WorldWideScience

Sample records for lejeune nc mcb

  1. 77 FR 5398 - Safety Zone; Atlantic Intracoastal Waterway, Vicinity of Marine Corps Base, Camp Lejeune, NC

    Science.gov (United States)

    2012-02-03

    ...-AA00 Safety Zone; Atlantic Intracoastal Waterway, Vicinity of Marine Corps Base, Camp Lejeune, NC... zone on the Atlantic Intracoastal Waterway (AICW) adjacent to Marine Corps Base (MCB) Camp Lejeune..., Vicinity of Marine Corps Base, Camp Lejeune, NC in the Federal Register (77 FR 1431). We received no...

  2. Kinetic Super-Resolution Long-Wave Infrared (KSR LWIR) Thermography Diagnostic for Building Envelopes: Camp Lejeune, NC

    Science.gov (United States)

    2015-08-18

    weather station logs, which are precise only to a single degree Fahrenheit . This introduces some error in the heat flow model, which is sensitive to...Investigator, COR Navi Singh Essess (857) 445-4135 Navi@essess.com Team Leader Thomas Burton USMC, Camp Lejeune, Facilities Engineers 910- 451

  3. Recommendations for Improving the Food Service Operations at MCB Camp Pendleton, CA MCAS El Toro and MCAS(H) Santa Ana, CA, MCB Camp Lejeune, NC, and MCDEC, Quantico, VA

    Science.gov (United States)

    1979-12-01

    this old equipment is the inefficiency in energy resulting from use. Newer equipment is much more energy conservation oriented as a result of energy...Include everyday: Carrots (/4 in. slice), celery (% in. slice), cucumbers (sliced), endive - escarole or romaine (torn), head lettuce (torn), green...equipment would result in more efficient operations, conservation of energy, and encourage rather than discourage progressive cooking techniques. The

  4. Fact and fiction: The problem of autobiographical writing in Lejeune ...

    African Journals Online (AJOL)

    Questo saggio presenta una lettura del Diario di un sognatore di Luigi Malerba sulla base della teoria dell'autobiografia elaborata da Philippe Lejeune in Le pacte autobiographique. Cerca di illustrare come il libro di. Malerba gioca ironicamente con i problemi inerenti alle riflessioni sistematiche di Lejeune già rilevati da ...

  5. fact and fiction: the problem of autobiographical writing in lejeune ...

    African Journals Online (AJOL)

    User

    This prologue is an excellent example of an autobiographical pact as it has been defined by Lejeune6. The writer of the diary not only feels. 6. Malerba seems to allude to the theory of the autobiographical pact, when he formulates: “È sulla base di tali ovvie premesse che questo lavoro reclama un suo credito presso i lettori.

  6. Assessment of DoD Wounded Warrior Matters -- Camp Lejeune

    Science.gov (United States)

    2012-03-30

    Therapy, Cognitive Therapy, Pain Management, Acupuncture , Audiology, Mental Health, Biofeedback and Otolaryngology. PTSD services are provided by...missions, the policies, and processes of: • Military units, beginning with the Army and Marine Corps, established to support the recovery of Service...conducted meetings and interviews during our 2-week visit at Camp Lejeune that included unit commanders, staff officers, and WWBn-East military staff

  7. Planning Change in an Organization; MCB Bank Limited, Pakistan

    OpenAIRE

    Fazal Haleem

    2015-01-01

    This paper is primarily based on a case study of a leading bank in Pakistan, that is, MCB Bank Ltd. Four established change models have been applied to the bank to find out how a change comes in/ is brought in, managed, and how it affects organizational environment and its stakeholders, particularly customers and employees. The four established change models applied are the change management approach by Ansoff and McDonnell; the change management model by Kurt Lewin; the 7S framework by Thoma...

  8. Planning Change in an Organization; MCB Bank Limited, Pakistan

    Directory of Open Access Journals (Sweden)

    Haleem Fazal

    2015-05-01

    Full Text Available This paper is primarily based on a case study of a leading bank in Pakistan, that is, MCB Bank Ltd. Four established change models have been applied to the bank to find out how a change comes in/ is brought in, managed, and how it affects organizational environment and its stakeholders, particularly customers and employees. The four established change models applied are the change management approach by Ansoff and McDonnell; the change management model by Kurt Lewin; the 7S framework by Thoman J. Peters and Robert H. Waterman; and the change management model developed by Stephanie Elam. The study covers a change management aspect such as strategic intervention technique; a need for change management; resource implication; planning change; strategies in change management; system effectiveness; managing resistance to change; leadership issues; cultural issues; people issues; external environment issues; workable approach to overcome change resistance; appropriate model and implementing the model.

  9. Payment or Reimbursement for Certain Medical Expenses for Camp Lejeune Family Members. Final rule.

    Science.gov (United States)

    2017-05-05

    The Department of Veterans Affairs (VA) adopts as final an interim final rule addressing payment or reimbursement of certain medical expenses for family members of Camp Lejeune veterans. Under this rule, VA reimburses family members, or pays providers, for medical expenses incurred as a result of certain illnesses and conditions that may be associated with contaminants present in the base water supply at U.S. Marine Corps Base Camp Lejeune (Camp Lejeune), North Carolina, from August 1, 1953, to December 31, 1987. Payment or reimbursement is made within the limitations set forth in statute and Camp Lejeune family members receive hospital care and medical services that are consistent with the manner in which we provide hospital care and medical services to Camp Lejeune veterans. The statutory authority has since been amended to also include certain veterans' family members who resided at Camp Lejeune, North Carolina, for no less than 30 days (consecutive or nonconsecutive) between August 1, 1953, and December 31, 1987. This final rule will reflect that statutory change and will address public comments received in response to the interim final rule.

  10. Large Nc

    Science.gov (United States)

    Jenkins, Elizabeth E.

    2009-12-01

    The 1/Nc expansion of QCD with Nc = 3 has been successful in explaining a wide variety of QCD phenomenology. Here I focus on the contracted spin-flavor symmetry of baryons in the large-Nc limit and deviations from spin-flavor symmetry due to corrections suppressed by powers of 1/Nc. Baryon masses provide an important example of the 1/Nc expansion, and successful predictions of masses of heavy-quark baryons continue to be tested by experiment. The ground state charmed baryon masses have all been measured, and five of the eight ground state bottom baryon masses have been found. Results of the 1/Nc expansion can aid in the discovery of the remaining bottom baryons. The brand new measurement of the Ωb- mass by the CDF collaboration conflicts with the original D0 discovery value and is in excellent agreement with the prediction of the 1/Nc expansion.

  11. Biocontrol potential of Halotolerant bacterial chitinase from high yielding novel Bacillus Pumilus MCB-7 autochthonous to mangrove ecosystem.

    Science.gov (United States)

    Rishad, K S; Rebello, Sharrel; Shabanamol, P S; Jisha, M S

    2017-04-01

    The multifaceted role of chitinase in medicine, agriculture, environmental remediation and various other industries greatly demands the isolation of high yielding chitinase producing microorganisms with improved properties. The current study aimed to investigate the isolation, characterization and biocontrol prospective of chitinase producing bacterial strains autochthonous to the extreme conditions of mangrove ecosystems. Among the 51 bacterial isolates screened, Bacillus pumilus MCB-7 with highest chitinase production potential was identified and confirmed by 16S rDNA typing. Chitinase enzyme of MCB-7 was purified; the chitin degradation was evaluated by SEM and LC-MS. Unlike previously reported B.pumilus isolates, MCB-7 exhibited highest chitinase activity of 3.36U/mL, active even at high salt concentrations and temperature up to 60°C. The crude as well as purified enzyme showed significant antimycotic activity against agricultural pathogens such as Aspergillus flavus, Aspergillus niger, Aspergillus fumigatus, Ceratorhiza hydrophila and Fusarium oxysporum. The enzyme also exhibited biopesticidal role against larvae of Scirpophaga incertulas (Walker). [Lep.: Pyralidae], a serious agricultural pest of rice. The high chitinolytic and antimycotic potential of MCB-7 increases the prospects of the isolate as an excellent biocontrol agent. To the best of our knowledge, this is the first report of high chitinase yielding Bacillus pumilus strain from mangrove ecosystem with a biocontrol role against phytopathogenic fungi and insect larval pests. Copyright © 2016 Elsevier Inc. All rights reserved.

  12. Validation of VHTRC calculation benchmark of critical experiment using the MCB code

    Directory of Open Access Journals (Sweden)

    Stanisz Przemysław

    2016-01-01

    Full Text Available The calculation benchmark problem Very High Temperature Reactor Critical (VHTR a pin-in-block type core critical assembly has been investigated with the Monte Carlo Burnup (MCB code in order to validate the latest version of Nuclear Data Library based on ENDF format. Executed benchmark has been made on the basis of VHTR benchmark available from the International Handbook of Evaluated Reactor Physics Benchmark Experiments. This benchmark is useful for verifying the discrepancies in keff values between various libraries and experimental values. This allows to improve accuracy of the neutron transport calculations that may help in designing the high performance commercial VHTRs. Almost all safety parameters depend on the accuracy of neutron transport calculation results that, in turn depend on the accuracy of nuclear data libraries. Thus, evaluation of the libraries applicability to VHTR modelling is one of the important subjects. We compared the numerical experiment results with experimental measurements using two versions of available nuclear data (ENDF-B-VII.1 and JEFF-3.2 prepared for required temperatures. Calculations have been performed with the MCB code which allows to obtain very precise representation of complex VHTR geometry, including the double heterogeneity of a fuel element. In this paper, together with impact of nuclear data, we discuss also the impact of different lattice modelling inside the fuel pins. The discrepancies of keff have been successfully observed and show good agreement with each other and with the experimental data within the 1 σ range of the experimental uncertainty. Because some propagated discrepancies observed, we proposed appropriate corrections in experimental constants which can improve the reactivity coefficient dependency. Obtained results confirm the accuracy of the new Nuclear Data Libraries.

  13. Neutronic and thermal-hydraulic coupling for 3D reactor core modeling combining MCB and fluent

    Directory of Open Access Journals (Sweden)

    Królikowski Igor P.

    2015-09-01

    Full Text Available Three-dimensional simulations of neutronics and thermal hydraulics of nuclear reactors are a tool used to design nuclear reactors. The coupling of MCB and FLUENT is presented, MCB allows to simulate neutronics, whereas FLUENT is computational fluid dynamics (CFD code. The main purpose of the coupling is to exchange data such as temperature and power profile between both codes. Temperature required as an input parameter for neutronics is significant since cross sections of nuclear reactions depend on temperature. Temperature may be calculated in thermal hydraulics, but this analysis needs as an input the power profile, which is a result from neutronic simulations. Exchange of data between both analyses is required to solve this problem. The coupling is a better solution compared to the assumption of estimated values of the temperatures or the power profiles; therefore the coupled analysis was created. This analysis includes single transient neutronic simulation and several steady-state thermal simulations. The power profile is generated in defined points in time during the neutronic simulation for the thermal analysis to calculate temperature. The coupled simulation gives information about thermal behavior of the reactor, nuclear reactions in the core, and the fuel evolution in time. Results show that there is strong influence of neutronics on thermal hydraulics. This impact is stronger than the impact of thermal hydraulics on neutronics. Influence of the coupling on temperature and neutron multiplication factor is presented. The analysis has been performed for the ELECTRA reactor, which is lead-cooled fast reactor concept, where the coolant fl ow is generated only by natural convection

  14. Electric Vehicle Preparedness: Task 1, Assessment of Fleet Inventory for Marine Corps Base Camp Lejeune

    Energy Technology Data Exchange (ETDEWEB)

    Schey, Stephen [Idaho National Lab. (INL), Idaho Falls, ID (United States); Francfort, Jim [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-01-01

    Several U.S. Department of Defense-based studies were conducted to identify potential U.S. Department of Defense transportation systems that are strong candidates for introduction or expansion of plug-in electric vehicles (PEVs). Task 1 included a survey of the inventory of non-tactical fleet vehicles at the Marine Corps Base Camp Lejeune (MCBCL) to characterize the fleet. This information and characterization will be used to select vehicles for monitoring that takes place during Task 2. This monitoring involves data logging of vehicle operation in order to identify the vehicle’s mission and travel requirements. Individual observations of these selected vehicles provide the basis for recommendations related to PEV adoption. It also identifies whether a battery electric vehicle or plug-in hybrid electric vehicle (collectively referred to as PEVs) can fulfill the mission requirements and provides observations related to placement of PEV charging infrastructure.

  15. Advancements in reactor physics modelling methodology of Monte Carlo Burnup Code MCB dedicated to higher simulation fidelity of HTR cores

    International Nuclear Information System (INIS)

    Cetnar, Jerzy

    2014-01-01

    The recent development of MCB - Monte Carlo Continuous Energy Burn-up code is directed towards advanced description of modern reactors, including double heterogeneity structures that exist in HTR-s. In this, we exploit the advantages of MCB methodology in integrated approach, where physics, neutronics, burnup, reprocessing, non-stationary process modeling (control rod operation) and refined spatial modeling are carried in a single flow. This approach allows for implementations of advanced statistical options like analysis of error propagation, perturbation in time domain, sensitivity and source convergence analyses. It includes statistical analysis of burnup process, emitted particle collection, thermal-hydraulic coupling, automatic power profile calculations, advanced procedures of burnup step normalization and enhanced post processing capabilities. (author)

  16. Implementation Approach for Electric Vehicles at Marine Corps Base Camp Lejeune. Task 4

    Energy Technology Data Exchange (ETDEWEB)

    Schey, Stephen [Idaho National Lab. (INL), Idaho Falls, ID (United States); Francfort, Jim [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-11-01

    Battelle Energy Alliance, LLC, managing and operating contractor for the U.S. Department of Energy’s Idaho National Laboratory, is the lead laboratory for U.S. Department of Energy Advanced Vehicle Testing. Battelle Energy Alliance, LLC contracted with Intertek Testing Services, North America (Intertek) to conduct several U.S. Department of Defense base studies to identify potential U.S. Department of Defense transportation systems that are strong candidates for introduction or expansion of plug-in electric vehicles (PEVs). This study is focused on the Marine Corps Base Camp Lejeune (MCBCL) located in North Carolina. Task 1 consisted of a survey of the non-tactical fleet of vehicles at MCBCL to begin the review of vehicle mission assignments and types of vehicles in service. In Task 2, daily operational characteristics of vehicles were identified to select vehicles for further monitoring and attachment of data loggers. Task 3 recorded vehicle movements in order to characterize the vehicles’ missions. The results of the data analysis and observations were provided. Individual observations of the selected vehicles provided the basis for recommendations related to PEV adoption, i.e., whether a battery electric vehicle (BEV) or plug-in hybrid electric vehicle (PHEV) (collectively PEVs) can fulfill the mission requirements. It also provided the basis for recommendations related to placement of PEV charging infrastructure. This report focuses on an implementation plan for the near-term adoption of PEVs into the MCBCL fleet. Intertek acknowledges the support of Idaho National Laboratory, Marine Corps headquarters, and Marine Corps Base Camp Lejeune fleet management and personnel for participation in this study. Intertek is pleased to provide this report and is encouraged by enthusiasm and support from MCBCL personnel.

  17. Characterization of Proxy Application Performance on Advanced Architectures. UMT2013, MCB, AMG2013

    Energy Technology Data Exchange (ETDEWEB)

    Howell, Louis H. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Gunney, Brian T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Bhatele, Abhinav [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2015-10-09

    Three codes were tested at LLNL as part of a Tri-Lab effort to make detailed assessments of several proxy applications on various advanced architectures, with the eventual goal of extending these assessments to codes of programmatic interest running more realistic simulations. Teams from Sandia and Los Alamos tested proxy apps of their own. The focus in this report is on the LLNL codes UMT2013, MCB, and AMG2013. We present weak and strong MPI scaling results and studies of OpenMP efficiency on a large BG/Q system at LLNL, with comparison against similar tests on an Intel Sandy Bridge TLCC2 system. The hardware counters on BG/Q provide detailed information on many aspects of on-node performance, while information from the mpiP tool gives insight into the reasons for the differing scaling behavior on these two different architectures. Results from three more speculative tests are also included: one that exploits NVRAM as extended memory, one that studies performance under a power bound, and one that illustrates the effects of changing the torus network mapping on BG/Q.

  18. Assessment of Charging Infrastructure for Plug-in Electric Vehicles at Marine Corps Base Camp Lejeune. Task 3

    Energy Technology Data Exchange (ETDEWEB)

    Schey, Stephen [Idaho National Lab. (INL), Idaho Falls, ID (United States); Francfort, Jim [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-11-01

    Battelle Energy Alliance, LLC, managing and operating contractor for the U.S. Department of Energy’s Idaho National Laboratory, is the lead laboratory for the U.S. Department of Energy’s advanced vehicle testing. Battelle Energy Alliance, LLC contracted with Intertek Testing Services, North America (Intertek) to conduct several U.S. Department of Defense-based studies to identify potential U.S. Department of Defense transportation systems that are strong candidates for introduction or expansion of plug-in electric vehicles (PEVs). Task 1 consisted of a survey of the non-tactical fleet of vehicles at Marine Corps Base Camp Lejeune to begin the review of vehicle mission assignments and types of vehicles in service. Task 2 selected vehicles for further monitoring and involved identifying daily operational characteristics of these select vehicles. Data logging of vehicle movements was initiated in order to characterize the vehicle’s mission. The Task 3 vehicle utilization report provided results of the data analysis and observations related to the replacement of current vehicles with PEVs. Finally, this report provides an assessment of charging infrastructure required to support the suggested PEV replacements. Intertek acknowledges the support of Idaho National Laboratory, Marine Corps headquarters, and Marine Corps Base Camp Lejeune Fleet management and personnel for participation in this study. Intertek is pleased to provide this report and is encouraged by enthusiasm and support from Marine Corps Base Camp Lejeune personnel.

  19. Utilization Assessment of Target Electrification Vehicles at Marine Corps Base Camp Lejeune. Task 3

    Energy Technology Data Exchange (ETDEWEB)

    Schey, Stephen [Idaho National Lab. (INL), Idaho Falls, ID (United States); Francfort, Jim [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-11-01

    Battelle Energy Alliance, LLC, managing and operating contractor for the U.S. Department of Energy’s Idaho National Laboratory, is the lead laboratory for U.S. Department of Energy Advanced Vehicle Testing. Battelle Energy Alliance, LLC contracted with Intertek Testing Services, North America (Intertek) to conduct several U.S. Department of Defense base studies to identify potential U.S. Department of Defense transportation systems that are strong candidates for introduction or expansion of plug-in electric vehicles (PEVs). Task 1 consisted of a survey of the non-tactical fleet of vehicles at MCBCL to begin the review of vehicle mission assignments and types of vehicles in service. Task 2 involved identifying daily operational characteristics of select vehicles and initiating data logging of vehicle movements in order to characterize the vehicle’s mission. Individual observations of these selected vehicles provide the basis for recommendations related to PEV adoption and whether a battery electric vehicle or plug-in hybrid electric vehicle (collectively referred to as PEVs) can fulfill the mission requirements and provide observations related to placement of PEV charging infrastructure. This report provides the results of the data analysis and observations related to replacement of current vehicles with PEVs. This fulfills part of the Task 3 requirements. Task 3 also includes an assessment of the charging infrastructure required to support this replacement, which is the subject of a separate report. Intertek acknowledges the support of Idaho National Laboratory, Marine Corps headquarters, and Marine Corps Base Camp Lejeune Fleet management and personnel for participation in this study. Intertek is pleased to provide this report and is encouraged by enthusiasm and support from MCBCL personnel.

  20. Characterization and use of the novel human multiple myeloma cell line MC-B11/14 to study biological consequences of CRISPR-mediated loss of immunoglobulin A heavy chain.

    Science.gov (United States)

    Walters, Denise K; Arendt, Bonnie K; Tschumper, Renee C; Wu, Xiaosheng; Jelinek, Diane F

    2018-01-01

    The genetic abnormalities underlying multiple myeloma (MM) are notoriously complex and intraclonal heterogeneity is a common disease feature. In the current study, we describe the establishment of a monoclonal immunoglobulin A (IgA) kappa (κ) MM cell line designated MC-B11/14. Cytogenetic and fluorescence in situ hybridization analyses of the original and relapse patient samples revealed that the MM clone was nonhyperdiploid and possessed an 11;14 chromosomal translocation. The MC-B11/14 cell line, established from the relapse sample, is tetraploid and houses the t(11;14) abnormality. Given our long-standing interest in Ig function and secretion, we next used CRISPR technology to knock out IgA heavy-chain expression in the MC-B11/14 cells to assess the biological consequences of converting this cell line to one only expressing κ light chains. As expected, secretion of intact IgA was undetectable from MC-B11/14 IgA- cells. Sensitivity to pomalidomide treatment was similar between the MC-B11/14 WT and MC-B11/14 IgA- cells; however, MC-B11/14 IgA- cells were found to be significantly more resistant to bortezomib treatment. This study describes the establishment of a new human MM cell line tool with which to study disease biology and the use of CRISPR technology to create a potentially useful model with which to study MM light-chain escape. Copyright © 2018 ISEH – Society for Hematology and Stem Cells. Published by Elsevier Inc. All rights reserved.

  1. Philippe Lejeune, Catherine Bogaert: Historia pewnej praktyki „Uri journal à soi" (Paris 2003, Ed. Textuel, s. 214, album

    Directory of Open Access Journals (Sweden)

    Regina Lubas-Bartoszyńska

    2007-06-01

    Full Text Available This article discusses the content of an album of P. Lejeune and C. Bogaert, published in Paris in last year (in 2003, dedicated to a personal diary. The fact of bringing out of this publication became for the author of this article an impulse to present an anthropological view at the form of diary. The author - taking an opportunity of presenting the content of the album - gives an outline of the tradition of the genre, discusses various criteria (geographical, historical, sociological which have an influence on the development and formation of this literary form. The author also draws attention to the significant features of a personal diary (the ones which differ it from, e.g. autobiography and its kinds (from the purest form of a personal, intimate diary through the diary-letter written by one to him/herself to some unconvetional diaries such as: a painter's diary, diary-comic-strip, film diary, diary-photograph, on line diary - blog. While also pointing to such forms as: spiritual diaries, journey diaries, log books, and historical chronicles, the author emphasises the necessity of relating the origin of the diary with a concrete situation of men.

  2. 33 CFR 80.525 - Cape Lookout, NC to Cape Fear, NC.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cape Lookout, NC to Cape Fear, NC... INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Fifth District § 80.525 Cape Lookout, NC to Cape Fear... southeast side of the Inlet. (g) Except as provided elsewhere in this section from Cape Lookout to Cape Fear...

  3. ORF Sequence: NC_006349 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006349 gi|53716750 >gi|53716750|ref|YP_105775.1| nonribosomal peptide synthetas...AIVALDAMPLTPNGKLDRAALPAPIVTGTSRRAPENRIEQQVCAMFAELLDAQTLGAEDNFFELGGDSLLAMRAINKLRQTFDVELTIRDLFSAPTVAALSMRLDAQLAARRAHADGAELPAG

  4. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|49176202 >gi|49176202|ref|NP_416756.3| putative aminotransferase [Escheric...QQALAALPFQPLSLPAWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHFRAAHTQKYYRERFPTLSLPNTEWNSERICSLPLFPDMTTADADHVITALQQLAGQ

  5. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18310296 >gi|18310296|ref|NP_562230.1| muramidase [Clostridium perfri...GFGDGDYGDLFPVLDVETPTDKSLTTTELVNWIDRFRDRFEEKTRRRLMLYTGLFFIGLYDDFKVPGKGYPLSDMPLWIAMYTRIPSNPRIPPNVGGWKRWTMWQFTD

  6. Strengthening functions of NC. Windows terminal functions; NC no kino kyoka. Windows tanmatsu kino

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-01-10

    A network computer (NC) was connected to a Citrix Meta Frame server to strengthen its functions so that such Windows applications as Excel and Word can be utilized. Combination of Meta Frame with the NC made it possible to structure such unique system that the Windows applications can be used, the environment can be unified easily with that of all clients, and no installation is required for applications at the clients. Thus, the scope of NC application has been expanded. Major usage includes the followings: (1) industrial area: a site controller can utilize work report (Excel) and mails by using an NC terminal available at factory production sites; (2) public area: a large number of learning persons can utilize Excel and Word at educational institutions; and (3) general area: ordinary offices can utilize applications developed by Visual Basic and others in addition to Excel and Work. (translated by NEDO)

  7. NC10 bacteria in marine oxygen minimum zones

    DEFF Research Database (Denmark)

    Padilla, Cory; Bristow, Laura A.; Sarode, Neha

    2016-01-01

    Bacteria of the NC10 phylum link anaerobic methane oxidation to nitrite denitrification through a unique O2-producing intra-aerobic methanotrophy pathway. A niche for NC10 in the pelagic ocean has not been confirmed. We show that NC10 bacteria are present and transcriptionally active in oceanic o...

  8. 78 FR 72009 - Establishment of Class E Airspace; Star, NC

    Science.gov (United States)

    2013-12-02

    ... Federal Aviation Administration 14 CFR Part 71 Establishment of Class E Airspace; Star, NC AGENCY: Federal... at Star, NC, to accommodate a new Area Navigation (RNAV) Global Positioning System (GPS) Standard... Federal Register a notice of proposed rulemaking to establish Class E airspace at Star, NC (78 FR 54413...

  9. Virtual NC machine model with integrated knowledge data

    International Nuclear Information System (INIS)

    Sidorenko, Sofija; Dukovski, Vladimir

    2002-01-01

    The concept of virtual NC machining was established for providing a virtual product that could be compared with an appropriate designed product, in order to make NC program correctness evaluation, without real experiments. This concept is applied in the intelligent CAD/CAM system named VIRTUAL MANUFACTURE. This paper presents the first intelligent module that enables creation of the virtual models of existed NC machines and virtual creation of new ones, applying modular composition. Creation of a virtual NC machine is carried out via automatic knowledge data saving (features of the created NC machine). (Author)

  10. The dual transcriptional regulator CysR in Corynebacterium glutamicum ATCC 13032 controls a subset of genes of the McbR regulon in response to the availability of sulphide acceptor molecules

    Directory of Open Access Journals (Sweden)

    Koch Daniel J

    2008-10-01

    Full Text Available Abstract Background Regulation of sulphur metabolism in Corynebacterium glutamicum ATCC 13032 has been studied intensively in the last few years, due to its industrial as well as scientific importance. Previously, the gene cg0156 was shown to belong to the regulon of McbR, a global transcriptional repressor of sulphur metabolism in C. glutamicum. This gene encodes a putative ROK-type regulator, a paralogue of the activator of sulphonate utilisation, SsuR. Therefore, it is an interesting candidate for study to further the understanding of the regulation of sulphur metabolism in C. glutamicum. Results Deletion of cg0156, now designated cysR, results in the inability of the mutant to utilise sulphate and aliphatic sulphonates. DNA microarray hybridisations revealed 49 genes with significantly increased and 48 with decreased transcript levels in presence of the native CysR compared to a cysR deletion mutant. Among the genes positively controlled by CysR were the gene cluster involved in sulphate reduction, fpr2 cysIXHDNYZ, and ssuR. Gel retardation experiments demonstrated that binding of CysR to DNA depends in vitro on the presence of either O-acetyl-L-serine or O-acetyl-L-homoserine. Mapping of the transcription start points of five transcription units helped to identify a 10 bp inverted repeat as the possible CysR binding site. Subsequent in vivo tests proved this motif to be necessary for CysR-dependent transcriptional regulation. Conclusion CysR acts as the functional analogue of the unrelated LysR-type regulator CysB from Escherichia coli, controlling sulphide production in response to acceptor availability. In both bacteria, gene duplication events seem to have taken place which resulted in the evolution of dedicated regulators for the control of sulphonate utilisation. The striking convergent evolution of network topology indicates the strong selective pressure to control the metabolism of the essential but often toxic sulphur

  11. ncPred: ncRNA-Disease Association Prediction through Tripartite Network-Based Inference.

    Science.gov (United States)

    Alaimo, Salvatore; Giugno, Rosalba; Pulvirenti, Alfredo

    2014-01-01

    Over the past few years, experimental evidence has highlighted the role of microRNAs to human diseases. miRNAs are critical for the regulation of cellular processes, and, therefore, their aberration can be among the triggering causes of pathological phenomena. They are just one member of the large class of non-coding RNAs, which include transcribed ultra-conserved regions (T-UCRs), small nucleolar RNAs (snoRNAs), PIWI-interacting RNAs (piRNAs), large intergenic non-coding RNAs (lincRNAs) and, the heterogeneous group of long non-coding RNAs (lncRNAs). Their associations with diseases are few in number, and their reliability is questionable. In literature, there is only one recent method proposed by Yang et al. (2014) to predict lncRNA-disease associations. This technique, however, lacks in prediction quality. All these elements entail the need to investigate new bioinformatics tools for the prediction of high quality ncRNA-disease associations. Here, we propose a method called ncPred for the inference of novel ncRNA-disease association based on recommendation technique. We represent our knowledge through a tripartite network, whose nodes are ncRNAs, targets, or diseases. Interactions in such a network associate each ncRNA with a disease through its targets. Our algorithm, starting from such a network, computes weights between each ncRNA-disease pair using a multi-level resource transfer technique that at each step takes into account the resource transferred in the previous one. The results of our experimental analysis show that our approach is able to predict more biologically significant associations with respect to those obtained by Yang et al. (2014), yielding an improvement in terms of the average area under the ROC curve (AUC). These results prove the ability of our approach to predict biologically significant associations, which could lead to a better understanding of the molecular processes involved in complex diseases. All the ncPred predictions together

  12. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57641467 >gi|57641467|ref|YP_183945.1| SSU ribosomal protein S17P [Thermococcus kodakarae...nsis KOD1] MREIGLRVQPPAEVCNDPKCPWHGNLKIHGRYVEGIVVSDKGKKTVVVERQYYHYLKKYERYELRKSKVHAHNPECINAKVGDKVLIAETRPISKTKSWVVVAVLQRAERAEEV

  13. ORF Sequence: NC_002677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002677 gi|15827448 >gi|15827448|ref|NP_301711.1| hypothetical protein ML0938 [Mycobacterium leprae... TN] MEHFLDVSTEPRWTEAQRLVTLAAIDIVKTFFKADRDAAGAKINEYLRRIGSEGVIAGYNGLCGMLVKHVAEVTGEDPMAVVYRAEETARNVLPEEEE

  14. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57640234 >gi|57640234|ref|YP_182712.1| hypothetical protein TK0299 [Thermococcus kodakarae...nsis KOD1] MEGGREKPSVRAGSEELLFEVLKEGLFWAALGRPSEVMPFLRGKLLGNGFSPKAKEELQWLLDQLEKYYSHVAASGRVEERHLRAIKSFYRDIVVVLSVERAEF

  15. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57640908 >gi|57640908|ref|YP_183386.1| hypothetical protein TK0973 [Thermococcus kodakarae...nsis KOD1] MAVISVRIPDELKAKMKELDINWSEEIRKFIEERVLRAEKQKKLDEIHRLLSGGTPADEGTARKYVRDDRDSN

  16. ORF Sequence: NC_002677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002677 gi|15827020 >gi|15827020|ref|NP_301283.1| putative GTP cyclohydrolase I [Mycobacterium leprae... TN] MALLDLGLESTAVPRIRVFDQQRAEAAIRELLYAIGEDPDREGLADTPARVARACRELFSGLYTDPQTVLNTMFDEEHNELV...IVKEIPMYSTCEHHLVSFHGVAHIGYLPGADGRVTGLSKIARLVDLYAKRPQVQERLTSQIADALVSKLDPRGVIIVVEAEHLCMAMRGVRKPGAITTTSAVRGQFKTDAASRAEALGLILRK

  17. ORF Sequence: NC_002677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002677 gi|15828228 >gi|15828228|ref|NP_302491.1| putative membrane protein [Mycobacterium leprae... TN] MSKGDRKNGVPSTLTTIPLVDPHAEPTEPSIGDLIKDATTQVSTLVRAEVELARAEIIRDVKKGLTGSVFFIAALVVLFYSTFFFF

  18. ORF Sequence: NC_002677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002677 gi|15826974 >gi|15826974|ref|NP_301237.1| hypothetical protein ML0151 [Mycobacterium leprae... TN] MRPEPPHHENAELTEMNTEVVEAPLLTDIEELREEIDRLDAQILATVKRRAEVSQAIGKVRMASGGTRLVHSREMKVIERYSELGPDGKDLAILLLRLGRGRLGH

  19. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57641662 >gi|57641662|ref|YP_184140.1| hypothetical protein TK1727 [Thermococcus kodakarae...nsis KOD1] MGKEERTVIENSPSFQYLLRFASDIGGGLKFISLEKDAYNIRENDIIVCFGDESKKRAEYLKKVLKYPIEIHSILEIIERYETNANGV

  20. ORF Sequence: NC_002677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002677 gi|15828329 >gi|15828329|ref|NP_302592.1| possible hemagglutinin. [Mycobacterium leprae... TN] MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRVEESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYL...EAATNRYNELVERGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGRAAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK

  1. ORF Sequence: NC_002677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002677 gi|15827196 >gi|15827196|ref|NP_301459.1| putative integration host factor [Mycobacterium leprae... TN] MALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDEVLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLEKFGSA

  2. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57640317 >gi|57640317|ref|YP_182795.1| hypothetical protein TK0382 [Thermococcus kodakarae...nsis KOD1] MSVWGWLLGFLLLGAILSILYDILFRPWKLVREGINDLERQLKLLDGRFARLRSFIIAPWLWGDVERTRTFVSHKLALKRAELELFEKLKGGGE

  3. ORF Sequence: NC_002677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002677 gi|15827491 >gi|15827491|ref|NP_301754.1| hypothetical protein ML1018 [Mycobacterium leprae... TN] MAYDDPFMQTESTYWPTLPAGAQQYTSSTKHPVDGDRAEATVDMAGIPCRIMPQRHRNEQHSVAGYASSHR

  4. ORF Sequence: NC_002677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002677 gi|15827265 >gi|15827265|ref|NP_301528.1| putative transcriptional regul...ator [Mycobacterium leprae TN] MLTLTIPKQTLPGLPCHADTSDLWFAETPADLECTKTLCANCPIRRPCLEAAMERAEPWGVWGGEIFDRGLIVSRKRPRGRPCNDVVVV

  5. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57641941 >gi|57641941|ref|YP_184419.1| hypothetical protein TK2006 [Thermococcus kodakarae...nsis KOD1] MSEAVNPKLYSIEKLLEDKDKRLLVSEVVLKLAEALGVTVEDFLGYMEWKENMGKLERAEKEAQIPESIPVEFPTEDAPEGLEEALNEIEEDIQKWQKIERRLKEMGLEL

  6. ORF Sequence: NC_002677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002677 gi|15827349 >gi|15827349|ref|NP_301612.1| hypothetical protein ML0802 [Mycobacterium leprae... TN] MAEMSGVKMAEDVRAEIVASVLEVVVSEGDQIGKGDVLVLLESMKMEIPVLAGVAGIVSKVSVSVGDVIQAGDLIAVIS

  7. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57640253 >gi|57640253|ref|YP_182731.1| hypothetical protein TK0318 [Thermococcus kodakarae...nsis KOD1] MVEIPEVEELKALLNELGEEGLLERLDAFVRMNGGLESKRGEDFIKVSILGFAEGLLTVLKEKYDEPRVKELYEKIKAKRAELDEQFRKPRIPYLEEEG

  8. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57640245 >gi|57640245|ref|YP_182723.1| hypothetical protein TK0310 [Thermococcus kodakarae...nsis KOD1] MLEKSEMVRSYEILDYKEGSDFYFLKIRAELIDGSVLHIREFVSNEEYNYSFQWQRDSELIIRWDNAPHHKDLPTFPHHKHVGSEKNVLPSSEITLEEVLGVISSYIQNP

  9. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57640174 >gi|57640174|ref|YP_182652.1| putative tRNA-binding protein [Thermococcus kodakarae...nsis KOD1] MELYDVDEFWKFDLRVGLVKRAEKLKRTRKLIKLDVDFGGEERTVITGIADQYSPEELEGKKFVFVLNLKPKKLSGVESQGMLIVAETEDGKVYLLPVPEEVPVGTRVW

  10. ORF Sequence: NC_003909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003909 gi|42782207 >gi|42782207|ref|NP_979454.1| BclA protein [Bacillus cereus ATCC 10987] MANRLNFTGP...LGCCGISGKTGPTGPTGPTGVTGSTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGP...TGATGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGSTGP

  11. ORF Sequence: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50086493 >gi|50086493|ref|YP_048003.1| putative transthyretin-like pr...otein precursor [Acinetobacter sp. ADP1] MISTHILDTHLGKPATQVDVRLYNAKTRDLIGQGVTDQDGRIKNFGREDLEAGAYLLEYDVAPYFSQKQLKTFFPQVLIQFAIENPAEHYHVPLLISPFAYSTYRGS

  12. ORF Sequence: NC_002163 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002163 gi|15792064 >gi|15792064|ref|NP_281887.1| transthyretin-like periplasmic... protein [Campylobacter jejuni subsp. jejuni NCTC 11168] MFSIKKTLLILASVPMFLSATEYQLSTHVLDITSGQPAPKVKVELYKLEAN

  13. ORF Sequence: NC_003912 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003912 gi|57237017 >gi|57237017|ref|YP_178819.1| transthyretin-like protein [Ca...mpylobacter jejuni RM1221] MFSIKKTLLILASVPMFLSATEYQLSTHVLDITSGQPAPKVKVELYKLEANQQWKKVSEEFTEENGRIGDLLPYEKAENRAFGIYKLKFFTKDYYTSHKINTFYPFVEVSFELSKDQKHYHVPITLSPFGYSTYRGS

  14. ORF Sequence: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005363 gi|42523756 >gi|42523756|ref|NP_969136.1| membrane protein necessary for nodulation/competitivene...ss [Bdellovibrio bacteriovorus HD100] MKSLMLILFVSLLSVVAKADCTTAITINEAISASTSDYLERAEKR

  15. ORF Sequence: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13471138 >gi|13471138|ref|NP_102707.1| transcriptional regulatory protein, nodulation competit...iveness determinant [Mesorhizobium loti MAFF303099] MTNESDTRSAELAELTADIVSAYVSNNPLPV

  16. ORF Sequence: NC_003078 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available etitiveness [Sinorhizobium meliloti 1021] MQLSACARRREAVRYRRRMARILILLFSLLSAFAFPVTPVP... NC_003078 gi|16264863 >gi|16264863|ref|NP_437655.1| probable membrane protein necessary for nodulation comp

  17. ORF Sequence: NC_004311 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Brucella suis 1330] MKTAHRISALANQLNELQACLGRASGRPSKSVMEAQRIAAELASLLEEWHLETLHIPETERDLYRVQNPYYAAH ... NC_004311 gi|23500123 >gi|23500123|ref|NP_699563.1| hypothetical protein BRA0370 [

  18. ORF Sequence: NC_006155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available g protein (involved in environmental [Yersinia pseudotuberculosis IP 32953] MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK ... NC_006155 gi|51595328 >gi|51595328|ref|YP_069519.1| hemolysin expression modulatin

  19. ORF Sequence: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26246999 >gi|26246999|ref|NP_753039.1| Hydrogenase-1 large chain [Escheric...hia coli CFT073] MSTQYETQGYTINNAGRRLVVDPITRIEGHMRCEVNINDQNVITNAVSCGTMFRGLEIILQGRDPRDAWAFVERICGVCTGVHALA

  20. ORF Sequence: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|15830383 >gi|15830383|ref|NP_309156.1| hydrogenase-1 large subunit [Escheric...hia coli O157:H7] MSTQYETQGYTINNAGRRLVVDPITRIEGHMRCEVNINDQNVITNAVSCGTMFRGLEIILQGRDPRDAWAFVERICGVCTGVH

  1. ORF Sequence: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|38703956 >gi|38703956|ref|NP_309866.2| hypothetical protein ECs1839 [Escheric...hia coli O157:H7] MSQFFYIHPDNPQQRLINQAVEIVRKGGVIVYPTDSGYALGCKIEDKNAMERICRIRQLPDGHNFTLMCRDLSELSTYSFVD

  2. ORF Sequence: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15802802 >gi|15802802|ref|NP_288829.1| putative enzyme [Escherichia c...YQQALAALPFQPLSLPAWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHFRAAHTQKYYRERFPSLSLPNTEWNSERICSLPLFPDMTTADADRVITALQQLAGQ

  3. ORF Sequence: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26248641 >gi|26248641|ref|NP_754681.1| Hypothetical protein yfbE [Escheric...QQYQQALAALPFQPLSLPAWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHFRAAHTQKYYRERFPTLSLPNTEWNSERICSLPLFPDMTTADADRVITALQQLAGQ

  4. ORF Sequence: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|38704067 >gi|38704067|ref|NP_311168.2| hypothetical protein ECs3141 [Escheric...QYQQALAALPFQPLSLPAWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHFRAAHTQKYYRERFPSLSLPNTEWNSERICSLPLFPDMTTADADRVITALQQLAGQ

  5. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|49176093 >gi|49176093|ref|NP_415783.3| hypothetical protein b1267 [Escheric...hia coli K12] MGTAAEHHREGIMSQFFYIHPDNPQQRLINQAVEIVRKGGVIVYPTDSGYALGCKIEDKNAMERICRIRQLPDGHNFTLMCRDLSELS

  6. ORF Sequence: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26247596 >gi|26247596|ref|NP_753636.1| Protein yciO [Escherichia coli... CFT073] MGTAAEHHREGIMSQFFYIHPDNPQQRLINQAVEIVRKGGVIVYPTDSGYALGCKIEDKNAMERICRIRQLPDGHNFTLMCRDLSELSTYSFVDNVAFR

  7. ORF Sequence: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26248286 >gi|26248286|ref|NP_754326.1| Putative salicyl-AMP ligase [Escheric...hia coli CFT073] MESALLRLAEVQDCAVVAAPDTLLGERICAFIIAQQVPTDYQQLRQQLTRMGLSAWKIPDQIEFLDHWPLTAVGKIDKKRLTALAVDRYRHSAQ

  8. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16128939 >gi|16128939|ref|NP_415492.1| hydrogenase-1 large subunit [Escheric...hia coli K12] MSTQYETQGYTINNAGRRLVVDPITRIEGHMRCEVNINDQNVITNAVSCGTMFRGLEIILQGRDPRDAWAFVERICGVCTGVHALAS

  9. ORF Sequence: NC_004461 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004461 gi|27468532 >gi|27468532|ref|NP_765169.1| hypothetical protein SE1614 [Staphylococcus epidermidis ATCC 12228] MIDQNKVSRPVLSDDQLSQLNIHLHEALQQSRPVNIKYYEEGYINFIELIVHRIDSINYEIEGTAPHSRERHKVSFLDIIDISFI

  10. ORF Sequence: NC_002951 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002951 gi|57652313 >gi|57652313|ref|YP_187383.1| hypothetical protein SACOL2592 [Stap...hylococcus aureus subsp. aureus COL] MSLNKEQRRITAEELQAHFEASTLSVQMIAEKLNVTTEDVEKVLAMTAPLGIFSHQLQRFIHLVWDVRDVINDNIKGNGQTPEPYTYLKGEKEDYWFLR

  11. ORF Sequence: NC_003923 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003923 gi|21284226 >gi|21284226|ref|NP_647314.1| hypothetical protein MW2497 [Stap...hylococcus aureus subsp. aureus MW2] MSLNKEQRRITCEELQAHFEESTLSVQMIAEKLNVTTEDVEKVLAMTAPLGIFSHQLQRFIHLVWDVRDVINDNIKGNGQTPEPYTYLKGEKEDYWFLR

  12. ORF Sequence: NC_002745 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002745 gi|15928156 >gi|15928156|ref|NP_375689.1| hypothetical protein SA2363 [Stap...hylococcus aureus subsp. aureus N315] MSLNKEQRRITAEELQAHFEESTLSVQMIAEKLNVTTEDVEKVLAMTAPLGIFSHQLQRFIHLVWDVRDVINDNIKGNGQTPEPYTYLKGEKEDYWFLR

  13. ORF Sequence: NC_002758 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002758 gi|15925567 >gi|15925567|ref|NP_373101.1| hypothetical protein SAV2577 [Stap...hylococcus aureus subsp. aureus Mu50] MSLNKEQRRITAEELQAHFEESTLSVQMIAEKLNVTTEDVEKVLAMTAPLGIFSHQLQRFIHLVWDVRDVINDNIKGNGQTPEPYTYLKGEKEDYWFLR

  14. ORF Sequence: NC_002952 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002952 gi|49484080 >gi|49484080|ref|YP_041304.1| hypothetical protein SAR1930 [Stap...hylococcus aureus subsp. aureus MRSA252] MKASRILFGIGVGVAAGFVVALQGRDDKSVKNNTIDRTAPTGSKSELQREFETIKQSFNDILNYGVQIKNESAEFGSSIGGEIKSLLGNFKSDINPNIERLQSHIENLQNRGEDIGNEISK

  15. ORF Sequence: NC_002953 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002953 gi|49487436 >gi|49487436|ref|YP_044657.1| hypothetical protein SAS2543 [Stap...hylococcus aureus subsp. aureus MSSA476] MRTNNHITDLDAIELSSGWNYNSKLETGKNALLSDSLLRDIKVLSSNAKGDADILETELRAVINAMSQNEGKSVDALKNSTAPLKNNLTKLKEQLDKTTH

  16. ORF Sequence: NC_002953 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002953 gi|49487356 >gi|49487356|ref|YP_044577.1| hypothetical protein SAS2463 [Stap...hylococcus aureus subsp. aureus MSSA476] MSLNKEQRRITCEELQAHFEESTLSVQMIAEKLNVTTEDVEKVLAMTAPLGIFSHQLQRFIHLVWDVRDVINDNIKGNGQTPEPYTYLKGEKEDYWFLR

  17. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available coli K12] MFVDRQRIDLLNRLIDARVDLAAYVQLRKAKGYMSVSESNHLRDNFFKLNRELHDKSLRLNLHLDQEEWSALHHAEEALATAAVCLMSGHHDCPTVITVNADKLENCLMSLTLSIQSLQKHAMLEKA ... NC_000913 gi|16128804 >gi|16128804|ref|NP_415357.1| putative receptor [Escherichia

  18. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18309706 >gi|18309706|ref|NP_561640.1| spore photoproduct lyase [Clostridium perfr...SAHWQLPLLSGCVGNCQYCYLNTNLGDKPYVKINVNVEDILNQAQKYIDERKPNITIFEGSATSDPIPVEPYTNSLKRAIEFFANNDFARFRFVTKYTDVDSLLGLDH

  19. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18311454 >gi|18311454|ref|NP_563388.1| probable cell-cycle protein [Clostridium perfr...LTRIIKKALFEVSSKHNNFELKHIQDIIALKDKGTGKQINITNGVIALNEYGDIRIKLVDSKKAKENKVLNLENIKDELDKNQKVVIEDDILGNYELIVEDLKKGEKFSKDRFIKSFDYDKISNIDIRFR

  20. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18310148 >gi|18310148|ref|NP_562082.1| lysine specific permease [Clostridium perfr...SAFTIVFEKLGLAGAASIMNAIILTSVLSAGNSGMYASSRMLYAMAKNGMAPKIFEKTNSRGVPVNAIIITTIIASLCFLTGIYAENTVYVWLVAASGLSGFIAWLGIAICHYRFR

  1. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18311446 >gi|18311446|ref|NP_563380.1| glycine-tRNA ligase [Clostridium perfr...ingens str. 13] MAVEKTMDKIVALCKNRGFIFPGSEIYGGLANSWDYGPLGVEFKNNVKRAWWKKFVQESKYNVGLDSAILMNREVWVASGHVGGFSDPLMDCKECKARFR

  2. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18311510 >gi|18311510|ref|NP_563444.1| hypothetical protein CPE2528 [Clostridium perfr...LEKLQDNNEITDFHKVKEIFYESFGTDINTYFLEFSETPLASASIAQVHRAQLIDGRDVVVKVQHYKIDEKMKLDLSILRRLSKLTSSHIANTLINPVEAFKEIEEATLKELDFEKEAKNTKRFR

  3. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18310876 >gi|18310876|ref|NP_562810.1| translation initiation factor IF-3 [Clostridium perfr...ingens str. 13] MADEAELDLVMISPNAKPPVCKIMDYGKFIYEQSKKEKEAKKKQKVISVKEIRVSPTIEKHDLEIKAKNAKKFLEAGDKVKITVRFRGREAEHSHVGVKILDSFLAQLEEVCSVEKPAKLEGRNMIMILAPKKA

  4. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18309950 >gi|18309950|ref|NP_561884.1| hypothetical protein CPE0968 [Clostridium perfr...ingens str. 13] MRSRVNKINNRTVAALGIKSLDENLEKSIVNIINCNPEYIILGCSEIPFTERILKALNNANCPKILILPFNYRFR

  5. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18311382 >gi|18311382|ref|NP_563316.1| 50S ribosomal protein L22 [Clostridium perfr...ingens str. 13] MEAKAIAKYVRMSPTKVGVVLDLIRGKNVNEAFAILKYTPRDAAEVISKVLKSAVANAENNHELDANRLFVAEAHVGHGPTLKRFRPMDHGKAFRINKRTSNITLVVKERA

  6. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18310629 >gi|18310629|ref|NP_562563.1| probable lipoprotein [Clostridium perfr...GEKVKGNILGNGAIIEFDIESKKKQLYSYGIRNVKGFDLNSSGEIFAIVGGIEDEGFRPLSGDSDYIYKIEGKGTWYGWPDYSGGDPVNSPRFR

  7. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18311064 >gi|18311064|ref|NP_562998.1| probable ABC transporter [Clostridium perfr...ingens str. 13] MKSKAKKLPKEKLTMKDRMKRFRNNKELLLLTIPGAIWFLVFAYLPMFGVIVAFKRWRIHGGFFESLMNSKWVGFDNFK

  8. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18309221 >gi|18309221|ref|NP_561155.1| hypothetical protein CPE0239 [Clostridium perfr...LGEEVSSEYIINDYNIRPIKELLLIDYDEKSIIKNIKNPFIKVFKINKINKNLDEETMEIQSARDEMKKISQCAQDDKLKLIRIYKLICSATNLGEAIEERFRDFIPMIQSSRLIYGDCNIEKRSYRIGNVMKCYDGIMQFLVKICETKYRSAEGKRVKYIKDSLIDEHLEELDLWKQSFNEI

  9. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18310125 >gi|18310125|ref|NP_562059.1| hypothetical protein CPE1143 [Clostridium perfr...ingens str. 13] MGLFSKNKERKGYTSIDSYLKENNLDNDIKSVTNVNIFFMDGEEEDFYLEDHMLLKFKNFIENPEKDFLVLKYYSSLYSDGFSLEEITLMRHGICRFRIDSEKENILVSD

  10. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18310294 >gi|18310294|ref|NP_562228.1| hypothetical protein CPE1312 [Clostridium perfr...KEVIISKDVLDENQCMDIMSICKEYKGVPSFHSRDSVYWPSRFRKYLYDIILNKKIPEKYRVKNIYVKEKEEWREVFKSNNIGKCIIIELNTKKLKKIRENLIKKGNY

  11. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18308994 >gi|18308994|ref|NP_560928.1| hypothetical protein CPE0012 [Clostridium perfr...NNSLGFMKSLKIAKEMINSISRKHVKDIFYDNHNQDRLIIDDSRKNKGYIKVMGNHYGEVTIAPAVSKIICDEIIDKLNCSLNKNFVDKRREFYRFRELSNEERNELI

  12. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18310749 >gi|18310749|ref|NP_562683.1| twitching motility protein [Clostridium perfr...ingens str. 13] MQSLAELLELTVKEGASDLHLTVGISPIIKVNGKLVRLEHEILRPEDTEAYAREILQDAYEKYDAIGEYDTSYSIHGKGRFR

  13. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18310630 >gi|18310630|ref|NP_562564.1| stage V sporulation protein B [Clostridium perfr...TMYGILNGLGRQNVILRNTIITEVLEVTLLFFLTAIPSINIYGYAITMLIISSLSLCLNLYEIYKNINIGLSLSNFLIYILTGVLTYICLSPLSLKLSFIDFRVQVLAVTSIATSIFIFLIIKEKFSSRFRKISLKSR

  14. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18309510 >gi|18309510|ref|NP_561444.1| hypothetical protein CPE0528 [Clostridium perfr...KEFNETYLNDTNRFKDLLDLNKNSENEEIKIIFFDLFNKDANKDQLFITSFMNKLGEILKYINWDKILIIFNEEIIFNKVTNIDSRFRECSLVLNNYDVNLNEFIHIL

  15. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available protein [Clostridium perfringens str. 13] MNKVDLIGRVATKIEVKESKNKKKYVRFRIAVNSFNGREETTTFLSVITWSKSTVDFLEKFVNIGDLVSVSGEIVESRYESESGEVRYYTNIQTSNINLLNKAKEKEIS ... NC_003366 gi|18310649 >gi|18310649|ref|NP_562583.1| probable single-strand binding

  16. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18310554 >gi|18310554|ref|NP_562488.1| hypothetical protein CPE1572 [Clostridium perfr...SKENEIIKECEDFKKTYKDSLDKIFVCSKCMCVKCIRECGFNPCLSCNKTGKVNYCDKENTNLIVFKNFIKQQYNNETNENEPLEILCEVEMLDMDKRFRIIKEVLSGEQLVLEYVYNIKDGDLYNSIEDVDLFNEIIDIYESNKI

  17. ORF Sequence: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39933242 >gi|39933242|ref|NP_945518.1| possible nicotinate-nucleotide adn...WWLVSPGNPLKDISSLREIDARVAAAQAIADDPRIQVSRLEAVIGTRYTADTLRYLRRHCPGARFVWIMGADNLAQFHRWQQWQQIAAEIPIAVIDRPPTSFRALAAPAAQRLMRMRIPNNKAATLADREPPAWVYLTGLKSLVSSTALRNPDGSWKT

  18. ORF Sequence: NC_003901 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available anosarcina mazei Go1] MMFATIGASFHKGWRAGPSIFMGHALVECILFMLILIGASSFLRQSIISYLSIVGGFVMVAFGLLMIKKAKEASTMDVSISASSLN... NC_003901 gi|21228124 >gi|21228124|ref|NP_634046.1| transporter, LysE family [Meth

  19. Inherent and antigen-induced airway hyperreactivity in NC mice

    Directory of Open Access Journals (Sweden)

    Tetsuto Kobayashi

    1999-01-01

    Full Text Available In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those strains in vivo. NC mice again showed comparable airway reactivity to that seen in A/J mice and a significantly greater reactivity than that seen in BALB/c and C57BL/6 mice. To investigate the effects of airway inflammation on airway reactivity to acetylcholine in vivo, NC and BALB/c mice were sensitized to and challenged with antigen. Sensitization to and challenge with antigen induced accumulation of inflammatory cells, especially eosinophils, in lung and increased airway reactivity in NC and BALB/c mice. These results indicate that NC mice exhibit inherent and antigen-induced airway hyperreactivity. Therefore, NC mice are a suitable strain to use in investigating the mechanisms underlying airway hyperreactivity and such studies will provide beneficial information for understanding the pathophysiology of asthma.

  20. ncRNA consensus secondary structure derivation using grammar strings.

    Science.gov (United States)

    Achawanantakun, Rujira; Sun, Yanni; Takyar, Seyedeh Shohreh

    2011-04-01

    Many noncoding RNAs (ncRNAs) function through both their sequences and secondary structures. Thus, secondary structure derivation is an important issue in today's RNA research. The state-of-the-art structure annotation tools are based on comparative analysis, which derives consensus structure of homologous ncRNAs. Despite promising results from existing ncRNA aligning and consensus structure derivation tools, there is a need for more efficient and accurate ncRNA secondary structure modeling and alignment methods. In this work, we introduce a consensus structure derivation approach based on grammar string, a novel ncRNA secondary structure representation that encodes an ncRNA's sequence and secondary structure in the parameter space of a context-free grammar (CFG) and a full RNA grammar including pseudoknots. Being a string defined on a special alphabet constructed from a grammar, grammar string converts ncRNA alignment into sequence alignment. We derive consensus secondary structures from hundreds of ncRNA families from BraliBase 2.1 and 25 families containing pseudoknots using grammar string alignment. Our experiments have shown that grammar string-based structure derivation competes favorably in consensus structure quality with Murlet and RNASampler. Source code and experimental data are available at http://www.cse.msu.edu/~yannisun/grammar-string.

  1. On pseudorandom generators in NC0

    DEFF Research Database (Denmark)

    Cryan, Mary; Miltersen, Peter Bro

    2001-01-01

    In this paper we consider the question of whether NC 0 circuits can generate pseudorandom distributions. While we leave the general question unanswered, we show – • Generators computed by NC 0 circuits where each output bit depends on at most 3 input bits (i.e, DNC 3 0 circuits) and with stretch...

  2. NC CATCH: Advancing Public Health Analytics.

    Science.gov (United States)

    Studnicki, James; Fisher, John W; Eichelberger, Christopher; Bridger, Colleen; Angelon-Gaetz, Kim; Nelson, Debi

    2010-01-01

    The North Carolina Comprehensive Assessment for Tracking Community Health (NC CATCH) is a Web-based analytical system deployed to local public health units and their community partners. The system has the following characteristics: flexible, powerful online analytic processing (OLAP) interface; multiple sources of multidimensional, event-level data fully conformed to common definitions in a data warehouse structure; enabled utilization of available decision support software tools; analytic capabilities distributed and optimized locally with centralized technical infrastructure; two levels of access differentiated by the user (anonymous versus registered) and by the analytical flexibility (Community Profile versus Design Phase); and, an emphasis on user training and feedback. The ability of local public health units to engage in outcomes-based performance measurement will be influenced by continuing access to event-level data, developments in evidence-based practice for improving population health, and the application of information technology-based analytic tools and methods.

  3. ORF Sequence: NC_002505 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002505 gi|15642286 >gi|15642286|ref|NP_231919.1| hypothetical protein VC2288 [Vibrio cholerae... O1 biovar eltor str. N16961] MNTFLITFGFFLAVIAAMAVGYIFQRKVVKGSCGGLGAVGIEKVCNCPEPCDARKKREAKAAARAERLAAWEKDRIA

  4. ORF Sequence: NC_002506 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002506 gi|15601079 >gi|15601079|ref|NP_232710.1| hypothetical protein VCA0314 [Vibrio cholerae... O1 biovar eltor str. N16961] MCFSEKFSQLCAYNSDVRCTMSENQKVKRAEPIETCSYKSPCVRHCCLDDKDICIGCGRTLDEICRWSSATNSEKQEILINSLARVQSRNISI

  5. ORF Sequence: NC_002506 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002506 gi|15601189 >gi|15601189|ref|NP_232820.1| hypothetical protein VCA0426 [Vibrio cholerae... O1 biovar eltor str. N16961] MRCTMSENQNVKRAEPIETCSYKSPCVRHCCLDDKDICIGCGRTIDEICRWSSATNSEKQEILINCLARVQGRNIST

  6. ORF Sequence: NC_002506 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002506 gi|15601250 >gi|15601250|ref|NP_232881.1| hypothetical protein VCA0489 [Vibrio cholerae... O1 biovar eltor str. N16961] MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKVRILFVMRAERDLRRLMLTKQ

  7. ORF Sequence: NC_003284 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available complex component, an evolutionarily conserved kinetochore protein (17.7 kD) (skr-19) [Caenorhabditis elega... NC_003284 gi|25150539 >gi|25150539|ref|NP_510193.2| SKp1 Related, ubiquitin ligase

  8. ORF Sequence: NC_003284 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available complex component, an evolutionarily conserved kinetochore protein (19.6 kD) (skr-20) [Caenorhabditis elega... NC_003284 gi|17569457 >gi|17569457|ref|NP_510192.1| SKp1 Related, ubiquitin ligase

  9. ORF Sequence: NC_003282 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available complex component, an evolutionarily conserved kinetochore protein (18.9 kD) (skr-12) [Caenorhabditis elega... NC_003282 gi|17542038 >gi|17542038|ref|NP_503045.1| SKp1 Related, ubiquitin ligase

  10. ORF Sequence: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available complex component, an evolutionarily conserved kinetochore protein (20.1 kD) (skr-15) [Caenorhabditis elega... NC_003280 gi|17535721 >gi|17535721|ref|NP_494662.1| SKp1 Related, ubiquitin ligase

  11. ORF Sequence: NC_003283 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003283 gi|25155185 >gi|25155185|ref|NP_741574.1| SpermaTHecal expression STH-1,... putative cytoplasmic protein (13.5 kD) (sth-1) [Caenorhabditis elegans] MSQKSKKSIGDVVVTSKLVFPVAEFRTKWERLWPK

  12. ORF Sequence: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003280 gi|32564269 >gi|32564269|ref|NP_871961.1| transthyretin-like precursor f...amily member (15.5 kD) (2F18) [Caenorhabditis elegans] MKWILAVFLLAGVAIAMRKQGVAVKGVLKCGTAFANNTKVRIVDIDTGPDPDDTLDEKRTGEDGAFALTGSTH

  13. ORF Sequence: NC_003281 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003281 gi|17557043 >gi|17557043|ref|NP_498707.1| copper (CU) Chaperonin, functi...onal, complements yeast atx1 mutant (7.6 kD) (cuc-1) [Caenorhabditis elegans] MTQYVFEMGMTCNGCANAARKVLGKLGEDKIKIDDINVETKKITVTTDLPASDVLEALKKTGKEIKQLQ

  14. ORF Sequence: NC_003279 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003279 gi|17510521 >gi|17510521|ref|NP_491035.1| protein with 11 leucine rich repeats, enri...ched in embryos (59.3 kD) (1D304) [Caenorhabditis elegans] MRPPVLILLVLVSGVISCQSGCKCPTKTTAVCKGSSLRSIPILLDPRTTVLDLSNNRI

  15. ORF Sequence: NC_001146 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available factor, as suggested by computational analysis of large-scale protein-protein interaction data; Ist1p [Sacch... NC_001146 gi|6324064 >gi|6324064|ref|NP_014134.1| Putative translation initiation

  16. ORF Sequence: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000962 gi|15608466 >gi|15608466|ref|NP_215842.1| PROBABLE 1,4-ALPHA-GLUCAN BRANCHING ENZYME GLGB (GLYCOG...EN BRANCHING ENZYME) [Mycobacterium tuberculosis H37Rv] MSRSEKLTGEHLAPEPAEMARLVAGTH

  17. ORF Alignment: NC_004369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004369 gi|25028543 >1c8kA 10 724 52 666 e-103 ... ref|YP_226324.1| ALPHA-GLUCAN PHOSPHORYLASE, GLYCOGEN...GLUCAN ... PHOSPHORYLASE, GLYCOGEN PHOSPHORYLASE [Corynebacterium ... glutamicum ATCC 13032] ...

  18. ORF Sequence: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31792522 >gi|31792522|ref|NP_855015.1| PROBABLE 1,4-ALPHA-GLUCAN BRANCHING ENZYME GLGB (GLYCOG...EN BRANCHING ENZYME) [Mycobacterium bovis AF2122/97] MSRSEKLTGEHLAPEPAEMARLVAGTHHNP

  19. ORF Alignment: NC_003450 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003450 gi|23308891 >1c8kA 10 724 52 666 e-103 ... ref|YP_226324.1| ALPHA-GLUCAN PHOSPHORYLASE, GLYCOGEN...GLUCAN ... PHOSPHORYLASE, GLYCOGEN PHOSPHORYLASE [Corynebacterium ... glutamicum ATCC 13032] ...

  20. ORF Alignment: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15965983 >1bu6Y 1 436 4 408 6e-44 ... emb|CAC46809.1| PUTATIVE CARBOHYDRATE... KINASE PROTEIN [Sinorhizobium meliloti] ... ref|NP_386336.1| PUTATIVE CARBOHYDRATE KINASE PROTEIN

  1. ORF Alignment: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15965553 >1rkd0 3 268 9 275 2e-23 ... emb|CAC46379.1| PUTATIVE CARBOHYDRATE... KINASE PROTEIN [Sinorhizobium meliloti] ... ref|NP_385906.1| PUTATIVE CARBOHYDRATE KINASE PROTEIN

  2. ORF Sequence: NC_001148 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available merization of 5-methylthioribose-1-phosphate to 5-methylthioribulose-1-phosphate in... NC_001148 gi|6325375 >gi|6325375|ref|NP_015443.1| Methylthioribose-1-phosphate isomerase, catalyzes the iso

  3. ORF Sequence: NC_001136 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available erization at the 5' splice site; Prp28p [Saccharomyces cerevisiae] MARPIDVSQLIAGINK... NC_001136 gi|6320449 >gi|6320449|ref|NP_010529.1| RNA helicase in the DEAD-box family, involved in RNA isom

  4. BChPT x 1/Nc: masses and currents

    Energy Technology Data Exchange (ETDEWEB)

    Goity, Jose L. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Hampton Univ., Hampton, VA (United States); Fernando, Ishara P. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Hampton Univ., Hampton, VA (United States)

    2018-04-01

    A summary of the implementation of the combined BChPT X 1/Nc expansion for three flavors is presented, along with its applications to the octet and decuplet baryon masses, SU(3) charges and axial couplings.

  5. ORF Sequence: NC_003995 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available vities [Bacillus anthracis str. A2012] MKEVLEVLPKTMKQLVESCKQYDALEEIRVRIGRPLECIAHGEV... NC_003995 gi|21402245 >gi|21402245|ref|NP_658230.1| AAA, ATPases associated with a variety of cellular acti

  6. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16128606 >gi|16128606|ref|NP_415156.1| RNA chaperone, transcription antiterm...inator, affects expression of rpoS and uspA [Escherichia coli K12] MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVIAL

  7. ORF Sequence: NC_001136 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available H2O2 and alkyl hydroperoxides with the use of hydrogens provided by thioredoxin, thioredoxin reductase, and ... NC_001136 gi|6320661 >gi|6320661|ref|NP_010741.1| Thioredoxin-peroxidase, reduces

  8. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available g protein (involved in environmental regulation of virulence factors) [Salmonella enterica subsp. enterica s... NC_006905 gi|62179085 >gi|62179085|ref|YP_215502.1| hemolysin expression modulatin

  9. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002947 gi|26988182 >1rwrA 1 265 36 293 1e-50 ... ref|NP_743607.1| surface colonization... ... gb|AAN67071.1| surface colonization protein, putative ... [Pseudomonas putida KT2440] ...

  10. ORF Sequence: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available se/invertase); possible inulinase [Bifidobacterium longum NCC2705] MTDFTPETPVLTPIHDHAAELAKAEAGVAEMAANRNNRWYP... NC_004307 gi|23464731 >gi|23464731|ref|NP_695334.1| beta-fructofuranosidase (sucra

  11. ORF Alignment: NC_002755 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available protein [Amycolatopsis azurea] ... Length = 288 ... Query: 142 VDAVLSKTGARYSFQVAKVDNGRCDPVAGTNTGESLPLAS... NC_002755 gi|15843206 >1m40A 3 263 6 293 3e-07 ... gb|AAQ21340.1| beta-lactamase-like

  12. ORF Alignment: NC_001264 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available protein [Amycolatopsis azurea] ... Length = 288 ... Query: 237 RVSLLVQEVGGPVLSSLNTSRPLAVGSTFKLAVLGEVQAQ... NC_001264 gi|15807905 >1m40A 3 263 6 293 3e-07 ... gb|AAQ21340.1| beta-lactamase-like

  13. ORF Alignment: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available protein [Amycolatopsis azurea] ... Length = 288 ... Query: 156 VDAALSKTGARYSFQVAKVDNGRCDPVAGTNTGESLPLAS... NC_000962 gi|15610729 >1m40A 3 263 6 293 3e-07 ... gb|AAQ21340.1| beta-lactamase-like

  14. 76 FR 78331 - Environmental Impact Statement: Jackson County, NC

    Science.gov (United States)

    2011-12-16

    ... following purpose description: ``The purpose of this project is to relieve traffic congestion in the Sylva... that improves the NC 107 north/south vehicular mobility by increasing average speeds for through...

  15. ORF Alignment: NC_004369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004369 gi|25028312 >1bt3A 46 337 1 298 1e-36 ... ref|NP_738366.1| putative tyrosinase... [Corynebacterium efficiens YS-314] ... dbj|BAC18566.1| putative tyrosinase [Corynebacterium ...

  16. ORF Sequence: NC_003282 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available inization of XX and XO animals FEM-3 (46.2 kD) (fem-3) [Caenorhabditis elegans] MEVDPGSDDVEADRETRAQKLKLKRNVK... NC_003282 gi|17540880 >gi|17540880|ref|NP_501587.1| sex determination protein, FEM

  17. ORF Sequence: NC_003281 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003281 gi|25151987 >gi|25151987|ref|NP_499440.2| TRAnsformer : XX animals trans...formed into males TRA-1, HERmaphrodization of XO animals HER-2, sex determination zinc-finger protein, alter

  18. ORF Sequence: NC_004631 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available a subsp. enterica serovar Typhi Ty2] MSNQYQTQGYTVNDAGRRLIVDPITRIEGHMRCEVNIDEQNVITNAVSCGTMFRGLEIILQGRDPRDAWAFVERIC... NC_004631 gi|29141562 >gi|29141562|ref|NP_804904.1| hydrogenase-1 large chain [Salmonella enteric

  19. ORF Sequence: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15800894 >gi|15800894|ref|NP_286910.1| hydrogenase-1 large subunit [Escheric...hia coli O157:H7 EDL933] MSTQYETQGYTINNAGRRLVVDPITRIEGHMRCEVNINDQNVITNAVSCGTMFRGLEIILQGRDPRDAWAFVERIC

  20. ORF Sequence: NC_004631 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available a subsp. enterica serovar Typhi Ty2] MSQFFYIHPDNPQQRLINQAVDIVRKGGVIVYPTDSGYALGCKIEDKGAMERICR... NC_004631 gi|29142069 >gi|29142069|ref|NP_805411.1| hypothetical protein t1633 [Salmonella enteric

  1. ORF Sequence: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15801912 >gi|15801912|ref|NP_287932.1| hypothetical protein Z2543 [Escheric...hia coli O157:H7 EDL933] MGTAAEHHREGIMSQFFYIHPDNPQQRLINQAVEIVRKGGVIVYPTDSGYALGCKIEDKNAMERICRIRQLPDGHNF

  2. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available a subsp. enterica serovar Choleraesuis str. SC-B67] MSQFFYIHPDNPQQRLINQAVDIVRKGGVIVYPTDSGYALGCKIEDKGAMERIC... NC_006905 gi|62180287 >gi|62180287|ref|YP_216704.1| putative translation factor [Salmonella enteric

  3. ORF Sequence: NC_006511 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006511 gi|56413501 >gi|56413501|ref|YP_150576.1| hydrogenase-1 large subunit [Salmonella enteric...a subsp. enterica serovar Paratypi A str. ATCC 9150] MAYPYQTQGFTLDNSGRRIVVDPVTRIEGHMRCEVNID...SNNVITNAVSTGTMWRGLEVILKGRDPRDAWAFVERICGVCTGTHALTSIRAVENALGIAIPDNANCIRNMMQATLHVHDHLVHFYHLHALDWVDVVAALKADPHQTS

  4. ORF Sequence: NC_006511 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006511 gi|56414112 >gi|56414112|ref|YP_151187.1| hypothetical protein SPA1967 [Salmonella enteric...a subsp. enterica serovar Paratypi A str. ATCC 9150] MKQTVYTASPESQQIHVWSLNHEGTLTLVQVVDVPGQ...VQPMVVSPDKRYLYVGVRPEFRVLAYRIAPDDGALTFAAESALPGSPTHISTDHHGRFVFVGSYNAGNVSVTRLQDGLPVELVDVVEGLDGCHSANITPDNRTLWVPALKQERIC

  5. ORF Sequence: NC_003384 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available a subsp. enterica serovar Typhi str. CT18] MVPFCHKLEEKLMTSNRCREIKTPPEHIIADYILRFMKNNKEAKLYEAMSRLESKINLFVADGHDELHIRALLNQAAHSHTKESLKQACERICN ... NC_003384 gi|18466439 >gi|18466439|ref|NP_569247.1| hypothetical protein HCM1.23c [Salmonella enteric

  6. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62180125 >gi|62180125|ref|YP_216542.1| putative hydrogenase-1 large subunit [Salmonella enteri...ca subsp. enterica serovar Choleraesuis str. SC-B67] MAYPYQTQGFTLDNSGRRIVVDPVTRIEGH...MRCEVNIDSNNVITNAVSTGTMWRGLEVILKGRDPRDAWAFVERICGVCTGTHALTSIRAVENALGIAIPDNANCIRKKLPKEALFSTLGRTAARALESVWAGNTLQY

  7. ORF Sequence: NC_003198 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available a subsp. enterica serovar Typhi str. CT18] MSQFFYIHPDNPQQRLINQAVDIVRKGGVIVYPTDSGYALGCKIEDKGAMERIC... NC_003198 gi|16760160 >gi|16760160|ref|NP_455777.1| hypothetical protein STY1330 [Salmonella enteric

  8. ORF Sequence: NC_006511 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available a subsp. enterica serovar Paratypi A str. ATCC 9150] MSQFFYIHPDNPQQRLINQAVDIVRKGGVIVYPTDSGYALGCKIEDKGAMERIC... NC_006511 gi|56413354 >gi|56413354|ref|YP_150429.1| hypothetical protein SPA1156 [Salmonella enteric

  9. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MQQFEWI... NC_006905 gi|62180071 >gi|62180071|ref|YP_216488.1| putative membrane transporter

  10. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MFYWILL... NC_006905 gi|62180070 >gi|62180070|ref|YP_216487.1| putative membrane transporter

  11. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003902 gi|21232942 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  12. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21242877 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  13. ORF Alignment: NC_004663 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004663 gi|29348666 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  14. ORF Alignment: NC_004578 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004578 gi|28867366 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  15. ORF Alignment: NC_005139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_005139 gi|37678876 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  16. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21241391 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  17. ORF Alignment: NC_006177 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006177 gi|51892124 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  18. ORF Alignment: NC_006349 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006349 gi|53716793 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  19. ORF Alignment: NC_006840 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006840 gi|59711756 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  20. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006370 gi|54310137 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  1. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21243399 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  2. ORF Alignment: NC_003869 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003869 gi|20807352 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  3. ORF Alignment: NC_006351 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006351 gi|53722013 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  4. ORF Alignment: NC_004459 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004459 gi|27363966 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  5. ORF Alignment: NC_006834 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006834 gi|58583632 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  6. Observations of NC stop nets for bottlenose dolphin takes

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To observe the NC stop net fishery to document the entanglement of bottlenose dolphins and movement of dolphins around the nets.

  7. ORF Sequence: NC_001139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001139 gi|6321518 >gi|6321518|ref|NP_011595.1| Protein of unknown function; deletion... mutant has synthetic fitness defect with an sgs1 deletion mutant; Slx9p [Saccharomyces cerevisiae] MVA

  8. ORF Sequence: NC_001138 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001138 gi|14318506 >gi|14318506|ref|NP_116640.1| Plasma membrane localized protein that protects membran...es from desiccation; induced by heat shock, oxidative stress, osmostress, stationar

  9. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13472223 >1fj2A 7 191 50 249 1e-07 ... emb|CAE26009.1| putative polyhydroxybutyrate... depolymerase [Rhodopseudomonas ... palustris CGA009] ref|NP_945918.1| putative ... polyhydroxybutyrate

  10. ORF Alignment: NC_006351 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006351 gi|53722803 >1jjfA 1 218 44 286 9e-11 ... ref|YP_105113.1| polyhydroxybutyrate... depolymerase domain protein [Burkholderia ... mallei ATCC 23344] gb|AAU46186.1| polyhydroxybutyrate

  11. ORF Alignment: NC_003037 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003037 gi|16263528 >1fj2A 7 191 50 249 1e-07 ... emb|CAE26009.1| putative polyhydroxybutyrate... depolymerase [Rhodopseudomonas ... palustris CGA009] ref|NP_945918.1| putative ... polyhydroxybutyrate

  12. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39933642 >1fj2A 7 191 50 249 1e-07 ... emb|CAE26009.1| putative polyhydroxybutyrate... depolymerase [Rhodopseudomonas ... palustris CGA009] ref|NP_945918.1| putative ... polyhydroxybutyrate

  13. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27376010 >1fj2A 7 191 50 249 1e-07 ... emb|CAE26009.1| putative polyhydroxybutyrate... depolymerase [Rhodopseudomonas ... palustris CGA009] ref|NP_945918.1| putative ... polyhydroxybutyrate

  14. ORF Alignment: NC_006349 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006349 gi|53716646 >1jjfA 1 218 44 286 9e-11 ... ref|YP_105113.1| polyhydroxybutyrate... depolymerase domain protein [Burkholderia ... mallei ATCC 23344] gb|AAU46186.1| polyhydroxybutyrate

  15. ORF Sequence: NC_001136 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001136 gi|6320036 >gi|6320036|ref|NP_010116.1| Component of the CCR4-NOT complex, which has multiple rol...es in regulating mRNA levels including regulation of transcription and destabilizin

  16. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available in involved in copper (silver) tolerance [Escherichia coli K12] MKKIALIIGSMIAGGIISAAGFTWVAKAEPPAEKTSTAERKILF... NC_000913 gi|16128557 >gi|16128557|ref|NP_415106.1| outer membrane transport prote

  17. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available in involved in copper (silver) tolerance [Escherichia coli K12] MSPCKLLPFCVALALTGCSLAPDYQRPAMPVPQQFSLSQNGLVN... NC_000913 gi|16128555 >gi|16128555|ref|NP_415104.1| outer membrane transport prote

  18. ORF Sequence: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004605 gi|28901366 >gi|28901366|ref|NP_801021.1| ScrC (sensory box/GGDEF family... protein) (involved in swarmer cell regulation) [Vibrio parahaemolyticus RIMD 2210633] MKKAVKKISSKKIITISAIIV

  19. ORF Sequence: NC_003281 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003281 gi|17552838 >gi|17552838|ref|NP_498286.1| dynamitin like, DyNactin Complex component DNC...-2 (37.2 kD) (dnc-2) [Caenorhabditis elegans] MSSIGKEDIYESDGAASQVQKSEPENDNPTHPDIELISVDVDEALK

  20. ORF Sequence: NC_001134 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001134 gi|6319437 >gi|6319437|ref|NP_009519.1| Component of the mitotic spindle that binds to interpol...ar microtubules via its association with beta-tubulin (Tub2p); required for interpola

  1. 77 FR 46631 - Television Broadcasting Services; Greenville, NC

    Science.gov (United States)

    2012-08-06

    ...] Television Broadcasting Services; Greenville, NC AGENCY: Federal Communications Commission. ACTION: Final... acceptance of full power television rulemaking petitions requesting channel substitutions in May 2011, it... Subjects in 47 CFR Part 73 Television. Federal Communications Commission. Barbara A. Kreisman, Chief, Video...

  2. ORF Alignment: NC_003551 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ndonuclease [Thermotoga subterranea] ... Length = 143 ... Query: 17 ... AGFFDGEGSVVVRFVRDGRYRAGYRVSTKVVFVQK... NC_003551 gi|20093993 >1t9iB 13 153 2 144 3e-22 ... emb|CAD89234.1| putative homing e

  3. ORF Alignment: NC_001147 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available r membrane transporter, exports 2-oxoadipate and ... 2-oxoglutarate from the mitochondrial matrix to ... NC_001147 gi|6324796 >1okcA 2 289 8 293 2e-45 ... ref|NP_014865.1| Mitochondrial inne

  4. ORF Alignment: NC_001148 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available r membrane transporter, exports 2-oxoadipate and ... 2-oxoglutarate from the mitochondrial matrix to ... NC_001148 gi|6325123 >1okcA 1 288 6 292 4e-39 ... ref|NP_015191.1| Mitochondrial inne

  5. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34558174 >1wcv1 4 239 4 244 2e-25 ... ref|NP_907989.1| SEPTUM SITE-DETERMINING...| SEPTUM ... SITE-DETERMINING PROTEIN MIND CELL DIVISION INHIBITOR ... MIND [Wolinella succino

  6. ORF Sequence: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15965329 >gi|15965329|ref|NP_385682.1| PROBABLE CARBAMOYL-PHOSPHATE SYNTHASE LARGE CHAIN (AMMO...NIA CHAIN ARGININE BIOSYNTHESIS) PROTEIN [Sinorhizobium meliloti 1021] MPKRQDIKSILI

  7. ORF Sequence: NC_001134 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ivery of heterogeneous nuclear ribonucleoproteins to the nucleoplasm, binds rg-nucl... NC_001134 gi|6319491 >gi|6319491|ref|NP_009573.1| Transportin, cytosolic karyopherin beta 2 involved in del

  8. ORF Sequence: NC_001139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001139 gi|6321481 >gi|6321481|ref|NP_011558.1| Zinc finger protein involved in control of meiosis; preve...nts meiosis by repressing IME1 expression and promotes mitosis by activating CLN2 e

  9. ORF Alignment: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004307 gi|23465117 >1g5aA 80 628 2 589 5e-59 ... gb|AAL05573.1| alpha-glucosidase [Bifidobacterium adolesce...ntis] ... Length = 588 ... Query: 1 ... MTANNLNDDWWKQAVVYQIYPRSFKDVNGDGLGDIAGVTEK

  10. Synthesis, thermolysis, and sensitivities of HMX/NC energetic nanocomposites.

    Science.gov (United States)

    Wang, Yi; Song, Xiaolan; Song, Dan; Liang, Li; An, Chongwei; Wang, Jingyu

    2016-07-15

    1,3,5,7-Tetranittro-1,3,5,7-tetrazocane/nitrocellulose (HMX/NC) nanocomposites were successfully synthesized by an improved sol-gel-supercritical method. NC nanoparticles with a size of ∼30nm were cross-linked to form a network structure, and HMX nanoparticles were imbedded in the nano-NC matrix. The key factors, i.e., the selection of catalyst and solvent, were probed. No phase transformation of the HMX occurred before or after fabrication, and the molecular structures of the HMX and NC did not change. Thermal analyses were performed, and the kinetic and thermodynamic parameters, such as activation energy (EK), per-exponent factor (lnAK), rate constant (k), activation heat (ΔH(≠)), activation free energy (ΔG(≠)), activation entropy (ΔS(≠)), critical temperature of thermal explosion (Tb), and critical heating rate of thermal explosion (dT/dt)Tb, were calculated. The results indicate that HMX/NC presented a much lower activation energy (165.03kJ/mol) than raw HMX (282.5kJ/mol) or raw NC (175.51kJ/mol). The chemical potential (ΔG(≠)) for the thermal decomposition of HMX/NC has a positive value, which means that the activation of the molecules would not proceed spontaneously. The significantly lower ΔH(≠) value of HMX/NC, which represents the heat needed to be absorbed by an explosive molecule to change it from its initial state to an activated state, implies that the molecules of HMX/NC are much easier to be activated than those of raw HMX. Similarly, the HMX/NC presented a much lower Tb (168.2°C) than raw HMX (283.2°C). From the results of the sensitivity tests, the impact and friction sensitivities of HMX/NC were significantly decreased compared with those of raw HMX, but the thermal sensitivity was distinctly higher. The activation of the particles under external stimulation was simulated, and the mechanism was found to be crucial. Combining the thermodynamic parameters, the mechanism as determined from the results of the sensitivity tests was

  11. Enhanced Surveillance during the Democratic National Convention, Charlotte, NC

    OpenAIRE

    Deyneka, Lana; Ising, Amy; Li, Meichun

    2013-01-01

    Objective To describe how the existing state syndromic surveillance system (NC DETECT) was enhanced to facilitate surveillance conducted at the Democratic National Convention in Charlotte, North Carolina from August 31, 2012 to September 10, 2012. Introduction North Carolina hosted the 2012 Democratic National Convention, September 3?6, 2012. The NC Epidemiology and Surveillance Team was created to facilitate enhanced surveillance for injuries and illnesses, early detection of outbreaks durin...

  12. precision deburring using NC and robot equipment. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Gillespie, L.K.

    1980-05-01

    Deburring precision miniature components is often time consuming and inconsistent. Although robots are available for deburring parts, they are not precise enough for precision miniature parts. Numerical control (NC) machining can provide edge break consistencies to meet requirements such as 76.2-..mu..m maximum edge break (chamfer). Although NC machining has a number of technical limitations which prohibits its use on many geometries, it can be an effective approach to features that are particularly difficult to deburr.

  13. Structural studies of n-type nc-Si-QD thin films for nc-Si solar cells

    Science.gov (United States)

    Das, Debajyoti; Kar, Debjit

    2017-12-01

    A wide optical gap nanocrystalline silicon (nc-Si) dielectric material is a basic requirement at the n-type window layer of nc-Si solar cells in thin film n-i-p structure on glass substrates. Taking advantage of the high atomic-H density inherent to the planar inductively coupled low-pressure (SiH4 + CH4)-plasma, development of an analogous material in P-doped nc-Si-QD/a-SiC:H network has been tried. Incorporation of C in the Si-network extracted from the CH4 widens the optical band gap; however, at enhanced PH3-dilution of the plasma spontaneous miniaturization of the nc-Si-QDs below the dimension of Bohr radius (∼4.5 nm) further enhances the band gap by virtue of the quantum size effect. At increased flow rate of PH3, dopant induced continuous amorphization of the intrinsic crystalline network is counterbalanced by the further crystallization promoted by the supplementary atomic-H extracted from PH3 (1% in H2) in the plasma, eventually holding a moderately high degree of crystallinity. The n-type wide band gap (∼1.93 eV) window layer with nc-Si-QDs in adequate volume fraction (∼52%) could furthermore be instrumental as an effective seed layer for advancing sequential crystallization in the i-layer of nc-Si solar cells with n-i-p structure in superstrate configuration.

  14. Enhanced Surveillance during the Democratic National Convention, Charlotte, NC

    Science.gov (United States)

    Deyneka, Lana; Ising, Amy; Li, Meichun

    2013-01-01

    Objective To describe how the existing state syndromic surveillance system (NC DETECT) was enhanced to facilitate surveillance conducted at the Democratic National Convention in Charlotte, North Carolina from August 31, 2012 to September 10, 2012. Introduction North Carolina hosted the 2012 Democratic National Convention, September 3–6, 2012. The NC Epidemiology and Surveillance Team was created to facilitate enhanced surveillance for injuries and illnesses, early detection of outbreaks during the DNC, assist local public health with epidemiologic investigations and response, and produce daily surveillance reports for internal and external stakeholders. Surveillane data were collected from several data sources, including North Carolina Electronic Disease Surveillance System (NC EDSS), triage stations, and the North Carolina Disease Event Tracking and Epidemiologic Collection Tool (NC DETECT). NC DETECT was created by the North Carolina Division of Public Health (NC DPH) in 2004 in collaboration with the Carolina Center for Health Informatics (CCHI) in the UNC Department of Emergency Medicine to address the need for early event detection and timely public health surveillance in North Carolina using a variety of secondary data sources. The data from emergency departments, the Carolinas Poison Center, the Pre-hospital Medical Information System (PreMIS) and selected Urgent Care Centers were available for monitoring by authorized users during the DNC. Methods Within NC DETECT, new dashboards were created that allowed epidemiologists to monitor ED visits and calls to the poison center in the Charlotte area, the greater Cities Readiness Initiative region and the entire state for infectious disease signs and symptoms, injuries and any mention of bioterrorism agents. The dashboards also included a section to view user comments on the information presented in NC DETECT. Data processing changes were also made to improve the timeliness of the EMS data received from Pre

  15. Synthesis, thermolysis, and sensitivities of HMX/NC energetic nanocomposites

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Yi, E-mail: wangyi528528@aliyun.com [School of Materials Science and Engineering, North University of China, Taiyuan 030051 (China); Song, Xiaolan, E-mail: songxiaolan00@126.com [School of Chemical Engineering and Environment, North University of China, Taiyuan 030051 (China); Song, Dan [China Ordnance Institute of Science and Technology, Beijing 100089 (China); Liang, Li; An, Chongwei; Wang, Jingyu [School of Chemical Engineering and Environment, North University of China, Taiyuan 030051 (China)

    2016-07-15

    Highlights: • A novel energetic nanocomposite (i.e., HMX/NC nanocomposites) was fabricated in which nano-HMX imbedded in nano-NC matrix. • The usage of catalysts and solvent, which dominated the fabrication, was discussed. • Thermodynamic and kinetic parameters were calculated to probe the thermal decomposition of HMX/NC. • Decomposition products were detected by DSC-IR analysis. • Friction, impact, and thermal sensitivity tests were performed and the mechanism about the results was discussed. - Abstract: 1,3,5,7-Tetranittro-1,3,5,7-tetrazocane/nitrocellulose (HMX/NC) nanocomposites were successfully synthesized by an improved sol-gel-supercritical method. NC nanoparticles with a size of ∼30 nm were cross-linked to form a network structure, and HMX nanoparticles were imbedded in the nano-NC matrix. The key factors, i.e., the selection of catalyst and solvent, were probed. No phase transformation of the HMX occurred before or after fabrication, and the molecular structures of the HMX and NC did not change. Thermal analyses were performed, and the kinetic and thermodynamic parameters, such as activation energy (E{sub K}), per-exponent factor (lnA{sub K}), rate constant (k), activation heat (ΔH{sup ≠}), activation free energy (ΔG{sup ≠}), activation entropy (ΔS{sup ≠}), critical temperature of thermal explosion (T{sub b}), and critical heating rate of thermal explosion (dT/dt){sub Tb}, were calculated. The results indicate that HMX/NC presented a much lower activation energy (165.03 kJ/mol) than raw HMX (282.5 kJ/mol) or raw NC (175.51 kJ/mol). The chemical potential (ΔG{sup ≠}) for the thermal decomposition of HMX/NC has a positive value, which means that the activation of the molecules would not proceed spontaneously. The significantly lower ΔH{sup ≠} value of HMX/NC, which represents the heat needed to be absorbed by an explosive molecule to change it from its initial state to an activated state, implies that the molecules of HMX/NC are

  16. Improving Earth Science Metadata: Modernizing ncISO

    Science.gov (United States)

    O'Brien, K.; Schweitzer, R.; Neufeld, D.; Burger, E. F.; Signell, R. P.; Arms, S. C.; Wilcox, K.

    2016-12-01

    ncISO is a package of tools developed at NOAA's National Center for Environmental Information (NCEI) that facilitates the generation of ISO 19115-2 metadata from NetCDF data sources. The tool currently exists in two iterations: a command line utility and a web-accessible service within the THREDDS Data Server (TDS). Several projects, including NOAA's Unified Access Framework (UAF), depend upon ncISO to generate the ISO-compliant metadata from their data holdings and use the resulting information to populate discovery tools such as NCEI's ESRI Geoportal and NOAA's data.noaa.gov CKAN system. In addition to generating ISO 19115-2 metadata, the tool calculates a rubric score based on how well the dataset follows the Attribute Conventions for Dataset Discovery (ACDD). The result of this rubric calculation, along with information about what has been included and what is missing is displayed in an HTML document generated by the ncISO software package. Recently ncISO has fallen behind in terms of supporting updates to conventions such updates to the ACDD. With the blessing of the original programmer, NOAA's UAF has been working to modernize the ncISO software base. In addition to upgrading ncISO to utilize version1.3 of the ACDD, we have been working with partners at Unidata and IOOS to unify the tool's code base. In essence, we are merging the command line capabilities into the same software that will now be used by the TDS service, allowing easier updates when conventions such as ACDD are updated in the future. In this presentation, we will discuss the work the UAF project has done to support updated conventions within ncISO, as well as describe how the updated tool is helping to improve metadata throughout the earth and ocean sciences.

  17. Characterization of the Neospora caninum NcROP40 and NcROP2Fam-1 rhoptry proteins during the tachyzoite lytic cycle.

    Science.gov (United States)

    Pastor-Fernández, Iván; Regidor-Cerrillo, Javier; Jiménez-Ruiz, Elena; Álvarez-García, Gema; Marugán-Hernández, Virginia; Hemphill, Andrew; Ortega-Mora, Luis M

    2016-01-01

    Virulence factors from the ROP2-family have been extensively studied in Toxoplasma gondii, but in the closely related Neospora caninum only NcROP2Fam-1 has been partially characterized to date. NcROP40 is a member of this family and was found to be more abundantly expressed in virulent isolates. Both NcROP2Fam-1 and NcROP40 were evaluated as vaccine candidates and exerted a synergistic effect in terms of protection against vertical transmission in mouse models, which suggests that they may be relevant for parasite pathogenicity. NcROP40 is localized in the rhoptry bulbs of tachyzoites and bradyzoites, but in contrast to NcROP2Fam-1, the protein does not associate with the parasitophorous vacuole membrane due to the lack of arginine-rich amphipathic helix in its sequence. Similarly to NcROP2Fam-1, NcROP40 mRNA levels are highly increased during tachyzoite egress and invasion. However, NcROP40 up-regulation does not appear to be linked to the mechanisms triggering egress. In contrast to NcROP2Fam-1, phosphorylation of NcROP40 was not observed during egress. Besides, NcROP40 secretion into the host cell was not successfully detected by immunofluorescence techniques. These findings indicate that NcROP40 and NcROP2Fam-1 carry out different functions, and highlight the need to elucidate the role of NcROP40 within the lytic cycle and to explain its relative abundance in tachyzoites.

  18. An overview on STEP-NC compliant controller development

    Science.gov (United States)

    Othman, M. A.; Minhat, M.; Jamaludin, Z.

    2017-10-01

    The capabilities of conventional Computer Numerical Control (CNC) machine tools as termination organiser to fabricate high-quality parts promptly, economically and precisely are undeniable. To date, most CNCs follow the programming standard of ISO 6983, also called G & M code. However, in fluctuating shop floor environment, flexibility and interoperability of current CNC system to react dynamically and adaptively are believed still limited. This outdated programming language does not explicitly relate to each other to have control of arbitrary locations other than the motion of the block-by-block. To address this limitation, new standard known as STEP-NC was developed in late 1990s and is formalized as an ISO 14649. It adds intelligence to the CNC in term of interoperability, flexibility, adaptability and openness. This paper presents an overview of the research work that have been done in developing a STEP-NC controller standard and the capabilities of STEP-NC to overcome modern manufacturing demands. Reviews stated that most existing STEP-NC controller prototypes are based on type 1 and type 2 implementation levels. There are still lack of effort being done to develop type 3 and type 4 STEP-NC compliant controller.

  19. Comparison of mechanical behavior of TiN, TiNC, CrN/TiNC, TiN/TiNC films on 9Cr18 steel by PVD

    Science.gov (United States)

    Feng, Xingguo; Zhang, Yanshuai; Hu, Hanjun; Zheng, Yugang; Zhang, Kaifeng; Zhou, Hui

    2017-11-01

    TiN, TiNC, CrN/TiNC and TiN/TiNC films were deposited on 9Cr18 steel using magnetron sputtering technique. The morphology, composition, chemical state and crystalline structure of the films were observed and analyzed by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) and scanning electron microscopy (SEM). Hardness and adhesion force were tested by nanoindentation and scratch tester, respectively. The friction and wear behavior of TiN, TiNC, CrN/TiNC and TiN/TiNC films sliding against GCr15 balls were investigated and compared synthetically using ball-on-disk tribometer. It was found that Tisbnd N, Tisbnd C, Tisbnd Nsbnd C and Csbnd C bonds were formed. The TiN/TiNC film was composed of TiN, TiC and TiNC phases. Hardness and adhesion force results indicated that although the TiN film possessed the highest hardness, its adhesion force was lowest among all the films. Tribological test results showed that the friction coefficient of TiN/TiNC was much lower than that of TiN and the wear rate decreases remarkably from 2.3 × 10-15 m3/Nm to 7.1 × 10-16 m3/Nm, which indicated the TiN/TiNC film has better wear resistance.

  20. Evaluating Application of Innovative Technologies to the Operation of a Wastewater Treatment Plant

    National Research Council Canada - National Science Library

    Eick, John

    1999-01-01

    An Advanced Wastewater Treatment Plant (AWTP) was installed at Camp Lejeune, NC, that incorporated tertiary treatment processes designed to protect the nutrient-sensitive nature of the receiving stream, the New River...

  1. ORF Alignment: NC_004757 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004757 gi|30250333 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  2. ORF Alignment: NC_002488 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002488 gi|15837680 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  3. ORF Alignment: NC_006369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006369 gi|54293610 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  4. ORF Alignment: NC_006085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006085 gi|50842381 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  5. ORF Alignment: NC_002946 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002946 gi|59800726 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  6. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003919 gi|21242823 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  7. ORF Alignment: NC_003112 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003112 gi|15676600 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  8. ORF Alignment: NC_002977 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002977 gi|53803220 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  9. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003902 gi|21231567 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  10. ORF Alignment: NC_004551 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004551 gi|28572541 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  11. ORF Alignment: NC_004572 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004572 gi|28493349 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  12. ORF Alignment: NC_003869 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003869 gi|20807422 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  13. ORF Alignment: NC_003116 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003116 gi|15793872 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  14. ORF Alignment: NC_006368 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006368 gi|54296649 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  15. ORF Alignment: NC_004556 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004556 gi|28198275 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  16. ORF Alignment: NC_002942 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002942 gi|52840863 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  17. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50085709 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  18. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005085 gi|34495926 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  19. ORF Alignment: NC_002516 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002516 gi|15598180 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  20. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006513 gi|56478742 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  1. ORF Alignment: NC_006834 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006834 gi|58581923 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  2. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002947 gi|26990072 >1uzbA 37 513 3 472 6e-68 ... ref|NP_745497.1| vanillin dehydro...genase [Pseudomonas putida KT2440] gb|AAN68961.1| ... vanillin dehydrogenase [Pseudomonas putida KT24

  3. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27381528 >1uzbA 40 515 6 475 3e-74 ... ref|NP_773057.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC51682.1| vanillin: NAD oxidoreductase ...

  4. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27377799 >1uzbA 40 515 5 474 3e-69 ... ref|NP_769328.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC47953.1| vanillin: NAD oxidoreductase ...

  5. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16126641 >1uzbA 58 515 12 462 8e-77 ... ref|NP_421205.1| vanillin dehydr...ogenase [Caulobacter crescentus CB15] gb|AAK24373.1| ... vanillin dehydrogenase [Caulobacter crescent...us CB15] ... pir||A87547 vanillin dehydrogenase [imported] - ... Caulobacter crescentus ...

  6. ORF Alignment: NC_005955 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005955 gi|49474347 >1k0iA 1 388 1 408 7e-30 ... ref|YP_032389.1| Salicylate hydrox...ylase [Bartonella quintana str. Toulouse] ... emb|CAF26245.1| Salicylate hydroxylase [Bartonella ...

  7. ORF Alignment: NC_005956 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005956 gi|49475734 >1k0iA 6 384 6 406 2e-28 ... ref|YP_033775.1| Salicylate hydrox...ylase [Bartonella henselae str. Houston-1] ... emb|CAF27777.1| Salicylate hydroxylase [Bartonella ...

  8. ORF Alignment: NC_006142 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006142 gi|51473766 >1xvqA 17 163 40 196 7e-07 ... ref|YP_067523.1| Sco2-like prote...in [Rickettsia typhi str. Wilmington] gb|AAU04041.1| ... Sco2-like protein [Rickettsia typhi str. Wil

  9. ORF Alignment: NC_000963 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000963 gi|15604438 >1xvqA 17 163 47 203 4e-07 ... ref|NP_220956.1| SCO2 PROTEIN PRECURSOR (sco2...) [Rickettsia prowazekii str. Madrid E] ... emb|CAA15032.1| SCO2 PROTEIN PRECURSOR (sco2...) ... [Rickettsia prowazekii] pir||F71663 sco2 protein ... precursor (sco2) RP587 - Rickettsia

  10. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17546835 >1f86A 3 109 4 113 5e-28 ... emb|CAD15823.1| PUTATIVE TRANSTHYR...ETIN-LIKE PROTEIN PRECURSOR [Ralstonia ... solanacearum] ref|NP_520237.1| PUTATIVE ... TRANSTH...YRETIN-LIKE PROTEIN PRECURSOR [Ralstonia ... solanacearum GMI1000] sp|Q8XXJ7|YL16_RALSO Hypothetical ... transth

  11. ORF Alignment: NC_003030 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003030 gi|15895740 >1w3oA 13 174 5 153 2e-30 ... ref|NP_349089.1| Possible 5-Nitroimidazole antibiotics... ... gb|AAK80429.1| Possible 5-Nitroimidazole antibiotics ... resistance protein, NimA-family [Clost...ridium ... acetobutylicum ATCC 824] pir||B97205 probable ... 5-Nitroimidazole antibiotics

  12. ORF Alignment: NC_002607 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002607 gi|15790649 >1b22A 10 70 5 63 2e-10 ... pdb|1XU4|A Chain A, Atpase In Compl...ex With Amp-Pnp, Magnesium And Potassium ... Co-F pdb|1T4G|A Chain A, Atpase In Complex With Amp-Pnp ...

  13. ORF Alignment: NC_003551 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003551 gi|20094872 >1b22A 10 70 5 63 2e-10 ... pdb|1XU4|A Chain A, Atpase In Compl...ex With Amp-Pnp, Magnesium And Potassium ... Co-F pdb|1T4G|A Chain A, Atpase In Complex With Amp-Pnp

  14. ORF Alignment: NC_000918 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000918 gi|15606868 >1tg6E 33 200 25 196 8e-08 ... ref|NP_214248.1| nodulation competitiveness... protein NfeD [Aquifex aeolicus VF5] ... gb|AAC07639.1| nodulation competitiveness protein... NfeD ... [Aquifex aeolicus VF5] pir||H70456 nodulation ... competitiveness protein NfeD - Aqu

  15. ORF Alignment: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003070 gi|42572131 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin

  16. ORF Alignment: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003070 gi|42563264 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin

  17. ORF Alignment: NC_005835 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available he Bacterial Chromosome Segregation Protein ... Soj pdb|1WCV|1 Chain 1, Structure Of The Bacterial ... Chromosome Segre...gation Protein Soj ... Length = 243 ... Query: 5 ... KVRRIALANQKGGVGKTTTAINLAAYLA... NC_005835 gi|46199907 >1wcv1 1 243 5 247 3e-93 ... pdb|2BEJ|A Chain A, Structure Of T

  18. ORF Alignment: NC_006361 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006361 gi|54027007 >1amuA 4 512 1501 2031 9e-92 ... ref|YP_083722.1| nonribosomal ...peptide synthetase [Bacillus cereus ZK] gb|AAU18126.1| ... nonribosomal peptide synthetase [Bacillus... cereus ZK] ... Length = 531 ... Query: 8405 ERDLVLRAWNTPGVEVPEVTMVDLXXXXXXXXXXXXXXXFGDTALSFGEMQRRANRIAR

  19. ORF Alignment: NC_006366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006366 gi|54292957 >2bjvA 9 226 34 249 5e-52 ... gb|AAC36805.1| HrpS [Pantoea stewartii subsp. stewart...ii] pir||S36185 wtsA protein ... - Erwinia stewartii sp|P36219|WTSA_ERWST Pathoge

  20. ORF Alignment: NC_006369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006369 gi|54295748 >2bjvA 9 226 34 249 5e-52 ... gb|AAC36805.1| HrpS [Pantoea stewartii subsp. stewart...ii] pir||S36185 wtsA protein ... - Erwinia stewartii sp|P36219|WTSA_ERWST Pathoge

  1. ORF Alignment: NC_000854 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000854 gi|14601919 >1n62B 44 802 1 748 0.0 ... ref|NP_148464.1| nicotine dehydroge...nase chain C [Aeropyrum pernix K1] ... dbj|BAA81228.1| 750aa long hypothetical nicotine ... de...hydrogenase chain C [Aeropyrum pernix K1] pir||D72530 ... probable nicotine dehydrogenase chain C APE

  2. ORF Alignment: NC_000854 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000854 gi|14601920 >1n62C 1 286 1 287 2e-71 ... ref|NP_148465.1| nicotine dehydrog...enase chain A [Aeropyrum pernix K1] ... dbj|BAA81231.1| 292aa long hypothetical nicotine ... d...ehydrogenase chain A [Aeropyrum pernix K1] pir||G72530 ... probable nicotine dehydrogenase chain A AP

  3. ORF Alignment: NC_003106 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003106 gi|15922820 >1n62B 24 793 4 684 e-115 ... ref|NP_378489.1| hypothetical nicotine... dehydrogenase subunit C [Sulfolobus tokodaii ... str. 7] dbj|BAB67598.1| 685aa long hypothetical nicotine

  4. ORF Alignment: NC_006509 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006509 gi|56410456 >1n62C 1 286 1 287 4e-70 ... ref|YP_145830.1| nicotine dehydrog...enase chain A [Geobacillus kaustophilus HTA426] ... dbj|BAD74262.1| nicotine dehydrogenase chain A ...

  5. ORF Alignment: NC_006510 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006510 gi|56419966 >1ofdA 1 1500 22 1473 0.0 ... ref|YP_147284.1| glutamate synthasel...arge subunit [Geobacillus kaustophilus HTA426] ... dbj|BAD75716.1| glutamate synthaselarge subuni

  6. ORF Alignment: NC_006510 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006510 gi|56421196 >1q6zA 7 522 41 566 e-133 ... ref|YP_148514.1| acetolactate synthasel...arge subunit [Geobacillus kaustophilus ... HTA426] dbj|BAD76946.1| acetolactate synthaselarge ...

  7. ORF Alignment: NC_006510 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006510 gi|56418908 >1q6zA 2 522 9 531 e-114 ... ref|YP_146226.1| acetolactate synthasel...arge subunit [Geobacillus kaustophilus ... HTA426] dbj|BAD74658.1| acetolactate synthaselarge ...

  8. ORF Alignment: NC_001140 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available es cerevisiae] sp|P38699|STB5_YEAST STB5 protein ... gb|AAB68023.1| Stb5p: SIN3 binding protein ... ... NC_001140 gi|6321972 >1pyiA 4 86 21 101 4e-06 ... ref|NP_012048.1| Stb5p [Saccharomyc

  9. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13475930 >1el5A 6 379 7 420 7e-42 ... ref|NP_107500.1| AgaE protein, conversion of agropini...c acid to mannopinic acid ... [Mesorhizobium loti MAFF303099] dbj|BAB53286.1| AgaE

  10. ORF Alignment: NC_002679 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002679 gi|13488188 >1el5A 4 377 26 437 3e-36 ... ref|NP_085608.1| agaE(conversion of agropini...c acid to mannopinic acid) ... [Mesorhizobium loti MAFF303099] dbj|BAB54449.1| AgaE ...

  11. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13475854 >1el5A 4 378 18 430 4e-33 ... ref|NP_107424.1| agaE protein, conversion of agropini...c acid to mannopinic acid ... [Mesorhizobium loti MAFF303099] dbj|BAB53210.1| Aga

  12. ORF Alignment: NC_003551 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003551 gi|20094874 >1fdr0 4 243 2 220 3e-16 ... ref|NP_421197.1| vanillate O-demet...hylase, reductase subunit [Caulobacter crescentus ... CB15] gb|AAK24365.1| vanillate O-demethylase, r...eductase ... subunit [Caulobacter crescentus CB15] pir||A87546 ... vanillate O-demethylase, re

  13. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27377501 >1rfs0 15 126 14 141 2e-05 ... ref|NP_769030.1| vanillate O-dem...ethylase oxygenase subunit [Bradyrhizobium japonicum ... USDA 110] dbj|BAC47655.1| vanillate O-demeth

  14. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002947 gi|26990443 >1rfs0 13 126 12 126 3e-05 ... gb|AAN69332.1| vanillate demethy...lase A [Pseudomonas putida KT2440] ... ref|NP_745868.1| vanillate demethylase A [Pseudomonas ...

  15. ORF Alignment: NC_002516 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002516 gi|15600098 >2pia0 10 321 3 317 6e-83 ... ref|NP_253592.1| vanillate O-deme...thylase oxidoreductase [Pseudomonas aeruginosa ... PAO1] gb|AAG08290.1| vanillate O-demethylase ... ... ... oxidoreductase [Pseudomonas aeruginosa PAO1] pir||G83033 ... vanillate O-demethylase oxidoreduc

  16. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003919 gi|21241137 >1vm9A 1 108 12 123 1e-14 ... gb|AAM35255.1| vanillate O-demeth...ylase oxygenase subunit [Xanthomonas axonopodis ... pv. citri str. 306] ref|NP_640719.1| vanillate ...

  17. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50083706 >1vm9A 2 98 30 133 5e-15 ... ref|YP_045216.1| putative vanillat...e O-demethylase oxygenase subunit [Acinetobacter ... sp. ADP1] emb|CAG67394.1| putative vanillate ...

  18. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50084192 >1vm9A 2 106 26 138 2e-15 ... ref|YP_045702.1| putative vanilla...te O-demethylase oxygenase subunit (VanA-like) ... [Acinetobacter sp. ADP1] emb|CAG67880.1| putative ... vanilla

  19. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50084184 >1vm9A 1 102 6 110 3e-17 ... ref|YP_045694.1| vanillate O-demet...hylase oxygenase subunit ... (4-hydroxy-3-methoxybenzoate demethylase) [Acinetobacter ... sp. ADP1] emb|CAG67872.1| van...illate O-demethylase ... oxygenase subunit (4-hydroxy-3-methoxybenzoate ...

  20. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003919 gi|21241085 >1vm9A 2 101 26 130 1e-13 ... gb|AAM35203.1| vanillate O-demeth...ylase oxygenase subunit [Xanthomonas axonopodis ... pv. citri str. 306] ref|NP_640667.1| vanillate ...

  1. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16126632 >1rfs0 13 126 17 131 3e-05 ... ref|NP_421196.1| vanillate O-dem...ethylase oxygenase, subunit A [Caulobacter ... crescentus CB15] gb|AAK24364.1| vanillate O-demethylas...e ... oxygenase, subunit A [Caulobacter crescentus CB15] ... pir||H87545 vanillate O-demethyla

  2. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936681 >1rfs0 15 126 14 141 2e-05 ... ref|NP_769030.1| vanillate O-dem...ethylase oxygenase subunit [Bradyrhizobium japonicum ... USDA 110] dbj|BAC47655.1| vanillate O-demeth

  3. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003902 gi|21229841 >1vm9A 1 108 12 123 3e-14 ... ref|NP_635758.1| vanillate O-deme...thylase oxygenase subunit [Xanthomonas campestris ... pv. campestris str. ATCC 33913] gb|AAM39682.1| vanilla

  4. ORF Alignment: NC_002516 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002516 gi|15600097 >1vm9A 1 108 6 116 4e-20 ... ref|NP_253591.1| vanillate O-demet...hylase oxygenase subunit [Pseudomonas aeruginosa ... PAO1] gb|AAG08289.1| vanillate O-demethylase oxy...genase ... subunit [Pseudomonas aeruginosa PAO1] pir||F83033 ... vanillate O-demethylase oxyge

  5. ORF Alignment: NC_004578 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004578 gi|28870083 >1vm9A 1 108 6 116 3e-17 ... ref|NP_792702.1| vanillate O-demet...hylase, oxygenase subunit [Pseudomonas syringae ... pv. tomato str. DC3000] gb|AAO56397.1| vanillate

  6. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003902 gi|21229775 >1vm9A 2 101 26 130 7e-13 ... ref|NP_635692.1| vanillate O-deme...thylase oxygenase subunit [Xanthomonas campestris ... pv. campestris str. ATCC 33913] gb|AAM39616.1| vanilla

  7. ORF Alignment: NC_006526 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006526 gi|56551352 >1czpA 7 89 20 102 3e-08 ... gb|AAV89080.1| vanillate O-demethy...lase oxidoreductase [Zymomonas mobilis subsp. ... mobilis ZM4] ref|YP_162191.1| vanillate O-demethyla

  8. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62180177 >1s7fA 1 176 1 176 3e-74 ... ref|YP_216594.1| acetyl transferase, modifies... ... enterica serovar Choleraesuis str. SC-B67] ... gb|AAX65513.1| acetyl transferase, modifies

  9. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available s; ... ATP-dependent adenylate transferase, modifies MoaD ... [Escherichia coli K12] dbj|BAA35...nylate transferase, modifies MoaD [Escherichia ... coli K12] gb|AAC73913.1| molybdopterin biosynthesi... NC_000913 gi|16128794 >1jw9B 1 247 2 248 9e-96 ... ref|NP_415347.1| ATP-dependent ade

  10. ORF Alignment: NC_004722 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004722 gi|30019013 >1t5bA 1 183 1 166 4e-19 ... ref|NP_830644.1| Modulator of drug... activity B [Bacillus cereus ATCC 14579] ... gb|AAP07845.1| Modulator of drug activity B [Bacillus ...

  11. ORF Alignment: NC_005791 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005791 gi|45359051 >1vpbA 3 420 7 430 1e-73 ... ref|NP_988608.1| Modulator of DNA ...gyrase [Methanococcus maripaludis S2] ... emb|CAF31044.1| Modulator of DNA gyrase [Methanococcus ...

  12. ORF Alignment: NC_005791 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005791 gi|45359088 >1vpbA 2 433 1 416 2e-52 ... ref|NP_988645.1| Modulator of DNA ...gyrase [Methanococcus maripaludis S2] ... emb|CAF31081.1| Modulator of DNA gyrase [Methanococcus ...

  13. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34557929 >1kmoA 12 661 39 664 3e-52 ... ref|NP_907744.1| RECEPTOR PRECURSOR-Most...ly Fe transport [Wolinella succinogenes DSM ... 1740] emb|CAE10644.1| RECEPTOR PRECURSOR-Most

  14. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26250902 >2tpsA 22 224 5 224 1e-09 ... ref|NP_756942.1| D-allulose-6-pho...sphate 3-epimerase [Escherichia coli CFT073] ... gb|AAN83516.1| D-allulose-6-phosphate 3-epimerase ...

  15. ORF Alignment: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15966596 >1c8kA 12 814 20 819 0.0 ... emb|CAC47422.1| PROBABLE GLYCOGEN ...PHOSPHORYLASE PROTEIN [Sinorhizobium meliloti] ... ref|NP_386949.1| PROBABLE GLYCOGEN PHOSPHORYLASE P

  16. ORF Alignment: NC_003296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003296 gi|17548463 >1rzuB 1 478 3 482 1e-72 ... ref|NP_521803.1| PROBABLE GLYCOGEN... SYNTHASE PROTEIN [Ralstonia solanacearum GMI1000] ... emb|CAD17393.1| PROBABLE GLYCOGEN SYNTHASE PRO

  17. ORF Alignment: NC_003296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003296 gi|17548459 >1g5aA 110 625 187 666 2e-15 ... ref|NP_521799.1| PROBABLE GLYCOGEN... OPERON PROTEIN GLGX [Ralstonia solanacearum ... GMI1000] emb|CAD17389.1| PROBABLE GLYCOGEN OPERO

  18. ORF Alignment: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31792524 >1c8kA 43 797 82 763 e-107 ... ref|NP_855017.1| PROBABLE GLYCOGEN... PHOSPHORYLASE GLGP [Mycobacterium bovis ... AF2122/97] emb|CAD94224.1| PROBABLE GLYCOGEN ...

  19. ORF Alignment: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15966599 >1rzuB 1 478 1 479 e-145 ... emb|CAC47425.1| PROBABLE GLYCOGEN ...SYNTHASE (STARCH [BACTERIAL GLYCOGEN] SYNTHASE) ... PROTEIN [Sinorhizobium meliloti] ref|NP_386952.1| ... PROBABLE GLYC...OGEN SYNTHASE (STARCH [BACTERIAL GLYCOGEN] ... SYNTHASE) PROTEIN [Sinorhizob

  20. ORF Alignment: NC_003450 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003450 gi|19552527 >1c8kA 22 818 15 790 0.0 ... ref|YP_225593.1| PUTATIVE GLYCOGEN... ... [Corynebacterium glutamicum ATCC 13032] emb|CAF20007.1| ... PUTATIVE GLYCOGEN PHOSPHORYLASE [C

  1. ORF Alignment: NC_002755 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002755 gi|15840783 >1c8kA 43 797 82 763 e-107 ... ref|NP_215844.1| PROBABLE GLYCOGEN...ase - ... Mycobacterium tuberculosis (strain H37RV) ... emb|CAA98092.1| PROBABLE GLYCOGEN PHOS

  2. ORF Alignment: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000962 gi|15608468 >1c8kA 43 797 82 763 e-107 ... ref|NP_215844.1| PROBABLE GLYCOGEN...ase - ... Mycobacterium tuberculosis (strain H37RV) ... emb|CAA98092.1| PROBABLE GLYCOGEN PHOS

  3. ORF Alignment: NC_005823 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005823 gi|45656251 >1v04A 13 339 27 348 2e-65 ... ref|YP_000337.1| paraoxonase [Le...ptospira interrogans serovar Copenhageni str. ... Fiocruz L1-130] gb|AAS68974.1| paraoxonase [Leptosp

  4. ORF Alignment: NC_004342 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004342 gi|24213099 >1v04A 13 339 27 348 5e-66 ... ref|NP_710580.1| paraoxonase 3-l...ike protein [Leptospira interrogans serovar Lai str. ... 56601] gb|AAN47598.1| paraoxonase 3-like pro

  5. ORF Alignment: NC_003283 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003283 gi|17561408 >1bor0 2 53 282 342 3e-04 ... ref|NP_757385.1| synoviolin 1 iso...form b [Homo sapiens] gb|AAH30530.1| Synoviolin 1, ... isoform b [Homo sapiens] ... Length = 61

  6. ORF Alignment: NC_000117 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000117 gi|15605324 >1jgmA 39 326 7 260 4e-33 ... ref|NP_220110.1| PHP superfamily hydrolase [Chlamydia trachomatis D/UW-3/CX] ... gb|AAC68196.1| PHP... ... trachomatis D/UW-3/CX] pir||G71494 probable php ... hydrolase - Chlamydia trachomatis (sero

  7. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62180303 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i

  8. ORF Alignment: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003280 gi|25149956 >1tx4A 1 170 679 853 1e-24 ... gb|AAN38752.1| axon identity spe...form b ... [Caenorhabditis elegans] ref|NP_495592.2| SYnapse ... Defective SYD-1, axon identity

  9. ORF Alignment: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003280 gi|25149956 >1qauA 5 99 56 151 2e-04 ... gb|AAN38752.1| axon identity speci...rm b ... [Caenorhabditis elegans] ref|NP_495592.2| SYnapse ... Defective SYD-1, axon identity

  10. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005085 gi|34495619 >1t06A 1 193 1 205 2e-24 ... gb|AAQ57843.1| DNA alkylation repa...ir enzyme [Chromobacterium violaceum ATCC 12472] ... ref|NP_899834.1| DNA alkylation repair enzyme ...

  11. ORF Alignment: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004307 gi|23466169 >1u94A 19 326 67 387 5e-28 ... ref|NP_696772.1| alkylation dama...ge repair protein [Bifidobacterium longum NCC2705] ... gb|AAN25408.1| alkylation damage repair protei

  12. ORF Alignment: NC_006087 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006087 gi|50955643 >1u94A 24 325 68 337 3e-32 ... ref|YP_062931.1| alkylation dama...ge DNA repair protein [Leifsonia xyli subsp. xyli ... str. CTCB07] gb|AAT89826.1| alkylation damage D

  13. ORF Alignment: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32477023 >1t06A 1 191 9 220 1e-24 ... ref|NP_870017.1| probable DNA alkylation... repair enzyme [Rhodopirellula baltica SH 1] ... emb|CAD79170.1| probable DNA alkylation repair

  14. ORF Alignment: NC_004350 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004350 gi|24378587 >1t06A 1 191 11 210 3e-32 ... gb|AAN57848.1| DNA alkylation rep...air enzyme [Streptococcus mutans UA159] ... ref|NP_720542.1| DNA alkylation repair enzyme ...

  15. ORF Alignment: NC_006576 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006576 gi|56751418 >1kgsA 3 222 4 231 2e-39 ... ref|YP_172119.1| two-component response regulator for energ... ... PCC 6301] dbj|BAD79599.1| two-component response ... regulator for energy transfer from ph

  16. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002939 gi|39997794 >1atg0 2 225 27 256 3e-20 ... ref|NP_953745.1| tungstate ABC tr...ansporter, periplasmic tungstate-binding protein, ... putative [Geobacter sulfurreducens PCA] gb|AAR36072.1| ... tung...state ABC transporter, periplasmic tungstate-binding ... protein, putative [Ge

  17. ORF Alignment: NC_003037 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available n with ... localized conservation [Sinorhizobium meliloti 1021] ... pir||B95312 hypothetical p...rvation [Sinorhizobium ... meliloti 1021] gb|AAK65060.1| hypothetical protei... NC_003037 gi|16262858 >1i0rB 4 152 13 156 2e-27 ... ref|NP_435648.1| hypothetical protein with localized conse

  18. ORF Alignment: NC_003037 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available n with ... localized conservation [Sinorhizobium meliloti 1021] ... pir||B95312 hypothetical p...rvation [Sinorhizobium ... meliloti 1021] gb|AAK65060.1| hypothetical protei... NC_003037 gi|16262855 >1i0rB 4 152 13 156 2e-27 ... ref|NP_435648.1| hypothetical protein with localized conse

  19. ORF Sequence: NC_001146 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available inal member of the mitochondrial inner membrane electron transport chain; predominantly express...ed during aerobic growth while its isoform Vb (Cox5Bp) is expressed during anaerobic growth; Cox5ap ... NC_001146 gi|6324276 >gi|6324276|ref|NP_014346.1| Subunit Va of cytochrome c oxidase, which is the term

  20. ORF Sequence: NC_001141 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available inal member of the mitochondrial inner membrane electron transport chain; predominantly express...ed during anaerobic growth while its isoform Va (Cox5Ap) is expressed during aerobic growth; Cox5bp ... NC_001141 gi|6322080 >gi|6322080|ref|NP_012155.1| Subunit Vb of cytochrome c oxidase, which is the term

  1. ORF Alignment: NC_000909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000909 gi|15669589 >1vhtA 3 200 2 186 2e-14 ... ref|NP_248402.1| alignment in /usr/local/projects...408.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ARG_R584_orf2.nr ... [Me

  2. ORF Alignment: NC_005791 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005791 gi|45359158 >1q7hA 13 141 446 567 8e-09 ... ref|NP_248016.1| alignment in /usr/local/projects...B99026.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ARG_R428_orf1.nr ...

  3. ORF Alignment: NC_000909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000909 gi|15669211 >1q7hA 13 141 446 567 8e-09 ... ref|NP_248016.1| alignment in /usr/local/projects...B99026.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ARG_R428_orf1.nr ...

  4. ORF Alignment: NC_006840 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006840 gi|59712585 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

  5. ORF Alignment: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004605 gi|28900550 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

  6. ORF Alignment: NC_002929 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002929 gi|33592330 >1uynX 1 299 352 647 5e-40 ... ref|NP_879974.1| tracheal colonization... factor precursor [Bordetella pertussis Tohama ... I] emb|CAA08832.2| tracheal colonization fac...tor ... [Bordetella pertussis] emb|CAE41497.1| tracheal ... colonization factor precursor [Bor

  7. ORF Alignment: NC_004722 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004722 gi|30021261 >1y9wA 2 118 130 246 1e-04 ... ref|NP_834326.1| Zwittermicin A ...resistance protein zmaR [Bacillus cereus ATCC 14579] ... gb|AAP11527.1| Zwittermicin A resistance pro

  8. ORF Alignment: NC_007530 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_007530 gi|47528487 >1y9wA 2 118 130 246 1e-04 ... ref|NP_834326.1| Zwittermicin A ...resistance protein zmaR [Bacillus cereus ATCC 14579] ... gb|AAP11527.1| Zwittermicin A resistance pro

  9. ORF Alignment: NC_004722 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004722 gi|30022695 >1y9wA 2 118 130 246 1e-04 ... ref|NP_834326.1| Zwittermicin A ...resistance protein zmaR [Bacillus cereus ATCC 14579] ... gb|AAP11527.1| Zwittermicin A resistance pro

  10. ORF Alignment: NC_003909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003909 gi|42782260 >1y9wA 2 118 130 246 1e-04 ... ref|NP_834326.1| Zwittermicin A ...resistance protein zmaR [Bacillus cereus ATCC 14579] ... gb|AAP11527.1| Zwittermicin A resistance pro

  11. ORF Alignment: NC_003997 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003997 gi|30263128 >1y9wA 2 118 130 246 1e-04 ... ref|NP_834326.1| Zwittermicin A ...resistance protein zmaR [Bacillus cereus ATCC 14579] ... gb|AAP11527.1| Zwittermicin A resistance pro

  12. ORF Alignment: NC_003909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003909 gi|42781970 >1y9wA 2 118 130 246 1e-04 ... ref|NP_834326.1| Zwittermicin A ...resistance protein zmaR [Bacillus cereus ATCC 14579] ... gb|AAP11527.1| Zwittermicin A resistance pro

  13. ORF Alignment: NC_003995 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003995 gi|21401081 >1y9wA 2 118 130 246 1e-04 ... ref|NP_834326.1| Zwittermicin A ...resistance protein zmaR [Bacillus cereus ATCC 14579] ... gb|AAP11527.1| Zwittermicin A resistance pro

  14. ORF Alignment: NC_005957 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005957 gi|49479519 >1y9wA 2 118 130 246 1e-04 ... ref|NP_834326.1| Zwittermicin A ...resistance protein zmaR [Bacillus cereus ATCC 14579] ... gb|AAP11527.1| Zwittermicin A resistance pro

  15. ORF Alignment: NC_006274 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006274 gi|52142345 >1y9wA 2 118 130 246 1e-04 ... ref|NP_834326.1| Zwittermicin A ...resistance protein zmaR [Bacillus cereus ATCC 14579] ... gb|AAP11527.1| Zwittermicin A resistance pro

  16. ORF Alignment: NC_005945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005945 gi|49185975 >1y9wA 2 118 130 246 1e-04 ... ref|NP_834326.1| Zwittermicin A ...resistance protein zmaR [Bacillus cereus ATCC 14579] ... gb|AAP11527.1| Zwittermicin A resistance pro

  17. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003155 gi|29831905 >1bt3A 46 334 1 287 4e-31 ... dbj|BAC73074.1| putative tyrosinase... [Streptomyces avermitilis MA-4680] ... dbj|BAB69182.1| putative tyrosinase [Streptomyces ... ... ... avermitilis] ref|NP_826539.1| putative tyrosinase ... [Streptomyces avermitilis MA-4680] ...

  18. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003155 gi|29827678 >1bt3A 46 336 1 274 3e-43 ... dbj|BAC68847.1| putative tyrosinase... [Streptomyces avermitilis MA-4680] ... dbj|BAB69175.1| tyrosinase [Streptomyces avermitilis] ... ... ... ref|NP_822312.1| putative tyrosinase [Streptomyces ... avermitilis MA-4680] ... Length =

  19. ORF Alignment: NC_003911 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003911 gi|56696289 >1bt3A 48 336 4 309 2e-36 ... gb|AAV94692.1| tyrosinase domain ...protein [Silicibacter pomeroyi DSS-3] ... ref|YP_166646.1| tyrosinase domain protein [Silicibacter ...

  20. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003888 gi|21221155 >1bt3A 46 334 1 287 4e-31 ... dbj|BAC73074.1| putative tyrosinase... [Streptomyces avermitilis MA-4680] ... dbj|BAB69182.1| putative tyrosinase [Streptomyces ... ... ... avermitilis] ref|NP_826539.1| putative tyrosinase ... [Streptomyces avermitilis MA-4680] ...

  1. ORF Alignment: NC_006085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006085 gi|50842772 >1qr0A 1 205 2 202 3e-27 ... ref|YP_055999.1| biosurfactants pr...oduction protein [Propionibacterium acnes ... KPA171202] gb|AAT83041.1| biosurfactants production ...

  2. ORF Alignment: NC_003282 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003282 gi|17540144 >1n0rA 2 124 89 212 5e-26 ... gb|AAA96093.1| Feminization of xx and xo animals... ... homolog a, FEMinization of XX and XO animals FEM-1 ... (fem-1) [Caenorhabditis elegans] pir||

  3. ORF Alignment: NC_004369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004369 gi|25027294 >1on3E 2 519 12 542 e-148 ... ref|NP_737348.1| detergent sensit...ivity rescuer DtsR [Corynebacterium efficiens ... YS-314] dbj|BAC17548.1| detergent sensitivity rescu

  4. ORF Alignment: NC_004369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004369 gi|25027293 >1on3E 8 519 12 536 e-154 ... ref|NP_737347.1| detergent sensit...ivity rescuer DtsR homolog [Corynebacterium ... efficiens YS-314] dbj|BAC17547.1| detergent sensitivi

  5. ORF Alignment: NC_005810 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005810 gi|45443303 >1v74B 1 87 1 87 6e-27 ... emb|CAA71434.1| Colicin D-157 immunity protein [Escheric...LNECLSSIFCLADLYN 61 ... + ++++AK F+ ... +++A ... F+ ... E ... +ER + ... +KD + ... + ... C ... +F ... A+ + ... Sbjct: 4 ... MAMIDLAKLFLASKITAIEFS----ERICVERRRLYGVKDLSPNILNCGEELFMAAERFE 59 ...

  6. ORF Alignment: NC_006155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006155 gi|51597427 >1v74B 1 87 1 87 6e-27 ... emb|CAA71434.1| Colicin D-157 immunity protein [Escheric...LSECLSSIFCLADLYN 61 ... + ++++AK F+ ... +++A ... F+ ... E ... +ER + ... +KD + ... + ... C ... +F ... A+ + ... Sbjct: 4 ... MAMIDLAKLFLASKITAIEFS----ERICVERRRLYGVKDLSPNILNCGEELFMAAERFE 59 ...

  7. ORF Alignment: NC_004556 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004556 gi|28198631 >1agjA 29 228 1 200 3e-25 ... pir||A56338 venom proteinase (EC 3.4.21.-) - Americ...an common bumblebee ... Length = 200 ... Query: 609 WLDVLTLSVLRQGKESPEWQ-------EHEALTERIC

  8. ORF Alignment: NC_003143 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003143 gi|16121178 >1v74B 1 87 1 87 6e-27 ... emb|CAA71434.1| Colicin D-157 immunity protein [Escheric...LNECLSSIFCLADLYN 61 ... + ++++AK F+ ... +++A ... F+ ... E ... +ER + ... +KD + ... + ... C ... +F ... A+ + ... Sbjct: 4 ... MAMIDLAKLFLASKITAIEFS----ERICVERRRLYGVKDLSPNILNCGEELFMAAERFE 59 ...

  9. ORF Alignment: NC_001139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001139 gi|6321679 >3pfk0 2 307 206 549 2e-83 ... ref|NP_011756.1| Alpha subunit of heterooctameric...EGLLRGGKYLKKMAWEDVRG 60 ... Query: 326 VDELVAEGRFTKEEVAPYKNLSIVGLVGSIDNDMSGTDSTIGAYSALERIC...EMVDYIDAT 385 ... VDELVAEGRFTKEEVAPYKNLSIVGLVGSIDNDMSGTDSTIGAYSALERICEMVDYIDAT Sbjct: 121 VDELV...AEGRFTKEEVAPYKNLSIVGLVGSIDNDMSGTDSTIGAYSALERICEMVDYIDAT 180 ... Query: 446 RRNNTIIVAEGALDDQLNPVTANDVKDALIELGLDT

  10. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62180869 >gi|62180869|ref|YP_217286.1| putative DegT/DnrJ/EryC1/StrS family [Salmonella enteri...ca subsp. enterica serovar Choleraesuis str. SC-B67] MSDFLPFSRPAMGAEELAAVKTVLDSGWIT...SGGRAPQAEVLAPGYKYNLPDLNAAIALAQLQKLDALNARRAAIAAQYHQAMADLPFQPLSLPSWEHIHAWHLFIIRVDEARCGITRDALMASLKTKGIGTGLHFRAAHTQKYYRERFPTLTLPDTEWNSERICSLPLFPDMTESDFDRVITALHQIAGQ

  11. ORF Alignment: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18309122 >1qhhB 31 259 333 567 1e-16 ... gb|AAQ19135.1| putative UvrD/REP helicase [Escheric...NNGSLEFITGDFSEITNKILELKNQG--YENK--------DILILAATERICK 485 ... + ... L ... G ... E ... + ... ++ ... E + ... E +

  12. ORF Alignment: NC_003923 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003923 gi|21283614 >2sak0 1 121 43 163 1e-41 ... dbj|BAB95750.1| STAPHYLOKINASE PRECURSOR [Stap...hylococcus aureus subsp. aureus MW2] ... ref|NP_646702.1| STAPHYLOKINASE PRECURSOR ... [Stap...hylococcus aureus subsp. aureus MW2] ... sp|Q8NVR2|SAK_STAAW Staphylokinase precursor ...

  13. ORF Alignment: NC_002952 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002952 gi|49483221 >1pwgA 4 329 74 373 1e-38 ... ref|YP_040445.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG40034.1| autolysis

  14. ORF Alignment: NC_004461 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004461 gi|27467672 >1pwgA 4 344 72 389 1e-36 ... ref|NP_764309.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... epidermidis ATCC 12228] gb|AAO04351.1| autolysis

  15. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26247437 >1j9iA 1 68 1 68 7e-21 ... ref|NP_753477.1| Prophage Qin DNA packaging... protein NU1 homolog [Escherichia coli ... CFT073] gb|AAN80037.1| Prophage Qin DNA packaging ... ...teriophage ... 21] pir||A49849 DNA-packaging protein Nu1 - phage 21 ...

  16. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62179784 >1j9iA 1 68 1 68 5e-21 ... ref|YP_216201.1| Gifsy-1 prophage DNA packaging... ... gb|AAX65120.1| Gifsy-1 prophage DNA packaging protein ... [Phage Gifsy-1] ... Length = 68 ... Q

  17. ORF Alignment: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005363 gi|42524871 >1tjlA 27 144 16 133 6e-10 ... ref|NP_970251.1| dnaK deletion s...uppressor protein [Bdellovibrio bacteriovorus HD100] ... emb|CAE78310.1| dnaK deletion suppressor pro

  18. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27380945 >1tjlA 26 141 1 116 7e-32 ... ref|NP_772474.1| dnaK deletion su...ppressor protein [Bradyrhizobium japonicum USDA ... 110] dbj|BAC51099.1| dnaK deletion suppressor pro

  19. ORF Alignment: NC_003317 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_003317 gi|17988031 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...

  20. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_002696 gi|16127809 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...

  1. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16124962 >1mgtA 4 167 79 239 2e-25 ... ref|NP_419526.1| ada regulatory protein, internal deletion... [Caulobacter crescentus ... CB15] gb|AAK22694.1| ada regulatory protein, internal ... deletio...n [Caulobacter crescentus CB15] pir||B87337 ada ... regulatory protein, internal deletion

  2. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16124962 >1adn0 1 76 1 75 1e-17 ... ref|NP_419526.1| ada regulatory protein, internal deletion... [Caulobacter crescentus ... CB15] gb|AAK22694.1| ada regulatory protein, internal ... deletion... [Caulobacter crescentus CB15] pir||B87337 ada ... regulatory protein, internal deletion

  3. ORF Alignment: NC_002689 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002689 gi|13541621 >1e1hD 9 166 248 399 1e-33 ... emb|CAA43999.1| botulinum neurotoxin... type E [Clostridium botulinum] ... sp|Q00496|BXE_CLOBO Botulinum neurotoxin type E ... pr

  4. ORF Alignment: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003070 gi|18407028 >1n1bB 40 536 280 782 5e-81 ... gb|AAL24105.1| putative S-linalool... ... [Arabidopsis thaliana] gb|AAN71959.1| putative ... S-linalool synthase [Arabidopsis thaliana

  5. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50084737 >1jfbA 14 398 24 409 2e-72 ... ref|YP_046247.1| linalool 8-mono...oxygenase (Cytochrome P450 111) (Cytochrome P450lin) ... [Acinetobacter sp. ADP1] emb|CAG68425.1| linalool

  6. Stepping Motor - Hydraulic Motor Servo Drives for an NC Milling ...

    African Journals Online (AJOL)

    In this paper the retrofit design of the control system of an NC milling machine with a stepping motor and stepping motor - actuated hydraulic motor servo mechanism on the machines X-axis is described. The servo designed in the course of this study was tested practically and shown to be linear - the velocity following errors ...

  7. ORF Alignment: NC_002936 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002936 gi|57234191 >1e0gA 2 45 443 490 1e-04 ... ref|YP_181785.1| endolysin, putat...ive [Dehalococcoides ethenogenes 195] ... gb|AAW39696.1| endolysin, putative [Dehalococcoides ...

  8. ORF Alignment: NC_003071 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003071 gi|18398317 >1e0gA 4 45 339 382 4e-05 ... ref|NP_814147.1| endolysin, putat...ive [Enterococcus faecalis V583] gb|AAO80218.1| ... endolysin, putative [Enterococcus faecalis V583

  9. ORF Alignment: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15801268 >1xjuA 9 154 30 175 1e-24 ... gb|AAG55897.1| putative endolysin... of prophage CP-933N [Escherichia coli O157:H7 ... EDL933] pir||E85679 probable endolysin of prophage..._287285.1| putative ... endolysin of prophage CP-933N [Escherichia coli O1

  10. ORF Alignment: NC_004668 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004668 gi|29376513 >1e0gA 4 45 319 362 2e-04 ... ref|NP_815667.1| endolysin [Enter...ococcus faecalis V583] gb|AAO81737.1| endolysin ... [Enterococcus faecalis V583] ... Length = 4

  11. ORF Alignment: NC_004668 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004668 gi|29374994 >1e0gA 4 45 339 382 4e-05 ... ref|NP_814147.1| endolysin, putat...ive [Enterococcus faecalis V583] gb|AAO80218.1| ... endolysin, putative [Enterococcus faecalis V583

  12. ORF Alignment: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|15834216 >1swyA 6 155 29 161 2e-20 ... dbj|BAB38385.1| putative endolysin... [Escherichia coli O157:H7] ref|NP_312989.1| ... putative endolysin [Escherichia coli O157:H7] ... ... ... pir||B91249 probable endolysin [imported] - Escherichia ... coli (strain O157:H7, substrain RIM

  13. ORF Alignment: NC_004668 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004668 gi|29377273 >1e0gA 3 45 338 382 3e-05 ... ref|NP_816427.1| endolysin [Enter...ococcus faecalis V583] gb|AAO82497.1| endolysin ... [Enterococcus faecalis V583] ... Length = 4

  14. ORF Sequence: NC_001145 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ions in rot1 cause cell wall defects, suppress tor2 mutations, and are synthetically lethal with rot2 mutati... NC_001145 gi|6323856 >gi|6323856|ref|NP_013927.1| Protein that may be involved in cell wall function; mutat...ons; Rot1p [Saccharomyces cerevisiae] MWSKKFTLKKLILGGYLFAQKVYCEDESNSIYGTWSSKSNQVFTG

  15. ORF Alignment: NC_001142 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001142 gi|6322362 >1na3A 1 86 6 91 2e-23 ... pdb|1NA0|B Chain B, Design Of Stable ...Alpha-Helical Arrays From An Idealized ... Tpr Motif pdb|1NA0|A Chain A, Design Of Stable ...

  16. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002939 gi|39996556 >1na3A 1 86 6 91 6e-23 ... pdb|1NA3|B Chain B, Design Of Stable... Alpha-Helical Arrays From An Idealized ... Tpr Motif pdb|1NA3|A Chain A, Design Of Stable ... A

  17. ORF Alignment: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|15829492 >1hxiA 10 111 3 104 8e-17 ... pdb|1NA0|B Chain B, Design Of Sta...ble Alpha-Helical Arrays From An Idealized ... Tpr Motif pdb|1NA0|A Chain A, Design Of Stable ...

  18. ORF Alignment: NC_006156 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006156 gi|51598497 >1na3A 1 86 6 91 6e-23 ... pdb|1NA3|B Chain B, Design Of Stable... Alpha-Helical Arrays From An Idealized ... Tpr Motif pdb|1NA3|A Chain A, Design Of Stable ...

  19. ORF Alignment: NC_006833 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006833 gi|58584782 >1na3A 1 86 6 91 6e-23 ... pdb|1NA3|B Chain B, Design Of Stable... Alpha-Helical Arrays From An Idealized ... Tpr Motif pdb|1NA3|A Chain A, Design Of Stable ... A

  20. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50085213 >1na0A 1 119 7 125 3e-30 ... pdb|1NA0|B Chain B, Design Of Stab...le Alpha-Helical Arrays From An Idealized ... Tpr Motif pdb|1NA0|A Chain A, Design Of Stable ...

  1. ORF Alignment: NC_000919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000919 gi|15639412 >1na3A 1 86 6 91 6e-23 ... pdb|1NA3|B Chain B, Design Of Stable... Alpha-Helical Arrays From An Idealized ... Tpr Motif pdb|1NA3|A Chain A, Design Of Stable ...

  2. ORF Alignment: NC_001318 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001318 gi|15594581 >1na3A 1 86 6 91 6e-23 ... pdb|1NA3|B Chain B, Design Of Stable... Alpha-Helical Arrays From An Idealized ... Tpr Motif pdb|1NA3|A Chain A, Design Of Stable ...

  3. ORF Alignment: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15799918 >1hxiA 10 111 3 104 8e-17 ... pdb|1NA0|B Chain B, Design Of Sta...ble Alpha-Helical Arrays From An Idealized ... Tpr Motif pdb|1NA0|A Chain A, Design Of Stable ...

  4. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26249530 >1hxiA 10 111 3 104 8e-17 ... pdb|1NA0|B Chain B, Design Of Sta...ble Alpha-Helical Arrays From An Idealized ... Tpr Motif pdb|1NA0|A Chain A, Design Of Stable ...

  5. ORF Alignment: NC_003103 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003103 gi|15892341 >1na3A 1 86 6 91 2e-23 ... pdb|1NA0|B Chain B, Design Of Stable... Alpha-Helical Arrays From An Idealized ... Tpr Motif pdb|1NA0|A Chain A, Design Of Stable ...

  6. ORF Sequence: NC_001134 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001134 gi|6319554 >gi|6319554|ref|NP_009636.1| ATPase required for the release of Sec17p during the 'pri...ming' step in homotypic vacuole fusion and for ER to Golgi transport; homolog of th

  7. ORF Alignment: NC_006055 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006055 gi|50364899 >1e0jA 7 282 163 444 6e-57 ... ref|YP_053324.1| DNA replication priming... helicase [Mesoplasma florum L1] ... gb|AAT75440.1| DNA replication priming helicase ...

  8. ORF Alignment: NC_004337 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004337 gi|24111904 >1bl0A 6 107 149 249 7e-08 ... ref|NP_415098.1| envelope protein; thermoregulation...ion of porin biosynthesis; transcriptional ... activator of envelope proteins, thermoregulation... of porin biosynthesis ... [Escherichia coli K12] gb|AAC73667.1| envelope protein; ... thermoregulat

  9. ORF Alignment: NC_004741 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004741 gi|30062018 >1bl0A 6 107 149 249 7e-08 ... ref|NP_415098.1| envelope protein; thermoregulation...ion of porin biosynthesis; transcriptional ... activator of envelope proteins, thermoregulation... of porin biosynthesis ... [Escherichia coli K12] gb|AAC73667.1| envelope protein; ... thermoregulat

  10. ORF Alignment: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|15829852 >1bl0A 6 107 149 249 7e-08 ... ref|NP_415098.1| envelope protein; thermoregulation...ion of porin biosynthesis; transcriptional ... activator of envelope proteins, thermoregulation... of porin biosynthesis ... [Escherichia coli K12] gb|AAC73667.1| envelope protein; ... thermoregulat

  11. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16128549 >1bl0A 6 107 149 249 7e-08 ... ref|NP_415098.1| envelope protein; thermoregulation...ion of porin biosynthesis; transcriptional ... activator of envelope proteins, thermoregulation... of porin biosynthesis ... [Escherichia coli K12] gb|AAC73667.1| envelope protein; ... thermoregulat

  12. ORF Alignment: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15800273 >1bl0A 6 107 149 249 7e-08 ... ref|NP_415098.1| envelope protein; thermoregulation...ion of porin biosynthesis; transcriptional ... activator of envelope proteins, thermoregulation... of porin biosynthesis ... [Escherichia coli K12] gb|AAC73667.1| envelope protein; ... thermoregulat

  13. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50086621 >1nz0D 14 109 22 118 7e-12 ... ref|YP_048131.1| RNase P, protein C5 component, processes... ... protein C5 component, processes tRNA, 4.5S RNA ... [Acinetobacter sp. ADP1] sp|Q6F6K8|RNPA_ACIAD

  14. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62180380 >1vk0A 18 203 2 166 1e-28 ... ref|YP_216797.1| RNase D, processes... ... gb|AAX65716.1| RNase D, processes tRNA precursor ... [Salmonella enterica subsp. enterica serovar

  15. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50085406 >1vk0A 40 206 33 185 2e-14 ... ref|YP_046916.1| ribonuclease D, processes... tRNA [Acinetobacter sp. ADP1] ... emb|CAG69094.1| ribonuclease D, processes tRNA ...

  16. ORF Alignment: NC_006087 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006087 gi|50955146 >1rq2B 19 306 17 304 7e-96 ... ref|YP_062434.1| cell divison pr...otein [Leifsonia xyli subsp. xyli str. CTCB07] ... gb|AAT89329.1| cell divison protein [Leifsonia xyl

  17. ORF Alignment: NC_006841 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006841 gi|59713627 >1vf7E 3 251 113 339 1e-21 ... ref|YP_206402.1| copper/silver r...esistance periplasmic protein [Vibrio fischeri ... ES114] gb|AAW87514.1| copper/silver resistance ...

  18. ORF Alignment: NC_003296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003296 gi|17549147 >1ek9A 2 398 35 411 9e-11 ... ref|YP_145666.1| outer membrane silver...otein ... [Ralstonia metallidurans CH34] emb|CAI11315.1| outer ... membrane silver efflux prot

  19. ORF Alignment: NC_006841 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006841 gi|59713626 >1ek9A 1 381 30 404 2e-06 ... ref|YP_206401.1| copper/silver re...sistance outer membrane protein [Vibrio fischeri ... ES114] gb|AAW87513.1| copper/silver resistance o

  20. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62181104 >1fpoA 1 171 1 171 2e-41 ... ref|YP_217521.1| co-chaperone protein Hsc20, believe...ica ... serovar Choleraesuis str. SC-B67] gb|AAX66440.1| ... co-chaperone protein Hsc20, believe

  1. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50084580 >1su0B 5 135 3 119 1e-30 ... ref|YP_046090.1| iron-binding protein believe... ... emb|CAG68268.1| iron-binding protein believed to be ... involved in Fe-S protein formation or repa

  2. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available sp. ... ADP1] emb|CAG68267.1| iron-binding protein , putative ... regulator believed to be invol...n , putative regulator believed to be involved ... in Fe-S protein formation or repair [Acinetobacter ... NC_005966 gi|50084579 >1r94A 3 96 2 95 8e-27 ... ref|YP_046089.1| iron-binding protei

  3. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50084578 >1fpoA 1 167 1 158 3e-23 ... ref|YP_046088.1| co-chaperone protein (Hsc20), believe... ... emb|CAG68266.1| co-chaperone protein (Hsc20), believed ... to be involved in assembly of Fe-S cl

  4. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936538 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  5. ORF Alignment: NC_005810 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005810 gi|45441793 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

  6. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39935198 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

  7. ORF Alignment: NC_002940 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002940 gi|33151562 >1u07A 8 84 201 279 1e-08 ... gb|AAP95304.1| TobB energy transd...ucing protein [Haemophilus ducreyi 35000HP] ... ref|NP_872915.1| TobB energy transducing protein ...

  8. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13473528 >1u07A 4 89 172 254 2e-09 ... ref|NP_105096.1| energy transduce...r TonB [Mesorhizobium loti MAFF303099] ... dbj|BAB50882.1| energy transducer; TonB [Mesorhizobium ...

  9. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27379019 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  10. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13471241 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris ... CGA009] ref|NP_948814.1| possible energy transducer ...

  11. ORF Alignment: NC_003143 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003143 gi|16122423 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

  12. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002939 gi|39996799 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

  13. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002939 gi|39995137 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  14. ORF Alignment: NC_004578 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004578 gi|28871348 >1dlwA 1 114 25 138 3e-25 ... ref|NP_793967.1| protozoan/cyanob...acterial globin family protein [Pseudomonas ... syringae pv. tomato str. DC3000] gb|AAO57662.1| ... protozoa

  15. ORF Alignment: NC_002977 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002977 gi|53804116 >1dlwA 19 113 26 120 5e-13 ... gb|AAU92168.1| protozoan/cyanoba...cterial globin family protein [Methylococcus ... capsulatus str. Bath] ref|YP_114018.1| ... protozoa

  16. ORF Alignment: NC_003911 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003911 gi|56696447 >1dlwA 19 115 21 125 4e-12 ... gb|AAV94850.1| protozoan/cyanoba...cterial globin family protein [Silicibacter ... pomeroyi DSS-3] ref|YP_166804.1| ... protozoan

  17. ORF Alignment: NC_006348 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006348 gi|53725407 >1dlwA 1 115 25 145 1e-19 ... ref|YP_103467.1| protozoan/cyanob...acterial globin family protein [Burkholderia mallei ... ATCC 23344] gb|AAU49423.1| protozoan/cyanobac

  18. ORF Alignment: NC_006350 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006350 gi|53718816 >1dlwA 1 115 25 145 1e-19 ... ref|YP_103467.1| protozoan/cyanob...acterial globin family protein [Burkholderia mallei ... ATCC 23344] gb|AAU49423.1| protozoan/cyanobac

  19. ORF Alignment: NC_002952 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002952 gi|49483165 >1dlwA 19 115 21 120 3e-19 ... ref|YP_040389.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG39975.1| ... protozoa

  20. ORF Alignment: NC_002976 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002976 gi|57866545 >1dlwA 19 115 47 146 6e-19 ... ref|YP_188173.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... epidermidis RP62A] gb|AAW53991.1| ... protozoa

  1. ORF Alignment: NC_002951 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002951 gi|57650195 >1dlwA 19 115 21 120 3e-19 ... ref|YP_185875.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... aureus subsp. aureus COL] gb|AAW36475.1| ... protozoa

  2. ORF Alignment: NC_000963 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000963 gi|15604553 >1n0qB 4 92 10 98 2e-14 ... ref|NP_221071.1| ANKYRIN, BRAIN VAR...IANT 2 (ank2) [Rickettsia prowazekii str. ... Madrid E] emb|CAA15147.1| ANKYRIN, BRAIN VARIANT 2 ...

  3. Large-Nc quantum chromodynamics and harmonic sums

    Indian Academy of Sciences (India)

    2012-06-08

    Jun 8, 2012 ... Abstract. In the large-Nc limit of QCD, two-point functions of local operators become harmonic sums. I review some properties which follow from this fact and which are relevant for phenomeno- logical applications. This has led us to consider a class of analytic number theory functions as toy models of ...

  4. ORF Alignment: NC_003028 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003028 gi|15900440 >1jbeA 9 123 8 119 2e-18 ... pdb|1KRX|A Chain A, Solution Structure Of Beryllofluoride... ... Site Contacts pdb|1KRW|A Chain A, Solution Structure And ... Backbone Dynamics Of Beryllofluoride...rage ... Structure Of Beryllofluoride-Activated Ntrc Receiver ... Domain: Model Structure Inco

  5. ORF Alignment: NC_003098 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003098 gi|15902507 >1jbeA 9 123 8 119 2e-18 ... pdb|1KRX|A Chain A, Solution Structure Of Beryllofluoride... ... Site Contacts pdb|1KRW|A Chain A, Solution Structure And ... Backbone Dynamics Of Beryllofluoride...rage ... Structure Of Beryllofluoride-Activated Ntrc Receiver ... Domain: Model Structure Inco

  6. ORF Alignment: NC_000963 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000963 gi|15604233 >1uf5A 4 265 215 450 3e-21 ... ref|NP_220749.1| APOLIPOPROTEIN N-ACYLTRANSFERASE (lnt... ... N-ACYLTRANSFERASE (lnt) [Rickettsia prowazekii] ... pir||G71693 apolipoprotein n-acyltransferase (lnt...) RP366 ... - Rickettsia prowazekii sp|Q9ZDG3|LNT_RICPR ...

  7. ORF Alignment: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31792055 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  8. ORF Alignment: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31793631 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  9. ORF Alignment: NC_002755 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002755 gi|15841974 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  10. ORF Alignment: NC_002755 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002755 gi|15840280 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  11. ORF Alignment: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000962 gi|15609587 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  12. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003155 gi|29830077 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  13. ORF Alignment: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000962 gi|15608007 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  14. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003888 gi|21220505 >1chkA 2 236 70 304 9e-83 ... ref|NP_626284.1| putative chitosan...ase (putative secreted protein) [Streptomyces ... coelicolor A3(2)] emb|CAB52859.1| putative chitosan...ase ... (putative secreted protein) [Streptomyces coelicolor ... A3(2)] pir||T34867 probable chitosan

  15. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003888 gi|21219207 >1chkA 2 236 45 279 3e-87 ... ref|NP_624986.1| secreted chitosan...ase [Streptomyces coelicolor A3(2)] ... emb|CAB61194.1| secreted chitosanase [Streptomyces ...

  16. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003155 gi|29828557 >1chkA 1 236 35 270 4e-95 ... dbj|BAC69726.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_823191.1| putative chitosanase [Streptomyces ...

  17. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003155 gi|29832733 >1chkA 1 236 48 283 9e-87 ... dbj|BAC73902.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_827367.1| putative chitosanase [Streptomyces ...

  18. ORF Alignment: NC_006274 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006274 gi|52142820 >1kwfA 3 362 53 435 5e-85 ... ref|YP_084010.1| chitosanase; gly...cosyl hydrolases family 8; endoglucanase [Bacillus ... cereus ZK] gb|AAU17839.1| chitosanase; glycosy

  19. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005085 gi|34499386 >1qgiA 1 259 102 360 4e-95 ... gb|AAQ61593.1| probable chitosan...ase A [Chromobacterium violaceum ATCC 12472] ... ref|NP_903601.1| probable chitosanase A [Chromobacte

  20. ORF Alignment: NC_006512 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006512 gi|56460843 >1vkpA 13 372 9 346 3e-73 ... ref|YP_156124.1| Peptidyl-arginine... deiminase related enzyme [Idiomarina loihiensis ... L2TR] gb|AAV82575.1| Peptidyl-arginine deiminas

  1. ORF Alignment: NC_003912 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003912 gi|57237777 >1vkpA 13 370 6 323 3e-87 ... ref|YP_179025.1| peptidyl-arginine... deiminase family protein [Campylobacter jejuni ... RM1221] gb|AAW35360.1| peptidyl-arginine deimina

  2. ORF Alignment: NC_003911 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003911 gi|56697815 >1vkpA 1 369 4 337 5e-75 ... gb|AAV96218.1| porphyromonas-type peptidyl-arginine... ... porphyromonas-type peptidyl-arginine deiminase family ... protein [Silicibacter pomeroyi DSS-3] ...

  3. ORF Alignment: NC_006369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006369 gi|54295805 >1xvqA 17 164 3 161 4e-27 ... ref|YP_096958.1| peroxynitrite re...28220.1| ... alkyl hydroperoxide reductase [Legionella pneumophila ... str. Lens] gb|AAU29011.1| peroxynitrite...bsp. ... pneumophila str. Philadelphia 1] gb|AAM00601.1| ... peroxynitrite reductase [Legionel

  4. ORF Alignment: NC_006368 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006368 gi|54298970 >1xvqA 17 164 3 161 4e-27 ... ref|YP_096958.1| peroxynitrite re...28220.1| ... alkyl hydroperoxide reductase [Legionella pneumophila ... str. Lens] gb|AAU29011.1| peroxynitrite...bsp. ... pneumophila str. Philadelphia 1] gb|AAM00601.1| ... peroxynitrite reductase [Legionel

  5. ORF Alignment: NC_002942 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002942 gi|52843159 >1xvqA 17 164 3 161 4e-27 ... ref|YP_096958.1| peroxynitrite re...28220.1| ... alkyl hydroperoxide reductase [Legionella pneumophila ... str. Lens] gb|AAU29011.1| peroxynitrite...bsp. ... pneumophila str. Philadelphia 1] gb|AAM00601.1| ... peroxynitrite reductase [Legionel

  6. ORF Alignment: NC_004565 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004565 gi|28373188 >1epwA 1 1289 2 1313 0.0 ... ref|NP_783831.1| tetanus toxin tet...X [Clostridium tetani] emb|CAA28033.1| tetanus toxin ... precursor (AA 1-1315) [Clostridium tetani] ... ... emb|CAA29564.1| unnamed protein product [Clostridium ... tetani] gb|AAO37454.1| tetanus

  7. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39937869 >1gxeA 9 128 1 106 4e-48 ... gb|AAW68944.1| anti-tetanus toxoid... immunoglobulin light chain variable region ... [Homo sapiens] gb|AAW68902.1| anti-tetanus toxoid ...

  8. ORF Sequence: NC_001139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001139 gi|50593217 >gi|50593217|ref|NP_011747.2| Subunit of the prohibitin complex (Phb1p-Phb2p...sized proteins; determinant of replicative life span; involved in mitochondrial segregation; Phb2p [Saccharo

  9. ORF Alignment: NC_006511 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006511 gi|56413338 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i

  10. 77 FR 33997 - Television Broadcasting Services; Greenville, NC

    Science.gov (United States)

    2012-06-08

    ...] Television Broadcasting Services; Greenville, NC AGENCY: Federal Communications Commission. ACTION: Proposed... freeze on the acceptance of rulemaking petitions by full power television stations requesting channel... filed by full power television stations seeking to relocate from channel 51 pursuant to a voluntary...

  11. ORF Alignment: NC_003413 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003413 gi|18977962 >1ktgA 3 131 38 166 2e-11 ... ref|NP_579319.1| mutt putative [P...yrococcus furiosus DSM 3638] gb|AAL81714.1| mutt ... putative [Pyrococcus furiosus DSM 3638] ...

  12. ORF Alignment: NC_005791 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005791 gi|45358156 >1wcv1 4 241 4 235 5e-21 ... ref|NP_987713.1| walker type ATPas...e [Methanococcus maripaludis S2] emb|CAF30149.1| ... walker type ATPase [Methanococcus maripaludis S2

  13. ORF Alignment: NC_006348 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006348 gi|53724326 >1g8eA 1 97 1 98 8e-23 ... ref|YP_109907.1| flagellar regulon master...|CAH37324.1| flagellar regulon master regulator ... subunit FlhD [Burkholderia pseudomallei K96243] ...

  14. ORF Alignment: NC_006350 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006350 gi|53720921 >1g8eA 1 97 1 98 8e-23 ... ref|YP_109907.1| flagellar regulon master...|CAH37324.1| flagellar regulon master regulator ... subunit FlhD [Burkholderia pseudomallei K96243] ...

  15. ORF Alignment: NC_001137 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ograde regulon which ... consists of genes whose expression is stimulated by... NC_001137 gi|6320764 >1wvfA 13 508 29 496 1e-67 ... ref|NP_010843.1| D-lactate dehydrogenase, part of the retr

  16. ORF Sequence: NC_001136 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001136 gi|6320230 >gi|6320230|ref|NP_010310.1| Component of the GARP (Golgi-associated retrograde... protein) complex, Vps51p-Vps52p-Vps53p-Vps54p, which is required for retrograde transport

  17. ORF Sequence: NC_001141 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001141 gi|6322114 >gi|6322114|ref|NP_012189.1| Part of a heptameric protein complex that regulates retro...grade Golgi-to-ER protein traffic in eukaryotic cells; coatomer forms the COP I ves

  18. ORF Alignment: NC_006274 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006274 gi|52142162 >1gpuA 4 663 4 663 0.0 ... ref|YP_084669.1| transketolase (glycoal...dehyde transferase) [Bacillus cereus ZK] ... gb|AAU17181.1| transketolase (glycoaldehyde transfera

  19. ORF Alignment: NC_003071 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003071 gi|42569531 >1wd2A 1 58 290 342 7e-13 ... gb|AAD32294.1| similar to Ariadne... protein from Drosophila [Arabidopsis thaliana] ... emb|CAD52893.1| ARIADNE-like protein ARI11 [Arabi...dopsis ... thaliana] pir||A84725 similar to Ariadne protein from ... Drosophila [imported] - A

  20. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1| ... acyl-CoA dehydrogenase, ferrulic acid biotransformation ... protein, putative [Pseudomo...ransformation protein, ... putative [Pseudomonas putida KT2440] gb|AAN68958.... NC_002947 gi|26990069 >1u8vA 9 432 4 458 7e-34 ... ref|NP_745494.1| acyl-CoA dehydrogenase, ferrulic acid biot

  1. ORF Alignment: NC_004461 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004461 gi|27467238 >1kolA 35 391 30 342 2e-04 ... ref|NP_763875.1| xylitol dehydro...genase [Staphylococcus epidermidis ATCC 12228] ... gb|AAO03917.1| xylitol dehydrogenase [Staphylococc

  2. ORF Alignment: NC_002745 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002745 gi|15925959 >1kolA 35 389 28 338 2e-04 ... dbj|BAB56418.1| similar to xylitol... ... SA0246 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370780.1| similar to xylitol

  3. ORF Alignment: NC_002758 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002758 gi|15923242 >1n8kA 34 374 26 339 4e-06 ... dbj|BAB56414.1| similar to xylitol... ... SA0242 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370776.1| similar to xylitol

  4. ORF Alignment: NC_002758 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002758 gi|15923246 >1kolA 35 389 28 338 2e-04 ... dbj|BAB56418.1| similar to xylitol... ... SA0246 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370780.1| similar to xylitol

  5. ORF Alignment: NC_006351 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006351 gi|53722258 >1kolA 2 388 1 341 4e-33 ... ref|YP_111243.1| putative zinc-binding xylitol... ... zinc-binding xylitol/sorbitol dehydrogenase ... [Burkholderia pseudomallei K96243] ... .../sorbitol dehydrogenase [Burkholderia ... pseudomallei K96243] emb|CAH38702.1| putative ...

  6. ORF Alignment: NC_002745 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002745 gi|15925955 >1n8kA 34 374 26 339 4e-06 ... dbj|BAB56414.1| similar to xylitol... ... SA0242 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370776.1| similar to xylitol

  7. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003155 gi|29828632 >1w1oA 22 489 11 408 6e-19 ... dbj|BAC69801.1| putative xylitol... oxidase [Streptomyces avermitilis MA-4680] ... ref|NP_823266.1| putative xylitol oxidase [Streptomyc

  8. ORF Alignment: NC_006677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006677 gi|58039331 >1hxhA 1 247 2 262 8e-39 ... pir||JC7939 xylitol dehydrogenase ...(EC 1.1.1.-) - Gluconobacter oxydans (Strain ... ATCC621) dbj|BAC16227.1| xylitol dehydrogenase ...

  9. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13474107 >1n8kA 9 365 1 332 2e-32 ... ref|NP_105675.1| xylitol (sorbitol...e ... (Xylitol dehydrogenase) (XDH) dbj|BAB51461.1| xylitol ... (sorbitol) dehydrogenase [Meso

  10. ORF Alignment: NC_000963 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000963 gi|15604602 >1mwmA 4 314 14 327 1e-47 ... ref|NP_221120.1| ROD SHAPE-DETERMINING... PROTEIN MREB (mreB) [Rickettsia prowazekii ... str. Madrid E] emb|CAA15196.1| ROD SHAPE-DETERMINING

  11. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34557359 >1mwmA 3 314 11 322 5e-28 ... ref|NP_907174.1| PUTATIVE ROD SHAPE-DETERMINING... PROTEIN (FRAGMENT) [Wolinella ... succinogenes DSM 1740] emb|CAE10074.1| PUTATIVE ROD ... SHAPE-DETERMIN...ING PROTEIN (FRAGMENT) [Wolinella ... succinogenes] ... Length = 312 ...

  12. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34556511 >1mwmA 3 314 14 327 1e-46 ... ref|NP_906326.1| PUTATIVE ROD SHAPE-DETERMINING... PROTEIN [Wolinella succinogenes DSM ... 1740] emb|CAE09226.1| PUTATIVE ROD SHAPE-DETERMINING

  13. ORF Alignment: NC_000921 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000921 gi|15612352 >1mwmA 3 314 14 329 4e-45 ... ref|NP_224005.1| ROD SHAPE-DETERMINING... PROTEIN [Helicobacter pylori J99] ... gb|AAD06861.1| ROD SHAPE-DETERMINING PROTEIN ... [

  14. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17544778 >1mwmA 4 314 14 329 3e-49 ... emb|CAD13587.1| PROBABLE ROD SHAPE-DETERMINING... PROTEIN [Ralstonia solanacearum] ... ref|NP_518180.1| PROBABLE ROD SHAPE-DETERMINING PR

  15. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17548082 >1wcv1 2 241 2 249 7e-27 ... emb|CAD16862.1| PROBABLE SEPTUM SITE-DETERMINING... PROTEIN MIND [Ralstonia ... solanacearum] ref|NP_521484.1| PROBABLE SEPTUM ... SITE-DETERMINING

  16. ORF Alignment: NC_000921 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000921 gi|15611661 >1vdkA 1 460 2 461 e-141 ... ref|NP_223312.1| ASPARTATE AMMONIA...-LYASE [Helicobacter pylori J99] gb|AAD06167.1| ... ASPARTATE AMMONIA-LYASE [Helicobacter pylori J99

  17. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17547375 >1v4aA 29 433 25 452 2e-95 ... emb|CAD16363.1| PROBABLE GLUTAMATE-AMMONIA... ... [Ralstonia solanacearum] ref|NP_520777.1| PROBABLE ... GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERAS

  18. ORF Alignment: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15964777 >1v4aA 24 435 49 467 e-101 ... emb|CAC45596.1| PUTATIVE GLUTAMATE-AMMONIA...-LIGASE ADENYLYLTRANSFERASE PROTEIN ... [Sinorhizobium meliloti] ref|NP_385130.1| PUTATIVE ... GLUTAMATE-AMMO...NIA-LIGASE ADENYLYLTRANSFERASE PROTEIN ... [Sinorhizobium meliloti 1021] sp|

  19. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34557077 >1vdkA 1 459 5 463 e-135 ... ref|NP_906892.1| ASPARTATE AMMONIA...-LYASE [Wolinella succinogenes DSM 1740] ... emb|CAE09792.1| ASPARTATE AMMONIA-LYASE [Wolinella ...

  20. ORF Alignment: NC_003318 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003318 gi|17988713 >1gkpA 3 425 8 405 2e-19 ... ref|NP_541346.1| IMIDAZOLONEPROPIONASE / HISTIDINE AMMONIA...-LYASE [Brucella ... melitensis 16M] gb|AAL53610.1| IMIDAZOLONEPROPIONASE / ... HISTIDINE AMMON...IA-LYASE [Brucella melitensis 16M] ... pir||AG3555 histidine ammonia-lyase (

  1. ORF Alignment: NC_003450 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003450 gi|19553429 >1v4aA 22 435 620 1034 4e-69 ... ref|YP_226470.1| GLUTAMATE-AMMONIA...mb|CAF20569.1| ... GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERASE ... [Corynebacterium glutami

  2. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17547365 >1gkmA 3 497 10 504 e-143 ... emb|CAD16353.1| PROBABLE HISTIDINE AMMONIA...-LYASE (HISTIDASE) PROTEIN [Ralstonia ... solanacearum] ref|NP_520767.1| PROBABLE HISTIDINE ... AMMONIA

  3. ORF Alignment: NC_004311 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004311 gi|23500656 >1gkpA 3 425 8 405 2e-19 ... ref|NP_541346.1| IMIDAZOLONEPROPIONASE / HISTIDINE AMMONIA...-LYASE [Brucella ... melitensis 16M] gb|AAL53610.1| IMIDAZOLONEPROPIONASE / ... HISTIDINE AMMON...IA-LYASE [Brucella melitensis 16M] ... pir||AG3555 histidine ammonia-lyase (

  4. ORF Alignment: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15966456 >1gkmA 2 501 3 499 e-107 ... emb|CAC47282.1| PUTATIVE HISTIDINE AMMONIA...-LYASE PROTEIN [Sinorhizobium meliloti] ... ref|NP_386809.1| PUTATIVE HISTIDINE AMMONIA-LYASE

  5. ORF Alignment: NC_003296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003296 gi|17548586 >1gkmA 10 504 26 526 e-118 ... ref|NP_521926.1| PROBABLE HISTIDINE AMMONIA...-LYASE PROTEIN [Ralstonia solanacearum ... GMI1000] emb|CAD17516.1| PROBABLE HISTIDINE ... AMMONIA

  6. ORF Alignment: NC_003317 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003317 gi|17987610 >1v4aA 20 435 2 420 e-106 ... gb|AAL52508.1| GLUTAMATE-AMMONIA-...LIGASE ADENYLYLTRANSFERASE [Brucella melitensis ... 16M] ref|NP_540244.1| GLUTAMATE-AMMONIA-LIGASE ...

  7. ORF Alignment: NC_003450 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003450 gi|19552717 >1vdkA 1 459 57 516 e-127 ... ref|YP_225787.1| ASPARTATE AMMONIA...ynebacterium glutamicum ATCC 13032] emb|CAF21511.1| ... ASPARTATE AMMONIA-LYASE (ASPARTASE) [Coryneba

  8. ORF Alignment: NC_003317 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003317 gi|17986393 >1vdkA 1 459 12 469 e-123 ... gb|AAL51291.1| ASPARTATE AMMONIA-...LYASE [Brucella melitensis 16M] ref|NP_539027.1| ... ASPARTATE AMMONIA-LYASE [Brucella melitensis 16M

  9. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006513 gi|56476897 >1r0wC 2 267 324 600 2e-59 ... ref|YP_158486.1| putative composite... ATP-binding transmembrane ABC transporter ... protein [Azoarcus sp. EbN1] emb|CAI07585.1| putative ... composite

  10. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003888 gi|21218662 >1cxqA 5 133 141 282 2e-06 ... ref|NP_624441.1| putative noncomposite... transposon transposase [Streptomyces ... coelicolor A3(2)] emb|CAB52910.1| putative noncomposite... ... transposon transposase [Streptomyces coelicolor A3(2)] ... pir||T36996 probable noncomposite

  11. ORF Alignment: NC_000912 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000912 gi|13507986 >1txoB 6 236 9 257 6e-28 ... gb|AAB96233.1| protein phoshatase ...iae ... M129] pir||S73911 protein phoshatase 2C homolog ptc1 - ... Mycoplasma pneumoniae (stra... ... ref|NP_109935.1| protein phoshatase 2C homolog; similar ... to Swiss-Prot Accession Number P3518

  12. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27377726 >1k4iA 2 216 3 205 5e-67 ... ref|NP_769255.1| 3,4-dihydroxy-2-butanone-4-phosha...0.1| ... 3,4-dihydroxy-2-butanone-4-phoshate synthase/GTP ... cyclohydrolase II [Bradyrhizobiu

  13. ORF Alignment: NC_003098 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ture subunit FibA [Peptostreptococcus micros] ... Length = 106 ... Query: 183 WYYLKSDGSYARNAWQGN----YYLK... NC_003098 gi|15902627 >1hcxA 4 111 266 371 5e-20 ... gb|AAD02873.1| fibril-like struc

  14. ORF Alignment: NC_003028 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ture subunit FibA [Peptostreptococcus micros] ... Length = 106 ... Query: 183 WYYLKSDGSYARNAWQGN----YYLK... NC_003028 gi|15900568 >1hcxA 4 111 266 371 5e-20 ... gb|AAD02873.1| fibril-like struc

  15. TwNC: a Multifaceted Dutch News Corpus

    NARCIS (Netherlands)

    Ordelman, Roeland J.F.; de Jong, Franciska M.G.; van Hessen, Adrianus J.; Hondorp, G.H.W.

    2007-01-01

    This contribution describes the Twente News Corpus (TwNC), a multifaceted corpus for Dutch that is being deployed in a number of NLP research projects among which tracks within the Dutch national research programme MultimediaN, the NWO programme CATCH, and the Dutch-Flemish programme STEVIN. The

  16. ORF Alignment: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available f|NP_289264.1| PTS system enzyme II ABC (asc), ... cryptic, transports specific beta-glucosides ... ...ABC (asc), cryptic, transports specific ... beta-glucosides [Escherichia coli O157:H7 EDL933] ... ... NC_002655 gi|15803232 >1iba0 1 77 8 85 7e-10 ... gb|AAG57822.1| PTS system enzyme II

  17. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006370 gi|54310056 >1r0wC 45 273 39 283 1e-54 ... ref|YP_131076.1| putative ABC-type metal ion transports...ative ... ABC-type metal ion transportsystem, ATPase component ... [Photobacterium profundum

  18. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006370 gi|54310050 >1r0wC 43 281 30 288 6e-50 ... ref|YP_131070.1| putative ABC-type oligopeptide transport...putative ... ABC-type oligopeptide transportsystem, ATPase component ... [Photobacterium profu

  19. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available f|NP_289264.1| PTS system enzyme II ABC (asc), ... cryptic, transports specific beta-glucosides ... ...ABC (asc), cryptic, transports specific ... beta-glucosides [Escherichia coli O157:H7 EDL933] ... ... NC_000913 gi|49176263 >1iba0 1 77 8 85 7e-10 ... gb|AAG57822.1| PTS system enzyme II

  20. ORF Alignment: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available f|NP_289264.1| PTS system enzyme II ABC (asc), ... cryptic, transports specific beta-glucosides ... ...ABC (asc), cryptic, transports specific ... beta-glucosides [Escherichia coli O157:H7 EDL933] ... ... NC_002695 gi|15832825 >1iba0 1 77 8 85 7e-10 ... gb|AAG57822.1| PTS system enzyme II

  1. ORF Alignment: NC_002488 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002488 gi|15839305 >1nhwA 3 221 3 192 2e-14 ... ref|NP_623378.1| Dehydrogenases with different specificitie... ... tengcongensis MB4] gb|AAM24982.1| Dehydrogenases with ... different specificities (related t

  2. ORF Alignment: NC_002488 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002488 gi|15838342 >1nhwA 3 221 3 192 2e-14 ... ref|NP_623378.1| Dehydrogenases with different specificitie... ... tengcongensis MB4] gb|AAM24982.1| Dehydrogenases with ... different specificities (related t

  3. ORF Alignment: NC_003869 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003869 gi|20806601 >1sbyA 1 240 1 248 1e-36 ... ref|NP_621772.1| Dehydrogenases with different specificitie... ... tengcongensis MB4] gb|AAM23376.1| Dehydrogenases with ... different specificities (related t

  4. ORF Alignment: NC_003869 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003869 gi|20807919 >1hxhA 7 250 6 247 9e-54 ... ref|NP_623090.1| Dehydrogenases with different specificitie... ... tengcongensis MB4] gb|AAM24694.1| Dehydrogenases with ... different specificities (related t

  5. ORF Alignment: NC_003869 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003869 gi|20808207 >1nhwA 3 221 3 192 2e-14 ... ref|NP_623378.1| Dehydrogenases with different specificitie... ... tengcongensis MB4] gb|AAM24982.1| Dehydrogenases with ... different specificities (related t

  6. ORF Alignment: NC_003869 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003869 gi|20806584 >1hxhA 4 249 2 245 2e-52 ... ref|NP_621755.1| Dehydrogenases with different specificitie... ... tengcongensis MB4] gb|AAM23359.1| Dehydrogenases with ... different specificities (related t

  7. ORF Alignment: NC_006834 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available v. oryzae ... KACC10331] gb|AAW75848.1| Dehydrogenases with different ... specificities (relat... NC_006834 gi|58582217 >1hxhA 4 249 11 249 8e-34 ... ref|YP_201233.1| Dehydrogenases with different specificiti...es (related to short-chain ... alcohol dehydrogenases) [Xanthomonas oryzae p

  8. ORF Alignment: NC_003869 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003869 gi|20808609 >1hxhA 7 250 9 255 1e-30 ... ref|NP_623780.1| Dehydrogenases with different specificitie... ... tengcongensis MB4] gb|AAM25384.1| Dehydrogenases with ... different specificities (related t

  9. ORF Alignment: NC_003869 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003869 gi|20809051 >1sbyA 1 244 1 262 8e-25 ... ref|NP_624222.1| Dehydrogenases with different specificitie... ... tengcongensis MB4] gb|AAM25826.1| Dehydrogenases with ... different specificities (related t

  10. 77 FR 64411 - Drawbridge Operation Regulations; Atlantic Intracoastal Waterway (AIWW), Wrightsville Beach, NC

    Science.gov (United States)

    2012-10-22

    ...), Wrightsville Beach, NC AGENCY: Coast Guard, DHS. ACTION: Notice of deviation from drawbridge regulation.... 74 Bridge across the Atlantic Intracoastal Waterway, mile 283.1, at Wrightsville Beach, NC. The... Intracoastal Waterway (AIWW) mile 283.1, at Wrightsville Beach, NC has a vertical clearance of 20 feet, above...

  11. 75 FR 38127 - Sherrill Furniture, Hickory White Furniture Division Hickory, NC; Including Workers of Hickory...

    Science.gov (United States)

    2010-07-01

    ... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-64,867] Sherrill Furniture, Hickory White Furniture Division Hickory, NC; Including Workers of Hickory White Upholstery High Point, NC in Support of Sherrill Furniture Hickory White Furniture Division Hickory, NC; Amended Certification...

  12. 78 FR 54413 - Proposed Establishment of Class E Airspace; Star, NC

    Science.gov (United States)

    2013-09-04

    ... Federal Aviation Administration 14 CFR Part 71 Proposed Establishment of Class E Airspace; Star, NC AGENCY... action proposes to establish Class E Airspace at Star, NC, to accommodate a new Area Navigation (RNAV... establish Class E airspace at Star, NC, providing the controlled airspace required to support the new RNAV...

  13. 75 FR 36608 - Drawbridge Operation Regulation; Atlantic Intracoastal Waterway, (AIWW) Scotts Hill, NC

    Science.gov (United States)

    2010-06-28

    ...-AA09 Drawbridge Operation Regulation; Atlantic Intracoastal Waterway, (AIWW) Scotts Hill, NC AGENCY... the operation of the Figure Eight Swing Bridge, at AIWW mile 278.1, at Scotts Hill, NC. The requested... Intracoastal Waterway, (AIWW) Scotts Hill, NC'' in the Federal Register (74 FR 7844-7847). The rulemaking would...

  14. A vaccine formulation combining rhoptry proteins NcROP40 and NcROP2 improves pup survival in a pregnant mouse model of neosporosis.

    Science.gov (United States)

    Pastor-Fernández, Iván; Arranz-Solís, David; Regidor-Cerrillo, Javier; Álvarez-García, Gema; Hemphill, Andrew; García-Culebras, Alicia; Cuevas-Martín, Carmen; Ortega-Mora, Luis M

    2015-01-30

    Currently there are no effective vaccines for the control of bovine neosporosis. During the last years several subunit vaccines based on immunodominant antigens and other proteins involved in adhesion, invasion and intracellular proliferation of Neospora caninum have been evaluated as targets for vaccine development in experimental mouse infection models. Among them, the rhoptry antigen NcROP2 and the immunodominant NcGRA7 protein have been assessed with varying results. Recent studies have shown that another rhoptry component, NcROP40, and NcNTPase, a putative dense granule antigen, exhibit higher expression levels in tachyzoites of virulent N. caninum isolates, suggesting that these could be potential vaccine candidates to limit the effects of infection. In the present work, the safety and efficacy of these recombinant antigens formulated in Quil-A adjuvant as monovalent vaccines or pair-wise combinations (rNcROP40+rNcROP2 and rNcGRA7+rNcNTPase) were evaluated in a pregnant mouse model of neosporosis. All the vaccine formulations elicited a specific immune response against their respective native proteins after immunization. Mice vaccinated with rNcROP40 and rNcROP2 alone or in combination produced the highest levels of IFN-γ and exhibited low parasite burdens and low IgG antibody levels after the challenge. In addition, most of the vaccine formulations were able to increase the median survival time in the offspring. However, pup survival only ensued in the groups vaccinated with rNcROP40+rNcROP2 (16.2%) and rNcROP2 (6.3%). Interestingly, vertical transmission was not observed in those survivor pups immunized with rNcROP40+rNcROP2, as shown by PCR analyses. These results show a partial protection against N. caninum infection after vaccination with rNcROP40+rNcROP2, suggesting a synergistic effect of the two recombinant rhoptry antigens. Copyright © 2014 Elsevier B.V. All rights reserved.

  15. Software module for geometric product modeling and NC tool path generation

    International Nuclear Information System (INIS)

    Sidorenko, Sofija; Dukovski, Vladimir

    2003-01-01

    The intelligent CAD/CAM system named VIRTUAL MANUFACTURE is created. It is consisted of four intelligent software modules: the module for virtual NC machine creation, the module for geometric product modeling and automatic NC path generation, the module for virtual NC machining and the module for virtual product evaluation. In this paper the second intelligent software module is presented. This module enables feature-based product modeling carried out via automatic saving of the designed product geometric features as knowledge data. The knowledge data are afterwards applied for automatic NC program generation for the designed product NC machining. (Author)

  16. Modular Design of NC Program in Multi-varieties and Small-batch Production Mode

    Directory of Open Access Journals (Sweden)

    Liu Hong

    2016-01-01

    Full Text Available Aiming at design efficiency and quality problems of NC program in multi-varieties and small-batch production mode, this paper applied the concept of product modular design into NC program design, and presented the modular design method of NC program and its implementation techniques. By design the module NC program structure and build the database of basic module, provided technical support for the modular design of NC program. The practical application shows those: the constructed module database can be reused and can be combined, using the modular design method can effectively improve the design efficiency and quality of NC program, especially for multi-varieties and small-batch parts, provides an optimal way for NC program to quickly meet the individual demands.

  17. Laser-Ablated U Atom Reactions with (CN)2 to Form UNC, U(NC)2, and U(NC)4: Matrix Infrared Spectra and Quantum Chemical Calculations.

    Science.gov (United States)

    Fang, Zongtang; Garner, Edward B; Dixon, David A; Gong, Yu; Andrews, Lester; Liebov, Benjamin

    2018-01-18

    Laser-ablated U atoms react with (CN) 2 in excess argon and neon during codeposition at 4 K to form UNC, U(NC) 2 , and U(NC) 4 as the major uranium-bearing products, which are identified from their matrix infrared spectra using cyanogen substituted with 13 C and 15 N and from quantum chemical calculations. The 12/13 CN and C 14/15 N isotopic frequency ratios computed for the U(NC) 1,2,4 molecules agree better with the observed values than those calculated for the U(CN) 1,2,4 isomers. Multiplets using mixed isotopic cyanogens reveal the stoichiometries of these products, and the band positions and quantum chemical calculations confirm the isocyanide bonding arrangements, which are 14 and 51 kJ/mol more stable than the cyanide isomers for UNC and U(NC) 2 , respectively, and 62 kJ/mol for U(NC) 4 in the isolated gas phase at the CCSD(T)/CBS level. The studies further demonstrate that the isocyano nitrogen is a better π donor, so it interacts with U(VI) better than carbon. Although the higher isocyanides are more stable than the corresponding cyanides, U(NC) 5 and U(NC) 6 were not observed here most likely because unfavorable or endothermic routes are required for their production from U(NC) 4 . The computed U-NC bond dissociation energies decrease from 581 kJ/mol for 4 [UNC] to 168 kJ/mol for 1 [U(NC) 6 ]. The ionic nature of U(NC) n decreases as the number of isocyano groups increases.

  18. Large Nc from Seiberg–Witten curve and localization

    Directory of Open Access Journals (Sweden)

    Jorge G. Russo

    2015-09-01

    Full Text Available When N=2 gauge theories are compactified on S4, the large Nc limit then selects a unique vacuum of the theory determined by saddle-point equations, which remains determined even in the flat-theory limit. We show that exactly the same equations can be reproduced purely from Seiberg–Witten theory, describing a vacuum where magnetically charged particles become massless, and corresponding to a specific degenerating limit of the Seiberg–Witten spectral curve where 2Nc−2 branch points join pairwise giving aDn=0, n=1,…,Nc−1. We consider the specific case of N=2 SU(Nc SQCD coupled with 2Nf massive fundamental flavors. We show that the theory exhibits a quantum phase transition where the critical point describes a particular Argyres–Douglas point of the Riemann surface.

  19. ORF Alignment: NC_002506 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002506 gi|15600871 >1t3kA 3 115 22 120 8e-13 ... gb|AAF96014.1| phage shock protein E [Vibrio cholerae... O1 biovar eltor str. N16961] ... ref|NP_232501.1| phage shock protein E [Vibrio cholerae... ... O1 biovar eltor str. N16961] pir||B82502 phage shock ... protein E VCA0100 [imported] - Vibrio cholerae... 99 ... Query: 22 ... FSSGAQASERAELAWQMVNEGALLIDVRTVEEYAQGHLDTALNWPLSEVETAFNAIEKER 81 ... FSSGAQASERAELAWQ...MVNEGALLIDVRTVEEYAQGHLDTALNWPLSEVETAFNAIEKER Sbjct: 1 ... FSSGAQASERAELAWQMVNEGALLIDVRTVEEYAQGHLDTALNWPLSEVETAFNAIEKER 60 ...

  20. ORF Alignment: NC_003103 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003103 gi|15892818 >1xvqA 25 163 52 203 1e-07 ... ref|NP_360532.1| sco2 protein pr...ecursor [Rickettsia conorii str. Malish 7] ... gb|EAA26363.1| sco2 protein precursor [Rickettsia ... ... ... sibirica 246] gb|AAL03433.1| sco2 protein precursor ... [Rickettsia conorii str. Malish 7] ref...|ZP_00142954.1| ... sco2 protein precursor [Rickettsia sibirica 246] ... pir||G97811 sco2