair cells in fish, we characterized and cloned an egfp transgenic stable fish line that trapped tnks1bp1, a highly conserved gene that has been implicated in the maintenance of telomeres' length. We then used this Tg(tnks1bp1:EGFP line in a FACsorting strategy combined with microarrays to identify new molecular markers for supporting cells. Conclusions We present a Tg(tnks1bp1:EGFP stable transgenic line, which we used to establish a transcriptional profile of supporting cells in the zebrafish lateral line. Therefore we are providing a new set of markers specific for supporting cells as well as candidates for functional analysis of this important cell type. This will prove to be a valuable tool for the study of regeneration in the lateral line of zebrafish in particular and for regeneration of neuroepithelia in general.

  14. [Effects of fertilization on fine root diameter, root length and specific root length in Larix kaempferi plantation].

    Science.gov (United States)

    Yu, Li-zhong; Ding, Guo-quan; Shi, Jian-wei; Yu, Shui-qiang; Zhu, Jiao-jun; Zhao, Lian-fu

    2007-05-01

    With 16 years old Larix kaempfersoil plantation in the mountainous area of eastern Liaoning Province as test object, this paper studied the effects of fertilization on the fine root diameter, root length, and specific root length (SRL) of the first to fifth order roots. The results showed that with ascending root orders, the mean fine root diameter and root length increased, while the SRL decreased significantly. Among the five order roots, the first order roots were the thinnest in diameter, the shortest in length, and the highest in SRL, but the fifth order roots were in reverse. The variance coefficients for the fine root diameter, root length, and SRL increased from the first to the fifth order roots. Except for the first order roots, soil depth had no significant influence on the fine root diameter, root length and SRL. Fertilization affected the fine root diameter, root length, and SRL of the first and the second order roots significantly, hut had little effects on other order roots. N fertilization decreased the mean diameter of the first and the second order roots significantly, and N or N + P fertilization decreased the mean length of the first order roots in surface soil (0-10 cm) significantly. The SRL of the first order roots in surface soil increased significantly under N fertilization.

  15. BP1, an Isoform of DLX4 Homeoprotein, Negatively Regulates BRCA1 in Sporadic Breast Cancer

    Science.gov (United States)

    Kluk, Brian J.; Fu, Yebo; Formolo, Trina A.; Zhang, Lei; Hindle, Anne K.; Man, Yan-gao; Siegel, Robert S.; Berg, Patricia E.; Deng, Chuxia; McCaffrey, Timothy A.; Fu, Sidney W.

    2010-01-01

    Introduction: Several lines of evidence point to an important role for BP1, an isoform of DLX4 homeobox gene, in breast carcinogenesis and progression. BRCA1 is a well-known player in the etiology of breast cancer. While familial breast cancer is often marked by BRCA1 mutation and subsequent loss of heterozygosity, sporadic breast cancers exhibit reduced expression of wild type BRCA1, and loss of BRCA1 expression may result in tumor development and progression. Methods: The Cister algorithm and Genomatix program were used to identify potential BP1 binding sites in BRCA1 gene. Real-time PCR, Western blot and immunohistochemistry analysis were performed to verify the expression of BRCA1 and BP1 in cell lines and breast cancer tissues. Double-stranded siRNA transfection was carried out for silencing BP1 expression. ChIP and EMSA were used to confirm that BP1 specifically binds to BRCA1. Results: A putative BP1 binding site was identified in the first intron of BRCA1, which was confirmed by chromatin immunoprecipiation and electrophoresis mobility shift assay. BP1 and BRCA1 expression were inversely correlated in breast cancer cell lines and tissues, suggesting that BP1 may suppress BRCA1 transcription through consensus sequence binding. Conclusions: BP1 homeoprotein represses BRCA1 expression through direct binding to its first intron, which is consistent with a previous study which identified a novel transcriptional repressor element located more than 500 base pairs into the first intron of BRCA1, suggesting that the first intron plays an important role in the negative regulation of BRCA1. Although further functional studies are necessary to confirm its repressor activity towards BRCA1, the elucidation of the role of BP1 in breast tumorigenesis holds great promise in establishing BP1 as a novel target for drug therapy. PMID:20877436

  16. Neolithic cultivation of water chestnuts (Trapa L.) at Tianluoshan (7000-6300 cal BP), Zhejiang Province, China.

    Science.gov (United States)

    Guo, Yi; Wu, Rubi; Sun, Guoping; Zheng, Yunfei; Fuller, Benjamin T

    2017-11-24

    Water chestnuts (Trapa) are frequently recovered at Neolithic sites along the Lower Yangtze River Valley and have been important components of the diets of prehistoric people. However, little systematic research has been conducted to determine their cultural and dietary importance. Excavations at the Tianluoshan site produced large quantities of well-preserved specimens, which provide an excellent collection for studying morphological changes with time. Using modern wild and domesticated water chestnuts (n = 447) as a reference, we find Neolithic samples (n = 481) at Tianluoshan are similar in shape but smaller in size compared to the domesticated species Trapa bispinosa. In particular, the Tianluoshan water chestnuts have bigger seeds than the wild species Trapa incisa. Further, water chestnuts diachronically increased in size at the Tianluoshan site with significant differences (one-way, ANOVA) observed for length (p = 7.85E-08), height (p = 3.19E-06), thickness (p = 1.2E-13), top diameter (p = 5.04E-08) and bottom diameter (p = 1.75E-05) between layers 7 (6700-6500 cal BP) and 6 (6500-6300 cal BP). These results suggest that water chestnuts were actively selected based on size (big), shape (full fruit, two round horns, wide base, etc.) and were an important non-cereal crop to the agricultural practices at the Tianluoshan site.

  17. RanBP9 overexpression accelerates loss of pre and postsynaptic proteins in the APΔE9 transgenic mouse brain.

    Directory of Open Access Journals (Sweden)

    Hongjie Wang

    Full Text Available There is now compelling evidence that the neurodegenerative process in Alzheimer's disease (AD begins in synapses. Loss of synaptic proteins and functional synapses in the amyloid precursor protein (APP transgenic mouse models of AD is well established. However, what is the earliest age at which such loss of synapses occurs, and whether known markers of AD progression accelerate functional deficits is completely unknown. We previously showed that RanBP9 overexpression leads to robustly increased amyloid β peptide (Aβ generation leading to enhanced amyloid plaque burden in a mouse model of AD. In this study we compared synaptic protein levels among four genotypes of mice, i.e., RanBP9 single transgenic (Ran, APΔE9 double transgenic (Dbl, APΔE9/RanBP9 triple transgenic (Tpl and wild-type (WT controls. We found significant reductions in the levels of synaptic proteins in both cortex and hippocampus of 5- and 6-months-old but not 3- or 4-months-old mice. Specifically, at 5-months of age, rab3A was reduced in the triple transgenic mice only in the cortex by 25% (p<0.05 and gap43 levels were reduced only in the hippocampus by 44% (p<0.01 compared to wild-type (WT controls. Interestingly, RanBP9 overexpression in the Tpl mice reduced gap43 levels by a further 31% (p<0.05 compared to APΔE9 mice. RanBP9 also further decreased the levels of drebrin in the hippocampus by 32% (p<0.01 and chromogranin in the cortex by 24% (p<0.05 compared to APΔE9 mice. At 6-months of age, RanBP9 expression in the cortex led to further reduction of rab3A by 30% (p<0.05 and drebrin by 38% (p<0.01 compared to APΔE9 mice. RanBP9 also increased Aβ oligomers in the cortex at 6 months. Similarly, in the hippocampus, RanBP9 expression further reduced rab3A levels by 36% (p<0.01 and drebrin levels by 33% (p<0.01. Taken together these data suggest that RanBP9 overexpression accelerates loss of synaptic proteins in the mouse brain.

  18. AcEST: BP918900 [AcEST

    Lifescience Database Archive (English)

    Full Text Available EZF4|A2EZF4_TRIVA Putative uncharacterized protein OS=Trich... 35 1.9 tr|Q66775|Q66775_9PICO Polyprotein OS=Equine rhinitis... A virus PE... 34 4.2 tr|Q66774|Q66774_9PICO Polyprotein OS=Equine rhinitis... A virus PE... 34 4.2 tr|Q2XPF8|Q2XPF8_9PICO Polyprotein OS=Equine rhinitis A virus PE... 34 4.2 tr...|Q2XP17|Q2XP17_9PICO Polyprotein OS=Equine rhinitis A virus PE... 34 4.2 tr|O39818|O39818_9PICO Polyprotein OS=Equine rhinitis...r|Q66775|Q66775_9PICO Polyprotein OS=Equine rhinitis A virus PE=4 SV=1 Length = 2227 Score = 33.9 bits (76),

  19. AcEST: BP920653 [AcEST

    Lifescience Database Archive (English)

    Full Text Available chnera aphi... 31 3.1 sp|Q9UJ42|GP160_HUMAN Probable G-protein coupled receptor 160 OS... 30 6.8 sp|Q9R1Y5|HIC1_MOUSE Hyperme...thylated in cancer 1 protein OS=Mus ... 29 8.7 sp|Q14526|HIC1_HUMAN Hypermethylated in canc... Query: 376 AAHC 387 + HC Sbjct: 171 SRHC 174 >sp|Q9R1Y5|HIC1_MOUSE Hypermethylated in cancer 1 protein OS=M...SL 850 >sp|Q14526|HIC1_HUMAN Hypermethylated in cancer 1 protein OS=Homo sapiens GN=HIC1 PE=1 SV=4 Length =

  20. AcEST: BP914841 [AcEST

    Lifescience Database Archive (English)

    Full Text Available olyprotein OS=AKV murine leukemia virus... 34 0.52 sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation... muri... 33 1.2 sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia... 33 1.2 sp|P03355|POL_M...95|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation murine leukemia virus (strain Kaplan) GN=pol PE=3 SV=1 ...TI+E ++ L+ A T+ WV L +++Y Sbjct: 383 LHCAYRPQSSGQVERMNRTIKE-TLTKLTLATGTR-DWVLLLPLALY 427 >sp|P11227|POL_MLVRD Pol polyprotein OS=Radi...ation murine leukemia virus GN=pol PE=3 SV=1 Length = 11

  1. AcEST: BP920262 [AcEST

    Lifescience Database Archive (English)

    Full Text Available olyprotein (Fragment) OS=Feline endogen... 40 0.005 sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation... muri... 39 0.006 sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia... 39 0.006 sp|P10272|...LLRARNTPNRFGLTPYEILYGGPP 916 >sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation... GF-AYNTTVTR-INPLRAQYGRDP 255 + A NT + P YG P Sbjct: 426 LYRARNTPGPHGLTPYEILYGAPP 449 >sp|P11227|POL_MLVRD Pol polyprotein OS=Radiati...on murine leukemia virus GN=pol PE=3 SV=1 Length = 1196 Score = 39.3 bits (90), Exp

  2. AcEST: BP911481 [AcEST

    Lifescience Database Archive (English)

    Full Text Available producing significant alignments: (bits) Value sp|Q13428|TCOF_HUMAN Treacle protein OS=Homo sapiens GN=TCOF1...N Treacle protein OS=Homo sapiens GN=TCOF1 PE=1 SV=2 Length = 1488 Score = 39.3 b...0.15 tr|B4E111|B4E111_HUMAN cDNA FLJ57346, highly similar to Homo sap... 39 0.15 tr|A0JLU0|A0JLU0_HUMAN TCOF1...DNA FLJ57346, highly similar to Homo sapiens Treacher Collins-Franceschetti syndrome 1 (TCOF1), transcript v...QVKGGALPPAKRAKKPEEESESSEEGSESEEE 282 >tr|A0JLU0|A0JLU0_HUMAN TCOF1 protein (Fragm

  3. AcEST: BP918362 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TP-binding cassette sub-family D member 2... 40 0.007 sp|P48410|ABCD1_MOUSE ATP-b...inding cassette sub-family D member 1... 40 0.007 sp|P33897|ABCD1_HUMAN ATP-binding cassette sub-family D me...GWRIEILN 403 +GI++LSI HRP+L K+H L DG GWR E L+ Sbjct: 654 AGISLLSITHRPSLWKYHTHLLQFDG---EGGWRFEQLD 689 >sp|P48410|ABCD1...W+ E L++ A Sbjct: 645 QAAKDAGIALLSITHRPSLWKYHTHLLQFDG---EGGWKFEKLDSAA 688 >sp|P33897|ABCD1_HUMAN ATP-binding... cassette sub-family D member 1 OS=Homo sapiens GN=ABCD1 PE=1 SV=2 Length = 745 Score = 40.0 bits (92), Expe

  4. AcEST: BP914455 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 108 1e-23 sp|P55096|ABCD3_MOUSE ATP-binding cassette sub-family D member 3... 104 3e-22 sp|P48410|ABCD1..._MOUSE ATP-binding cassette sub-family D member 1... 84 4e-16 sp|P33897|ABCD1_HUMAN A...NGSGKSS 583 + L+++L+ +V G+++LI GPNG GKSS Sbjct: 453 DILIQDLSFEVRSGNHVLICGPNGRGKSS 481 >sp|P48410|ABCD1_MOUSE...SS Sbjct: 469 DVEQGIICENIPIITPTGEVVVASLNIRVEEGMHLLITGPNGCGKSS 515 >sp|P33897|ABCD1_HUMAN ATP-binding cassett...e sub-family D member 1 OS=Homo sapiens GN=ABCD1 PE=1 SV=2 Length = 745 Score = 84.3 bits (207), Expect = 4e

  5. AcEST: BP912184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available o sapiens GN=NOX4 PE=... 39 0.019 sp|Q9JHI8|NOX4_MOUSE NADPH oxidase 4 OS=Mus musculus GN=Nox4 PE=... 35 0.2...7 sp|Q924V1|NOX4_RAT NADPH oxidase 4 OS=Rattus norvegicus GN=Nox4 ... 34 0.35 sp|...Q9JHI8|NOX4_MOUSE NADPH oxidase 4 OS=Mus musculus GN=Nox4 PE=1 SV=1 Length = 578 Score = 34.7 bits (78), Exp...KVP---SRRTRRLLDKSKTLHITCG 109 >sp|Q924V1|NOX4_RAT NADPH oxidase 4 OS=Rattus norvegicus GN=Nox4 PE=1 SV=2 Len

  6. AcEST: BP911855 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rot sp_hit_id Q19673 Definition sp|Q19673|TYR3_CAEEL Putative tyrosinase-like protein tyr-3 OS=Caenorhabditi...s producing significant alignments: (bits) Value sp|Q19673|TYR3_CAEEL Putative tyrosinase-like protein tyr-3...norvegicus G... 32 2.0 sp|P34269|TYR1_CAEEL Putative tyrosinase-like protein tyr-1 OS=C... 32 2.6 sp|O03199|...H WLC CGLW F +W Sbjct: 420 HNPWLCDCGLWPFLQW 435 >sp|P34269|TYR1_CAEEL Putative tyrosinase...673|TYR3_CAEEL Putative tyrosinase-like protein tyr-3 OS=Caenorhabditis elegans GN=tyr-3 PE=2 SV=5 Length =

  7. AcEST: BP914375 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Result : Swiss-Prot sp_hit_id P32926 Definition sp|P32926|DSG3_HUMAN Desmoglein-...nt alignments: (bits) Value sp|P32926|DSG3_HUMAN Desmoglein-3 OS=Homo sapiens GN=....3 >sp|P32926|DSG3_HUMAN Desmoglein-3 OS=Homo sapiens GN=DSG3 PE=1 SV=1 Length = ...d A8K2V2 Definition tr|A8K2V2|A8K2V2_HUMAN cDNA FLJ75630, highly similar to Homo sapiens desmoglein 3 (pemph... similar to Homo sapiens desmoglein 3 (pemphigus vulgaris antigen) (DSG3), mRNA O

  8. AcEST: BP916894 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Ttn PE=1 SV=1 33 0.45 sp|Q5GN48|DMD_PIG Dystrophin OS=Sus scrofa GN=DMD PE=1 SV=1 33 0.45 sp|A6KYH1|RS4_BACV...8 30S ribosomal protein S4 OS=Bacteroides vulg... 33 0.58 sp|P11531|DMD_MOUSE Dystrophin OS=Mus musculus GN=...Dmd PE=1 SV=2 33 0.58 sp|P11532|DMD_HUMAN Dystrophin OS=Homo sapiens GN=DMD PE=1 ...APLKVPTAEKKVRKLLPEP 12730 >sp|Q5GN48|DMD_PIG Dystrophin OS=Sus scrofa GN=DMD PE=1...AKYTYGVLEKQFRNL 71 >sp|P11531|DMD_MOUSE Dystrophin OS=Mus musculus GN=Dmd PE=1 SV=2 Length = 3678 Score = 32

  9. AcEST: BP914225 [AcEST

    Lifescience Database Archive (English)

    Full Text Available . 107 3e-23 sp|Q93TJ5|HAPMO_PSEFL 4-hydroxyacetophenone monooxygenase OS=Pse... 37 0.050 sp|Q9Y6V0|PCLO_HUMAN Protein picc...hila melanog... 30 4.8 sp|Q9JKS6|PCLO_RAT Protein piccolo OS=Rattus norvegicus GN...=Pclo ... 30 4.8 sp|Q9QYX7|PCLO_MOUSE Protein piccolo OS=Mus musculus GN=Pclo PE=... 30 4.8 sp|Q58380|CBIX_M...DQLHILGTWLMGPVIEPYLPLIAEEAVTAEEDLRA 128 >sp|Q9Y6V0|PCLO_HUMAN Protein piccolo OS=Homo sapiens GN=PCLO PE=1 S...HQHQHHQHPAHPHSHQ 220 >sp|Q9JKS6|PCLO_RAT Protein piccolo OS=Rattus norvegicus GN=Pclo PE=1 SV=1 Length = 508

  10. Environmental change in the Limfjord, Denmark (ca 7500-1500 cal yrs BP): A multiproxy study

    DEFF Research Database (Denmark)

    Lewis, J. P.; Ryves, D.B.; Rasmussen, P.

    2013-01-01

    (and high productivity) between ca 7500–5000 BP, followed by a gradual transition to a shallow benthic system with more oceanic conditions (i.e. higher salinity, lower productivity, slower sedimentary accumulation rate and poorer fossil preservation) after ca 5000 BP and no stratification after ca 4400...

  11. InterProScan Result: BP126341 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP126341 BP126341_1_ORF1 E023A90F592AFE65 PROSITE PS01175 RIBONUCLEASE_II NA T IPR001900 Ribonu...clease II/R Molecular Function: RNA binding (GO:0003723)|Molecular Function: ribonuclease activity (GO:0004540) ...

  12. InterProScan Result: BP126341 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP126341 BP126341_1_ORF1 E023A90F592AFE65 PANTHER PTHR23355:SF10 RIBONUCLEASE II-RE...LATED 3.4e-50 T IPR001900 unintegrated Molecular Function: RNA binding (GO:0003723)|Molecular Function: ribonuclease activity (GO:0004540) ...

  13. InterProScan Result: BP126341 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP126341 BP126341_1_ORF1 E023A90F592AFE65 PANTHER PTHR23355 RIBONUCLEASE 3.4e-50 T ...IPR001900 unintegrated Molecular Function: RNA binding (GO:0003723)|Molecular Function: ribonuclease activity (GO:0004540) ...

  14. BP and Renal Outcomes in Diabetic Kidney Disease: The Veterans Affairs Nephropathy in Diabetes Trial.

    Science.gov (United States)

    Leehey, David J; Zhang, Jane H; Emanuele, Nicholas V; Whaley-Connell, Adam; Palevsky, Paul M; Reilly, Robert F; Guarino, Peter; Fried, Linda F

    2015-12-07

    Proteinuric diabetic kidney disease frequently progresses to ESRD. Control of BP delays progression, but the optimal BP to improve outcomes remains unclear. The objective of this analysis was to evaluate the relationship between BP and renal outcomes in proteinuric diabetic kidney disease. BP data from all 1448 randomized participants in the Veterans Affairs Nephropathy in Diabetes Trial were included in a post hoc analysis. The associations of mean on-treatment BP with the primary end point (decline in eGFR, ESRD, or death), renal end point (decline in eGFR or ESRD), rate of eGFR decline, and mortality were measured. The median (25th, 75th percentile) follow-up time was 2.2 (1.2, 3.0) years. There were 284 primary end points. In univariate analyses, both mean systolic and mean diastolic BPs were strongly associated (Prenal end point and rate of eGFR decline were similar to those with the primary end point. No association of BP with mortality was observed, possibly because of the limited number of mortality events. In patients with proteinuric diabetic kidney disease, mean systolic BP ≥ 140 mmHg and mean diastolic BP ≥ 80 mmHg were associated with worse renal outcomes. Copyright © 2015 by the American Society of Nephrology.

  15. CacyBP/SIP promotes the proliferation of colon cancer cells.

    Directory of Open Access Journals (Sweden)

    Huihong Zhai

    Full Text Available CacyBP/SIP is a component of the ubiquitin pathway and is overexpressed in several transformed tumor tissues, including colon cancer, which is one of the most common cancers worldwide. It is unknown whether CacyBP/SIP promotes the proliferation of colon cancer cells. This study examined the expression level, subcellular localization, and binding activity of CacyBP/SIP in human colon cancer cells in the presence and absence of the hormone gastrin. We found that CacyBP/SIP was expressed in a high percentage of colon cancer cells, but not in normal colonic surface epithelium. CacyBP/SIP promoted the cell proliferation of colon cancer cells under both basal and gastrin stimulated conditions as shown by knockdown studies. Gastrin stimulation triggered the translocation of CacyBP/SIP to the nucleus, and enhanced interaction between CacyBP/SIP and SKP1, a key component of ubiquitination pathway which further mediated the proteasome-dependent degradation of p27kip1 protein. The gastrin induced reduction in p27kip1 was prevented when cells were treated with the proteasome inhibitor MG132. These results suggest that CacyBP/SIP may be promoting growth of colon cancer cells by enhancing ubiquitin-mediated degradation of p27kip1.

  16. InterProScan Result: BP125414 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP125414 BP125414_2_ORF1 53AC87ED4CE73EA3 PANTHER PTHR11511 INSECT HEMOCYANIN-RELAT...ED 0.00074 T IPR013788 Arthropod hemocyanin/insect LSP Molecular Function: oxygen transporter activity (GO:0005344)|Biological Process: transport (GO:0006810) ...

  17. InterProScan Result: BP115758 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP115758 BP115758_4_ORF1 08B82F106E72F523 PANTHER PTHR11511 INSECT HEMOCYANIN-RELAT...ED 1e-08 T IPR013788 Arthropod hemocyanin/insect LSP Molecular Function: oxygen transporter activity (GO:0005344)|Biological Process: transport (GO:0006810) ...

  18. InterProScan Result: BP126555 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP126555 BP126555_6_ORF2 0D05AF860DCFDE97 PANTHER PTHR11511 INSECT HEMOCYANIN-RELAT...ED 2.5e-25 T IPR013788 Arthropod hemocyanin/insect LSP Molecular Function: oxygen transporter activity (GO:0005344)|Biological Process: transport (GO:0006810) ...

  19. InterProScan Result: BP117067 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP117067 BP117067_1_ORF2 D483359C05197373 PFAM PF00067 p450 6e-05 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...

  20. InterProScan Result: BP124291 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP124291 BP124291_5_ORF1 92B626ADD33C8436 PFAM PF00067 p450 1.8e-09 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...

  1. InterProScan Result: BP123442 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP123442 BP123442_1_ORF1 331440C6CA592A17 PRINTS PR00385 P450 6.3e-05 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...

  2. InterProScan Result: BP116799 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP116799 BP116799_1_ORF2 D3F3F8C61868AD4C PRINTS PR00309 ARRESTIN 6e-17 T IPR000698 Arrestin Biolog...ical Process: signal transduction (GO:0007165)|Biological Process: sensory perception (GO:0007600) ...

  3. InterProScan Result: BP116799 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP116799 BP116799_1_ORF2 D3F3F8C61868AD4C PANTHER PTHR11792 ARRESTIN 3.5e-15 T IPR000698 Arrestin Biolog...ical Process: signal transduction (GO:0007165)|Biological Process: sensory perception (GO:0007600) ...

  4. The HLA-G 14-bp polymorphism and recurrent implantation failure: a meta-analysis.

    Science.gov (United States)

    Fan, Wei; Huang, Zhongying; Li, Shangwei; Xiao, Zhun

    2017-11-01

    The human leucocyte antigen-G (HLA-G) 14-bp insertion/deletion polymorphism was implicated in recurrent implantation failure (RIF), but individual published studies showed inconclusive results. Thus, a meta-analysis was performed to clarify the effect of HLA-G 14-bp polymorphism on RIF risk. A comprehensive search for relevant articles was conducted. The odds ratios (ORs) and 95% confidence intervals (CIs) for HLA-G 14-bp polymorphism and RIF were calculated. A total of five studies were included. In studies conducted in RIF patients and controls who had at least one spontaneous pregnancy, meta-analysis revealed no statistically significant association between the HLA-G 14-bp polymorphism and RIF in allele contrast and all genetic models in the overall population, but significant association was found in the population of Caucasian origin under allele contrast (OR = 1.73, 95% CI, 1.20, 2.50) and genetic models of +14 bp/+14 bp vs. -14 bp/-14 bp (OR = 3.09, 95% CI, 1.43, 6.65). In studies conducted in RIF patients and controls who had successful pregnancy following IVF-ET, the meta-analysis showed that there was statistically significant association between the HLA-G 14 bp polymorphism and RIF in allele contrast (OR = 1.74, 95% CI, 1.13, 2.67) and genetic models of +14 bp/+14 bp vs. -14 bp/-14 bp (OR = 10.20, 95% CI, 2.47, 42.14) and dominant model (OR = 4.34, 95% CI, 1.72, 10.92). No publication bias was found in the present studies. This meta-analysis suggested that the HLA-G 14-bp insertion allele may increase the risk of RIF in Caucasians. Further studies with large sample size of different ethnic populations are necessary.

  5. Fault Diagnosis of Power System Based on Improved Genetic Optimized BP-NN

    Directory of Open Access Journals (Sweden)

    Yuan Pu

    2015-01-01

    Full Text Available BP neural network (Back-Propagation Neural Network, BP-NN is one of the most widely neural network models and is applied to fault diagnosis of power system currently. BP neural network has good self-learning and adaptive ability and generalization ability, but the operation process is easy to fall into local minima. Genetic algorithm has global optimization features, and crossover is the most important operation of the Genetic Algorithm. In this paper, we can modify the crossover of traditional Genetic Algorithm, using improved genetic algorithm optimized BP neural network training initial weights and thresholds, to avoid the problem of BP neural network fall into local minima. The results of analysis by an example, the method can efficiently diagnose network fault location, and improve fault-tolerance and grid fault diagnosis effect.

  6. Conformational Dynamics of apo-GlnBP Revealed by Experimental and Computational Analysis

    KAUST Repository

    Feng, Yitao

    2016-10-13

    The glutamine binding protein (GlnBP) binds l-glutamine and cooperates with its cognate transporters during glutamine uptake. Crystal structure analysis has revealed an open and a closed conformation for apo- and holo-GlnBP, respectively. However, the detailed conformational dynamics have remained unclear. Herein, we combined NMR spectroscopy, MD simulations, and single-molecule FRET techniques to decipher the conformational dynamics of apo-GlnBP. The NMR residual dipolar couplings of apo-GlnBP were in good agreement with a MD-derived structure ensemble consisting of four metastable states. The open and closed conformations are the two major states. This four-state model was further validated by smFRET experiments and suggests the conformational selection mechanism in ligand recognition of GlnBP. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim

  7. Leg Length Versus Torso Length in Pedophilia: Further Evidence of Atypical Physical Development Early in Life.

    Science.gov (United States)

    Fazio, Rachel L; Dyshniku, Fiona; Lykins, Amy D; Cantor, James M

    2017-08-01

    Adult men's height results from an interaction among positive and negative influences, including genetic predisposition, conditions in utero, and influences during early development such as nutritional quality, pathogen exposure, and socioeconomic status. Decreased height, reflected specifically as a decreased leg length, is strongly associated with increased risk of poorer health outcomes. Although prior research has repeatedly shown that pedophiles are shorter than nonpedophiles, the largest study to date relied on self-reported height. In the present study, pedophiles demonstrated reduced measured height and reduced leg length as compared with teleiophiles. Given the prenatal and early childhood origins of height, these findings contribute additional evidence to a biological, developmental origin of pedophilia. In addition, the magnitude of this height difference was substantially larger than that found in children exposed to a variety of early environmental stressors, but similar to that seen in other biologically based neurodevelopmental disorders.

  8. Dealcoholized red wine decreases systolic and diastolic blood pressure and increases plasma nitric oxide: short communication.

    Science.gov (United States)

    Chiva-Blanch, Gemma; Urpi-Sarda, Mireia; Ros, Emilio; Arranz, Sara; Valderas-Martínez, Palmira; Casas, Rosa; Sacanella, Emilio; Llorach, Rafael; Lamuela-Raventos, Rosa M; Andres-Lacueva, Cristina; Estruch, Ramon

    2012-09-28

    Experimental studies have shown a potential blood pressure (BP) lowering effect of red wine polyphenols, whereas the effects of ethanol and polyphenols on BP in humans are not yet clear. The aim of the present work was to evaluate the effects of red wine fractions (alcoholic and nonalcoholic) on BP and plasma nitric oxide (NO) in subjects at high cardiovascular risk. Sixty-seven men at high cardiovascular risk were studied. After a 2-week run-in period, subjects were randomized into 3 treatment periods in a crossover clinical trial, with a common background diet plus red wine (30g alcohol/day), the equivalent amount of dealcoholized red wine, or gin (30g alcohol/day), lasting 4 weeks each intervention. At baseline and after each intervention, anthropometrical parameters, BP and plasma NO were measured. Systolic and diastolic BP decreased significantly after the dealcoholized red wine intervention and these changes correlated with increases in plasma NO. Dealcoholized red wine decreases systolic and diastolic BP. Our results point out through an NO-mediated mechanism. The daily consumption of dealcoholized red wine could be useful for the prevention of low to moderate hypertension. Trial registered at controlled-trials.com: ISRCTN88720134.

  9. BP1 Homeoprotein Enhances Metastatic Potential in Er-Negative Breast Cancer

    Directory of Open Access Journals (Sweden)

    Yebo Fu, Yi Lian, Kyung Soon Kim, Lei Zhang, A. Katharine Hindle, Fred Brody, Robert S. Siegel, Timothy A. McCaffrey, Sidney W. Fu

    2010-01-01

    Full Text Available Tumor invasion and metastasis remain a major cause of mortality in breast cancer patients. It was reported that BP1, a homeobox isoform of DLX4, is overexpressed in 80% of breast cancer patients and in 100% of estrogen receptor negative (ER- tumors. The prevalence of BP1 positive cells and the intensity of BP1 immunoreactivity increased with the extent of ductal proliferation and tumorigenesis. These findings imply that BP1 may play an important role in ER- breast cancer. I sought to determine the effects and mechanisms of BP1 on cell proliferation and metastasis using ER- Hs578T cells as a model. Cells were transfected with either pcDNA3.2 plasmid containing BP1 gene, or pcDNA3.2 vector, then selected and cloned. Overexpression of BP1 increased cell proliferation rate by 2-5 fold (p<0.005, and enhanced the in vitro invasive activity by 25-65 fold (p<0.001. Microarray experiments were performed to identify differentially expressed genes when BP1 is overexpressed. The gene expression profile of the transfected cell lines were compared, resulting in 71 differentially expressed genes with a fold-change of >=2.0. Of those genes, 49 were up-regulated and 22 were down-regulated. Significant pathways were identified involving cell proliferation and metastasis. These data demonstrated that overexpression of BP1 significantly enhanced cell proliferation and metastatic potential in ER- Hs578T cells. Further analysis with more ER- cell lines and patient samples is warranted to establish BP1 as a therapeutic target.

  10. RanBP9 Plays a Critical Role in Neonatal Brain Development in Mice.

    Science.gov (United States)

    Palavicini, Juan Pablo; Lloyd, Brandon Noel; Hayes, Crystal D; Bianchi, Elisabetta; Kang, David E; Dawson-Scully, Ken; Lakshmana, Madepalli K

    2013-01-01

    RanBP9 is known to act as a scaffolding protein bringing together a variety of cell surface receptors and intracellular targets thereby regulating functions as diverse as neurite and axonal outgrowth, cell morphology, cell proliferation, myelination, gonad development, myofibrillogenesis and migration of neuronal precursors. Though RanBP9 is ubiquitously expressed in all tissues, brain is one of the organs with the highest expression levels of RanBP9. In the neurons, RanBP9 is localized mostly in the cytoplasm but also in the neurites and dendritic processes. We recently demonstrated that RanBP9 plays pathogenic role in Alzheimer's disease. To understand the role of RanBP9 in the brain, here we generated RanBP9 null mice by gene-trap based strategy. Most of Ran-/- mice die neonatally due to defects in the brain growth and development. The major defects include smaller cortical plate (CP), robustly enlarged lateral ventricles (LV) and reduced volume of hippocampus (HI). The lethal phenotype is due to a suckling defect as evidenced by lack of milk in the stomachs even several hours after parturition. The complex somatosensory system which is required for a behavior such as suckling appears to be compromised in Ran-/- mice due to under developed CP. Most importantly, RanBP9 phenotype is similar to ERK1/2 double knockout and the neural cell adhesion receptor, L1CAM knockout mice. Both ERK1 and L1CAM interact with RanBP9. Thus, RanBP9 appears to control brain growth and development through signaling mechanisms involving ERK1 and L1CAM receptor.

  11. RanBP9 Plays a Critical Role in Neonatal Brain Development in Mice.

    Directory of Open Access Journals (Sweden)

    Juan Pablo Palavicini

    Full Text Available RanBP9 is known to act as a scaffolding protein bringing together a variety of cell surface receptors and intracellular targets thereby regulating functions as diverse as neurite and axonal outgrowth, cell morphology, cell proliferation, myelination, gonad development, myofibrillogenesis and migration of neuronal precursors. Though RanBP9 is ubiquitously expressed in all tissues, brain is one of the organs with the highest expression levels of RanBP9. In the neurons, RanBP9 is localized mostly in the cytoplasm but also in the neurites and dendritic processes. We recently demonstrated that RanBP9 plays pathogenic role in Alzheimer's disease. To understand the role of RanBP9 in the brain, here we generated RanBP9 null mice by gene-trap based strategy. Most of Ran-/- mice die neonatally due to defects in the brain growth and development. The major defects include smaller cortical plate (CP, robustly enlarged lateral ventricles (LV and reduced volume of hippocampus (HI. The lethal phenotype is due to a suckling defect as evidenced by lack of milk in the stomachs even several hours after parturition. The complex somatosensory system which is required for a behavior such as suckling appears to be compromised in Ran-/- mice due to under developed CP. Most importantly, RanBP9 phenotype is similar to ERK1/2 double knockout and the neural cell adhesion receptor, L1CAM knockout mice. Both ERK1 and L1CAM interact with RanBP9. Thus, RanBP9 appears to control brain growth and development through signaling mechanisms involving ERK1 and L1CAM receptor.

  12. Importance of Viral Sequence Length and Number of Variable and Informative Sites in Analysis of HIV Clustering.

    Science.gov (United States)

    Novitsky, Vlad; Moyo, Sikhulile; Lei, Quanhong; DeGruttola, Victor; Essex, M

    2015-05-01

    To improve the methodology of HIV cluster analysis, we addressed how analysis of HIV clustering is associated with parameters that can affect the outcome of viral clustering. The extent of HIV clustering and tree certainty was compared between 401 HIV-1C near full-length genome sequences and subgenomic regions retrieved from the LANL HIV Database. Sliding window analysis was based on 99 windows of 1,000 bp and 45 windows of 2,000 bp. Potential associations between the extent of HIV clustering and sequence length and the number of variable and informative sites were evaluated. The near full-length genome HIV sequences showed the highest extent of HIV clustering and the highest tree certainty. At the bootstrap threshold of 0.80 in maximum likelihood (ML) analysis, 58.9% of near full-length HIV-1C sequences but only 15.5% of partial pol sequences (ViroSeq) were found in clusters. Among HIV-1 structural genes, pol showed the highest extent of clustering (38.9% at a bootstrap threshold of 0.80), although it was significantly lower than in the near full-length genome sequences. The extent of HIV clustering was significantly higher for sliding windows of 2,000 bp than 1,000 bp. We found a strong association between the sequence length and proportion of HIV sequences in clusters, and a moderate association between the number of variable and informative sites and the proportion of HIV sequences in clusters. In HIV cluster analysis, the extent of detectable HIV clustering is directly associated with the length of viral sequences used, as well as the number of variable and informative sites. Near full-length genome sequences could provide the most informative HIV cluster analysis. Selected subgenomic regions with a high extent of HIV clustering and high tree certainty could also be considered as a second choice.

  13. CEBAF Upgrade Bunch Length Measurements

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, Mahmoud [Old Dominion Univ., Norfolk, VA (United States)

    2016-05-01

    Many accelerators use short electron bunches and measuring the bunch length is important for efficient operations. CEBAF needs a suitable bunch length because bunches that are too long will result in beam interruption to the halls due to excessive energy spread and beam loss. In this work, bunch length is measured by invasive and non-invasive techniques at different beam energies. Two new measurement techniques have been commissioned; a harmonic cavity showed good results compared to expectations from simulation, and a real time interferometer is commissioned and first checkouts were performed. Three other techniques were used for measurements and comparison purposes without modifying the old procedures. Two of them can be used when the beam is not compressed longitudinally while the other one, the synchrotron light monitor, can be used with compressed or uncompressed beam.

  14. Murine protein H is comprised of 20 repeating units, 61 amino acids in length

    DEFF Research Database (Denmark)

    Kristensen, Torsten; Tack, B F

    1986-01-01

    A cDNA library constructed from size-selected (greater than 28 S) poly(A)+ RNA isolated from the livers of C57B10. WR mice was screened by using a 249-base-pair (bp) cDNA fragment encoding 83 amino acid residues of human protein H as a probe. Of 120,000 transformants screened, 30 hybridized......, 448 bp of 3'-untranslated sequence, and a polyadenylylated tail of undetermined length. Murine pre-protein H was deduced to consist of an 18-amino acid signal peptide and 1216 residues of H-protein sequence. Murine H was composed of 20 repetitive units, each about 61 amino acid residues in length...

  15. Overview of bunch length measurements

    International Nuclear Information System (INIS)

    Lumpkin, A. H.

    1999-01-01

    An overview of particle and photon beam bunch length measurements is presented in the context of free-electron laser (FEL) challenges. Particle-beam peak current is a critical factor in obtaining adequate FEL gain for both oscillators and self-amplified spontaneous emission (SASE) devices. Since measurement of charge is a standard measurement, the bunch length becomes the key issue for ultrashort bunches. Both time-domain and frequency-domain techniques are presented in the context of using electromagnetic radiation over eight orders of magnitude in wavelength. In addition, the measurement of microbunching in a micropulse is addressed

  16. Kondo length in bosonic lattices

    Science.gov (United States)

    Giuliano, Domenico; Sodano, Pasquale; Trombettoni, Andrea

    2017-09-01

    Motivated by the fact that the low-energy properties of the Kondo model can be effectively simulated in spin chains, we study the realization of the effect with bond impurities in ultracold bosonic lattices at half filling. After presenting a discussion of the effective theory and of the mapping of the bosonic chain onto a lattice spin Hamiltonian, we provide estimates for the Kondo length as a function of the parameters of the bosonic model. We point out that the Kondo length can be extracted from the integrated real-space correlation functions, which are experimentally accessible quantities in experiments with cold atoms.

  17. Lack of relationship between PTEN 32-bp and TP53 16-bp Ins/Del polymorphisms and chronic hepatitis B virus infection.

    Science.gov (United States)

    Eskandari, Ebrahim; Dahmardeh, Tayebeh; Dahmardeh, Fatemeh; Pahlevani, Elham; Metanat, Malihe

    2017-09-01

    TP53 and phosphate and tension homolog (PTEN) are two tumor suppressor genes that regulate cell proliferation, migration, and death. P53 and PTEN deficiency has been associated with hepatic fibrosis, a prominent pathological feature associated with chronic hepatitis B (CHB). The present study is aimed to assess the association of PTEN 32-bp Ins/Del (rs34421660) and TP53 16-bp Ins/Del polymorphisms with CHB infection susceptibility. A total of 411 subjects were recruited in this case-control study of 213 patients with CHB infection and 198 healthy individuals as controls. PTEN and TP53 deletions were detected by polymerase chain reaction method. We found no significant association between PTEN 32-bp Ins/Del polymorphism and the risk for CHB using either of codominant (Ins/Del vs. Ins/Ins: P  = 0.427; Del/Del vs. Ins/Ins: P  = 0.235), dominant (Ins/Del + Del/Del vs. Ins/Ins P  = 0.343) or recessive genetic model (Del/Del vs. Ins/Ins + Ins/Del: P  = 0.516). At allelic level although the PTEN Del variant allele was more common in CHB patients compared to controls (55 vs. 51), but the difference did not reach the statistical significant range (OR 0.87, P  = 0.327). Similarly, no association was observed between TP53 16-bp Ins/Del and the risk for CHB infection at both genotype and allele levels ( P  > 0.05). In summary, our study demonstrated that the PTEN 32-bp and TP53 16-bp Ins/Del polymorphisms did not affect the risk of CHB infection in the Iranian population.

  18. Mutagenicity Assessment of Organophosphates using Polymerase Chain Reaction-Restriction Fragment Length Polymorphism Assay

    OpenAIRE

    Bhinder, Preety; Chaudhry, Asha

    2013-01-01

    Objectives: In this study we have evaluated the mutagenicity of organophosphate pesticides acephate, chlorpyrifos, and profenofos using polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) assay with the mosquito Culex quinquefasciatus taken as an experimental model. Materials and Methods: Second instar larvae were treated with LC20 of each pesticide for 24 h and mutations induced in the sequence of mitochondrial COII gene (690bp) were studied from restriction pattern...

  19. Expression of the Transcription Factor E4BP4 in Human Basophils

    DEFF Research Database (Denmark)

    Jensen, Bettina Margrethe; Gohr, Maria; Poulsen, Lars Kærgaard

    2014-01-01

    Rationale The cytokine IL-3 plays an important role for human basophil development, function and survival. IL-3 is also reported to induce the expression of the transcription factor E4BP4, but it is not known whether E4BP4 is expressed in basophils and influences basophil responsiveness. The aim...... by Alcian blue. RNA was extracted (0.005-0.02 µg RNA from 0.5 - 1 x 106 cells), and the corresponding cDNA analyzed by real-time PCR where E4BP4 expression was calculated as 2-(CT(E4BP4) - CT(β-actin)). E4BP4 protein expression was visualized in basophil lysates (107 cells/ml) by Western blot followed...... by ECL stain and X-ray film exposure. Protein band intensities were correlated to -actin expression. Results We analyzed basophils from 14 donors and found E4BP4 mRNA expression in all donors (2.33 ± 2.42) despite a low basophil RNA level. Seven donors were also tested for E4BP4 protein expression...

  20. IGF2BP3 Modulates the Interaction of Invasion-Associated Transcripts with RISC

    Directory of Open Access Journals (Sweden)

    Hanane Ennajdaoui

    2016-05-01

    Full Text Available Insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3 expression correlates with malignancy, but its role(s in pathogenesis remains enigmatic. We interrogated the IGF2BP3-RNA interaction network in pancreatic ductal adenocarcinoma (PDAC cells. Using a combination of genome-wide approaches, we have identified 164 direct mRNA targets of IGF2BP3. These transcripts encode proteins enriched for functions such as cell migration, proliferation, and adhesion. Loss of IGF2BP3 reduced PDAC cell invasiveness and remodeled focal adhesion junctions. Individual nucleotide resolution crosslinking immunoprecipitation (iCLIP revealed significant overlap of IGF2BP3 and microRNA (miRNA binding sites. IGF2BP3 promotes association of the RNA-induced silencing complex (RISC with specific transcripts. Our results show that IGF2BP3 influences a malignancy-associated RNA regulon by modulating miRNA-mRNA interactions.

  1. Cyclic codes of length 2

    Indian Academy of Sciences (India)

    Springer Verlag Heidelberg #4 2048 1996 Dec 15 10:16:45

    [X]/〈X2m. − 1〉 are given. Cyclic codes of length 2m over the finite field Fq, of odd characteristic, are defined in terms of their generator polynomials. The exact minimum distance and the dimension of the codes are obtained. Keywords.

  2. Diet, nutrition and telomere length.

    Science.gov (United States)

    Paul, Ligi

    2011-10-01

    The ends of human chromosomes are protected by DNA-protein complexes termed telomeres, which prevent the chromosomes from fusing with each other and from being recognized as a double-strand break by DNA repair proteins. Due to the incomplete replication of linear chromosomes by DNA polymerase, telomeric DNA shortens with repeated cell divisions until the telomeres reach a critical length, at which point the cells enter senescence. Telomere length is an indicator of biological aging, and dysfunction of telomeres is linked to age-related pathologies like cardiovascular disease, Parkinson disease, Alzheimer disease and cancer. Telomere length has been shown to be positively associated with nutritional status in human and animal studies. Various nutrients influence telomere length potentially through mechanisms that reflect their role in cellular functions including inflammation, oxidative stress, DNA integrity, DNA methylation and activity of telomerase, the enzyme that adds the telomeric repeats to the ends of the newly synthesized DNA. Copyright © 2011 Elsevier Inc. All rights reserved.

  3. Fractional baud-length coding

    Directory of Open Access Journals (Sweden)

    J. Vierinen

    2011-06-01

    Full Text Available We present a novel approach for modulating radar transmissions in order to improve target range and Doppler estimation accuracy. This is achieved by using non-uniform baud lengths. With this method it is possible to increase sub-baud range-resolution of phase coded radar measurements while maintaining a narrow transmission bandwidth. We first derive target backscatter amplitude estimation error covariance matrix for arbitrary targets when estimating backscatter in amplitude domain. We define target optimality and discuss different search strategies that can be used to find well performing transmission envelopes. We give several simulated examples of the method showing that fractional baud-length coding results in smaller estimation errors than conventional uniform baud length transmission codes when estimating the target backscatter amplitude at sub-baud range resolution. We also demonstrate the method in practice by analyzing the range resolved power of a low-altitude meteor trail echo that was measured using a fractional baud-length experiment with the EISCAT UHF system.

  4. Femur length and biparietal diameter

    African Journals Online (AJOL)

    2014-12-02

    Dec 2, 2014 ... Shipp TD, Bromley B, Mascola M, Benacerraf B. Variation in fetal femur length with respect to maternal race. J Ultrasound Med 2001;20:141‑4. 25. Deter RL, Harrist RB, Birnholz JC, Hadlock FP. Quantitative Obstetrical. Ultrasonography. New York: Wiley; 1986. 26. Yeh MN, Bracero L, Reilly KB, Murtha L, ...

  5. Mutation particle swarm optimization of the BP-PID controller for piezoelectric ceramics

    Science.gov (United States)

    Zheng, Huaqing; Jiang, Minlan

    2016-01-01

    PID control is the most common used method in industrial control because its structure is simple and it is easy to implement. PID controller has good control effect, now it has been widely used. However, PID method has a few limitations. The overshoot of the PID controller is very big. The adjustment time is long. When the parameters of controlled plant are changing over time, the parameters of controller could hardly change automatically to adjust to changing environment. Thus, it can't meet the demand of control quality in the process of controlling piezoelectric ceramic. In order to effectively control the piezoelectric ceramic and improve the control accuracy, this paper replaced the learning algorithm of the BP with the mutation particle swarm optimization algorithm(MPSO) on the process of the parameters setting of BP-PID. That designed a better self-adaptive controller which is combing the BP neural network based on mutation particle swarm optimization with the conventional PID control theory. This combination is called the MPSO-BP-PID. In the mechanism of the MPSO, the mutation operation is carried out with the fitness variance and the global best fitness value as the standard. That can overcome the precocious of the PSO and strengthen its global search ability. As a result, the MPSO-BP-PID can complete controlling the controlled plant with higher speed and accuracy. Therefore, the MPSO-BP-PID is applied to the piezoelectric ceramic. It can effectively overcome the hysteresis, nonlinearity of the piezoelectric ceramic. In the experiment, compared with BP-PID and PSO-BP-PID, it proved that MPSO is effective and the MPSO-BP-PID has stronger adaptability and robustness.

  6. [Segmentation of whole body bone SPECT image based on BP neural network].

    Science.gov (United States)

    Zhu, Chunmei; Tian, Lianfang; Chen, Ping; He, Yuanlie; Wang, Lifei; Ye, Guangchun; Mao, Zongyuan

    2007-10-01

    In this paper, BP neural network is used to segment whole body bone SPECT image so that the lesion area can be recognized automatically. For the uncertain characteristics of SPECT images, it is hard to achieve good segmentation result if only the BP neural network is employed. Therefore, the segmentation process is divided into three steps: first, the optimal gray threshold segmentation method is employed for preprocessing, then BP neural network is used to roughly identify the lesions, and finally template match method and symmetry-removing program are adopted to delete the wrongly recognized areas.

  7. Association between the CCR5 32-bp deletion allele and late onset of schizophrenia

    DEFF Research Database (Denmark)

    Rasmussen, Henrik Berg; Timm, Sally; Wang, August G

    2006-01-01

    OBJECTIVE: The 32-bp deletion allele in chemokine receptor CCR5 has been associated with several immune-mediated diseases and might be implicated in schizophrenia as well. METHOD: The authors genotyped DNA samples from 268 schizophrenia patients and 323 healthy subjects. Age at first admission...... of the deletion allele in the latter subgroup of patients. CONCLUSIONS: These findings suggest that the CCR5 32-bp deletion allele is a susceptibility factor for schizophrenia with late onset. Alternatively, the CCR5 32-bp deletion allele may act as a modifier by delaying the onset of schizophrenia without...

  8. Managing carbon sinks by changing rotation length in European forests

    Energy Technology Data Exchange (ETDEWEB)

    Kaipainen, Terhi; Liski, Jari; Pussinen, Ari; Karjalainen, Timo

    2004-06-01

    Elongation of rotation length is a forest management activity countries may choose to apply under Article 3.4 of the Kyoto Protocol to help them meet their commitments for reduction of greenhouse gas emissions. We used the CO2FIX model to analyze how the carbon stocks of trees, soil and wood products depend on rotation length in different European forests. Results predicted that the carbon stock of trees increased in each forest when rotation length was increased, but the carbon stock of soil decreased slightly in German and Finnish Scots pine forests; the carbon stock of wood products also decreased slightly in cases other than the Sitka spruce forest in UK. To estimate the efficiency of increasing rotation length as an Article 3.4 activity, we looked at changes in the carbon stock of trees resulting from a 20-year increase in current rotation lengths. To achieve the largest eligible carbon sink mentioned in Article 3.4 of the Kyoto Protocol, the rotation lengths need to be increased on areas varying from 0.3 to 5.1 Mha depending on the forest. This would in some forests cause 1-6% declines in harvesting possibilities. The possible decreases in the carbon stock of soil indicate that reporting the changes in the carbon stocks of forests under Article 3.4 may require measuring soil carbon.

  9. Activin A induces ovine follicle stimulating hormone beta using -169/-58 bp of its promoter and a simple TATA box

    Directory of Open Access Journals (Sweden)

    Miller William L

    2009-06-01

    Full Text Available Abstract Background Activin A increases production of follicle stimulating hormone (FSH by inducing transcription of its beta subunit (FSHB. This induction has been studied here in LbetaT2 gonadotropes using transient expression of ovine FSHBLuc (-4741 bp of ovine FSHB promoter plus exon/intron 1 linked to Luc. Several sequences between -169/-58 bp of the ovine FSHB proximal promoter are necessary for induction by activin A in LbetaT2 cells, but deletions between -4741/-752 bp decrease induction > 70% suggesting the existence of other important 5' sequences. Induction disappears if a minimal T81 thymidine kinase promoter replaces the ovine FSHB TATA box and 3' exon/intron. The study reported here was designed to determine if sequences outside -169/-58 bp are important for induction of ovine FSHB by activin A. Methods Progressively longer deletions of ovine FSHBLuc were created between -4741/-195 bp. Deletions internal to this region were created also, but replaced with substitute DNA. The ovine FSHB TATA box region (-40/+3 bp was replaced by thymidine kinase and rat prolactin minimal promoters, and substitutions were made in 3' intron/exon sequences. All constructs were tested for basal and activin A-induced expression in LbetaT2 cells. Results Successive 5' deletions progressively lowered fold-induction by activin A from 9.5 to zero, but progressively increased basal expression. Replacing deletions with substitute DNA showed no changes in basal expression or fold-induction. Induction by activin A was supported by the minimal rat prolactin promoter (TATA box but not the thymidine kinase promoter (no TATA box. Replacement mutations in the 3' region did not decrease induction by activin A. Conclusion The data show that specific ovine FSHB sequences 5' to -175 bp or 3' of the transcription start site are not required for induction by activin A. A minimal TATA box promoter supports induction by activin A, but the sequence between the TATA box and

  10. Effect of 2,4-dihydroxybenzophenone (BP1) on early life-stage development of the marine copepod Acartia tonsa at different temperatures and salinities

    DEFF Research Database (Denmark)

    Kusk, Kresten Ole; Avdolli, Manola; Wollenberger, Leah

    2011-01-01

    Benzophenone (BP)-type ultraviolet (UV) filters are widely used in cosmetic and sunscreen products and can enter the aquatic environment. Therefore, we investigated the subchronic toxicity of 2,4-dihydroxybenzophenone (BP1) on the marine calanoid copepod Acartia tonsa in an early life-stage...... was found acutely toxic at 2.6 mg/L (48-h median lethal concentration [LC50]). The toxicity of BP1 on early life-stage development was studied in combinations of three temperatures (15, 20, 25°C) and three salinities (15, 20, 25‰) using five toxicant concentrations between 0.051 and 2 mg/L in each scenario...... a copepodite stage (DT(½) ) at the different conditions were calculated. The DT(½) values decreased from 296 h at 15°C to 89 h at 25°C and were also affected by salinity (126 h at 15‰ and 167 h at 30‰), whereas the light:dark regime and culture density influenced development only to a minor extent. BP1...

  11. Improving enantioselectivity towards tertiary alcohols using mutants of Bacillus sp. BP-7 esterase EstBP7 holding a rare GGG(X)-oxyanion hole.

    Science.gov (United States)

    Fillat, Amanda; Romea, Pedro; Urpí, Fèlix; Pastor, F I Javier; Diaz, Pilar

    2014-05-01

    Lipases and esterases are important biocatalysts for synthetic organic fine chemistry. An esterase from Bacillus sp. BP-7 (EstBP7) bears in its amino acid sequence a rare GGG(A)X oxyanion hole motif, where an uncommon threonine (T) is found at the third position. Detection of this pattern motivated evaluation of the ability of EstBP7 for conversion of tertiary alcohols. The enzyme was engineered in order to optimize its performance to provide important chiral building blocks: five variants with mutations in the oxyanion hole motif were created to investigate the influence on activity and enantioselectivity in the kinetic resolution of eight acetates of tertiary alcohols. Wild-type enzyme converted all esters of tertiary alcohols assayed with low enantioselectivity, whereas some of the mutants displayed significantly increased E-values. One of the mutants (EstBP7-AGA; Mut 5) showed an E >100 towards a complex tertiary alcohol acetate (2-(4-pyridyl)but-3-yn-2-yl acetate) at low reaction temperature (4 °C). Therefore, the catalytic toolbox was expanded for biocatalysis of optically pure tertiary alcohols valuable for the pharmaceutical industry.

  12. Length of a Hanging Cable

    Directory of Open Access Journals (Sweden)

    Eric Costello

    2011-01-01

    Full Text Available The shape of a cable hanging under its own weight and uniform horizontal tension between two power poles is a catenary. The catenary is a curve which has an equation defined by a hyperbolic cosine function and a scaling factor. The scaling factor for power cables hanging under their own weight is equal to the horizontal tension on the cable divided by the weight of the cable. Both of these values are unknown for this problem. Newton's method was used to approximate the scaling factor and the arc length function to determine the length of the cable. A script was written using the Python programming language in order to quickly perform several iterations of Newton's method to get a good approximation for the scaling factor.

  13. Keeping disease at arm's length

    DEFF Research Database (Denmark)

    Lassen, Aske Juul

    2015-01-01

    and physical activities at the activity centre. In this way, keeping disease at arm’s length is analysed as an ambiguous health strategy. The article shows the importance of looking into how active ageing is practised, as active ageing seems to work well in the everyday life of the older people by not giving......Many older people live with a range of chronic diseases. However, these diseases do not necessarily impede an active lifestyle. In this article the author analyses the relation between the active ageing discourse and the way older people at two Danish activity centres handle disease. How does...... active ageing change everyday life with chronic disease, and how do older people combine an active life with a range of chronic diseases? The participants in the study use activities to keep their diseases at arm’s length, and this distancing of disease at the same time enables them to engage in social...

  14. An Inventory Controlled Supply Chain Model Based on Improved BP Neural Network

    Directory of Open Access Journals (Sweden)

    Wei He

    2013-01-01

    Full Text Available Inventory control is a key factor for reducing supply chain cost and increasing customer satisfaction. However, prediction of inventory level is a challenging task for managers. As one of the widely used techniques for inventory control, standard BP neural network has such problems as low convergence rate and poor prediction accuracy. Aiming at these problems, a new fast convergent BP neural network model for predicting inventory level is developed in this paper. By adding an error offset, this paper deduces the new chain propagation rule and the new weight formula. This paper also applies the improved BP neural network model to predict the inventory level of an automotive parts company. The results show that the improved algorithm not only significantly exceeds the standard algorithm but also outperforms some other improved BP algorithms both on convergence rate and prediction accuracy.

  15. Prediction of BP Reactivity to Talking Using Hybrid Soft Computing Approaches

    Directory of Open Access Journals (Sweden)

    Gurmanik Kaur

    2014-01-01

    Full Text Available High blood pressure (BP is associated with an increased risk of cardiovascular diseases. Therefore, optimal precision in measurement of BP is appropriate in clinical and research studies. In this work, anthropometric characteristics including age, height, weight, body mass index (BMI, and arm circumference (AC were used as independent predictor variables for the prediction of BP reactivity to talking. Principal component analysis (PCA was fused with artificial neural network (ANN, adaptive neurofuzzy inference system (ANFIS, and least square-support vector machine (LS-SVM model to remove the multicollinearity effect among anthropometric predictor variables. The statistical tests in terms of coefficient of determination (R2, root mean square error (RMSE, and mean absolute percentage error (MAPE revealed that PCA based LS-SVM (PCA-LS-SVM model produced a more efficient prediction of BP reactivity as compared to other models. This assessment presents the importance and advantages posed by PCA fused prediction models for prediction of biological variables.

  16. Study on the identifying of meat's visible spectrum based on BP artificial neural network

    Science.gov (United States)

    Li, Xiaotian; Zhang, Tieqiang; Li, Bo; Jiang, Yongheng; Liu, Binghui; Li, Zhaokai

    2006-01-01

    A method to identify different meat by the visible and reflected spectra of meat with BP artificial neural net (BP-ANN) was introduced in this paper. The visible and reflected spectra (from 420 to 535nm) of different meat (beef and pork) were measured with fiber sensor spectrometer. A kind of ANN with a double-hidden layer was created to identify the different meat automatically. Its right ratio reaches 92.71%.

  17. Hurricanes and climate in the Caribbean during the past 3700 years BP

    OpenAIRE

    Malaizé, Bruno; Bertran, Pascal; Carbonel, Pierre; Bonnissent, Dominique; Charlier, Karine; Galop, Didier; Imbert, Daniel; Serrand, Nathalie; Stouvenot, Christian; Pujol, C.

    2011-01-01

    International audience; A multiproxy analysis of lacustrine sediments cored in Grand-Case Pond at Saint-Martin, north of the Lesser Antilles archipelago, reveals three distinct climatic periods for the last 3700 years. From 3700 to ~2500 yr cal. BP and from 1150 yr cal. BP to the present, carbonate mud deposition occurred in connection with pond lowstands. These periods were also punctuated by severe drought events, marked by gypsum laminae, and hurricane landfalls, leading to marine sand inp...

  18. Discrete Sampling Test Plan for the 200-BP-5 Operable Unit

    Energy Technology Data Exchange (ETDEWEB)

    Sweeney, Mark D.

    2010-02-04

    The Discrete Groundwater Sampling Project is conducted by the Pacific Northwest National Laboratory (PNNL) on behalf of CH2M HILL Plateau Remediation Company. The project is focused on delivering groundwater samples from proscribed horizons within select groundwater wells residing in the 200-BP-5 Operable Unit (200-BP-5 OU) on the Hanford Site. This document provides the scope, schedule, methodology, and other details of the PNNL discrete sampling effort.

  19. RBP-Jkappa/SHARP recruits CtIP/CtBP corepressors to silence Notch target genes.

    Science.gov (United States)

    Oswald, Franz; Winkler, Michael; Cao, Ying; Astrahantseff, Kathy; Bourteele, Soizic; Knöchel, Walter; Borggrefe, Tilman

    2005-12-01

    Notch is a transmembrane receptor that determines cell fates and pattern formation in all animal species. After ligand binding, proteolytic cleavage steps occur and the intracellular part of Notch translocates to the nucleus, where it targets the DNA-binding protein RBP-Jkappa/CBF1. In the absence of Notch, RBP-Jkappa represses Notch target genes through the recruitment of a corepressor complex. We and others have identified SHARP as a component of this complex. Here, we functionally demonstrate that the SHARP repression domain is necessary and sufficient to repress transcription and that the absence of this domain causes a dominant negative Notch-like phenotype. We identify the CtIP and CtBP corepressors as novel components of the human RBP-Jkappa/SHARP-corepressor complex and show that CtIP binds directly to the SHARP repression domain. Functionally, CtIP and CtBP augment SHARP-mediated repression. Transcriptional repression of the Notch target gene Hey1 is abolished in CtBP-deficient cells or after the functional knockout of CtBP. Furthermore, the endogenous Hey1 promoter is derepressed in CtBP-deficient cells. We propose that a corepressor complex containing CtIP/CtBP facilitates RBP-Jkappa/SHARP-mediated repression of Notch target genes.

  20. BP Canada Energy Company : climate change action plan update 1999-2000

    International Nuclear Information System (INIS)

    2001-10-01

    An aggressive, world-wide target for a 10 per cent reduction of greenhouse gas emissions was set by BP p.l.c. and BP Canada Energy Company has supported this endeavour. Six major areas have been identified as offering potential solutions to the problem of climate change: the control of greenhouse gases, the conservation of energy, the introduction of new technologies, the promotion of flexible market instruments, the participation in the policy process, and an investment in research. This document reviewed the efforts expanded to date in those areas. It was noted that a deliberate shift was made by BP leadership from oil to natural gas production, releasing much less carbon dioxide in the atmosphere when burned. A brief overview of the operations of BP Canada Energy Company was provided in chapter 1, followed by the philosophy concerning greenhouse gases in chapter 2. In chapter 3, the topic of BP's global emissions trading system was discussed. The current and projected greenhouse gas emissions were looked at in chapter 4, while chapter 5 dealt with setting global targets, with specific emphasis on Canadian targets. In chapter 6 , the emphasis was placed on BP's emission reduction initiatives. In chapter 7, the question of raising awareness was examined. 7 tabs., 7 figs