Refugee, Asylum, and Related Legislation in the US Congress: 2013–2016

Directory of Open Access Journals (Sweden)

Tara Magner

2016-11-01

Full Text Available Members of Congress have introduced numerous pieces of legislation in recent years related to refugees, asylum seekers, and other populations of migrants seeking protection in the United States. These bills were drafted in reaction to dramatic events within the United States, at its borders, and around the world. For example, roughly 400,000 children traveling alone and mothers with children have arrived at the southern US border since 2013, many seeking protection from organized crime, gang violence, and threats of human trafficking. Similarly, more than a million refugees from the Middle East, North Africa, and Asia sought to reach safety on the European continent in 2015 alone. Terrorist attacks fueled attempts to curtail the US commitment to offer protection to those fleeing persecution, even when those attacks had no connection to refugees or only tenuous links. And yet existing US law has been left virtually unchanged throughout this tumultuous period. This article describes the significant attempts to enact legislation related to refugees and international migrants since 2013 and examines the reasons why those attempts have not succeeded. It also describes American attitudes toward refugees and assesses whether those attitudes affected the fate of legislation.

Hydrogen and fuel cells in the United States Congress

International Nuclear Information System (INIS)

Yacobucci, B.D.

2003-01-01

Over the past few years, the United States Congress has shown increasing interest in the development of hydrogen fuel and fuel cells for transportation, stationary, and mobile applications The high efficiency of fuel cell systems could address some of the concern over increasing dependence on imported petroleum. Further, lower emissions could help promote air quality goals However, many questions remain, including the affordability, safety, overall fuel-cycle efficiency and emissions. These questions, especially those related to cost, have led Members of Congress to enact legislation to speed the development and commercialization of the technologies. This paper discusses congressional action on hydrogen and fuel cells. It provides an overview of the U.S. Congress, and outlines the role of the appropriations process. It then provides a history of federal hydrogen fuel research and development (R and D), both in terms of legislative and executive initiatives, and it describes pending legislation current as of this writing, including bills on energy policy, transportation policy, tax policy, and appropriations. Finally, the paper presents some of the issues that the pending legislation may raise for industry. (author)

'Pivotal politics' in US energy and climate legislation

International Nuclear Information System (INIS)

Skodvin, Tora

2010-01-01

In the 110th Congress (2007-2008) legislation related to climate change was introduced at a faster pace than in any previous Congress, yet it did not result in a corresponding increase in enacted climate-related laws. A pertinent example of the political infeasibility of climate policy change in the 110th Congress is the case of tax credit extensions for production of renewable energy. While this issue in itself was uncontroversial, the extensions were only adopted in the 11th hour, after innumerable failed attempts. With an analytical point of departure in Krehbiel's theory of pivotal politics, this paper seeks to identify pivotal legislators in the case of the tax credit extensions and discusses how changes in the composition of pivotal legislators in the 111th Congress (2009-2010) may impact the prospects of moving climate legislation more generally. The analysis indicates that a majority of the legislative pivots in the case of tax credit extensions were Republican senators representing coal-producing states. In the case of climate change, however, the regional dimension is likely to be more significant for Democratic voting behaviour. Thus, the opportunity space for climate legislation in the 111th Congress remains narrow even with a reinforced Democratic majority in Congress.

Excitation function and yield for the 103Rh(d,2n)103Pd nuclear reaction: Optimization of the production of palladium-103

International Nuclear Information System (INIS)

Manenti, Simone; Alí Santoro, María del Carmen; Cotogno, Giulio; Duchemin, Charlotte; Haddad, Ferid; Holzwarth, Uwe; Groppi, Flavia

2017-01-01

Deuteron-induced nuclear reactions for the generation of 103 Pd were investigated using the stacked-foil activation technique on rhodium targets at deuteron energies up to E d = 33 MeV. The excitation functions of the reactions 103 Rh(d,xn) 101,103 Pd, 103 Rh(d,x) 100g,cum,101m,g,102m,g Rh and 103 Rh(d,2p) 103 Ru have been measured, and the Thick-Target Yield for 103 Pd has been calculated.

The legislative perspective

International Nuclear Information System (INIS)

Hartman, L.

1990-01-01

This paper reports that the United States Congress has only recently become interested in the issue of ballistic missile proliferation. It was primarily as a result of the outcome of the debate over chemical weapons legislation that Congress joined the issue of ballistic missile proliferation in the matter of restraints on foreign countries, particularly those based in Missile Technology Control Regime (MTCR) countries. This paper addresses the following questions: Is it Congress's place to enforce compliance with international agreements? More importantly, will such measures have the desired effect?

31 CFR 50.91 - Notice to Congress.

Science.gov (United States)

2010-07-01

... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Notice to Congress. 50.91 Section 50... PROGRAM Cap on Annual Liability § 50.91 Notice to Congress. Pursuant to section 103(e)(3) of the Act, the Secretary shall provide an initial notice to Congress within 15 days of the certification of an act of...

Nuclear Regulatory legislation

International Nuclear Information System (INIS)

1984-06-01

This compilation of statutes and material pertaining to nuclear regulatory legislation through the 97th Congress, 2nd Session, has been prepared by the Office of the Executive Legal Director, U.S. Nuclear Regulatory Commission, with the assistance of staff, for use as an internal resource document

29 CFR 1400.735-19 - Influencing Members of Congress.

Science.gov (United States)

2010-07-01

... 29 Labor 4 2010-07-01 2010-07-01 false Influencing Members of Congress. 1400.735-19 Section 1400... Responsibilities § 1400.735-19 Influencing Members of Congress. No money appropriated to the Service shall be used... devices intended to influence any Member of Congress regarding any legislation or appropriation before the...

An analysis of physician antitrust exemption legislation: adjusting the balance of power.

Science.gov (United States)

Hellinger, F J; Young, G J

2001-07-04

Current antitrust law restricts physicians from joining together to collectively negotiate. However, such activities may be approved by state laws under the so-called state action immunity doctrine and by federal legislation under an explicit antitrust exemption. In 1999, Texas became the first state to pass physician antitrust exemption legislation allowing physicians, under certain defined circumstances, to collectively negotiate fees with health plans. Last year, similar legislation was introduced in the US Congress, in 18 state legislatures, and in the District of Columbia. This legislation was passed only in the District of Columbia where its implementation was blocked by the city's financial control board. Nonetheless, legislation permitting physicians to collectively negotiate fees with managed care plans has been introduced in 10 state legislatures this year, and there is continued interest in introducing similar legislation in the US Congress. This analysis examines the basic features of this legislation and its potential impact on the balance of power between physicians and managed care plans.

Nuclear Regulatory Legislation

International Nuclear Information System (INIS)

1989-08-01

This compilation of statutes and material pertaining to nuclear regulatory legislation through the 100th Congress, 2nd Session, has been prepared by the Office of the General Counsel, US Nuclear Regulatory Commission, with the assistance of staff, for use as an internal resource document. Persons using this document are placed on notice that it may not be used as an authoritative citation in lieu of the primary legislative sources. Furthermore, while every effort has been made to ensure the completeness and accuracy of this material, neither the United States Government, the Nuclear Regulatory Commission, nor any of their employees makes any expressed or implied warranty or assumes liability for the accuracy or completeness of the material presented in this compilation

Sonora Legislators and their Constitution, 1857-1861

Directory of Open Access Journals (Sweden)

Zulema Trejo

2010-01-01

Full Text Available This paper describes the members of the Sonora constituent congress (1857-61, and analyzes the debates they held regarding the project for the state's Constitution, which would follow the lines estblished by the 1857 Federal Constitution. It also points out the relations between each legislator's trajectory and politicial affiliation (as far as available sources allow for this, and the proposals he presented during the legislative debates that gave place to the 1861 Constitution of Sonora.

The 'Big Karl' magnetic spectrometer - studies of the 103Ru transition nucleus with (d,p) and (p,d) reactions

International Nuclear Information System (INIS)

Huerlimann, W.

1981-04-01

The paper describes the structure and characteristics of the spectrometer and its application in a study of the 102 Ru(d,p) 103 Ru and 104 Ru(p,d) 103 Ru reactions. The study is structured as follows: To begin with the theoretical fundamentals, ion-optical characteristics and layout of BIG KARL are described. Field measurements and analyses carried out on the magnets of the spectrometer are described as well as the functioning of the 'Ht correction coils' used here for the first time to prevent faulty imaging. Chapter IV then describes methods employed so far to optimize resolution for large aperture angles of the spectrometer. Finally, chapter V investigates the 103 Ru transition nucleons on the basis of the 102 Ru(d,p) 103 RU and 104 Ru(p,d) 103 Ru transfer reactions measured in BIG KARL. (orig./HSI) [de

Working at Congress : a Sandian's experience.

Energy Technology Data Exchange (ETDEWEB)

Allen, Matthew

2009-03-01

During the 110th Congress (calendar years 2007 and 2008), Matthew Allen, a Sandian nuclear scientist, served as a Congressional Fellow on the Committee on Homeland Security in the House of Representatives. This report is an informative account of the role staffers play in assisting the members of Congress in their oversight and legislative duties. It is also a personal account of Matthew Allen's experience as a committee staffer in the House of Representatives.

Working Together: An Empirical Analysis of a Multiclass Legislative-Executive Branch Simulation

Science.gov (United States)

Kalaf-Hughes, Nicole; Mills, Russell W.

2016-01-01

Much of the research on the use of simulations in the political science classroom focuses on how simulations model different events in the real world, including political campaigns, international diplomacy, and legislative bargaining. In the case of American Politics, many simulations focus on the behavior of Congress and the legislative process,…

MIPPA: First Broad Changes to Medicare Part D Plan Operations.

Science.gov (United States)

LeMasurier, Jean D; Edgar, Babette

2009-04-01

In July 2008, as part of broad Medicare reform, Congress passed the first major legislative changes to Medicare Part D since its enactment in 2003-the Medicare Improvements for Patients and Providers Act. This new legislation has significant implications for how Part D plans can market and enroll Medicare beneficiaries. The new legislation also strengthened beneficiary protections, expanded the low-income subsidy provisions originally included in Part D, and expanded Part D coverage. These changes have significant implications for the operation of Part D plans and can affect those involved in benefit design, including specialty pharmacy coverage. This article discusses the major changes that took effect on January 1, 2009, and have immediate implications for Part D plan sponsors, including Medicare Advantage plans and stand-alone prescription drug plans.

Beyond Brazilian Coalition Presidentialism: the Appropriation of the Legislative Agenda

Directory of Open Access Journals (Sweden)

Rafael Silveira e Silva

2014-12-01

Full Text Available Even though they possess several power resources, Brazilian Presidents also elaborate their legislative proposals based upon bills already being processed in Congress through a phenomenon called Appropriation of the legislative agenda. In this paper I examine the conditions under which this phenomenon occurs by means of a typology and a qualitative comparative analysis (QCA. I conclude that Appropriation provides the President with the expansion of the formal support base by controlling the agenda of allied and opposition parties as well as obtaining the "paternity" of several policies already in motion in Congress, thus enabling a public association of the President's actions and his or her party with the possibility of social benefits. Be it in the pursuit of promising agendas or for the maintenance of their own dominance, Appropriation shows that Brazilian Presidents must go beyond coalition presidentialism.

Discourse and dissonance: religious agendas in the 104th Congress

Directory of Open Access Journals (Sweden)

Bethany Blackstone

2015-07-01

Full Text Available This paper investigates the religious dimension of Republican legislators’ participation in one-minute speeches during the 104th Congress (1995–1996. Many have characterized the House Republican Conference that emerged after the 1994 elections as a highly cohesive majority party. Even in that context, however, legislators represent varied personal agendas, and in part these are informed by religion. We topically coded a subset of floor speeches to measure the extent to which variation is observed in the issues addressed by Members of Congress. The findings demonstrate that on key policy domains, such as the role of government, culture, and social welfare, speech participation varies systematically on the basis of member religion. This suggests that legislative participation is influenced by genuine personal preferences in additional to strategic political factors.

Is there a doctor in the house? . . . Or the Senate? Physicians in US Congress, 1960-2004.

Science.gov (United States)

Kraus, Chadd K; Suarez, Thomas A

2004-11-03

The legislative and fiscal influences of Congress, as well as the continuing overall growth in health care spending as a portion of the gross domestic product, make congressional representation by physicians important because physicians have unique expertise in the impact of legislation on patient care and medical practice. To describe physician representation in the US Congress between 1960 and 2004 and relate the results to past representation of physicians in Congress. A retrospective observational study of members of the US Congress from all 50 states and all represented territories, who served from January 1960 to April 2004 (including 108th Congress), using data available in public access databases and congressional biographical records. Physician representation in Congress, including occupation before taking office, state/territory of representation, sex, party affiliation, and time served. During the past 44 years, 25 (1.1%) of 2196 members of Congress were physicians. Physicians in Congress were more likely to be members of the Republican Party (60% vs 45.1% of all members, P = .007) and were similar to other members of Congress in mean years of service (9.2 years for physicians vs 12.3 years for all members, P = .09) and in sex distribution (4.0% female physicians vs 6.8% all female members, P = .57). Physicians in Congress represented 17 states, the Virgin Islands, and Puerto Rico. Physician representation in Congress is low and is in stark contrast with physician roles during the first century of the United States. However, the 8 physicians currently serving in Congress may be indicative of a shift toward more direct influence of physicians in national politics.

11. National congress on ionizing radiation monitoring

International Nuclear Information System (INIS)

The theme of the Congress was centred on 'the development of radioprotection confronted with the progress of techniques using ionising radiations' in industry, energy, medicine and reseach. The 32 communications were distributed over the following 6 sessions: radioprotection and preventive medicine, radioprotection in a medical environment, radioprotection and energy, practical aspects of radioprotection, training and legislation in radioprotection [fr

House Calls: Physicians in the US Congress, 2005-2015.

Science.gov (United States)

Goldenberg, Matthew N

2015-11-01

Physicians occupy a prominent position in the US healthcare system, and physicians who serve in Congress may bring a particular perspective, expertise, and influence to health-related legislation. The purpose of this study was to describe physician membership in the US Congress between 2005 and 2015. Congressional biographical records were searched to identify physicians who served in the US Congress from 2005 to 2015. Political and demographic characteristics of physician-members were compared with those of nonphysician-members of Congress and of all US physicians. The numbers of physicians in recent Congresses also were compared with those in each Congress since 1945. A total of 27 physicians representing 17 states have served in Congress since 2005. There has been a significant increase in physician representation since 1987, reaching a high of 20 members (3.7%) in the Congresses immediately following passage of the Patient Protection and Affordable Care Act. Physician-members were mostly men (93%) and more likely than their Congressional colleagues to be Republican (78% vs 53% of all members, P = 0.007) and from the South (63% vs 35% of all members, P = 0.003). Compared with physicians in general, physicians in Congress were more likely to be men (93% vs 70%, P = 0.009) and surgeons (26% vs 11%, P = 0.01). Physician representation in Congress has increased substantially since 2000, potentially reflecting the greater political prominence of healthcare issues, as well as increased interest by and recruitment of physician-candidates. Physicians in Congress differ from their colleagues and from physicians in general in various demographic and political characteristics.

National Congress of Food Science and Technology

International Nuclear Information System (INIS)

1995-01-01

ATAM is the principal promoter of the diffusion of food science and technology in Mexico with the organization of the XXVI National Congress of Food Science and Technology. Pre-Congress activities were as follow: two first on 'Food legislation in the United States of America' and the second on 'Characterization of food quality', a magisterial desk on the theme 'The challenge of food industry in front of the present Mexico', two round tables: a) Quality assurance systems and risk analysis 'Iso 9000' and b) 'Biotechnological products' and c) 'H Program'. With the ambitious program, the Congress included 234 papers divided in oral presentations and posters on subjects as: nutrition, education, toxicology, additives, gums, fruits, cereals, new products, dairy products, rheology, oleaginous, risk analysis, critical points, statistics and analysis. The foreign participant countries were Venezuela, Spain, Cuba and United States of America. Short communication. (Author)

Mapping "Trauma-Informed" Legislative Proposals in U.S. Congress.

Science.gov (United States)

Purtle, Jonathan; Lewis, Michael

2017-11-01

Despite calls for translation of trauma-informed practice into public policy, no empirical research has investigated how the construct has been integrated into policy proposals. This policy mapping study identified and analyzed every bill introduced in US Congress that mentioned "trauma-informed" between 1973 and 2015. Forty-nine bills and 71 bill sections mentioned the construct. The number of trauma-informed bills introduced annually increased dramatically, from 0 in 2010 to 28 in 2015. Trauma-informed bill sections targeted a range of sectors, but disproportionally focused on youth (73.2%). Only three bills defined "trauma-informed." Implications within the context of a changing political environment are discussed.

The integration of the Constituent Congress in 1917

Directory of Open Access Journals (Sweden)

Juan Bernardino Sánchez Aguilar

2017-01-01

Full Text Available This paper offers a new perspective around the perception of political legitimacy held by the representatives to one of the most emblematic assemblies in Mexico. Reviewing the credentials of the Querétaro Constituent Congress allows us to observe the first internal disputes within constitutionalism, since plenty has been said about the enactment of the Political Constitution of the Mexican United States, whereas the legislative sessions that gave rise to it are not studied enough.  By presenting the chiaroscuros of the constituent parliamentary work, particularly during the first days of the electoral college, this article aims to complement the existing enormous historiographic production on this Congress.

Some considerations regarding the reforms of nuclear liability legislation in the United States

International Nuclear Information System (INIS)

Welck, S. von

1980-01-01

In the United States, as in the Federal Republic of Germany and in Switzerland, some thought is presently being given to reforms of nuclear liability legislation. In each case it was either triggered or influenced by the Three Mile Island incident of March 28, 1979. Some of the current thinking in the United States has already been incorporated in a number of draft bills now before Congress for deliberation and decision. Other draft bills on reforms of U.S. nuclear liability law have been announced. It is certain that this reform of nuclear liability legislation in the United States will be carried out not only with determination and the political will to improve the present situation, but also with the required caution and prudence, and that it will keep Congress busy not only for this term, but also next year. (orig.) [de

New determination of the half-lives of 57Co, 103Ru, sup(103m)Rh, 103Pd, and 109Cd

International Nuclear Information System (INIS)

Vaninbroukx, R.; Grosse, G.; Zehner, W.

1981-01-01

The half-lives of five radionuclides were redetermined by photon-counting techniques using NaI(Tl)- and Si(Li) detectors. The results are: 57 Co: (271.90 +- 0.09)d, 103 Ru: (39.260 +- 0.020)d, sup(103m)Rh: (56.114 +- 0.020)m, 103 Pd: (16.991 +- 0.019)d, and 109 Cd: (461.90 +- 0.30)d. The quoted uncertainties, corresponding to a lσ level, take into account random and systematic uncertainties. (author)

Proliferation of Precision Strike: Issues for Congress

Science.gov (United States)

2012-05-14

industrial base. Finally, should Congress legislate requirements for DOD to develop precision strike countermeasures and then provide funding for that...Defense, Part 187 – Environmental Effects Abroad of Major Department of Defense Actions, Section 187.3: Definitions. 32 Bryan Clark and Dan Whiteneck...so many missiles ... referring to reports of Venezuelan arms flowing to Colombian guerrillas.... The Chavez regime also has close ties with

Telecommunications Law Reform. 1980, 96th Congress, 2nd Session.

Science.gov (United States)

American Enterprise Inst. for Public Policy Research, Washington, DC.

Arguments for and against the major legislative proposals pertaining to the reform of the nonbroadcast part of the nation's telecommunications law which are pending before the 96th Congress are analyzed. Background information is given regarding (1) the structure of the domestic telecommunications industry, (2) the regulatory authority which…

Enact legislation supporting residential property assessed clean energy financing (PACE)

Energy Technology Data Exchange (ETDEWEB)

Saha, Devashree

2012-11-15

Congress should enact legislation that supports residential property assessed clean energy (PACE) programs in the nation’s states and metropolitan areas. Such legislation should require the Federal Housing Finance Agency (FHFA) to allow Fannie Mae and Freddie Mac to purchase residential mortgages with PACE assessments while at the same time providing responsible underwriting standards and a set of benchmarks for residential PACE assessments in order to minimize financial risks to mortgage holders. Congressional support of residential PACE financing will improve energy efficiency, encourage job creation, and foster economic growth in the nation’s state and metropolitan areas.

The Peruvian Congress: Public Policies and Informal Influence over the Bureaucracy

Directory of Open Access Journals (Sweden)

Enrique Patriau

2014-01-01

Full Text Available The Peruvian Constitution grants presidents the power to participate in the policy making process. At the same time, the Peruvian Congress is considered to lack the technical and professional ability to fully participate in such a process. However, such analysis neglects the influence that the Congress can exert through informal politics. Based on 31 interviews with legislators, political authorities, officials and experts in public administration this paper shows that the Peruvian legislature participates in the policy making process albeit through informal channels of influence over the bureaucracy.

Participation without representation? Senior opinion, legislative behavior, and federal health reform.

Science.gov (United States)

Bradley, Katharine W V; Chen, Jowei

2014-04-01

Why do legislators sometimes engage in behavior that deviates from the expressed policy preferences of constituents who participate in politics at high rates? We examine this puzzle in the context of Democratic legislators' representation of their senior citizen constituents on the Patient Protection and Affordable Care Act of 2010 (ACA). We find that legislators' roll-call votes on the ACA did not reflect the stated preferences of their respective senior constituents; by contrast, these roll-call votes did reflect the preferences of nonsenior adults. We draw upon a theoretical framework developed by Mansbridge to explain this apparent nonresponsiveness to seniors on the ACA. This framework distinguishes between promissory representation, whereby legislators merely respond to constituents' preferences, and anticipatory representation, whereby legislators respond to constituents' underlying policy interests, even when such interests conflict with expressed preferences. By considering the Medicare provisions in the ACA and analyzing Democratic legislators' floor speeches on health reform, we provide preliminary evidence that members of Congress engaged in anticipatory representation of their senior constituents by attempting to educate seniors about how the ACA serves their policy interests.

Cybersecurity: Current Legislation, Executive Branch Initiatives, and Options for Congress

Science.gov (United States)

2009-09-30

responsibilities of cybersecurity stakeholders. Privacy and civil liberties—maintaining privacy and freedom of speech protections on the Internet...securing networks before tackling the attendant issues such as freedom of speech , privacy, and civil liberty protections as they pertain to the Internet...legislation to mandate privacy and freedom of speech protections to be incorporated into a national strategy. • Assessing current congressional

Individuals with Disabilities Education Act: Reauthorization Overview. CRS Report for Congress.

Science.gov (United States)

Aleman, Steven R.

This report provides a review of programs authorized under the Individuals with Disabilities Education Act (IDEA) and an overview of potential reauthorization issues, as the second session of the 103rd Congress considers revisions to these programs. The Infants and Toddlers Program (Part H of IDEA) provides formula grants to participating States…

GHG legislation: Lessons from Taiwan

International Nuclear Information System (INIS)

Huang, W.M.; Lee, Grace W.M.

2009-01-01

Taiwan has drafted a Greenhouse Gas (GHG) Reduction Bill in 2006, which is currently undergoing the legislative process in the Congress. The purpose of this study is to reexamine the legal framework and contents of this Bill, evaluate potential problems and propose recommendations. This study advocates that setting the GHG reduction targets should be settled in this Bill. In addition, based on the analysis of international experiences, it is recommenced that emissions trading scheme in the Bill should be focused on large emission sources and the share of allowance auction should be increased to reduce gratis allocation. Furthermore, from the calculation results based on the long-range energy alternative planning (LEAP) model, a conflict is observed for the existing energy policy and GHG reduction efforts in Taiwan. That is, coal-burning power plants will be the most important source of energy for Taiwan in the future. In order to reduce this conflict, the authors have recommended that the Bill should also be integrated with other relevant existing legislation to achieve a complementary effect.

Influence of social networks on congresses of urological societies and associations: Results of the 81th National Congress of the Spanish Urological Association.

Science.gov (United States)

Gómez-Rivas, J; Rodríguez-Socarrás, M E; Tortolero-Blanco, L; Garcia-Sanz, M; Alvarez-Maestro, M; Ribal, M J; Cózar-Olmo, M

2017-04-01

To measure social network activity during the 81th National Congress of the Spanish Urological Association (AEU) and to compare it with the activity during other congresses of national and international urological associations. We designed and registered the official hashtag #AEU16 for the 81 th National Congress of the AEU on the Symplur website. The following measurements were recorded: number of participants, number of tweets, tweets by participant, tweets per hour and views. The number of participants in the social network activity during the congress was 207. The measurements of activity in Twitter consisted of a total of 1866 tweets, a mean rate of 16 tweets/h, 9 tweets per participant and 1,511,142 views. The activity during the international congresses is as follows: 2016 American Urological Association annual congress (views: 28,052,558), 2016 European Association of Urology annual congress (views: 13,915,994), 2016 Urological Society of Australia and New Zealand (views: 4,757,453), 2015 Société Internationale d'Urologie annual congress (views: 1,023,038). The activity during the national congresses was recorded as follows: 2016 Annual Conference of The British Association of Urological Surgeons (views: 2,518,880), 81th National Congress of the AEU (views: 1,511,142), 109th Congress of l'Association Française d'Urologie (views: 662,828), 67th German Congress of Urology (views: 167,347). We found 10 posts in Facebook and 2 communications via Periscope TV related to #AEU16. The social network activity during the 81 th National Congress of the AEU was notable given the results of this study. The use of social networks has expanded among urological associations, congresses and meetings, giving them a global character. Copyright © 2016 AEU. Publicado por Elsevier España, S.L.U. All rights reserved.

Right-to-Know legislation and the chemist

International Nuclear Information System (INIS)

Newburg-Rinn, S.D.

1991-01-01

In 1986 Congress passed the Emergency Planning and Community Right-to-Know Act. It sought a fundamental change environmental problem solving. Frustrated by the lack of progress achieved through regulation, Congress decided to give information directly to the people, hoping for change. AND HAS CHANGE COME exclamation point Major chemical manufacturers have promised drastic reductions in their releases. State right-to-known and pollution prevention legislation has been passed. The CMA has called for a major shift in the way the chemical industry has approached its business. In the Pollution Prevention Act of 1990 it is stated that there are significant opportunities for industry to reduce or prevent pollution at the source through cost effective changes in production, operation, and raw materials use. The Administrator of EPA has called for a 50% reduction in the releases of 17 major chemicals over the next several years. To achieve these national goals and requirements the chemist will play an essential role. And don't expect this push to die down. Already there are calls for more information dissemination, more public access exclamation point

Proceedings of the 10. Brazilian congress on energy. The global access to energy. v. 1

International Nuclear Information System (INIS)

2004-01-01

This congress approaches the papers presenting the global utilization of the access to the energy, covering the following subjects: models for prediction the supply and demand of energy, energy and climatic changes, technological prospecting of the energy generation, and regulation and legislation of energetic projects

5 CFR 575.103 - Eligible categories of employees.

Science.gov (United States)

2010-01-01

... INCENTIVES Recruitment Incentives § 575.103 Eligible categories of employees. (a) Except as provided in § 575.104, an Executive agency may pay a recruitment incentive to an employee appointed or placed in the... § 575.104, a legislative agency may pay a recruitment incentive to an employee appointed or placed in a...

VI Congress of Spanish Radiation Protection Society, Cordoba, 24-27 Set 1996

International Nuclear Information System (INIS)

1996-01-01

This special issue of the journal Radioprotection compiles the sessions of VI Congress of Spanish Radiation Protection Society. The sessions were: 1.- Radiation protection and the environment. 2.- Radiation protection of the workers. 3.- Natural radiation. 4.- Biological effects of the radiations. 5.- Radiation protection of patients. 6.- Dosimetry. 7.- Quality control. 8.- Training on radiation protection. 9.- Legislation. (Author)

Towards harmonisation of radiation protection in Europe: European IRPA Congress 2002: Florence, Italy, 8-11 October 2002: proceedings

International Nuclear Information System (INIS)

D'Alberti, F.; Osimani, C.

2002-01-01

The first European IRPA Congress, involving most of the European countries, is proposed to replace various European regional congresses, providing the opportunity to European radiation protection Societies to define, together with IRPA, a common strategy towards the harmonisation, diffusion and, above all, the defence and growth of radiation protection culture. Many European Societies, together with Israel, an historical partner in the regional Mediterranean congresses, will participate as well as delegates from international organizations, with their scientific contributions on contemporary subjects. Therefore, this Congress will provide the opportunity for contact and communication among experts, to discuss and analyse relevant aspects in science, medicine, engineering and legislation with the aim of gathering necessary information for the protection of people and the environment from ionising radiation. During the Congress, an IRPA Associate Societies Forum will take place, where common problems will be examined and where the possibility of enhancing the role of IRPA and the co-operation among Associate Societies will be discussed

7. international congress of radiation research

International Nuclear Information System (INIS)

Musilek, L.

1984-01-01

The congress was held in Amsterdam on July 3 to 8, 1983, with the participation of 1305 specialists from 44 countries. The number of papers came close to one thousand, most of them being posters. The congress met in 44 sessions grouped by problem areas of which there were five: A. Chemistry and Physics; B. Biology; C. Somatic and genetic effects; D. Biology and therapy of tumours; E. Dosimetry, radionuclides and technology. The congress brought out the immense quantitative growth of knowledge in the field of radiation biology and biochemistry. A general idea of the effects of radiation on organisms is yet to be attained. (Ha)

13th International Congress on Polymers in Concrete

OpenAIRE

Aguiar, J. L. Barroso de, ed. lit.; Jalali, Said, ed. lit.; Camões, Aires, ed. lit; Ferreira, Rui Miguel, ed. lit.; International Congress on Polymers in Concrete, 13, Madeira, 2010

2010-01-01

The 13th International Congress on Polymers in Concrete 2010 (13th ICPIC 2010) follows a series of 12 earlier successful congresses, which has been started in London in 1975. These congresses, being held every three years, played a key role in disseminating R&D findings between researchers, academics, industrials and students. The 13th ICPIC was again a forum to exchange knowledge and most recent research findings among participants. It represented a contribution to the development of this im...

New England Energy Congress project. Final report, June 1978-July 1980

Energy Technology Data Exchange (ETDEWEB)

None

1981-11-20

From May 1978 until April 1979, 120 New Englanders volunteered for one of six committees to devise and consider energy policy recommendations for the region's twenty-five Member, six state Congressional delegation. Sponsored by the New England Congressional Caucus and Tufts University, the New England Energy Congress was funded by grants from the Economic Development Administration, US Department of Commerce and the Office of Environment, US Department of Energy. The results of the work of the 120 delegates and nine staff was a 500 page report, Blueprint for Energy Action, containing over 150 policy recommendations to the Congress, Executive agencies, state legislatures and municipalities. The New England Congressional Caucus responded in June 1979 with an Energy Package, including twenty (and ultimately twenty-five) legislative bills and several letters to federal agencies, based on the recommendations of the Energy Congress. Following the release of the report in June 1979, 55 delegates continued their efforts as members of the Implementation Group of the Energy Congress. In July 1980, this group released a volume of Strategy Papers designed to assist in the implementation of Energy Congress recommendations. As a result of this work, a broad array of energy activities were initiated in New England and in Washington. By January 1981, 20 of the 25 bills in the Caucus package had been passed in whole or in part. This final report discusses the Energy Congress' activities, consensus decision-making process and its findings. The report reviews the results of a thorough evaluation conducted through the mail and by phone of participants, outside observers and from Capital Hill. The clear conclusion is that the Energy Congress made a unique and significant contribution towards enabling New Englanders, both in the region and in Washington, to set energy goals and priorities and to begin serious efforts to reduce the region's precarious dependence on oil imports.

Investigation of palladium-103 production and IR07-103Pd brachytherapy seed preparation

International Nuclear Information System (INIS)

Saidi, Pooneh; Sadeghi, Mahdi; Enferadi, Milad; Aslani, Gholamreza

2011-01-01

Highlights: → We report the cyclotron production of 103-palladium via 103 Rh(p,n) 103 Pd reaction. → 103 Pd was absorbed on resin beads for brachytherapy seed preparation. → The optimum absorption of 103 Pd in resin was achieved at 0.5 M HCl. → Version 5 of MCNP code was employed to model a new 103 Pd brachytherapy seed. - Abstract: In this study, design and fabrication of 103 Pd brachytherapy seed was investigated. The excitation functions of 103 Rh(p,n) 103 Pd and 103 Rh(d,2n) 103 Pd reactions were calculated using EMPIRE (version 3.1 Rivoli), ALICE/ASH and TALYS-1.2 codes, the TENDL-2010 database and compared with the published data. Production of 103 Pd was done via 103 Rh(p,n) 103 Pd nuclear reaction. The target was bombarded with 18 MeV protons at 200 μA beam current for 15 h. After irradiation and radiochemical separation of the electroplated rhodium target, the optimum condition for absorption of 103 Pd into Amberlite (registered) IR-93 resin was achieved at 0.5 M HCl. Version 5 of the (MCNP) Monte Carlo radiation transport code was employed to calculate the dosimetric parameters around the 103 Pd brachytherapy seed. Finally the calculated results were compared with published results for other commercial sources.

VI Congress of the Radiation Protection Spanish Society: Cordoba, 24-27 Sep 1996: lectures

International Nuclear Information System (INIS)

1996-01-01

This special issue of journal ''Radioproteccion'' complies the lectures presented at the VI Congress of the Radiation Protection Spanish Society. The sessions were: 1.- Radiation protection of people and environment 2.- Radiation protection workers. 3.- Natural radiation 4.- Biological effects of radiations 5.- Radiation protection of patients. 6.- Measurement of radiations 7.- Legislation 8.- Quality Control 9.- Training in radiation protection

The German REACH Congress 2016: a workshop report.

Science.gov (United States)

Reihlen, Antonia; Jepsen, Dirk; Broschinski, Lutz; Luch, Andreas; Schulte, Agnes

2018-03-01

In October 2016, the German REACH Congress was held at the German Federal Institute for Risk Assessment (BfR) in Berlin. Here, the associated improvement made in the fields of consumer protection and the progress in and experiences gained from the implementation of the authorisation procedure were discussed. Several speakers from EU institutions, German authorities, industry, and civil society organisations were invited to present their views. There was a shared consensus that REACH contributes to the advancement of consumer protection against chemical risks, mainly because more and higher quality information on substance-related hazards and potential exposures becomes available. In addition, risk management measures, particularly regarding restrictions on uses, scale down consumer exposures to chemicals. Opportunities for improvements identified at the congress include the quality of registration dossiers and the management of and communication on substances of very high concern (SVHC) that may be present in consumer articles. Although regarded as being in an early implementation phase, the authorisation process was generally found to be operational and progressing well. Criticism was expressed with regard to the consistency of authorisation decisions and the costs and uncertainties related to authorisation applications. Consumer protection legislation consists of several legal provisions which are interlinked. The congress participants agreed that REACH is an important element of this legal framework as it enhances and complements other legal provisions.

Status of legislation

International Nuclear Information System (INIS)

Warner, C.

1982-01-01

The status of the House legislation, the major differences between the House and Senate legislation and a preview of what is likely to take place during the lame duck session in December are presented. The House legislation provides: long-term program leading toward permanent disposal of nuclear waste; an interim program for storage and for expansion of storage space for spent fuel; provides an R and D component through what is called a test and evaluation facility; an alternative long-term storage program based on a proposal to be completed by the Department of Energy on what's called Monitored Retrievable Storage; full upfront financing of the program through user fees based on contracts between the government and the users of the nuclear waste disposal services

Meeting report on the 3rd International Congress on Developmental Origins of Health and Disease (DOHaD).

Science.gov (United States)

Gillman, Matthew W; Barker, David; Bier, Dennis; Cagampang, Felino; Challis, John; Fall, Caroline; Godfrey, Keith; Gluckman, Peter; Hanson, Mark; Kuh, Diana; Nathanielsz, Peter; Nestel, Penelope; Thornburg, Kent L

2007-05-01

Developmental origins of health and disease (DOHaD) focuses on the earliest stages of human development, and provides a novel paradigm to complement other strategies for lifelong prevention of common chronic health conditions. The 3 International Congress on DOHaD, held in 2005, retained the most popular features from the first two biannual Congresses, while adding a number of innovations, including increased emphasis on implications of DOHaD for the developing world; programs for trainees and young investigators; and new perspectives, including developmental plasticity, influences of social hierarchies, effects of prematurity, and populations in transition. Emerging areas of science included, first, the controversial role of infant weight gain in predicting adult obesity, diabetes, and cardiovascular disease. Second, in the era of epidemic obesity, paying attention to the over-nourished fetus is as important as investigating the growth retarded one. Third, environmental toxins appear to have abroad range of long-lasting effects on the developing human. Fourth, epigenetic mechanisms could unite several strands of human and animal observations, and explain how genetically identical individuals raised in similar postnatal environments can nonetheless develop widely differing phenotypes. Improving the environment to which an individual is exposed during development may be as important as any other public health effort to enhance population health world wide.

"Right to Try" Legislation Moving Through Congress: But Drug Companies and Some Patient Groups Want Changes.

Science.gov (United States)

Barlas, Stephen

2017-12-01

State "Right to Try" laws, which allow terminally ill patients to seek investigational treatments under certain circumstances, have created pressure for Congress to follow up with a federal law. Though facing opposition from patient advocates and the drug industry, a bill passed by the Senate is now making its way to the House.

Advanced Automotive Technologies annual report to Congress, fiscal year 1996

International Nuclear Information System (INIS)

NONE

1998-01-01

This annual report serves to inform the United States Congress on the progress for fiscal year 1996 of programs under the Department of Energy's Office of Advanced Automotive Technologies (OAAT). This document complies with the legislative requirement to report on the implementation of Title III of the Automotive Propulsion Research and Development Act of 1978. Also reported are related activities performed under subsequent relevant legislation without specific reporting requirements. Furthermore, this report serves as a vital means of communication from the Department to all public and private sector participants. Specific requirements that are addressed in this report are: Discussion of how each research and development contract, grant, or project funded under the authority of this Act satisfies the requirements of each subsection; Current comprehensive program definition for implementing Title III; Evaluation of the state of automotive propulsion system research and development in the United States; Number and amount of contracts and grants awarded under Title III; Analysis of the progress made in developing advanced automotive propulsion system technology; and Suggestions for improvements in automotive propulsion system research and development, including recommendations for legislation

Congress turns cold on fusion

International Nuclear Information System (INIS)

Marshall, E.

1984-01-01

A 5% cut in fusion research budgets will force some programs to be dropped in order to keep the large machinery running unless US and European scientists collaborate instead of competing. Legislators became uneasy about the escalating costs of the new devices. The 1984 budget of $470 million for magnetic fusion research is only half the projected cost of the Tokomak Fusion Core Experiment (TFCX) planned to ignite, for the first time, a self-sustaining burn. Planning for the TCFX continued despite the message from Congress. Work at the large institutions at Princeton, MIT, etc. may survive at the expense of other programs, some of which will lose academic programs as well. Scientists point to the loss of new ideas and approaches when projects are cancelled. Enthusiasm is growing for international collaboration

Receptive Congress, Resistant Executive: The Legislative Fight for Tribal Colleges in the '80s.

Science.gov (United States)

Deegan, Gregory G.

1997-01-01

Describes the legislative difficulties encountered in the struggle for tribal college funding in the 1980s, including executive classification of Native American higher education as nontrust, decreasing funds despite increased enrollment, and opposition from the Bureau of Indian Affairs. (18 citations) (YKH)

Advanced Automotive Technologies annual report to Congress, fiscal year 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-03-01

This annual report serves to inform the United States Congress on the progress for fiscal year 1996 of programs under the Department of Energy`s Office of Advanced Automotive Technologies (OAAT). This document complies with the legislative requirement to report on the implementation of Title III of the Automotive Propulsion Research and Development Act of 1978. Also reported are related activities performed under subsequent relevant legislation without specific reporting requirements. Furthermore, this report serves as a vital means of communication from the Department to all public and private sector participants. Specific requirements that are addressed in this report are: Discussion of how each research and development contract, grant, or project funded under the authority of this Act satisfies the requirements of each subsection; Current comprehensive program definition for implementing Title III; Evaluation of the state of automotive propulsion system research and development in the United States; Number and amount of contracts and grants awarded under Title III; Analysis of the progress made in developing advanced automotive propulsion system technology; and Suggestions for improvements in automotive propulsion system research and development, including recommendations for legislation.

10 CFR 32.103 - Schedule D-prototype tests for ice detection devices containing strontium-90.

Science.gov (United States)

2010-01-01

... water and the strontium-90 shall be considered leakage. (e) Observations. After each of the tests... 10 Energy 1 2010-01-01 2010-01-01 false Schedule D-prototype tests for ice detection devices... § 32.103 Schedule D—prototype tests for ice detection devices containing strontium-90. An applicant for...

Understanding Cancer Prognosis

Medline Plus

Full Text Available ... Book Legislative Activities Hearings & Testimonies Current Congress Legislative History Committees of ... Oncologist Anthony L. Back, M.D., a national expert on doctor-patient communications, talks with one of his patients about what ...

Parliamentary debates on death with dignity in Argentina: the rights of terminal patients on the legislative agenda, 1996-2012.

Science.gov (United States)

Alonso, Juan Pedro; Villarejo, Agustina; Brage, Eugenia

2017-01-01

This article examines the regulation on terminal patients' rights in Argentina at two points in time: the first attempts to regulate end-of-life rights (1996), and the "death with dignity" law passed by the National Congress (2011-2012). Comparative analysis allows us to observe variations among the individuals and situations included in the legislation, as well as in the conceptualization of autonomy and the interventions that is considered lawful refuse. The political context and the differential way that "death with dignity" entered the legislative agenda in each period determined the public's construction of the problem and thus the extent and result of the debates.

2nd European Congress of Mathematics

CERN Document Server

Katona, G; Recski, A; Sza’sz, D

1998-01-01

This is the second volume of the procedings of the second European Congress of Mathematics. Volume I presents the speeches delivered at the Congress, the list of lectures, and short summaries of the achievements of the prize winners. Together with volume II it contains a collection of contributions by the invited lecturers. Finally, volume II also presents reports on some of the Round Table discussions. This two-volume set thus gives an overview of the state of the art in many fields of mathematics and is therefore of interest to every professional mathematician. Contributors: Vol. I: N. Alon, L. Ambrosio, K. Astala, R. Benedetti, Ch. Bessenrodt, F. Bethuel, P. Bjørstad, E. Bolthausen, J. Bricmont, A. Kupiainen, D. Burago, L. Caporaso, U. Dierkes, I. Dynnikov, L.H. Eliasson, W.T. Gowers, H. Hedenmalm, A. Huber, J. Kaczorowski, J. Kollár, D.O. Kramkov, A.N. Shiryaev, C. Lescop, R. März. Vol. II: J. Matousek, D. McDuff, A.S. Merkurjev, V. Milman, St. Müller, T. Nowicki, E. Olivieri, E. Scoppola, V.P. Platon...

Federal Aviation Administration (FAA) Reauthorization : an overview of legislative action in the 111th Congress

Science.gov (United States)

2009-10-08

This report tracks the status of ongoing legislative action and debate related to FAA : reauthorization. It is organized into six major program areas: aviation system finance; airport : financing; FAA management and organizational issues; system capa...

Eighth Mendeleyev Congress on General and Applied Chemistry USSR.

Science.gov (United States)

1960-06-27

the congress a memorable gift - 9- 1- a silk -embroidered portrait of D.I. Mendeleyev. At the subsequent plenary sessions of the congress the...of zirconium and iron (E.M. Braynina); titanium and silicon (A.N. Nesmeyanov, O.V. Nogina, Yu.P. Kudryavtsev); aluminum trlalkyls (L.I. Zakharkin...of ™tr tents. __,,,__ M.Ye. Pronln, in his paper ««iffeet of Fertilizers on Yields of Corn and Amelioration of Its Quality«, called attention

MyD88 Signaling Regulates Steady-State Migration of Intestinal CD103+ Dendritic Cells Independently of TNF-α and the Gut Microbiota

DEFF Research Database (Denmark)

Hägerbrand, Karin; Westlund, Jessica; Yrlid, Ulf

2015-01-01

Intestinal homeostasis and induction of systemic tolerance to fed Ags (i.e., oral tolerance) rely on the steady-state migration of smallintestinal lamina propria dendritic cells (DCs) into draining mesenteric lymph nodes (MLN). The majority of these migratory DCs express the α integrin chain CD103......, and in this study we demonstrate that the steady-state mobilization of CD103+ DCs into the MLN is in part governed by the IL-1R family/TLR signaling adaptor molecule MyD88. Similar to mice with complete MyD88 deficiency, specific deletion of MyD88 in DCs resulted in a 50–60% reduction in short-term accumulation......, the proportion and phenotypic composition of DCs were similar in mesentericlymph from germ-free and conventionally housed mice. Although TNF-α was required for CD103+ DC migration to the MLN after oral administration of the TLR7 agonist R848, it was not required for the steady-state migration of these cells...

Satisfaction and behavioural intentions of congress attendees: Evidence from an international congress in Novi Sad Serbia

Directory of Open Access Journals (Sweden)

Dragićević Vanja

2010-01-01

Full Text Available The congress industry, as a part of business tourism sector, is globally recognized for its valuable economic contribution to tourism destinations. Regardless economic benefits, there are as well as numerous social, cultural and environmental benefits that congress industry brings to destinations. This is the reason why the congress industry is becoming one of the fastest growing sectors of tourism industry. At the same time, the congress destinations worldwide are competing in bidding international congresses. According to the Strategy of Tourism Development of the Republic of Serbia (2005, congress tourism is recognized as a quick win product that could contribute in a short period of 3 to 5 years to tourism development and image of Serbia. The cities of Belgrade, Novi Sad and Niš are identified as the congress destinations capable for hosting international congresses. Novi Sad, as administrative, economic, cultural, scientific and educational centre of the region of Vojvodina (northern part of Serbia and known as 'town of fairs'(it has long tradition in organizing fairs - since 1923 has strong potential for smaller international congresses. In order to improve quality of 'congress' tourist product, provide stability of congress destination and congress centers, it is necessary to understand meeting planners' and congress attendees' levels of satisfaction and reaction to their experience in destination. In Serbia there is no research regarding mentioned items. The aim of this paper is to examine and analyze the perspective of the congress attendees, as they are final consumers of congress tourist product and their experience and behavioural intentions regarding Novi Sad is thus essential to destination marketing and management organizations, congress centre, hotel managers and meeting planners. .

First Asian regional congress on radiation protection

Energy Technology Data Exchange (ETDEWEB)

Kumar, S K [Bhabha Atomic Research Centre, Bombay (India). Library and Technical Information Section

1975-12-01

Due to the rapid progress in the development of nuclear energy and its applications in medicine, agriculture and industry, the potential danger to targe groups of population due to radiation hazards has increased. Thus, radiation protection has become an important aspects of industrial and public hygiene. The article reviews the deliberations of the First Asian Regional Congress on Radiation Protection which was held during 15-20 December 1974 at the Bhabha Atomic Research Centre. 190 papers were presented on the following broad subjects: (1) organization of radiation protection services on a countrywide scale and significant problems and experiences; (2) research and cooperation, mutual assistance, education and training; (3) personnel monitoring; (4) nuclear industry risks and benefits; (5) radiation protection legislation and (6) panel discussions and regional international cooperation in the field of radiation protection.

PREFACE: XVII Congress of Bioengineering and VI Clinical Engineering Conference

Science.gov (United States)

Rocha, Darío

2011-09-01

at least 12 different countries. In the three days of planned activities, more than 800 participants were registered and over 2000 people visited the associated expo. Several symposia and thematic meetings were held simultaneously. Around 207 works were presented, each evaluated by two referees, and 181 presentations were finally accepted. The organizers of the Congress proposed that the 14 best works be published in the Journal of Physics Conference Series. A few of the speakers deserve a special mention: James Lin, PhD, USA, Wireless noninvasive sensing and physiological signatures and vital signs; Luis Kun, PhD, USA, Biomedical Engineering and Global Health Transformation: A vision of opportunities and challenges; Mario Munich, PhD, USA, Avances en Robótica y Aplicaciones en Salud (Advances in robotics and health applications); Jose Folgueras, PhD, Cuba, Generación de productos de alto valor agregado a través del conocimiento (Generating products adding value through knowledge); Daniel Goroso, PhD, Brazil, Avanço e tecnología en Medicina Física y Rehabilitación (Advances in technology in physical medicine and rehab); Adolfo Spangenberg, PhD, Brazil, Telemedicine and Health - New perspectivas in development countries; Francisco Rojo Pérez, PhD, Spain, Propiedades del Comportamiento Mecánico y la rotura de la aorta humana (Properties of mechanical behaviour and rupture of the human aorta); and Eduardo de Forteza, PhD, Argentina, La fusión del humanismo médico y la tecnología (Fusion between medical humanism and technology), among others. We would like to thank the institutions, universities, government bodies, and private enterprises that supported and facilitated this Congress, and the members of the Organizing Commitee: Eng David Astegiano (Science and Technology State Minister), Eng Carlos Cerruti (Past President of the Rosario Tecnology Center), Eng Viviana Rotger (Past President of SABI) and MSc Guillermo Civetta (Manager of RTP). The members of the

The humidifier disinfectant case and the legislative challenges of the 20th Congress

Directory of Open Access Journals (Sweden)

Taehyun Park

2016-08-01

Full Text Available A number of absurdities surrounding the humidifier disinfectant (HD incident may have occurred because 1 a judicial system operates on the underlying false assumption that the involved parties are equals in knowledge, information and resource mobilization capabilities, regardless of respective real status as company or individual; 2 there is a lack of a system that mandates a company to prevent and actively manage possible catastrophes; 3 the regulatory scheme makes companies believe that as long as they are complying with the existing regulations, they have satisfied all of their responsibilities. I believe that this issue is an opportunity to bring about changes in the judicial redress system, the system of internal management of manufacturers, and the regulatory system of the government. The following regulation amendments are needed to move towards the changes stated above. First, legislation relating to victim relief that is applicable to the HD incident must be established. Second, a risk management system must be formed within the manufacturing company and to this end an institutional environment for the system must be established within regulatory framework. Furthermore, legislation must be passed that could punish companies themselves that have caused severe damage to individuals because they had failed to take necessary actions to avoid foreseeable harm. Finally, the framework of regulation must be changed so that the company, who has the necessary information regarding the product and the component chemicals used in the product, must self-directed experiment and assessment of the safety of their own products.

African American legislators' perceptions of firearm violence prevention legislation.

Science.gov (United States)

Payton, Erica; Thompson, Amy; Price, James H; Sheu, Jiunn-Jye; Dake, Joseph A

2015-06-01

Firearm mortality is the leading cause of death for young African American males, however, few studies have focused on racial/ethnic minority populations and firearm violence. The National Black Caucus of State Legislators advocates for legislation that promotes the health of African Americans. Thus, the purpose of this study was to collect baseline data on African American legislators' perceptions regarding firearm violence in the African American community. A cross-sectional study of African American legislators (n = 612) was conducted to investigate the research questions. Of the 612 questionnaires mailed, 12 were not deliverable, and 170 were returned (28%). Utilizing a three wave mailing process, African American legislators were invited to participate in the study. The majority (88%) of respondents perceived firearm violence to be very serious among African Americans. Few (10%) legislators perceived that addressing legislative issues would be an effective strategy in reducing firearm violence among African Americans. The majority (72%) of legislators perceived the most effective strategy to reducing firearm violence in the African American community should focus on addressing societal issues (e.g. crime and poverty). After adjusting for the number of perceived barriers, the number of perceived benefits was a significant predictor of legislators' perceived effectiveness of firearm violence prevention legislation for 8 of the 24 potential firearm violence prevention legislative bills.

First Asian regional congress on radiation protection

International Nuclear Information System (INIS)

Kumar, S.K.

1975-01-01

Due to the rapid progress in the development of nuclear energy and its applications in medicine, agriculture and industry, the potential danger to targe groups of population due to radiation hazards has increased. Thus, radiation protection has become an important aspects of industrial and public hygiene. The article reviews the deliberations of the First Asian Regional Congress on Radiation Protection which was held during 15-20 December 1974 at the Bhabha Atomic Research Centre. 190 papers were presented on the following broad subjects: (1) organization of radiation protection services on a countrywide scale and significant problems and experiences; (2) research and cooperation, mutual assistance, education and training; (3) personnel monitoring; (4) nuclear industry risks and benefits; (5) radiation protection legislation and (6) panel discussions and regional international cooperation in the field of radiation protection. (S.K.K.)

Formulation of a possible advanced reactor legislative strategy and proposal

International Nuclear Information System (INIS)

1994-01-01

A number of initiatives have been taken to date regarding the formulation of legislation to support in various ways the DOE advanced nuclear reactor program. Among the more prominent of these are bills that have been introduced by Sen. Johnston (D-La) and Rep. Udall (D-Az) as well as a draft bill put together by the nuclear industry and that could be introduced by Rep. Stallings (D-Id). These legislative initiatives are presented in this paper

The role of congress in future disposal of fissile materials from dismantled nuclear weapons

International Nuclear Information System (INIS)

Donnelly, W.H.; Davis, Z.S.

1991-01-01

Assuming the Soviet Union remains intact as a major power and the superpowers do not retrogress to a new Cold War era, it is likely that the United States and the Soviet Union will eventually agree to deep cuts in their nuclear arsenals. Future arms control agreements may be coupled with companion agreements to stop production of fissile materials for nuclear weapons, to dismantle the warheads of the nuclear weapons, and to dispose of their fissile materials to prevent reuse in new warheads. Such agreements would be negotiated by the U.S. executive branch but probably would require ratification, funding, and enabling legislation from the U.S. Congress if they are to succeed. There follows a brief review of the ideas for disposal of fissile materials from dismantled nuclear warheads and the potential role and influence of the Congress in the negotiation, ratification, and implementation of U.S.-Soviet agreements for such disposal

103Ru/103mRh generator

International Nuclear Information System (INIS)

Bartos, B.; Kowalska, E.; Bilewicz, A.; Skarnemark, G.

2009-01-01

103m Rh is a very promising radionuclide for Auger electron therapy due to its very low photon/electron ratio. The goal of the present work was the elaboration a method for production of large quantities of 103m Rh for generator system. It was found that the combination of solvent extraction with evaporation of 103 RuO 4 followed by decomposition of H 5 IO 6 makes it possible to produce 103m Rh of high radionuclidic and chemical purity. (author)

Sensitivity of the ViroSeq HIV-1 Genotyping System for Detection of the K103N Resistance Mutation in HIV-1 Subtypes A, C, and D

Science.gov (United States)

Church, Jessica D.; Jones, Dana; Flys, Tamara; Hoover, Donald; Marlowe, Natalia; Chen, Shu; Shi, Chanjuan; Eshleman, James R.; Guay, Laura A.; Jackson, J. Brooks; Kumwenda, Newton; Taha, Taha E.; Eshleman, Susan H.

2006-01-01

The US Food and Drug Administration-cleared ViroSeq HIV-1 Genotyping System (ViroSeq) and other population sequencing-based human immunodeficiency virus type 1 (HIV-1) genotyping methods detect antiretroviral drug resistance mutations present in the major viral population of a test sample. These assays also detect some mutations in viral variants that are present as mixtures. We compared detection of the K103N nevirapine resistance mutation using ViroSeq and a sensitive, quantitative point mutation assay, LigAmp. The LigAmp assay measured the percentage of K103N-containing variants in the viral population (percentage of K103N). We analyzed 305 samples with HIV-1 subtypes A, C, and D collected from African women after nevirapine administration. ViroSeq detected K103N in 100% of samples with >20% K103N, 77.8% of samples with 10 to 20% K103N, 71.4% of samples with 5 to 10% K103N, and 16.9% of samples with 1 to 5% K103N. The sensitivity of ViroSeq for detection of K103N was similar for subtypes A, C, and D. These data indicate that the ViroSeq system reliably detects the K103N mutation at levels above 20% and frequently detects the mutation at lower levels. Further studies are needed to compare the sensitivity of different assays for detection of HIV-1 drug resistance mutations and to determine the clinical relevance of HIV-1 minority variants. PMID:16931582

Semiannual report to Congress, October 1, 1994--March 31, 1995

Energy Technology Data Exchange (ETDEWEB)

NONE

1995-04-01

The Office of Inspector General Semiannual Report to the Congress covers the period October 1, 1994, through March 31, 1995. The report summarizes significant audit, inspection and investigative accomplishments for the reporting period, a large number of which facilitated Department management`s efforts to improve management controls and ensure efficient and effective operation. Narratives of the most significant reports are grouped by six primary performance measures: (1) Recommendations accepted by management, (2) Audit/inspection savings, recoveries, and funds identified for better use, (3) Legislative/regulatory compliance to recommendations, (4) Positive impacts on the Department after implementation of recommendations, (5) Complaints resolved, and (6) Investigation recoveries, fines, and funds identified for better use.

World geothermal congress

International Nuclear Information System (INIS)

Povarov, O.A.; Tomarov, G.V.

2001-01-01

The World geothermal congress took place in the period from 28 May up to 10 June 2000 in Japan. About 2000 men from 43 countries, including specialists in the area of developing geothermal fields, creating and operating geothermal electrical and thermal plants and various systems for the earth heat application, participated in the work of the Congress. It was noted at the Congress, that development of the geothermal power engineering in the world is characterized by the large-scale application of geothermal resources for the electrical energy generation [ru

Generator separation of 103Ru//sup 103m/Rh

International Nuclear Information System (INIS)

Epperson, C.E.

1975-01-01

A generator for producing carrier-free Rh-103m was developed using a liquid extraction technique. Initially, Ru-103 chloride was converted to the sulfate by moderate fuming for 80 minutes in 1:1 sulfuric acid. The Ru-103 was then brought to its highest oxidation state with 0.2 N ceric sulfate. Ru-103 tetroxide was removed from an aqueous equilibrium solution of Ru-103/Rh-103m by three one-minute extractions into CCl 4 . The Rh-103m daughter was not extracted under these conditions. Yields of Rh-103m exceeded 90 percent theoretical. The Ru-103 removed by CCl 4 could be recovered by two hours of back-extraction into 2 M sulfuric acid containing 5 mg of sodium sulfite. A cyclic extraction system was made possible by employing sulfate media. Equilibrium Ru-103 could be repeatedly extracted and recovered, thereby producing a ''generator'' system for the production of Rh-103m. Ru-103 chloride can be converted to the sulfate and then stored for at least 38 days prior to extraction. By performing the fuming step whenever convenient, the time required to perform an extraction separation was reduced to 15 minutes. Prior treatment of glassware surfaces with dilute sulfuric acid prevented Ru-103 glass adsorption losses and made glassware much easier to decontaminate. Off-the-shelf reagent-grade CCl 4 could be used without further purification. Efforts to separate Rh-103m from Ru-103 by chromatography techniques were unsuccessful

2017 Gas Congress special

International Nuclear Information System (INIS)

Corbin, Patrick; Ferrier, Jerome; Holleaux, Didier; Vivier, Laurent; Gattaz, Pierre; Delga, Carole; Carenco, Jean-Francois; Sadamori, Keisuke

2017-01-01

This special issue of 'Gaz d'Aujourd'hui' journal is entirely devoted to the 2017 Gas Congress proceedings. The congress was organized in 5 round tables and 12 workshops: Round table 1 - COP 21 2 years after, workshops 1-6: 1 - digital transformation: what are the challenges for the gas sector? 2 - Which actors and what policies to fight against energy insecurity? 3 - Natural gas development: what fiscal signs? 4 - Terrestrial transportation: current situation and prospects; 5 - Consumers' perception of gas; 6 - industrial uses; Round table 2 - Maritime and fluvial LNG perspectives; Round table 3 - Territories, the new decision-makers, workshops 7-12: 7 - What energy regulation for tomorrow? 8 - How to succeed in injecting more and more green gas? 9 - Digital, data and emerging technologies (drones, blockchain..): challenges and applications for gas networks? 10 - Underground storage: a promising infrastructure? 11 - Security of supply: what new cooperation? 12 - Power-to-gas: a new way of energy valorization; Round table 4 - Gas and electricity, winning synergies; Round table 5 - The Europe of gas

Flooding in Pakistan: Overview and Issues for Congress

Science.gov (United States)

2010-09-21

Melissa D. Ho Specialist in Agricultural Policy mho@crs.loc.gov, 7-5342 Bruce Vaughn, Coordinator Specialist in Asian Affairs bvaughn...Carter Specialist in Natural Resources Policy 7-0854 ncarter@crs.loc.gov Agricultural Effects of Flooding Melissa D. Ho Specialist in Agricultural ... Policy 7-5342 mho@crs.loc.gov Flooding in Pakistan: Overview and Issues for Congress Congressional Research Service 26 Area of Expertise Name

2018 Congress Podium Abstracts

Science.gov (United States)

2018-02-21

Each abstract has been indexed according to first author. Abstracts appear as they were submitted and have not undergone editing or the Oncology Nursing Forum’s review process. Only abstracts that will be presented appear here. For Congress scheduling information, visit congress.ons.org or check the Congress guide. Data published in abstracts presented at the ONS 43rd Annual Congress are embargoed until the conclusion of the presentation. Coverage and/or distribution of an abstract, poster, or any of its supplemental material to or by the news media, any commercial entity, or individuals, including the authors of said abstract, is strictly prohibited until the embargo is lifted. Promotion of general topics and speakers is encouraged within these guidelines.

Cross section for the 103Rh(n,n')103Rhm reaction in the energy range 5.7 endash 12 MeV

International Nuclear Information System (INIS)

Miah, M.M.; Strohmaier, B.; Vonach, H.; Mannhart, W.; Schmidt, D.

1996-01-01

The 103 Rh(n,n ' ) 103 Rh m cross section was measured by the activation method in the neutron energy range 5.7 endash 12 MeV with an uncertainty of ≅5%. Monoenergetic neutrons produced by the D(d,n) 3 He reaction were used to irradiate metallic Rh samples at 0 degree relative to the deuteron beam. The K x rays from 103 Rh m were measured with a calibrated Si detector, and the neutron fluence was determined by means of a 238 U fission chamber. The measured cross sections resolve the discrepancies in previous data and agree with the results of recent statistical model calculations of the fast-neutron cross sections of rhodium. copyright 1996 The American Physical Society

Report explores Congress' science policy

Science.gov (United States)

Jones, Richard

Scientists interested in understanding how Congress develops science policy would find it useful to read a recent report by the Carnegie Commission on Science, Technology, and Government. “Science, Technology and Congress: Analysis and Advice from the Congressional Support Agencies” contains revealing insights about the often hard-pressed system that Congress uses to analyze science and technology issues.“Congress is on the front line of many battles over the directions of science and technology,” says the 70-page report. “The quality of congressional decisions on these issues often depends on the quality and usefulness of information and analysis made available to Congress.” The report describes the overwhelming amount of information received by members of Congress, few of whom have “substantial training or experience” in science and technology. Making this information understandable and useful is the role of the Office of Technology Assessment, the Congressional Research Service, the General Accounting Office, and the Congressional Budget Office.

21 CFR 14.10 - Applicability to Congress.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Applicability to Congress. 14.10 Section 14.10... HEARING BEFORE A PUBLIC ADVISORY COMMITTEE General Provisions § 14.10 Applicability to Congress. This part applies to Congress, individual Members of Congress, and other employees or representatives of Congress in...

Legislation.

Science.gov (United States)

Florio, David H.

1979-01-01

Highlights the issues to be dealt with during the 96th Congress including the establishment of a Department of Education, reauthorization of the Higher Education Act and related programs, and funding for fiscal 1980 and 1981. (JMF)

Diet pills and the cataract outbreak of 1935: reflections on the evolution of consumer protection legislation.

Science.gov (United States)

Margo, Curtis E; Harman, Lynn E

2014-01-01

An outbreak of cataracts in 1935 caused by dinitrophenol (DNP), the active ingredient of popular diet pills, highlighted the inability of the U.S. Food and Drug Administration (FDA) to prevent harmful drugs from entering the marketplace. Just two years earlier, the FDA used horrific images of ocular surface injury caused by cosmetics at the World's Fair in Chicago to garner public support for legislative reform. The FDA had to walk a fine line between a public awareness campaign and lobbying Congress while lawmakers debated the need for consumer protection. The cataract outbreak of 1935 was conspicuous in the medical literature during the height of New Deal legislation, but questions persist as to how much it affected passage of the proposed Food, Drug, and Cosmetic Act (of 1938). The legislation languished in committee for years. The cataract outbreak probably had little impact on the eventual outcome, but medical opinion concerning the safety of DNP may have contributed to the voluntary withdrawal of the diet drug from the market. We review the DNP cataract outbreak and examine it in context of the challenges facing regulatory reform at that time. Copyright © 2014 Elsevier Inc. All rights reserved.

20 CFR 401.170 - Congress.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Congress. 401.170 Section 401.170 Employees... Disclosure of Official Records and Information § 401.170 Congress. (a) We disclose information to either House of Congress. We also disclose information to any committee or subcommittee of either House, or to...

γ-detected NMR of sup(103m)RhFe

International Nuclear Information System (INIS)

Kempter, H.; Klein, E.

1977-01-01

Using the method of γ-detection, the NMR in the metastable 40 keV-state of 103 Rh in Fe (thin foils with diffused 103 Pd activity) was measured in external fields of 0.5 to 14 kG. We find a zero-field resonance frequency of ν 0 = (550.3 +- 0.5) MHz and a slope of dν/dH = -(0.933 +- 0.017) MHz/kG, yielding g = 1.22 +- 0.02. The resulting value for the hyperfine field, Hsub(hf) = (590 +- 10) kG, is inconsistent with that of an NMR measurement in the ground state of 103 Rh. Possible reasons for this discrepancy are discussed. (orig.) [de

First Mayan Women's Congress.

Science.gov (United States)

Teissedre, S

1997-01-01

In October 1997, over 200 participants attended the First Mayan Women's Congress in Mexico and called for financial assistance, capacity building, and training to help Mayan women escape poverty. The Congress was initiated by the UN Development Fund for Women in collaboration with the Small Grants Program of the UN Development Program. Traditionally, Mayan women and men have played distinct roles in society, and efforts are underway to increase gender sensitivity and achieve a new balance of power. Mayan women attending the Congress reported that they face daily challenges in gaining their husbands' approval for participation in income-generating activities outside of the home. Eventually, however, some husbands also start working in these enterprises and are learning to assume their share of domestic responsibilities. Mayan women have been forced to reevaluation their role in society by a prevailing agricultural and environmental crisis as well as a high unemployment rate. Crafts that were once produced only for household consumption are now considered for export. Because the women need funds to initiate income-generating activities, the Conference linked women's groups with development practitioners, policy-makers, and donors. The women requested financial aid for more than 30 specific projects, and Congress participants agreed to pursue innovate strategies to support the enterprises with funds, training, and technical assistance. The Congress also encouraged environmental nongovernmental organizations to include Mayan women in mainstream development activities. This successful Congress will be duplicated in other Mexican states.

Lesotho Medical Congress

African Journals Online (AJOL)

12 Okt 1974 ... The Medical Association of Lesotho held its first congress from 6 to 8 September 1974, in Maseru. In every respect it was a remarkable success, to the extent that the organising committee will be hard put to emulate it for the next congress. We cer- tainly speak for every delegate when we say that this was ...

Understanding Cancer Prognosis

Medline Plus

Full Text Available ... Book Careers at NCI Visitor Information Legislative Activities Hearings & Testimonies Current Congress Legislative History Committees of Interest ... Congressional Justification NCI Budget Fact Book Legislative Activities Hearings & Testimonies Current Congress Legislative History Committees of Interest ...

XVIIth Interntional Congress on Mathematical Physics

DEFF Research Database (Denmark)

This volume contains the proceedings of the XVIIth International Congress on Mathematical Physics. It is the main scientific event of the International Association of Mathematical Physics (IAMP). The Congress was held in Aalborg, Denmark, August 6-11, 2012.......This volume contains the proceedings of the XVIIth International Congress on Mathematical Physics. It is the main scientific event of the International Association of Mathematical Physics (IAMP). The Congress was held in Aalborg, Denmark, August 6-11, 2012....

"Wandering in the Desert": The Clinch River Breeder Reactor Debate in the U.S. Congress, 1972-1983.

Science.gov (United States)

Camp, Michael

2018-01-01

The experimental Clinch River breeder reactor, approved by the U.S. Congress in 1970 for construction in East Tennessee, would have used plutonium instead of uranium. The project drew the ire of environmentalists who insisted that plutonium was too dangerous for commercial use, along with opponents of nuclear proliferation. Tennessee's representatives in Congress, however, desired the jobs that the project would create, and formed legislative coalitions to ensure continued appropriations for the project. Funding lasted until 1983, when fiscal conservatives, concerned about ballooning cost projections, joined with environmentalists to defund the breeder. Interpretations of U.S. nuclear policy in the 1980s have often revolved around the Three Mile Island meltdown's aftermath, but Clinch River was not affected by the incident. Instead, the Clinch River controversy revolved around other unrelated issues. The Clinch River story therefore offers a corrective to accounts that privilege national public opinion at the expense of other variables.

Comparative dosimetry of prostate brachytherapy with I-125 and Pd-103 seeds via SISCODES/MCNP

Energy Technology Data Exchange (ETDEWEB)

Trindade, Bruno Machado; Falcao, Patricia Lima, E-mail: bmtrindade@yahoo.com [Nucleo de Radiacoes Ionizantes - Universidade Federal de Minas Gerais (NRI/UFMG), Belo Horizonte, MG (Brazil); Christovao, Marilia Tavares [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil); Trindade, Daniela de Fatima Maia [Centro Universitario Una, Belo Horizonte, MG (Brazil); Campos, Tarcisio Passos Ribeiro de [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil)

2012-09-15

Objective: The present paper is aimed at presenting a comparative dosimetric study of prostate brachytherapy with I-125 and Pd-103 seeds. Materials and Methods: A protocol for both implants with 148 seeds was simulated on a heterogeneous three-dimensional pelvic phantom by means of the SISCODES/MCNP5 codes. Dose-volume histograms on prostate, rectum and bladder, dose indexes D10, D30, D90, D0.5cc, D2cc and D7cc, and representations of the spatial dose distribution were evaluated. Results: For a D90 index equivalent to the prescription dose, the initial activity of each I-125 seed was calculated as 0.42 mCi and of Pd-103 as 0.94 mCi. The maximum dose on the urethra was 90% and 108% of the prescription dose for I-125 and Pd-103, respectively. The D2cc for I-125 was 30 Gy on the rectum and 127 Gy on the bladder; for Pd-103 was 29 Gy on the rectum and 189 Gy on the bladder. The D10 on the pubic bone was 144 Gy for I-125 and 66 Gy for Pd-103. Conclusion: The results indicate that Pd-103 and I-125 implants could deposit the prescribed dose on the target volume. Among the findings of the present study, there is an excessive radiation exposure of the pelvic bones, particularly with the I-125 protocol. (author)

32 CFR 270.19 - Reports to Congress.

Science.gov (United States)

2010-07-01

... 32 National Defense 2 2010-07-01 2010-07-01 false Reports to Congress. 270.19 Section 270.19... Reports to Congress § 270.19 Reports to Congress. Not later than September 23, 1998, the Commission will prepare and the Secretary will submit to Congress a report on the payment of claims under this part...

16 CFR 1015.12 - Disclosure to Congress.

Science.gov (United States)

2010-01-01

... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Disclosure to Congress. 1015.12 Section 1015...) § 1015.12 Disclosure to Congress. (a) All records of the Commission shall be disclosed to Congress upon a request made by the chairman or ranking minority member of a committee or subcommittee of Congress acting...

Annual report to Congress 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-07-01

Since its creation in 1977, the Energy Information Administration (EIA) has provided high-quality energy information products and services to a broad spectrum of customers across the Nation and around the world, including Congress, representatives of the print and broadcast news media, businesses, officials of Federal, State, and local agencies, foreign governments and international organizations, students, librarians, researchers, lawyers and private citizens. Our motto: {open_quotes}On-line or off the shelf, EIA is the first place to go for the last word in energy information.{close_quotes} Established as an independent statistical and analytical agency within the U.S. Department of Energy (DOE), EIA was charged by its enabling legislation with: (1) Maintaining a comprehensive data and information program on energy resources and reserves, energy production, energy demand, energy technologies, and related financial and statistical information relevant to the adequacy of energy resources to meet the Nation`s demands in the near and longer term future. (2) Developing and maintaining analytical tools and collection and processing systems; providing analyses that are accurate, timely, and objective; and providing information dissemination services. This report summarizes the reports and contact information issued by the EIA.

Annual report to Congress 1996

International Nuclear Information System (INIS)

1997-07-01

Since its creation in 1977, the Energy Information Administration (EIA) has provided high-quality energy information products and services to a broad spectrum of customers across the Nation and around the world, including Congress, representatives of the print and broadcast news media, businesses, officials of Federal, State, and local agencies, foreign governments and international organizations, students, librarians, researchers, lawyers and private citizens. Our motto: open-quotes On-line or off the shelf, EIA is the first place to go for the last word in energy information.close quotes Established as an independent statistical and analytical agency within the U.S. Department of Energy (DOE), EIA was charged by its enabling legislation with: (1) Maintaining a comprehensive data and information program on energy resources and reserves, energy production, energy demand, energy technologies, and related financial and statistical information relevant to the adequacy of energy resources to meet the Nation's demands in the near and longer term future. (2) Developing and maintaining analytical tools and collection and processing systems; providing analyses that are accurate, timely, and objective; and providing information dissemination services. This report summarizes the reports and contact information issued by the EIA

14 CFR 1232.103 - Definitions.

Science.gov (United States)

2010-01-01

... school accredited by the American Veterinary Medical Association's Council on Education or has a... NASA ACTIVITIES § 1232.103 Definitions. The following definitions of terms comply with the PHS Policy... this rule and PHS Policy. (d) Authorized NASA Official is the Director, Life Sciences Division, NASA...

Comparison of occupational noise legislation in the Americas: An overview and analysis

Directory of Open Access Journals (Sweden)

Jorge P Arenas

2014-01-01

Full Text Available The workplace contributes significantly to the total dose of daily noise to which a person is subjected. Therefore, millions of people around the world are exposed to potentially dangerous noise levels and consequently, there is an urgent, global need for legislation to adequately protect the auditory health of workers. Occupational noise legislation has been adopted in many of the countries with different degrees of comprehensiveness and varying levels of sophistication. This paper presents a global view of current legislation on occupational noise in the 22 countries that make up the Americas, that is, Latin America, Canada, and the United States. Upon analysis of the legislation, there are notable differences among countries in the defined values for permissible exposure limit (PEL and exchange rate. Of the countries that have regulations, the majority (81% use a PEL of 85 dBA. A PEL of 85 dBA and the 3-dB exchange rate are currently used by 32% of the nations in the Americas. Most nations limit impulsive noise exposure to a peak unweighted sound pressure level of 140 dB (or dBC, while a few use slightly lower limits. However, 27% of the countries in the region still have not established regulations with respect to permissible noise levels and exchange rates. This fact is leaving millions of workers in the Americas unprotected against occupational noise. Provide an overview and analysis of the current legislation on occupational noise in the 22 countries that make up the Americas. The information on legislation, regulations, and standards discussed in this paper were obtained directly from official government sources in each country, the International Labour Organization database, or through various colleagues in each country. (1 There are notable differences among countries in the defined values for PEL and exchange rate. (2 Of the countries that have regulations, the majority (81% use a PEL of 85 dBA. A PEL of 85 dBA and the 3-dB exchange

12th International Congress of Applied Mechanics

CERN Document Server

Vincenti, Walter

1969-01-01

This volume contains the Proceedings of the Twelfth International Congress of Applied Mechanics, held at Stanford University on August 26 to 31, 1968. The Congress was organized by the International Union of Theoretical and Applied Mechanics; members of the IUTAM Congress Committee and Bureau are listed under Congress Organization. The members of the Stanford Organizing Committee, which was responsible for the detailed organization of the Congress, are also given, as are the names of the sponsors and the industrial and educational organizations that contributed so generously to the financial support of the meeting. Those attending the Congress came from 32 countries and totaled 1337 persons, plus wives and children. A list of the registered participants is included in the volume. The technical sessions of the Congress comprised four General Lectures and 281 contributed papers, the latter being presented in groups of five simultaneous sessions. The final choice of the contributed papers was made on the basis o...

International Youth Nuclear Congress (IYNC)

International Nuclear Information System (INIS)

Janin, D.

2017-01-01

International Youth Nuclear Congress (IYNC) is the global network of a new generation of nuclear professionals to: Communicate the benefits of nuclear energy; Promote the peaceful use of nuclear science and technology; Facilitate knowledge transfer between generations; Provide a platform for networking. The benefits of IYNC's biannual congress maintain IYNC. Innovation for Nuclear: To propose and reward innovative ideas focused on nuclear technologies for a sustainable development; To support young energy in thinking innovative solutions. The congress is funded from sponsorship (between 1000 and 45,000 euros) and individual participant's registration fees (400 euros including meals, technical visit and networking events). Knowledge Transfer at IYNC congress involves Speakers: top managers and nuclear experts, Publication of technical papers, Face-to-face with keynote speakers and organising Workshops

The 18. World energy congress in Buenos Aires

International Nuclear Information System (INIS)

Boiteux, M.; Bellec, G.

2001-01-01

The World Energy Council held its 18. congress in Buenos Aires, Argentina, from 21 to 25 October 2001 on the theme: 'Energy markets: challenges of the new millennium'. Despite recent events, 3 sitting Heads of State, 25 ministers, around 3,000 delegates from 99 countries and numerous company managers took part in the congress. During the congress closing ceremony on 25 October, the World Energy Prize was awarded to Mr Marcel Boiteux, honorary president of WEC and EDF. In this paper, we publish the speech Mr. Boiteux pronounced during the congress as well as the tribute paid by French Energy Council President Mr. Ailleret. Our readers will also find the congress conclusions and recommendations as well as Gilles Bellec's impressions after the congress. On 13 December, the French Energy Council organised a conference in Paris to discuss the results of the Buenos Aires congress. We publish the conclusions hereafter, which have taken the form of a round table called 'What have we remembered about the Buenos Aires congress ?'. The half-day presentation of the congress works will be published in the French Energy Congress' next letter, due in February 2002. (authors)

The Role of Congress in the Strategic Posture of the United States, 1970-1980: Sufficiency to PD 59

Science.gov (United States)

2010-02-01

political and military leaders. Withdrawal from Vietnam—due in part to efforts by Congress to end the war— the Watergate scandal , the resignation of...Vietnam and Watergate . In the strategic arena, most Democrats and Republicans in Congress favored détente with the Soviet Union and an ongoing

International Multidisciplinary Microscopy Congress

CERN Document Server

Oral, Ahmet; Ozer, Mehmet; InterM; INTERM2013

2014-01-01

The International Multidisciplinary Microscopy Congress (INTERM2013) was organized on October 10-13, 2013. The aim of the congress was to bring together scientists from various branches to discuss the latest advances in the field of microscopy. The contents of the congress have been broadened to a more "interdisciplinary" scope, so as to allow all scientists working on related subjects to participate and present their work. These proceedings include 39 peer-reviewed technical papers, submitted by leading academic and research institutions from over 12 countries and representing some of the most cutting-edge research available. The 39 papers are grouped into the following sections: - Applications of Microscopy in the Physical Sciences - Applications of Microscopy in the Biological Sciences

A possible in vivo generator 103Pd/103mRh-Recoil considerations

International Nuclear Information System (INIS)

Rooyen, Johann van; Szucs, Zoltan; Rijn Zeevaart, Jan

2008-01-01

The use of Auger emitters as potential radiopharmaceuticals is increasingly investigated. One such radionuclide of interest is 103m Rh. This can be produced from 103 Ru or from 103 Pd in an in vivo generator. A potential problem with this concept is the recoil of the 103m Rh out of the carrier molecule and even out of the target cell. In order to determine whether this would happen in the 103 Pd/ 103m Rh case calculations were done to prove that this does not happen. From theoretical considerations it seems that the 103 Pd/ 103m Rh in vivo generator system would be possible

Hawaii state legislator views on e-cigarettes and likelihood of legislative action.

Science.gov (United States)

Juarez, Deborah Taira; Seto, Jason; Guimaraes, Alexander; Masterson, James; Davis, James; Seto, Todd B

2015-01-01

To examine perspectives on e-cigarette use and regulations in Hawaii through key informant interviews with state legislators. E-cigarette use is rapidly increasing, with sales in 2013 topping $1 billion in the United States, but e-cigarettes are still a largely unregulated industry. Although e-cigarettes are thought by most to be a healthier alternative to traditional cigarettes, long-term health effects are not yet known. Semistructured key informant interviews were conducted with Hawaii state legislators (n = 15). We found a lack of consensus among legislators, which suggests that substantial legislative action is unlikely in the upcoming session. However, most legislators believe that some type of incremental legislation will pass, such as enactment of a small tax, limitations on advertising to protect adolescents, or regulations concerning where people can use e-cigarettes. Legislators eagerly await further research to clarify the overall benefits and harms of e-cigarettes at both the individual and population levels.

The legislative and litigation history of special education.

Science.gov (United States)

Martin, E W; Martin, R; Terman, D L

1996-01-01

Between the mid 1960s and 1975, state legislatures, the federal courts, and the U.S. Congress spelled out strong educational rights for children with disabilities. Forty-five state legislatures passed laws mandating, encouraging, and/or funding special education programs. Federal courts, interpreting the equal protection and due process guarantees of the Fourteenth Amendment to the U.S. Constitution, ruled that schools could not discriminate on the basis of disability and that parents had due process rights related to their children's schooling. Congress, in legislation now retitled the Individuals with Disabilities Education Act (IDEA), laid out detailed procedural protections regarding eligibility for special educational services, parental rights, individualized education programs (IEPs), the requirement that children be served in the least restrictive environment, and the need to provide related (noneducational) services. Decisions on instructional matters such as curricula and the elements of the IEP remain the province of local and state authorities. Advocates for students with disabilities have continually sought separate (categorical) funding for special education services. Current movements toward block grants rather than categorical programs and toward greater inclusion of special education students in general education classrooms raise concerns in some quarters about whether students with disabilities will continue to have full access to the special services they need. While the cost of special services may be an unexpressed criterion in many decisions made by school districts, nowhere does the IDEA explicitly allow cost to be considered. Where a service is necessary for an individual child, cost considerations would not allow a school district to escape its obligations to the child. However, in instances where more than one appropriate configuration of services is available to meet a child's needs, the school district may be allowed to consider the cost

H.R. 1046: a Bill to grant the consent of the Congress to the Central Interstate Low-Level Radioactive Waste Compact. Introduced in the House of Representatives, Ninety-Ninth Congress, First Session, February 7, 1985, October 22, 1985 and December 5, 1985

International Nuclear Information System (INIS)

Anon.

1985-01-01

Congressional consent in H.R. 1046 to establish a low-level radioactive waste compact among the central states encourages a cooperative approach to improving the efficiency and reducing the risks of waste management. The states covered by the Act are Arkansas, Iowa, Kansas, Louisiana, Minnesota, Missouri, Nebraska, North Dakota, and Oklahoma. The enabling legislation outlines the rights and obligations of the compact member states as well as the procedures for developing and operating regional facilities. The term of the compact is 10 years, after which Congress may modify or repeal the Act

2018 Congress Poster Abstracts

Science.gov (United States)

2018-02-21

Each abstract has been indexed according to the first author. Abstracts appear as they were submitted and have not undergone editing or the Oncology Nursing Forum’s review process. Only abstracts that will be presented appear here. Poster numbers are subject to change. For updated poster numbers, visit congress.ons.org or check the Congress guide. Data published in abstracts presented at the ONS 43rd Annual Congress are embargoed until the conclusion of the presentation. Coverage and/or distribution of an abstract, poster, or any of its supplemental material to or by the news media, any commercial entity, or individuals, including the authors of said abstract, is strictly prohibited until the embargo is lifted. Promotion of general topics and speakers is encouraged within these guidelines.

18 CFR 401.119 - Disclosure to Congress.

Science.gov (United States)

2010-04-01

... 18 Conservation of Power and Water Resources 2 2010-04-01 2010-04-01 false Disclosure to Congress. 401.119 Section 401.119 Conservation of Power and Water Resources DELAWARE RIVER BASIN COMMISSION... Disclosure to Congress. All records of the Commission shall be disclosed to Congress upon an authorized...

7 CFR 1409.9 - Report to Congress.

Science.gov (United States)

2010-01-01

... 7 Agriculture 10 2010-01-01 2010-01-01 false Report to Congress. 1409.9 Section 1409.9 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF... CORPORATION § 1409.9 Report to Congress. The Secretary of Agriculture will annually report to the Congress...

National legislative and regulatory activities

International Nuclear Information System (INIS)

2012-01-01

This section gathers the following national legislative and regulatory activities sorted by country: Bulgaria: General legislation; Czech Republic: General legislation; France: General legislation, Regulatory infrastructure and activity; Germany: General legislation; India: Liability and compensation, Organisation and structure; Ireland: Radiation protection, General legislation; Korea (Republic of): Organisation and structure; Lithuania: Regulatory infrastructure and activity, Radioactive waste management, Radiation protection, international cooperation, Nuclear safety; Poland: General legislation; Romania: Environmental protection; Russian Federation: Radioactive waste management; Slovenia: Nuclear safety; Spain: Liability and compensation, Nuclear security; Sweden: Nuclear safety; Turkey: Radiation protection, Regulatory infrastructure and activity, Nuclear safety, Liability and compensation; United States: General legislation

10 CFR 9.109 - Report to Congress.

Science.gov (United States)

2010-01-01

... 10 Energy 1 2010-01-01 2010-01-01 false Report to Congress. 9.109 Section 9.109 Energy NUCLEAR REGULATORY COMMISSION PUBLIC RECORDS Government in the Sunshine Act Regulations § 9.109 Report to Congress. The Secretary shall annually report to the Congress regarding the Commission's compliance with the...

32 CFR 700.304 - Recommendations to Congress.

Science.gov (United States)

2010-07-01

... 32 National Defense 5 2010-07-01 2010-07-01 false Recommendations to Congress. 700.304 Section 700... The Secretary of the Navy § 700.304 Recommendations to Congress. After first informing the Secretary of Defense, the Secretary of the Navy may make such recommendations to Congress relating to the...

40 CFR 1603.13 - Report to Congress.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Report to Congress. 1603.13 Section... GOVERNMENT IN THE SUNSHINE ACT § 1603.13 Report to Congress. The CSB General Counsel shall annually report to the Congress regarding the Board's compliance with the Government in the Sunshine Act, including a...

49 CFR 801.41 - Reports to Congress.

Science.gov (United States)

2010-10-01

... 49 Transportation 7 2010-10-01 2010-10-01 false Reports to Congress. 801.41 Section 801.41... PUBLIC AVAILABILITY OF INFORMATION Other Board Documents § 801.41 Reports to Congress. The NTSB submits its annual report to Congress each year, in accordance with 49 U.S.C. 1117. The report will be...

45 CFR 1622.10 - Report to Congress.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 4 2010-10-01 2010-10-01 false Report to Congress. 1622.10 Section 1622.10 Public... MEETINGS UNDER THE GOVERNMENT IN THE SUNSHINE ACT § 1622.10 Report to Congress. The Corporation shall report to the Congress annually regarding its compliance with the requirements of the Government in the...

32 CFR 537.20 - Certification to Congress.

Science.gov (United States)

2010-07-01

... 32 National Defense 3 2010-07-01 2010-07-01 true Certification to Congress. 537.20 Section 537.20... BEHALF OF THE UNITED STATES § 537.20 Certification to Congress. Admiralty claims, including claims for... of the Army for approval and if in excess of $500,000 for certification to Congress for final...

18 CFR 16.15 - Commission recommendation to Congress.

Science.gov (United States)

2010-04-01

... recommendation to Congress. 16.15 Section 16.15 Conservation of Power and Water Resources FEDERAL ENERGY... 15 of the Federal Power Act § 16.15 Commission recommendation to Congress. Upon receipt of a... Congress. ...

12 CFR 650.25 - Report to Congress.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Report to Congress. 650.25 Section 650.25 Banks... GENERAL PROVISIONS § 650.25 Report to Congress. On a determination by the receiver that there are... submit to the Secretary of the Treasury and Congress a report on the financial condition of the...

21 CFR 20.87 - Disclosure to Congress.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Disclosure to Congress. 20.87 Section 20.87 Food... INFORMATION Limitations on Exemptions § 20.87 Disclosure to Congress. (a) All records of the Food and Drug Administration shall be disclosed to Congress upon an authorized request. (b) An authorized request for Food and...

Small Big Data Congress 2017

NARCIS (Netherlands)

Doorn, J.

2017-01-01

TNO, in collaboration with the Big Data Value Center, presents the fourth Small Big Data Congress! Our congress aims at providing an overview of practical and innovative applications based on big data. Do you want to know what is happening in applied research with big data? And what can already be

Elder Abuse: A National Disgrace. A Report by the Chairman of the Subcommittee on Health and Long-Term Care of the Select Committee on Aging. House of Representatives, Ninety-Ninth Congress, First Session.

Science.gov (United States)

Cravedi, Kathleen Gardner; And Others

This report presents the results of efforts of the Subcommittee on Health and Long-Term Care to examine the extent of elder abuse in the United States. The executive summary presents details of the actions taken by Congress to pass legislation (H.R. 7551) to help control unwarranted violence against the aged and by the states to pass elder…

38 CFR 1.507 - Disclosures to members of Congress.

Science.gov (United States)

2010-07-01

... Congress. 1.507 Section 1.507 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS... Disclosures to members of Congress. Members of Congress shall be furnished in their official capacity in any... which may not be furnished a claimant, the member of Congress shall be advised that the information is...

Ashtrays and signage as determinants of a smoke-free legislation's success.

Science.gov (United States)

Vardavas, Constantine I; Agaku, Israel; Patelarou, Evridiki; Anagnostopoulos, Nektarios; Nakou, Chrysanthi; Dramba, Vassiliki; Giourgouli, Gianna; Argyropoulou, Paraskevi; Antoniadis, Antonis; Gourgoulianis, Konstantinos; Ourda, Despoina; Lazuras, Lambros; Bertic, Monique; Lionis, Christos; Connolly, Gregory; Behrakis, Panagiotis

2013-01-01

Successful smoke-free legislation is dependent on political will, enforcement and societal support. We report the success and pitfalls of a non-enforced nationwide smoke-free legislation in Greece, as well as ways in which compliance and enforcement-related factors, including ashtrays and signage, may impact indoor secondhand smoke (SHS) concentrations. A follow-up study of venues (n=150, at baseline, n=75 at 2-year follow-up) in Greece assessed indoor particulate matter with a diameter less than 2.5 micrometers (PM 2.5 ) concentrations attributable to SHS smoke every six months for two years (n=455 venue/measurements). Following the implementation of the 2010 smoke-free legislation, mean PM2.5 concentrations attributable to SHS fell from 175.3 µg/m(3) pre-ban to 84.52 µg/m(3) immediately post-ban, increasing over subsequent waves (103.8 µg/m(3) and 158.2 µg/m(3) respectively). Controlling for potential influential factors such as ventilation, time of day, day of week, city and venue type, all post-ban measurements were still lower than during the pre-ban period (Wave 2 beta: -118.7, Wave 3 beta: -87.6, and Wave 4 beta: -69.9). Outdoor or indoor signage banning smoking was not found to affect SHS concentrations (beta: -10.9, p=0.667 and beta: -18.1, p=0.464 respectively). However, ashtray or ashtray equivalents were strong determinants of the existence of indoor SHS (beta: +67 µg/m(3), p=0.017). While the public may be supportive of smoke-free legislation, adherence may decline rapidly if enforcement is limited or nonexistent. Moreover, enforcement agencies should also focus on the comprehensive removal of ashtray equivalents that could act as cues for smoking within a venue.

Ashtrays and signage as determinants of a smoke-free legislation's success.

Directory of Open Access Journals (Sweden)

Constantine I Vardavas

Full Text Available INTRODUCTION: Successful smoke-free legislation is dependent on political will, enforcement and societal support. We report the success and pitfalls of a non-enforced nationwide smoke-free legislation in Greece, as well as ways in which compliance and enforcement-related factors, including ashtrays and signage, may impact indoor secondhand smoke (SHS concentrations. METHODS: A follow-up study of venues (n=150, at baseline, n=75 at 2-year follow-up in Greece assessed indoor particulate matter with a diameter less than 2.5 micrometers (PM 2.5 concentrations attributable to SHS smoke every six months for two years (n=455 venue/measurements. RESULTS: Following the implementation of the 2010 smoke-free legislation, mean PM2.5 concentrations attributable to SHS fell from 175.3 µg/m(3 pre-ban to 84.52 µg/m(3 immediately post-ban, increasing over subsequent waves (103.8 µg/m(3 and 158.2 µg/m(3 respectively. Controlling for potential influential factors such as ventilation, time of day, day of week, city and venue type, all post-ban measurements were still lower than during the pre-ban period (Wave 2 beta: -118.7, Wave 3 beta: -87.6, and Wave 4 beta: -69.9. Outdoor or indoor signage banning smoking was not found to affect SHS concentrations (beta: -10.9, p=0.667 and beta: -18.1, p=0.464 respectively. However, ashtray or ashtray equivalents were strong determinants of the existence of indoor SHS (beta: +67 µg/m(3, p=0.017. CONCLUSIONS: While the public may be supportive of smoke-free legislation, adherence may decline rapidly if enforcement is limited or nonexistent. Moreover, enforcement agencies should also focus on the comprehensive removal of ashtray equivalents that could act as cues for smoking within a venue.

7th WACBE World Congress on Bioengineering 2015

CERN Document Server

Lim, Chwee

2015-01-01

This volume publishes the proceedings of the WACBE World Congress on Bioengineering 2015 (WACBE 2015), which was be held in Singapore, from 6 to 8 July 2015. The World Association for Chinese Biomedical Engineers (WACBE) organizes this World Congress biannually. Our past congresses have brought together many biomedical engineers from over the world to share their experiences and views on the future development of biomedical engineering. The 7th WACBE World Congress on Bioengineering 2015 in Singapore continued to offer such a networking platform for all biomedical engineers. Hosted by the Biomedical Engineering Society (Singapore) and the Department of Biomedical Engineering, National University of Singapore, the congress covered all related areas in bioengineering.

SAAPMB summer school and congress

International Nuclear Information System (INIS)

1992-01-01

Medical and health physics are covered by the papers and posters presented at this congress. A third group within the Association, the group of Radiobiological Scientists, was expected to be formed during this congress. 67 articles have been indexed (44 papers and 23 poster presentations), and 8 articles have been considered to be out of scope for INIS

Influence of 103Pd radioactive stent on apoptosis of vascular smooth muscle cells

International Nuclear Information System (INIS)

Liu Yingmei; Wu Wei; Chen Xiaochao; Zhang Xuming; Wang Jingfeng; Wei Yulin; Yang Li

2003-01-01

Objective: To evaluate the influence of 103 Pd radioactive stent on apoptosis and its relative genes bcl-2 and bax in injured vascular media smooth muscle cells of rabbit abdominal arteries and to investigate the mechanism of 103 Pd radioactive stent for preventing restenosis after angioplasty. Methods: Fifty male New Zealand rabbits were randomized into stent group and 103 Pd stent group. Each group was subdivided into 5 sub-groups. Control group was set up. The study arteries were harvested at 3, 7, 14, 28 and 56 d after stenting and the pathomorphology, apoptosis analysis and in situ hybridization were performed to evaluate the expression of bcl-2 and bax mRNA. Results: The severity of the restenosis in 103 Pd stent group was less than that of stent group. It was most obvious at the 56th day (P 103 Pd stent group had much more apoptosis of vascular smooth muscle cells than stent group did and reached the peak at the 7th day, (14.72±0.53)% vs (12.42±1.13)% (P 103 Pd stent group was much lower than that of stent group at 3 to 28 d. The difference was most obvious at the 28th day after stenting, (18.43± 0.67)% vs (21.55±0.93)% (P 103 Pd stent group was higher than that of stent group, the peak was at the 7th day, (11.17±0.94)% vs (9.30±1.01)%. The ratio of bcl-2/bax in 103 Pd stent group was much lower than that of stent group at 3 to 28 d. Linear correlation analysis showed that there was significant negative correlation between bcl-2 mRNA and apoptosis. Between bax mRNA and apoptosis, the positive correlation was found (P 103 Pd radioactive stent induced more significant apoptosis in vascular media smooth muscle cells by promoting the expression of apoptosis related genes and relieved the expanding of restenosis

42 CFR 64a.103 - Definitions.

Science.gov (United States)

2010-10-01

... grant authorized by section 303 of the Act. Community Mental Health Centers Act means the Community Mental Health Centers Act (42 U.S.C. 2689 et seq.) other than Part D thereof. Experimental nature refers... OBLIGATED SERVICE FOR MENTAL HEALTH TRAINEESHIPS § 64a.103 Definitions. As used in this part: Act means the...

Simulative study on dose distribution of 103Pd stent in blood-vessel

International Nuclear Information System (INIS)

Yuan Shuyu; Dai Guangfu; Xu Zhiyong; Sun Fuyin; Xu Shuhe; Ma Fengwu

2003-01-01

Objective: To evaluate the dose distribution of 103 Pd stent in the blood-vessel. Methods: Simulative study on dose distribution of endovascular 103 Pd stent was conducted with thermoluminescence dosimeter. The vessel wall was substituted by muscle equivalent material in this simulative study. Results: When radioactivity of the study 103 Pd stent was 9.8 MBq the absorbed dose from the stent surface by muscle equivalent material was 9.8 Gy at 17 d (the half-life period of 103 Pd). The radioactivity of 103 Pd stent surface rapidly attenuated over the radial distance. 80% of the radioactivity at the area that was radially 0.4 mm apart from the stent surface was absorbed by the simulative blood-vessel wall. Conclusion: Endovascular 103 Pd stent does not exert significant injury on the surrounding organs or tissues

95. German Roentgen congress and 7. joint congress of the DRG and OeRG. Program with abstracts

International Nuclear Information System (INIS)

Diederich, Stefan; Lammer, Johannes

2014-01-01

The volume contains the program and the abstracts of the 95th German Roentgen congress and the 7th joint congress of the DRG and OeRG. The radiological focal points of the congress were thorax radiology (pneumology: lung fibrosis, emphysema); oncological radiology: skeletal carcinoma, lung carcinoma, kidneys, lung metastases, primary liver carcinoma, liver metastases. Further topics included radiology in hospitals and medical centers, tele-radiology, ambulant health care, legal issues, financial accounting and management issues. Several courses an specific radiological issues and radiological techniques were offered, including radiation protection and legal aspects.

Proceedings of the Third World Petroleum Congress. General Volume

Energy Technology Data Exchange (ETDEWEB)

1951-01-01

The following four papers which were presented at the Third World Petroleum Congress are included in this proceedings: (1) Some Recent Progress in Petroleum Chemistry; (2) Oilfields of the Middle East; (3) Heat and Power from Petroleum; (4) Benefits from Research to the Petroleum Industry. The first paper is in French. Besides these four papers, this proceedings includes the following: composition of councils and committees; national committees and their delegates; general report on preparation and results of the Third World Petroleum Congress; text of resolutions approved by the Congress at the final plenary session; table of sectional meetings; plenary opening session; reception by the Municipal Council of the Hague; official banquet; final plenary session; history of petroleum congress; list of members of the Congress; contents of the Volumes I-X of the Third World Petroleum Congress; index of names occurring in Volumes I-XI of the Proceedings of the Third World Petroleum Congress; list of errata and addenda for Volumes I-XI.

XXVI UIA Congress and General Assembly in Seoul

Directory of Open Access Journals (Sweden)

Elena Grigoryeva

2017-12-01

Full Text Available The article presents the results of the UIA World Congress and several fragments of the manifesto. It also touches on the participation of the Russian delegation in the previous Congresses. The important role of the Congresses in the dynamics of the current urbanization processes is pointed out.

22 CFR 181.7 - Transmittal to the Congress.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Transmittal to the Congress. 181.7 Section 181... PUBLICATION OF INTERNATIONAL AGREEMENTS § 181.7 Transmittal to the Congress. (a) International agreements.... Background statements, while not expressly required by the act, have been requested by the Congress and have...

National congress of radiation protection

International Nuclear Information System (INIS)

2001-01-01

The congress of radiation protection tackled different areas of radiation protection. The impact of ionizing radiations on environment coming from radioactive activities. The biological radiation effects, the dosimetry, the different ways of doing relative to radiation protection,the risks analysis and the communications with populations, information about accidents and the lessons learned from them are included in this congress. (N.C.)

Associations between membership of farm assurance and organic certification schemes and compliance with animal welfare legislation.

Science.gov (United States)

KilBride, A L; Mason, S A; Honeyman, P C; Pritchard, D G; Hepple, S; Green, L E

2012-02-11

Animal health (AH) defines the outcome of their inspections of livestock holdings as full compliance with the legislation and welfare code (A), compliance with the legislation but not the code (B), non-compliance with legislation but no pain, distress or suffering obvious in the animals (C) or evidence of unnecessary pain or unnecessary distress (D). The aim of the present study was to investigate whether membership of farm assurance or organic certification schemes was associated with compliance with animal welfare legislation as inspected by AH. Participating schemes provided details of their members, past and present, and these records were matched against inspection data from AH. Multivariable multilevel logistic binomial models were built to investigate the association between compliance with legislation and membership of a farm assurance/organic scheme. The percentage of inspections coded A, B, C or D was 37.1, 35.6, 20.2 and 7.1 per cent, respectively. Once adjusted for year, country, enterprise, herd size and reason for inspection, there was a pattern of significantly reduced risk of codes C and D compared with A and B, in certified enterprises compared with the enterprises that were not known to be certified in all species.

XI AUTISM-EUROPE INTERNATIONAL CONGRESS

Directory of Open Access Journals (Sweden)

Jasmina TROSHANSKA

2016-04-01

Full Text Available In the period from 16th to 18th September 2016 in the historic city of Edinburgh the 11th International Congress of Autism Europe organized by the National Organization for Autism from the UK will be held. Theme of the Congress in 2016 will be "happy, healthy and empowered". The Congress will focus on the most recent developments in the field of autism, including causes, genetics, diagnosis, early intervention, treatments, education, support, employment, rights and policies, and many more. The improvement of the science, the rights and services for autistic people will be presented, and an insight into future developments of the events, knowledge and technologies for autistic people that may soon become a part of everyday life will be provided.

IAEA participation in the International Congress of Radiology

International Nuclear Information System (INIS)

1963-01-01

The congress is organized every three years, and the latest was held at Montreal, Canada, from 25 August to 1 September, and was attended by about 4000 persons, including approximately 2000 full members. Four scientists from the Agency's staff took part in the congress as full members, and out of a total of 517 scientific papers presented at the congress, three were by the Agency participants. The Agency also participated in a scientific exhibition, which was held along with the congress, with a display entitled 'The Contribution of IAEA to Radiology'

The return of the phoenix: the 1963 International Congress of Zoology and American zoologists in the twentieth century.

Science.gov (United States)

Johnson, Kristin

2009-01-01

This paper examines the International Congress of Zoology held in Washington D.C. in 1963 as a portrait of American zoologists' search for effective and rewarding relationships with both each other and the public. Organizers of the congress envisioned the congress as a last ditch effort to unify the disparate subdisciplines of zoology, overcome the barriers of specialization, and ward off the heady claims of more reductionist biologists. The problems zoologists faced as they worked to fulfill these ambitious goals illuminate some of the challenges faced by members of the naturalist tradition as they worked to establish disciplinary unity while seeking public support in the competitive world of twentieth century science.

Legislation and regulation

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-09-01

This document presents the fulfilling of the Brazilian obligations under the Convention on Nuclear Safety. The Chapter 3 of the document contains some details about the Brazilian legislation and regulation, the nuclear and environmental licensing, and emergency preparedness legislation.

Legislation and regulation

International Nuclear Information System (INIS)

1998-01-01

This document presents the fulfilling of the Brazilian obligations under the Convention on Nuclear Safety. The Chapter 3 of the document contains some details about the Brazilian legislation and regulation, the nuclear and environmental licensing, and emergency preparedness legislation

Reduction of secondhand tobacco smoke in public places following national smoke-free legislation in Uruguay.

Science.gov (United States)

Blanco-Marquizo, Adriana; Goja, Beatriz; Peruga, Armando; Jones, Miranda R; Yuan, Jie; Samet, Jonathan M; Breysse, Patrick N; Navas-Acien, Ana

2010-06-01

Smoke-free legislation eliminating tobacco smoke in all indoor public places and workplaces is the international standard to protect all people from exposure to secondhand smoke. Uruguay was the first country in the Americas and the first middle-income country in the world to enact a comprehensive smoke-free national legislation in March 2006. To compare air nicotine concentrations measured in indoor public places and workplaces in Montevideo, Uruguay before (November 2002) and after (July 2007) the implementation of the national legislation. Air nicotine concentrations were measured for 7-14 days using the same protocol in schools, a hospital, a local government building, an airport and restaurants and bars. A total of 100 and 103 nicotine samples were available in 2002 and 2007, respectively. Median (IQR) air nicotine concentrations in the study samples were 0.75 (0.2-1.54) microg/m(3) in 2002 compared to 0.07 (0.0-0.20) microg/m(3) in 2007. The overall nicotine reduction comparing locations sampled in 2007 to those sampled in 2002 was 91% (95% CI 85% to 94%) after adjustment for differences in room volume and ventilation. The greatest nicotine reduction was observed in schools (97% reduction), followed by the airport (94% reduction), the hospital (89% reduction), the local government building (86% reduction) and restaurants/bars (81% reduction). Exposure to secondhand smoke has decreased greatly in indoor public places and workplaces in Montevideo, Uruguay, after the implementation of a comprehensive national smoke-free legislation. These findings suggest that it is possible to successfully implement smoke-free legislations in low and middle-income countries.

Ideas suggested by the Nuclear Inter Jura Congress 1975 at Aix-en-Provence

International Nuclear Information System (INIS)

Nocera, Fabrizio

1976-01-01

The increasing importance of nuclear law in the sphere of juridical disciplines is stressed, in particular, as illustrated by various contributions among the ones presented at the Congress, which took place from 29 September to 3 October 1975, by the experts of countries and organizations. The Italian papers deal with the problems raised by the construction of off-shore nuclear power plants and the recent development of the national nuclear legislation, the US papers refer to the current problems, due to potential conflicts between nuclear legislation and that of other connected sectors; the great importance of the juridico-administrative aspects connected with the processing and disposal of radioactive wastes were recalled by the Dutch expert, in the framework of the wider regulations for the protection of the environment; emphasis is given to the originality and at the same time the practical importance of the questions dealt with by the NEA expert on the subject of modifications to nuclear plants in the course of operation, with particular regard to the problem of possible compensation for the operator. Finally, the expert of the Community presented a significant paper on the revision of the radiation protection directives which is in progress, owing to the influence they exert on the corresponding national norms. (author)

Legislation and supervision

International Nuclear Information System (INIS)

1998-01-01

In this part next aspects are described: (1) Legislative and supervision-related framework (reviews of structure of supervisory bodies; legislation; state supervision in the nuclear safety area, and state supervision in the area of health protection against radiation are given); (2) Operator's responsibility

Legislation and regulation

Energy Technology Data Exchange (ETDEWEB)

NONE

2001-09-01

This document presents the fulfilling of the Brazilian obligations under the Convention on Nuclear Safety. The Chapter 3 of the document contains some details about the Brazilian legislation and regulation, the legislative and regulatory framework, regulatory body and responsibility of the license holder.

Legislation and regulation

International Nuclear Information System (INIS)

2001-01-01

This document presents the fulfilling of the Brazilian obligations under the Convention on Nuclear Safety. The Chapter 3 of the document contains some details about the Brazilian legislation and regulation, the legislative and regulatory framework, regulatory body and responsibility of the license holder

Working with Your Legislative Delegation

Science.gov (United States)

Safransky, Robert J.

2010-01-01

In this article, the author discusses how to work with legislative delegation to get positive legislation passed. Most school districts have a person who is responsible for working with the legislators and informing them of the district's position on bills and issues that arise in each legislative session. Even if one has a full-time or part-time…

SAAPMB summer school and congress

International Nuclear Information System (INIS)

1991-01-01

The proceedings of the 31st annual congress of the South African Association of Physicists in Medicine and Biology are presented. Topics covered at the congress include: radiation physics; radiotherapy and computer applications in radiotherapy; isotope production; dosimetry; nuclear medicine; radiobiology, and radiation protection. 11 articles have been indexed (11 papers and 11 poster presentations). 11 articles were considered to be outside the subject scope of INIS

15 CFR 12.4 - Report to the Congress.

Science.gov (United States)

2010-01-01

... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Report to the Congress. 12.4 Section....4 Report to the Congress. Whenever the Secretary publishes a final determination under § 12.3(b)(4) or § 12.3(c)(5), he shall promptly report such determination to the Congress with a statement of the...

Prediction of palladium-103 production using the Monte Carlo code MCNPX

International Nuclear Information System (INIS)

Mahmodi, Mahbobeh; Sadeghi, Mahdi; Tenreiro, Claudio

2013-01-01

Highlights: ► The production of 103 Pd activity in 15 h of irradiation at 200 μA was calculated to be 685 mCi. ► MCNPX was used to calculate the energy distribution of the proton flux on the Rh target. ► The activity based on the MCNPX was calculated to be 674.58 mCi. - Abstract: The radionuclide 103 Pd (T 1/2 = 16.991 d; decays almost exclusively by EC to 103m Rh, T 1/2 = 56.114 min) has been of great interest in prostate and eye cancer therapy due to its suitable half-life and decay characteristics. 103 Pd has been produced by proton irradiation of a 103 Rh target through the 103 Rh(p,n) 103 Pd reaction. In this paper, the Monte Carlo simulation code (MCNPX) was used to calculate the energy distribution of the proton flux on the Rh target. The activity based on the MCNPX was calculated to be 674.58 mCi. Good agreement between the theoretical and the experimental data of the 103 Pd activity and the activity estimation based on MCNPX calculation was observed. This study demonstrated that MCNPX provides a suitable tool for the simulation of radionuclide production using proton irradiation

[The flexibilization of the Brazilian legislation on pesticides and the risks to human health: analysis of Bill of Law 3,200/2015].

Science.gov (United States)

Almeida, Mirella Dias; Cavendish, Thais Araújo; Bueno, Priscila Campos; Ervilha, Iara Campos; Gregório, Luisa De Sordi; Kanashiro, Natiela Beatriz de Oliveira; Rohlfs, Daniela Buosi; Carmo, Thenille Faria Machado do

2017-07-27

This article aims to contribute to a reflection on pesticides, based on the Brazilian legal framework, from the perspective of protecting human health and the environment. This initiative is due to successive attempts to flexibilize the regulation of pesticides in Brazil, through bills of law in progress in the Brazilian National Congress. An analysis of Bill of Law 3,200/2015 was carried out. This bill of law represents a major setback to the legislative achievements for the regulation of pesticides, in order to alert to the risks to human health from exposure to these products and aggravated by other similar proposals.

STS-103 Pilot Scott Kelly during TCDT activities

Science.gov (United States)

1999-01-01

STS-103 Pilot Scott J. Kelly is ready to take his turn at driving a small armored personnel carrier that is part of emergency egress training during Terminal Countdown Demonstration Test (TCDT) activities. Behind him (left) is Mission Specialist Jean-Frangois Clervoy of France, who is with the European Space Agency. At right is Mission Specialist Steven L. Smith. The tracked vehicle could be used by the crew in the event of an emergency at the pad during which the crew must make a quick exit from the area. The TCDT also provides simulated countdown exercises and opportunities to inspect the mission payloads in the orbiter's payload bay. STS-103 is a 'call-up' mission due to the need to replace and repair portions of the Hubble Space Telescope. Although Hubble is operating normally and conducting its scientific observations, only three of its six gyroscopes are working properly. Four EVA's are planned to make the necessary repairs and replacements on the telescope. The other STS-103 crew members are Commander Curtis L. Brown Jr. and Mission Specialists C. Michael Foale (Ph.D.), John M. Grunsfeld (Ph.D.), and Claude Nicollier of Switzerland, who also is with the European Space Agency. The mission is targeted for launch Dec. 6 at 2:37 a.m. EST.

The potential impact of proposed hazardous air pollutant legislation on the US refining industry

International Nuclear Information System (INIS)

1989-11-01

The Administration has recently submitted a Clean Air Act Bill to Congress which would significantly modify the regulatory treatment of industrial hazardous air pollutants (air toxics). The adverse economic impacts of this legislation on the petroleum refining industry could be substantial. Depending on how EPA interprets the legislative language, the capital costs of compliance for the proposed bill could range from $1.3 to $15.0 billion. At the upper end of the range, costs of this order of magnitude would be over 2.5 times larger than the combined estimated cost of EPAs gasoline volatility (RVP) regulations and the proposed diesel sulfur content regulations. Potential compliance costs could be as much as $0.40 per barrel processed for large, complex refineries and as much as $0.50 per barrel for some small, simple refineries. For perspective, total refining costs, including a normal return on investment, are $4--5 per barrel. Because foreign refineries supplying the US will not be affected by the US air toxics regulations, US refineries may not be able to raise prices sufficiently to recover their compliance costs. For this reason, the air toxic legislation may put US refineries at an economic disadvantage relative to foreign competitors. Even under the best petroleum product market conditions, costs of $0.40 to $0.50 per barrel processed could reduce US Gulf refiner cash operating margins by as much as 29 percent. Under less favorable market conditions, such as the mid-80's when refiners were losing money, the hazardous air pollutant regulations could greatly increase US refiner operating losses and potentially lead to closure of some marginal refineries

10th International Geostatistics Congress

CERN Document Server

Rodrigo-Ilarri, Javier; Rodrigo-Clavero, María; Cassiraga, Eduardo; Vargas-Guzmán, José

2017-01-01

This book contains selected contributions presented at the 10th International Geostatistics Congress held in Valencia from 5 to 9 September, 2016. This is a quadrennial congress that serves as the meeting point for any engineer, professional, practitioner or scientist working in geostatistics. The book contains carefully reviewed papers on geostatistical theory and applications in fields such as mining engineering, petroleum engineering, environmental science, hydrology, ecology, and other fields.

World Energy Council 15th Congress

International Nuclear Information System (INIS)

Consejo Mundial de la Energia.

1992-01-01

All energetic aspects collected within the main topic 'Energy and life' are gathered in 14 volumes. Environmental questions were devoted special attention because of public concern. The congress resolved to promote clean technologies and renewable energies with less environmental impact but without forgetting profitability. Experts in energetic topics attended the Congress

Specific Statistics of Czech Legislation

Czech Academy of Sciences Publication Activity Database

Novák, František

2015-01-01

Roč. 5, č. 3 (2015), s. 162-183 ISSN 1805-8396 Institutional support: RVO:68378122 Keywords : legislation * quantitative description of legislation * structure and development of the legislation in the CR Subject RIV: AG - Legal Sciences

2nd ISAAC Congress

CERN Document Server

Gilbert, Robert; Kajiwara, Joji

2000-01-01

This book is the Proceedings of the Second ISAAC Congress. ISAAC is the acronym of the International Society for Analysis, its Applications and Computation. The president of ISAAC is Professor Robert P. Gilbert, the second named editor of this book, e-mail: gilbert@math.udel.edu. The Congress is world-wide valued so highly that an application for a grant has been selected and this project has been executed with Grant No. 11-56 from *the Commemorative Association for the Japan World Exposition (1970). The finance of the publication of this book is exclusively the said Grant No. 11-56 from *. Thus, a pair of each one copy of two volumes of this book will be sent to all contributors, who registered at the Second ISAAC Congress in Fukuoka, free of charge by the Kluwer Academic Publishers. Analysis is understood here in the broad sense of the word, includ­ ing differential equations, integral equations, functional analysis, and function theory. It is the purpose of ISAAC to promote analysis, its applications, and...

48 CFR 1305.403 - Requests from Members of Congress.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Requests from Members of Congress. 1305.403 Section 1305.403 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE... from Members of Congress. Requests from Members of Congress shall be handled in accordance with the...

Rhodium-103m generator

International Nuclear Information System (INIS)

Mamadaliev, N.; Levin, V.I.; Malinin, A.B.

1978-01-01

103 Pd separated from metal rhodium irradiated with deuterons has been used without a carrier for sup( 03m)Rh generator The generator of sup(103m)Rh is a column 6mm in diameter filled with an anionite in Cl - form (Dowex-2,8,200-400 mesh) with an adsorbed parent isotope of 103 Pd. As a result of its decay, a 103 Rh daughter isotope is accumulated, which can be washed out from the generator from time to time with a corresponding solution. To prepare the generator, 0.5g of the resin with an adsorbed 103 Pd is charged into the column containing 1g of the same resin. Washing out with 2N HCl yields more than 90% of sup(103m)Rh with a radionuclide purity of more than 99.99%

Antinomy in Legislation in Indonesia

Directory of Open Access Journals (Sweden)

Zainal Arifin Mochtar

2015-12-01

Full Text Available A number of reality for laws as a production of Parliament and President was canceled by the Constitutional Court, occur as a result of the legislation matter that plural reflects the injustice and legal uncertainty. The high number of judicial review becomes signal less accommodation of citizen interests and rights in a legislation product. The absence of arrangement harmony made by Parliament gives impact on plural legislation sued. This paper attempts to describe some debate antinomy that characterizes the existence of legislation in Indonesia. The analysis showed, antinomy-conflict-norm in the legislation is one thing that is difficult to avoid, especially given the poor-legislative process in the parliament today. In each establishment of legislation, synchronization and norms harmonization is not a major pressing point, but defeated by transnational politics inter-faction in the parliament that actually looked more dominant. But when these norms conflict constituted a rule of law which are simultaneous, dynamic, and meet legal ideals, would not be a problem. As long as not to cause harm to the fulfillment of constitutional rights of citizens.

Dosimetria comparativa de braquiterapia de próstata com sementes de I-125 e Pd-103 via SISCODES/MCNP

Directory of Open Access Journals (Sweden)

Bruno Machado Trindade

2012-10-01

Full Text Available OBJETIVO: O presente artigo visa apresentar um estudo dosimétrico comparativo de braquiterapia de próstata com sementes de I-125 e Pd-103. MATERIAIS E MÉTODOS: Um protocolo adotado para ambos os implantes com 148 sementes foi simulado em um fantoma tridimensional heterogêneo de pelve por meio dos códigos SISCODES/MCNP5. Histogramas dose-volume na próstata, bexiga e reto, índices de doses D10, D30, D90, D0,5cc, D2cc e D7cc, e representações de distribuição espacial de dose foram avaliados. RESULTADOS: A atividade inicial de cada semente de I-125, para que D90 seja equivalente à dose de prescrição, foi calculada em 0,42 mCi, e de Pd-103, em 0,94 mCi. A dose máxima na uretra foi 90% e 108% da dose de prescrição para I-125 e Pd-103, respectivamente. A D2cc para I-125 foi 30 Gy no reto e 127 Gy na bexiga, e para Pd-103 foi 29 Gy no reto e 189 Gy na bexiga. A D10 no osso do púbis foi 144 Gy para I-125 e 66 Gy para Pd-103. CONCLUSÃO: Os resultados indicam que os implantes de Pd-103 e I-125 puderam depositar a dose prescrita no volume alvo. Entre os achados, observou-se excessiva exposição de radiação nos ossos da pelve, principalmente no protocolo com I-125.

Changes in Tax Legislation and Social Responsibility of Taxpayers and Legislative Institutions

Directory of Open Access Journals (Sweden)

Štager Vesna

2018-03-01

Full Text Available The article deals with the cost of tax compliance which arises for taxpayers from tax complexity and the constant changes in tax legislation. A socially responsible institution for the fiscal aggression is the Financial Administration of the Republic of Slovenia, as its powers and responsibilities creates the tax position of individuals, businesses and the entire economy. The aim of our research is to encourage socially responsible behaviour of legislation institutions in adopting the tax legislation, which will help to improve the social responsibility of taxpayers and increase tax compliance.

Acid rain legislation update

International Nuclear Information System (INIS)

Storey, H.L.

1990-01-01

This paper presents the author's view that the coal industry should develop a strategy to respond to the global warming issue. A few weeks ago a speaker stated that the global warming issue placed coal at the crossroads. He stated that global warming legislation, could reduce the consumption of coal by approximately twenty-five percent, without global warming legislation coal would continue to grow at a approximately three percent per year. It is believed there is a path to be traveled between the two options, legislation or no legislation, that can result in coal obtaining the position as the primary fuel source for electrical generating throughout the world. This is a path the coal industry can define and should follow

103Pd decay

International Nuclear Information System (INIS)

Belyavenko, V.S.; Borozenets, G.P.; Vishnevskij, I.N.; Zheltonozhskij, V.A.

1986-01-01

103 Pd decay in different chemical states has been investigated. The change of the partial half-life period equal to 0.67±0.15% has been detected. The γ-spectrum has been measured to a high precision. The new data have been obtained on population probabilities of 103 Rh excited states and the total energy of decay for 103 Pd has been determined to a high precision (543.0±0.8). The values of log ft have been determined

International environmental legislation; Internationales Umweltrecht

Energy Technology Data Exchange (ETDEWEB)

Proelss, Alexander (ed.) [Trier Univ. (Germany)

2017-07-01

The book on international environmental legislation includes the following contributions: Development, sources and actors concerning the international environmental legislation, cross-national environmental justice, principles of the international environmental legislation, environmental protection by lawsuit, environmental protection and human right, environmental protection and trading, responsibility and liability, peaceful settlement of disputes, climatic change, preservation and sustainable use of the biodiversity, protection of air and space, oceanic protection, protection of inland waters, protection of the Antarctic and Arctic environment, waste and hazardous materials legislation.

National legislative and regulatory activities

International Nuclear Information System (INIS)

2015-01-01

This section treats of the following National legislative and regulatory activities: 1 - Canada: Liability and compensation; 2 - France: Liability and compensation; Nuclear safety and radiological protection; 3 - Greece: Organisation and structure; 4 - Hungary: General legislation; 5 - India: Liability and compensation; 6 - Japan: Liability and compensation; 7 - Korea: Liability and compensation; 8 - Lithuania: General legislation; Transport of radioactive material; 9 - Slovak Republic: International co-operation; Liability and compensation; 10 - Slovenia: General legislation; 11 - Switzerland: Liability and compensation; 12 - United States: Radioactive waste management

Absolute calibration of the Rh-103(n,n')Rh-103m reaction rate

International Nuclear Information System (INIS)

Taylor, W.H.; Murphy, M.F.; March, M.R.

1979-05-01

The uncertainties in determining the absolute values of the Rh-103(n, n') Rh-103m reaction rate (which is widely used as a neutron damage flux monitor) have been reduced to approximately +-5%. This has been achieved with the use of a calibrated source of Pd-103-Rh-103m activity supplied by the IAEA. Agreement to within 3% between measured and calculated values of the reaction rate (normalised to the U-238 fission rate) has been achieved. (author)

The International Congress of Mechanical Engineering and Agricultural Sciences – CIIMCA 2013

International Nuclear Information System (INIS)

Remolina-Millán, Aduljay; Hernández-Arroyo, Emil

2014-01-01

The organizing committee of The International Congress of Mechanical Engineering and Agricultural Sciences – CIIMCA 2013 – are pleased to present CIIMCA-2013: the first international conference focused on subjects of materials science, mechanical engineering and renewable energy organized by Mechanical Engineering Faculty of the ''Universidad Pontificia Bolivariana'' in Bucaramanga, Colombia. This conference aims to be a place to produce discussions on whole topics of the congress, between the scientists of Colombia and the world. We strongly believe that knowledge is fundamental to the development of our countries. For that reason this multidisciplinary conference is looking forward to integrate engineering, agricultural science and nanoscience and nanotechnology to produce a synergy of this area of knowledge and to achieve scientific and technological developments. Agriculture is a very important topic for our conference; in Colombia, agricultural science needs more attention from the scientific community and the government. In the Faculty of Mechanical Engineering we are beginning to work on these issues to produce knowledge and improve the conditions in our country. The CIIMCA conference is a great opportunity to create interpersonal relationships and networks between scientists around the world. The interaction between scientists is very important in the process of the construction of knowledge. The general chairman encourages and invites you to make friends, relationships and participate strongly in the symposia and all program activities. PhD Aduljay Remolina-Millán Principal Chairman, International Mechanical Engineering and Agricultural Sciences Congress – CIIMCA Msc Emil Hernández-Arroyo Principal Chairman, International Mechanical Engineering and Agricultural Sciences Congress – CIIMCA Conferencephotograph Conferencephotograph 'Universidad Pontificia Bolivariana seccional Bucaramanga' host of the first

15th Congress of European Hematology Association

NARCIS (Netherlands)

Chomienne, Christine; Guenova, Margarita; Hagenbeek, Antony; Lacombe, Catherine; McCann, Shaun; Foa, Robin

2010-01-01

Each year the annual congress of the European Hematology Association gathers clinicians, biologists and scientists dedicated to all fields of hematology. This year's Congress was held in Barcelona, Spain, and presented an appealing program with experts presenting state-of-the-art sessions to more

5 CFR 842.209 - Members of Congress.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Members of Congress. 842.209 Section 842.209 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL EMPLOYEES RETIREMENT SYSTEM-BASIC ANNUITY Eligibility § 842.209 Members of Congress. (a...

International Drug Discovery Science and Technology--BIT's Seventh Annual Congress.

Science.gov (United States)

Bodovitz, Steven

2010-01-01

BIT's Seventh Annual International Drug Discovery Science and Technology Congress, held in Shanghai, included topics covering new therapeutic and technological developments in the field of drug discovery. This conference report highlights selected presentations on open-access approaches to R&D, novel and multifactorial targets, and technologies that assist drug discovery. Investigational drugs discussed include the anticancer agents astuprotimut-r (GlaxoSmithKline plc) and AS-1411 (Antisoma plc).

Energy-efficiency glass walls using the optical rasters

Czech Academy of Sciences Publication Activity Database

Jirka, Vladimír; Čáp, J.; Jangl, J.; Wagner, J.; Pokorný, Jan

2000-01-01

Roč. 17, - (2000), s. 1870-1873 ISSN 0960-1481. [Word Renewable Energy Congress /6./. Brighton, 01.07.2000-07.07.2000] R&D Projects: GA ČR GA103/99/0562 Subject RIV: JE - Non-nuclear Energetics, Energy Consumption ; Use Impact factor: 0.175, year: 2000

Absolute calibration of the Rh-103 (n, n') Rh-103m reaction rate

International Nuclear Information System (INIS)

Taylor, W.H.; Murphy, M.F.; March, M.R.

1979-05-01

The uncertainties in determining the absolute values of the Rh-103 (n, n') Rh-103m reaction rate (which is widely used as a neutron damage flux monitor) have been reduced to ∼±5%. This has been achieved with the use of a calibrated source of Pd-103-Rh-103m activity supplied by the I.A.E.A. Agreement to within 3% between measured and calculated values of the reaction rate (normalised to the U-238 fission rate) has been achieved. (author)

30 CFR 77.103 - Electrical work; qualified person.

Science.gov (United States)

2010-07-01

... Section 77.103 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR COAL MINE SAFETY AND HEALTH MANDATORY SAFETY STANDARDS, SURFACE COAL MINES AND SURFACE WORK AREAS OF UNDERGROUND... Health Districts at regular intervals, or as demand requires. (d) A score of at least 80 percent on each...

National legislative and regulatory activities

International Nuclear Information System (INIS)

2014-01-01

This section of the Bulletin presents a summary of the recent national legislative and regulatory activities sorted by country and topic: - Algeria: Nuclear security. - France: Radioactive waste management; Nuclear safety and radiological protection; General legislation; International co-operation. - Germany: International trade. - Indonesia: Nuclear security, General legislation. - Ireland: Nuclear safety and radiological protection; General legislation. - Lithuania: Nuclear security; Nuclear safety and radiological protection. - Slovak Republic: International co-operation; Liability and compensation; Environmental protection. - Switzerland: Radioactive waste management. - United Arab Emirates: Liability and compensation. - United States: Radioactive waste management; Licensing and regulatory infrastructure

LLW Notes, Volume 12, Number 2

International Nuclear Information System (INIS)

Norris, C.; Brown, H.; Colsant, J.; Lovinger, T.; Scheele, L.; Shaker, M.A.

1997-02-01

Contents include the following articles: National Environmental Justice Advisory Council considers Ward Valley resolution; NGA urges Congressional and Presidential support for low-level radioactive waste compacts and transfer of federal land in Ward Valley; RFP issued for SEIS on Ward Valley land transfer; Illinois siting criteria finalized; Consideration of tribal concerns during Ward Valley siting process; State legislators' LLRW working group meets in D.C.; Upcoming state and compact events; Court calendar; Texas compact legislation introduced in Congress; Superfund reform is a priority for 105th Congress; High-level waste bill gets off to an early start; Fort Mojave petition NEJAC for Ward Valley resolution; EPA withdraws cleanup rule from OMB; Board ruling raises doubts about proposed Louisiana enrichment facility; DOE recommends external regulation by NRC; and Supplement--Background on environmental justice

LLW Notes, Volume 12, Number 2

Energy Technology Data Exchange (ETDEWEB)

Norris, C.; Brown, H. [eds.; Colsant, J.; Lovinger, T.; Scheele, L.; Shaker, M.A.

1997-02-01

Contents include the following articles: National Environmental Justice Advisory Council considers Ward Valley resolution; NGA urges Congressional and Presidential support for low-level radioactive waste compacts and transfer of federal land in Ward Valley; RFP issued for SEIS on Ward Valley land transfer; Illinois siting criteria finalized; Consideration of tribal concerns during Ward Valley siting process; State legislators` LLRW working group meets in D.C.; Upcoming state and compact events; Court calendar; Texas compact legislation introduced in Congress; Superfund reform is a priority for 105th Congress; High-level waste bill gets off to an early start; Fort Mojave petition NEJAC for Ward Valley resolution; EPA withdraws cleanup rule from OMB; Board ruling raises doubts about proposed Louisiana enrichment facility; DOE recommends external regulation by NRC; and Supplement--Background on environmental justice.

International Youth Nuclear Congress 2000. Film

International Nuclear Information System (INIS)

OST Film Production Studio; YDRNS Information Technology Services, Ltd.

2001-01-01

This CD-ROM contains 28 minutes 30 seconds of video-film about programme of International Youth Nuclear Congress 2000 (IYNC 2000). There is documentary video-film about IYNC 2000, also presented are: the Opening panel of the IYNC 2000, every day work of IYNC 2000, Congress people; the fun run; Entertainment excursion in Bratislava, about excursion in Mochovce NPP as well as in IAEA

Gambler’s fallacy and imperfect best response in legislative bargaining

Czech Academy of Sciences Publication Activity Database

Nunnari, S.; Zápal, Jan

2016-01-01

Roč. 99, September (2016), s. 275-294 ISSN 0899-8256 R&D Projects: GA ČR(CZ) GP14-27902P Institutional support: PRVOUK-P23 Keywords : legislative bargaining * experiments * quantal response Subject RIV: AH - Economics Impact factor: 0.904, year: 2016

Taking Congress Home: Effects of NC 4-H Congress on Youth Behaviors and Intentions

Directory of Open Access Journals (Sweden)

Benjamin Silliman

2008-03-01

Full Text Available This evaluation report describes the outcomes and quality of the 2006 North Carolina 4-H Congress, an annual five-day teen conference focused on citizenship, leadership, and service. A majority of returning youth cited Congress experiences as significant in their continued learning and practice in citizenship, leadership, and service learning. Likewise, most youth participants in the 2006 conference indicated that they planned to participate in more citizenship, community leadership, and service activities in their home communities. A Youth Program Climate survey revealed that youth viewed NC 4-H Congress as a setting where service was important, where they learned to accept differences, teamwork was emphasized, and where they were able to make a difference in the lives of others. Three implications of the evaluation report are discussed: 1 value of a youth leadership conference for educating and inspiring youth in citizenship, leadership, and service; 2 evaluation methodology, including engaging youth leaders in design and use of conference data; and 3 marketing and accountability opportunities resulting from program evaluations.

Measurement of 103mRh produced by the 103Rh(γ,γ')103mRh reaction with liquid scintillation counting

International Nuclear Information System (INIS)

Sekine, T.; Yoshihara, Kenji; Pavlicsek, I.; Lakosi, L.; Veres, A.

1989-01-01

A liquid scintillation counting technique was applied to measure the isotope 103m Rh (half life = 56.12 min) which is difficult to detect because its γ-ray is of low energy and low emission probability. Tris-(2,4-pentanedionato)rhodium(III) (Rh(acac) 3 ) was irradiated with bremsstrahlung of accelerated 3.2 MeV electrons by LINAC. The method has given a reliable calibration curve for the determination of 103m Rh radioactivity below Rh(acac) 3 concentrations of 2 mM. The integrated cross section of 103 Rh(γ,γ') 103m Rh determined by this method was found to be 6.8±3.4 μb MeV at 3.2 MeV. (author) 8 refs.; 5 figs

45 CFR 12.15 - Reports to Congress.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Reports to Congress. 12.15 Section 12.15 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION DISPOSAL AND UTILIZATION OF SURPLUS REAL PROPERTY FOR PUBLIC HEALTH PURPOSES § 12.15 Reports to Congress. The Secretary will make such...

Recoil effect on β-decaying in vivo generators, interpreted for 103Pd/103mRh

International Nuclear Information System (INIS)

Szucs, Zoltan; Rooyen, Johann van; Zeevaart, Jan Rijn

2009-01-01

The use of Auger emitters as potential radiopharmaceuticals is being increasingly investigated. One of the radionuclides of interest is 103m Rh, which can be produced from 103 Ru or 103 Pd in an in vivo generator. A potential problem, however, is the recoil of the 103m Rh out of the carrier molecule and even out of the target cell. In order to determine the likelihood of this happening in the 103 Pd/ 103m Rh, case calculations were made to prove that this does not happen. The equations were generalised for all radionuclides with an atomic mass of 10-240 as a tool for determining the recoil threshold of any β-emitting radionuclide.

Trade policy-making in a model of legislative bargaining

Czech Academy of Sciences Publication Activity Database

Celik, Levent; Karabay, Bilgehan; McLaren, J.

2013-01-01

Roč. 91, č. 2 (2013), s. 179-190 ISSN 0022-1996 R&D Projects: GA ČR(CZ) GAP402/12/0666 Grant - others:UK(CZ) UNCE 204005/2012 Institutional support: PRVOUK-P23 Keywords : trade policy * multilateral legislative bargaining * political economy Subject RIV: AH - Economics Impact factor: 2.443, year: 2013

Policy Making While Paradigms Shift: Understanding the Development of Policy Drought in the U.S. Congress 1981-2013

Science.gov (United States)

McCurdy, K. M.

2013-12-01

Ronald Reagan famously announced in his 1981 inaugural address that 'government is not the solution to our problem; government is the problem.' For the scientific community and Members of Congress of that time, who were partners in working within the scientific management policy paradigm and the meritocracy on which its technical expertise depended, these words were outside their paradigm of good public service. Despite this announcement of a new paradigm by the incoming President, their policy world continued undisturbed, finding points of agreement to make incremental improvements in policy. Executive branch actions in Reagan's two terms as president were dismissed as peculiar, although they were the beginnings of realizing a policy goal of reducing the size and influence of the federal government. The important parameters influencing policy making in the U.S. Congress, which party holds the majority that sets the agenda and schedules votes, seniority that determines leadership positions in the conference and caucus, specialization on policy by committee jurisdictions, vary little annually and thereby were treated as constants by participants and observers alike. But member replacement has policy consequences that are infrequently noted. Members die in office, retire, and lose re-election bids, while the new members replacing them do not replicate any of their institutional characteristics. The policy process continues seemingly unchanged, but there are changes that become apparent with time. By 2013, scientists are no longer unquestioning partners in shaping federal public policy. They have been ridiculed in congressional hearings and in media attacks. Meanwhile new legislative strategies are being tried, e.g. shutting down government, increasing the use of earmarks instead of peer review, filibuster threats, and repeated attempts to repeal laws are now common tactics in Congress. Science and Congress no longer seem to act as partners in policy making, but as

Proceedings of the 5. Regional congress on radiation protection and safety; 2. Iberian and Latin American Congress on Radiological Protection Societies; Regional IRPA Congress

International Nuclear Information System (INIS)

2001-01-01

The Fifth Regional Congress on Radiation Protection and Nuclear Safety has been held in Recife (Brazil), from 29th April to 4th May 2001. The congress was hosted by the Brazilian Radiation Protection Society, under the joint sponsorship of FRALC and UFPE-DEN Department of Nuclear Energy. Its designation as a Regional IRPA Congress has been requested. The main purpose of the meeting was to bring together professionals from the industry, universities and research laboratories to present and discuss the latest research results, and to review the state of the art on applied and fundamental aspects of the radiation protection. These specialists have talked about nuclear safety and radiological protection, radiation natural exposure, biological effect of radiation, radiotherapy and medical radiological safety, radiological safety in industry and research. In their discussions, also were included subjects related to radiological safety of nuclear and radioactive facilities, radioactive waste management, radioactive material transport, environmental radiological monitoring program, radiological emergency and accidents, instruments and dosimetry, basic safety standards of protection against radiation

Coping with EU environmental legislation

DEFF Research Database (Denmark)

Anker, Helle Tegner; de Graaf, Kars; Purdy, Ray

2015-01-01

A ‘burden reducing’ agenda has spurred an increased interest in how EU environmental legislation is transposed into national legislation—most prominently reflected in the principle of ‘no gold-plating’. Yet, an important question is to what extent transposition principles and practices may ensure...... on coherence and accessibility with respect to environmental legislation and that such issues deserve more attention in the transposition process.......A ‘burden reducing’ agenda has spurred an increased interest in how EU environmental legislation is transposed into national legislation—most prominently reflected in the principle of ‘no gold-plating’. Yet, an important question is to what extent transposition principles and practices may ensure...... a coherent and accessible body of environmental legislation, while at the same time ensuring adequate transposition of EU environmental legislation. This article analyses the existence, or emergence, of transposition principles and practices in three Member States—the United Kingdom, the Netherlands...

A Model Proposal on the Use of Creative Tourism Experiences in Congress Tourism and the Congress Marketing Mix

Directory of Open Access Journals (Sweden)

Özen Kırant Yozcu

2010-04-01

Full Text Available Congress tourism has a great importance for the extension of the tourism season, enhancement of employment opportunities and tourism revenues, promotion and efficient use of the facilities in the area. Creative Tourism provides an authentic feel for a local culture through informal, hands-on workshops and creative experiences. Ensuring that the attendants of congress tourism take part in creative tourism activities may be an example of the synergy to be achieved by including creative tourism in thecongress marketing mix. In this study the tourism marketing mix, programming, packaging, partnership, people, product, price, promotion, place, are adapted for congress tourism and a model which illustrates how to use the creative tourism experiences and activities within the marketing mix is proposed.

From Terrorism to Politics, the World Armenian Congresses (1979-1985

Directory of Open Access Journals (Sweden)

mustafa

2015-06-01

Full Text Available Armenians who had used terrorism in order to gain their independence since the second half of the 19th century continued this policy during the World War I and also after the war. When they began terrorism activities again in 1970s, their aim was to draw the attention of world public to Armenian Issue. Reaching their aim, Armenians also sought to move the issue into the political arena. To this end, in 1979, 1983 and 1985, the World Armenian Congresses were organized by the Swiss James Viktor Karnusyan. The overall objective of the Congresses was to combine the Armenians scattered in different parts of the world in a political platform and by doing so make world states, at first Turkey, accept the Armenian Genocide. However, two main problems were about the congresses. The first one was that these congresses were in the shadow of the terrorism, and the other one was that the traditional Armenian Parties did not support these congresses. Despite all of them, the decisions taken at the congresses, the National Council of Armenian that was created and Armenian Constitution which was declared had historical nature. In addition, it is evident that these congresses also had a role in transporting the Armenian issue into the Political platform.

Practically perfect: learning by doing at AVS congress.

Science.gov (United States)

2017-02-18

It has been some time since Cambridge vet school last hosted the annual AVS congress, which meant that this year's congress committee faced a steep learning curve. However, as Gill Harris reports, it rose to the occasion. British Veterinary Association.

Absolute calibration of the Rh-103 (n, n') Rh-103m reaction rate

Energy Technology Data Exchange (ETDEWEB)

Taylor, W.H.; Murphy, M.F.; March, M.R. [Reactor Physics Division, Atomic Energy Establishment, Winfrith, Dorchester, Dorset (United Kingdom)

1979-05-15

The uncertainties in determining the absolute values of the Rh-103 (n, n') Rh-103m reaction rate (which is widely used as a neutron damage flux monitor) have been reduced to {approx}{+-}5%. This has been achieved with the use of a calibrated source of Pd-103-Rh-103m activity supplied by the I.A.E.A. Agreement to within 3% between measured and calculated values of the reaction rate (normalised to the U-238 fission rate) has been achieved. (author)

7 CFR 1220.103 - Commerce.

Science.gov (United States)

2010-01-01

... 7 Agriculture 10 2010-01-01 2010-01-01 false Commerce. 1220.103 Section 1220.103 Agriculture... CONSUMER INFORMATION Soybean Promotion and Research Order Definitions § 1220.103 Commerce. The term commerce means interstate, foreign, or intrastate commerce. ...

26 CFR 5e.274-8 - Travel expenses of Members of Congress.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 14 2010-04-01 2010-04-01 false Travel expenses of Members of Congress. 5e.274...) INCOME TAX (CONTINUED) TEMPORARY INCOME TAX REGULATIONS, TRAVEL EXPENSES OF MEMBERS OF CONGRESS § 5e.274-8 Travel expenses of Members of Congress. (a) In general. Members of Congress (including any...

Separating Judicial from Legislative Reasoning in Moral Dilemma Interviews.

Science.gov (United States)

Langford, Peter E

1997-12-01

Unlike previous studies of the development of reasoning about moral dilemmas, the 2 studies reported separated judicial reasoning (the application of rules) from legislative reasoning (the justification of rules), as well as attending to other aspects of context, using a modification of the weakly interpretive scoring method of Langford and D'Cruz. This assigns justifications to relatively simple conceptually defined categories. Findings were in accord with substantially modified versions of the views of Piaget and Kohlberg, according to which legislative reasoning can be divided into 3 main types of stages in the period 7-21 years: heteronomy (Piaget) or egocentrism (Kohlberg); local groups (attention to group interests, harmony, and reciprocity in local groups), wider groups (attention to these thing in wider groups). Findings contradicted Gibbs's theory.

IRPA Regional Congress on Radiation Protection in Central Europe

International Nuclear Information System (INIS)

2003-01-01

The Congress proceedings included 93 papers. The IRPA Congress materials deals with progress the various IRPA initiatives to implement new radiation protection concepts. In accordance to this actual trends the main topics of the congress are 'Clearance levels and material release' and 'Environmental impact assessment of workplaces resp. facilities with radiation sources'. Papers and posters in all traditional radiation protection subjects (general aspects, biological effects of radiation, radiation protection in medicine, dosimetry, instrumentation, quality assurance)

IRPA Regional Congress on Radiation Protection in Central Europe

Energy Technology Data Exchange (ETDEWEB)

NONE

2003-07-01

The Congress proceedings included 93 papers. The IRPA Congress materials deals with progress the various IRPA initiatives to implement new radiation protection concepts. In accordance to this actual trends the main topics of the congress are 'Clearance levels and material release' and 'Environmental impact assessment of workplaces resp. facilities with radiation sources'. Papers and posters in all traditional radiation protection subjects (general aspects, biological effects of radiation, radiation protection in medicine, dosimetry, instrumentation, quality assurance)

The Third International Congress on Child Abuse and Neglect: Conference Highlights.

Science.gov (United States)

Besharov, Douglas J.

1981-01-01

Presents highlights from the Third International Congress on Child Abuse and Neglect. The topic of child sexual abuse dominated the Congress; other topics included malnutrition, research problems, and concerns of Third World countries. Recommendations of the Congress are summarized.

1991 SOLAR WORLD CONGRESS - VOLUME 1, PART I

Science.gov (United States)

The four-volume proceedings document the 1991 Solar World Congress (the biennial congress of the International Solar Energy Society) in Denver, CO, August 19-23, 1991. Volume 1 is dedicated to solar electricity, biofuels, and renewable resources. Volume 2 contains papers on activ...

2nd International Multidisciplinary Microscopy and Microanalysis Congress

CERN Document Server

Oral, Ahmet; Ozer, Mehmet

2015-01-01

The 2nd International Multidisciplinary Microscopy and Microanalysis Congress & Exhibition (InterM 2014) was held on 16–19 October 2014 in Oludeniz, Fethiye/ Mugla, Turkey. The aim of the congress was to gather scientists from various branches and discuss the latest improvements in the field of microscopy. The focus of the congress has been widened in an "interdisciplinary" manner, so as to allow all scientists working on several related subjects to participate and present their work. These proceedings include 33 peer-reviewed technical papers, submitted by leading academic and research institutions from over 17 countries and representing some of the most cutting-edge research available. The papers were presented at the congress in the following sessions: ·         Applications of Microscopy in the Physical Sciences ·         Applications of Microscopy in the Biological Sciences.

Proceedings of the 14. Congress of the Maria Sklodowska-Curie Polish Radiation Society

International Nuclear Information System (INIS)

Lankoff, A.; Wojcik, A.

2007-01-01

Held every three years Congress of the Polish Radiation Research Society presents the latest achievements in the radiation research. In 2007 participants presented 9 plenary lectures, 38 section lectures and 61 posters. Communications and posters covered four disciplines: (a) radiobiology and radiotherapy, (b) radiation chemistry and photochemistry, (c) non-ionizing radiation, (d) radioprotection and the environmental radiation

VII International Congress of Engineering Physics

Science.gov (United States)

2015-01-01

In the frame of the fortieth anniversary celebration of the Universidad Autónoma Metropolitana and the Physics Engineering career, the Division of Basic Science and Engineering and its Departments organized the "VII International Congress of Physics Engineering". The Congress was held from 24 to 28 November 2014 in Mexico City, Mexico. This congress is the first of its type in Latin America, and because of its international character, it gathers experts on physics engineering from Mexico and all over the globe. Since 1999, this event has shown research, articles, projects, technological developments and vanguard scientists. These activities aim to spread, promote, and share the knowledge of Physics Engineering. The topics of the Congress were: • Renewable energies engineering • Materials technology • Nanotechnology • Medical physics • Educational physics engineering • Nuclear engineering • High precision instrumentation • Atmospheric physics • Optical engineering • Physics history • Acoustics This event integrates lectures on top trending topics with pre-congress workshops, which are given by recognized scientists with an outstanding academic record. The lectures and workshops allow the exchange of experiences, and create and strengthen research networks. The Congress also encourages professional mobility among all universities and research centres from all countries. CIIF2014 Organizing and Editorial Committee Dr. Ernesto Rodrigo Vázquez Cerón Universidad Autónoma Metropolitana - Azcapotzalco ervc@correo.azc.uam.mx Dr. Luis Enrique Noreña Franco Universidad Autónoma Metropolitana - Azcapotzalco lnf@correo.azc.uam.mx Dr. Alberto Rubio Ponce Universidad Autónoma Metropolitana - Azcapotzalco arp@correo.azc.uam.mx Dr. Óscar Olvera Neria Universidad Autónoma Metropolitana - Azcapotzalco oon@correo.azc.uam.mx Professor Jaime Granados Samaniego Universidad Autónoma Metropolitana - Azcapotzalco jgs@correo.azc.uam.mx Dr. Roberto Tito Hern

Inspector General Semiannual Report to Congress - October 1, 2008 - March 31, 2009

Energy Technology Data Exchange (ETDEWEB)

None

2008-10-01

On behalf of the Department of Energy's Office of Inspector General, I am pleased to submit our Semiannual Report to Congress for the period ending March 31, 2009. The Report highlights key accomplishments of the Office of Inspector General, particularly pertaining to our efforts to ensure the economy, efficiency, and effectiveness of Department of Energy operations. Details pertaining to some of our most significant reviews and projects are presented in the Report. This reporting period has been quite eventful. On February 17, 2009, the President signed the American Recovery and Reinvestment Act of 2009. The stated intent of this new legislation is to strengthen the U.S. economy through the creation of new jobs, aiding State and local governments with budget shortfalls, cutting taxes for working families, and investing in the long-term health of the Nation's economic prosperity. The Recovery Act establishes the status of the Nation's energy supply as a prime focus. Specifically, the Department of Energy will receive approximately $40 billion for various energy, environmental, and science programs and initiatives. The passage of this legislation makes the coming months an exciting and transformative time for the Department of Energy and the Office of Inspector General. In recognition of the need for effective oversight to protect taxpayer interests, the Recovery Act includes the creation of the Recovery Act Accountability and Transparency Board and mandates specific actions by the Inspectors General. I will be a permanent member of this newly created Board, along with nine other Inspectors General whose agencies are significant recipients of Recovery Act funds. Since the passage of the legislation, my office has developed a strategy consistent with the objectives outlined in the Recovery Act. The overarching goal of the strategy is to ensure that the taxpayers interests relating to the performance and results of the Recovery Act are protected. During

Separation of rhodium-103m from ruthenium-103 by solvent extraction

International Nuclear Information System (INIS)

Chiu, J.H.; Landolt, R.R.; Kessler, W.V.

1978-01-01

The results for eight replications of the solvent extraction and purification procedures were /sup 103m/Rh yield, 100.9 +- 2.1% and 103 Ru contamination, 0.0%. The use of sodium hypochlorite as the oxidizing agent eliminated the need for fuming with 1:1 H 2 SO 4 to eliminate chlorides as was required when ceric sulfate was used as the oxidizing agent. The optimum pH for extraction of RuO 4 into CCl 4 was determined to be in the range 6.5 to 7.5. A boiling procedure was used to purify the extracted aqueous solution of /sup 103m/Rh

VGB congress 'Power Plants 2009'

International Nuclear Information System (INIS)

Anon.

2009-01-01

The VGB Congress 'Power Plants 2009' took place in Lyon/France from 23rd to 25th September 2009 and was themed 'Addressing Climate Change - Winning Public Acceptance through Advanced Technologies'. Nearly 1,300 participants attended the plenary and technical lectures and had the opportunity to discus the current topics of electricity and heat generation. The study carried out by VGB according to which EU-27 requires about 475.000 MW of new power plant capacity was also presented. Specific papers were addressing further topics. The Congress was rounded off by a side-programme and technical visits. (orig.)

21st European Congress of Obstetrics and Gynaecology

DEFF Research Database (Denmark)

Hornnes, Peter

2010-01-01

The 21st European Congress of Obstetrics and Gynaecology took place in Antwerp 5-8 May 2010. The congress provided the participants with an overview of recent scientific and clinical developments throughout the field of obstetrics and gynaecology, and these are summarized in this article....

Navigating SA's climate change legislation

International Nuclear Information System (INIS)

Dickey, Suzanne

2006-01-01

It is proposed that there should be a legislation to address climate change and Greenhouse Gas Emission Reduction Bill. South Australian Government Greenhouse Strategy and climate change legislation in light of the far-reaching implications this legislation could have on clients, who face the impacts of climate change in the business and natural environment. It is a commitment to reduce greenhouse gas emissions in South Australia by 2050 to 60 per cent of 1990 levels

National legislative and regulatory activities

International Nuclear Information System (INIS)

Anon.

2010-01-01

Belarus: general legislation with amendments to laws on the use of atomic energy (2009) and criminal law on acts concerning the use of radioactive sources and administrative law for non criminal violations of radiation safety requirement (2009). Egypt: general legislation with law on activities in the nuclear and radiation field (2010). France: radioactive waste management with a decree establishing a committee on industrial co-ordination of radioactive waste (2010) and third part liability with a law on the recognition and indemnification of victims of nuclear tests conducted by France (2010). Germany: general legislation with a tenth amendment to the atomic energy act (2010), and act on environmental impact assessment (2009) concerning organisation and structure we find a revised version of statutes of the Radiation Protection Commission (2009), about radiation protection we find an act on the protection against non-ionizing radiation (2009), and for transport of radioactive materials we have an ordinance on the international transport of dangerous goods by road (2009). Ireland: In radiation protection we have an order to amend Regulations on active implantable medical devices (2010). Italy: general legislation we have a decree setting out rules for the sitting, construction and operation of nuclear installations (2010). Romania: general legislation with a law on the reorganisation of public authorities (2009). Slovak Republic: general legislation with an amendment of the atomic act (2009). spain: radioactive waste management with a law regulation limited investment companies quoted on the real estate market (2009). Ukraine: general legislation with an overview of recent amendments to laws in the field of nuclear energy (2009). (N.C.)

23 CFR 646.103 - Application.

Science.gov (United States)

2010-04-01

... 23 Highways 1 2010-04-01 2010-04-01 false Application. 646.103 Section 646.103 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS RAILROADS Railroad-Highway Insurance Protection § 646.103 Application. (a) This part applies: (1) To a contractors' legal...

33 CFR 174.103 - Administration.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Administration. 174.103 Section 174.103 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED....103 Administration. The State casualty reporting system must be administered by a State agency that...

5 CFR 960.103 - Location.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Location. 960.103 Section 960.103 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL EXECUTIVE BOARDS § 960.103 Location. Federal Executive Boards have been established and shall continue in...

7th International Crop Science Congress Announcement

Institute of Scientific and Technical Information of China (English)

2016-01-01

August 14–19,2016 Beijing,China Crop Science—Innovation and SustainabilityInternational Crop Science Congress(ICSC)is a regular forum for crop scientists from around the world to integrate current knowledge into a global context and international applications.The Congress is organized about every four years beginning in July,1992.The International Crop Science Society has primary oversight for general

14 CFR 1201.103 - Administration.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Administration. 1201.103 Section 1201.103 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION STATEMENT OF ORGANIZATION AND GENERAL INFORMATION Introduction § 1201.103 Administration. (a) NASA is headed by an Administrator, who is appointed...

Congress ISAAC '97

CERN Document Server

Gilbert, Robert; Wen, Guo-Chun

1999-01-01

This volume of the Proceedings of the congress ISAAC '97 collects the contributions of the four sections 1. Function theoretic and functional analytic methods for pde, 2. Applications of function theory of several complex variables to pde, 3. Integral equations and boundary value problems, 4. Partial differential equations. Most but not all of the authors have participated in the congress. Unfortunately some from Eastern Europe and Asia have not managed to come because of lack of financial support. Nevertheless their manuscripts of the proposed talks are included in this volume. The majority of the papers deal with complex methods. Among them boundary value problems in particular the Riemann-Hilbert, the Riemann (Hilbert) and related problems are treated. Boundary behaviour of vector-valued functions are studied too. The Riemann-Hilbert problem is solved for elliptic complex equations, for mixed complex equations, and for several complex variables. It is considered in a general topological setting for mapping...

22nd International Congress of Theoretical and Applied Mechanics

CERN Document Server

Finn, Matthew

2013-01-01

The 22nd International Congress of Theoretical and Applied Mechanics (ICTAM) of the International Union of Theoretical and Applied Mechanics was hosted by the Australasian mechanics community in the city of Adelaide during the last week of August 2008. Over 1200 delegates met to discuss the latest development in the fields of theoretical and applied mechanics. This volume records the events of the congress and contains selected papers from the sectional lectures and invited lectures presented at the congresses six mini-symposia.

5 CFR 308.103 - Authority.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Authority. 308.103 Section 308.103 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS VOLUNTEER SERVICE § 308.103 Authority. Section 301 of the Civil Service Reform Act of 1978, Public Law 95-454, authorized Federal...

ICPES World Congress 2003

Directory of Open Access Journals (Sweden)

Chu-Pak Lau

2002-04-01

Full Text Available The XII World Congress on Cardiac Pacing and Electrophysiology is co-organised by the International Cardiac Pacing & Electrophysiology Society (ICPES and the Hong Kong College of Cardiology (HKCC. It will take place at the Hong Kong Convention and Exhibition Centre on February 19-22, 2003. The World Congress has been organized in various countries, including USA, France, The Netherlands, Japan, Canada, Austria, Israel, Argentina and Germany. The coming Congress is going to be held in the centre of Asia where East meets West – Hong Kong, which is now a Special Administrative Region of China since 1997. Hong Kong continues to enjoy a high degree of autonomy, and has remained an important center of finance, information technology, tourism, trade and exchange in Asia. In addition, it enjoys increasing interaction with the rapidly developing Mainland China. Developed with the assistance of a broadly represented International Scientific Advisory Committee, the scientific programme will feature 11 major topics - “Electrophysiology”, “Catheter Ablation”, “Pacing”, “Defibrillation”, “Pharmacology”, “Hybrid Therapy”, “Pediatric Arrhythmias”, “Arrhythmias for Allied Professionals”, “Genetics & Gene Therapy”, “ECG, Noninvasive Evaluation & Risk Stratification” and “Implantable Monitoring Devices”. It includes Plenary Sessions, Core Sessions, Expert Sessions, Featured Symposia, Live Demonstration, Teaching Courses, Abstract Presentations and Poster Sessions.

Preparation of 103Pd seed-molecular plating of 103Pd onto silver rod

International Nuclear Information System (INIS)

Zhang Chunfu; Wang Yongxian; Tian Haibin; Yin Duanzhi

2002-01-01

A method for 103 Pd 'molecular plating' onto the surface of a silver rod is reported. The optimal composition of the plating bath is as follows: palladium chloride 0.1 mol/l, formaldehyde 2 mol/l, nitric acid 1 mol/l, and formic acid 0.4 mol/l. The 103 Pd molecular plating procedure will last 25 min at 30 deg. C. This article provides a valuable experience for the preparation of 103 Pd brachytherapy seed

45 CFR 1386.103 - Discovery.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 4 2010-10-01 2010-10-01 false Discovery. 1386.103 Section 1386.103 Public... Hearing Procedures § 1386.103 Discovery. The Department and any party named in the Notice issued pursuant to § 1386.90 has the right to conduct discovery (including depositions) against opposing parties as...

5 CFR 535.103 - Authority.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Authority. 535.103 Section 535.103 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CRITICAL POSITION PAY AUTHORITY § 535.103 Authority. (a) Subject to a grant of authority from OPM in consultation with OMB and all other...

5 CFR 304.103 - Authority.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Authority. 304.103 Section 304.103... APPOINTMENTS § 304.103 Authority. (a) Basic authority. (1) When authorized by an appropriation or other statute... expert or consultant who works on a strictly intermittent basis may be appointed under this authority...

36 CFR 902.12 - Maintenance of statistics; annual report to Congress.

Science.gov (United States)

2010-07-01

...; annual report to Congress. 902.12 Section 902.12 Parks, Forests, and Public Property PENNSYLVANIA AVENUE...; annual report to Congress. (a) The Administrative Officer shall maintain records of: (1) The fees... committees of Congress. [41 FR 43143, Sept. 30, 1976, as amended at 48 FR 17354, Apr. 22, 1983] ...

20th International Congress of Theoretical and Applied Mechanics, ICTAM2000

Energy Technology Data Exchange (ETDEWEB)

Hassan, Aref

2000-08-27

The 20th International Congress of Theoretical and Applied Mechanics, ICTAM2000, was held in Chicago, IL, from August 27 - September 2, 2000. It was 32 years since the last of these congresses had been held in USA. A record number of researchers in the mechanical engineering sciences attended and presented their work. The Congress provided an opportunity for the US mechanics community to act as international hosts. Several universities, professional societies, private foundations and individuals, and Federal agencies provided financial support for the Congress.

Regulatory control, legislation and framework

International Nuclear Information System (INIS)

Parthasarathy, K.S.

1998-01-01

The legislation and regulations, a regulatory authority to authorise and inspect the regulated activities and to enforce the legislation and regulations, sufficient financial and man-power resources are the essential parts of a national infrastructure to implement the Basic Safety Standards. The legal framework consists of legislation (Act passed by Parliament) and the regulations (framed by the government and endorsed by the Parliament). This paper is primarily deals with the the legal framework set up in India for atomic energy activities

Annual report to Congress 1992

Energy Technology Data Exchange (ETDEWEB)

1993-03-25

By Congress in 1977 as an independent entity within the Department of Energy, the Energy Information Administration (EIA) is the principal and authoritative source of comprehensive energy data for the Congress, the Federal Government, the States, and the public. During 1992, EIA provided information and analysis in response to many energy-related issues and events, including Hurricane Andrew. In addition, EIA made substantial strides in a number of critical special projects, most notably development of the National Energy Modeling System, preparation of National Petroleum Council studies on petroleum refining and natural gas, and establishment of oxygenate data program mandated by the Clean Air Act Amendments of 1990. EIA also took advantage of new opportunities for international consultations and energy information exchanges. This report to Congress contains energy-related information on the following: petroleum; natural gas; integrated analysis and forecasting; electricity; coal; energy markets and end use, nuclear, statistical standards, and information services. The appendices include: data collection surveys of the Energy Information Administration; Analytic models of the Energy Information Administration; EIA publication -- EIA products available on diskette; and Major laws affecting EIA, 1974-1992.

Proceedings of the world heavy oil congress 2011

International Nuclear Information System (INIS)

2011-01-01

The World Heavy Oil Congress 2011 took place March 2011 in Edmonton, Alberta, Canada. This congress is an international gathering of heavy oil experts and professionals which takes place every 18 months to discuss issues and opportunities facing the heavy oil industry in terms of commercial, technical, regulatory and geo-political areas. Innovative solutions for improving performance, reducing costs and mitigating environmental impacts are presented. Hundreds of presentations were made, courses were delivered, and over 100 companies from 30 countries exhibited. The congress had support from various companies and government entities.This conference featured 133 papers, all of have been catalogued separately for inclusion in this database.

12 CFR 410.103 - Definitions.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Definitions. 410.103 Section 410.103 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES § 410.103 Definitions...

World Renewable Energy Congress - To Be Held In Denver In 1996

Science.gov (United States)

) announced today that they will host the World Renewable Energy Congress IV in Denver from June 15-21, 1996 to be held outside of the United Kingdom. The World Renewable Energy Congress, which meets every two include world leaders in renewable energy, banking and business. The Congress' objectives are to support

41 CFR 105-54.203-3 - Submission to Library of Congress.

Science.gov (United States)

2010-07-01

... Congress. 105-54.203-3 Section 105-54.203-3 Public Contracts and Property Management Federal Property... Submission to Library of Congress. The GSA Committee Management Officer furnishes a copy of each charter to the Library of Congress when or shortly after copies are filed with the requisite committees of the...

VGB Congress 'Power Plants 2006'

International Nuclear Information System (INIS)

Anon.

2006-01-01

The VGB Congress 'Power Plants' took place in Dresden, 27 th to 29 th September 2006 under the auspices of the Federal Minister for Economics and Technology, Michael Glos. The motto of this year's Congress was 'Future becomes Reality - Investments in New Power Plants'. More than 1,200 participants from Germany and abroad attended the plenary and technical lectures on the topics 'Market and Competition' as well as 'Technology, Operation and Environment' for information and discussion. Special papers were dealing with further issues like 'Generation Market in Europe', 'Clean Power Technology Platform', French policy for new power plants as well as potentials and technology of renewables. (orig.)

Harmonization of Legislation of a Candidate Country with EU Legislation: Insights from the Prism of the Citizens of Macedonia

Directory of Open Access Journals (Sweden)

Abdula Azizi

2013-05-01

Full Text Available Since the majority of the Western Balkan countries remain although they have expressed a willingness to join the EU, it is considered necessary to examine the topic of harmonization of national legislation of these countries with the EU legislation. So while until now, to this problem is not devoted adequate attention in scientific circles, it is considered necessary to explain and analyze the theoretical aspect of the harmonization of the legislation of the candidate countries with EU legislation, while they also learned things fr survey was conducted with the citizens of Macedonia where they express their opinions on the harmonization of Macedonian legislation and government policies related to Euro hope that in the future this work will encourage research and other activities related to government policy on the harmonization of national legislation with EU legislation.

7 CFR 1786.103 - Security.

Science.gov (United States)

2010-01-01

... 7 Agriculture 12 2010-01-01 2010-01-01 false Security. 1786.103 Section 1786.103 Agriculture... Prepayments on RUS Notes in the Event of a Merger of Certain RUS Electric Borrowers § 1786.103 Security. If... of providing security for loans the proceeds of which were used to prepay RUS Notes. Such lien...

Congress of the Polish Chamber of Tourism - Egypt 2017

Directory of Open Access Journals (Sweden)

Marek Napierała

2017-12-01

Full Text Available The aim of the article is to assess the effectiveness of the Congress of the Polish Chamber of Tourism 2017 in the elaboration of joint applications regarding the provision of substantive and logistical support to entrepreneurs as well as the pursuit of comprehensive regulation of tourism law; adaptation of Polish law to European standards. Research problems: What is the legal status in the field of tourism law regarding outgoing tourism, incoming tourism and MICE, children and youth tourism, domestic tourism and accommodation facilities, travel agents and air transport? What are the main problems of the industries and what are their solutions proposed? What is the position and conclusions of the Congress? Research methods: study of documents, source materials, study of Congress materials, interviews with participants of the Congress, personal participation in the Congress. The PIT Congress took place on 25.11. - 2.12.2017 in Egypt (Marsa Alam: "Groundbreaking changes in tourism law: challenges and problems". The aim of the Congress was to develop a common position in the field of tourism law on outgoing tourism, incoming tourism and MICE, children and youth tourism, domestic tourism and accommodation facilities, travel agents and air transport. PIT is the largest nationwide organization of the economic self-government of the tourism industry. Polish Chamber of Tourism, which is a full member of the European Union of Travel Agencies of the European Union (ECTAA. From the beginning of its existence (25 years of activity, it has been successfully applying for a new shape of tourist business in Poland. Conclusions: - trainings should be carried out using the latest laws, - substantive and logistical support should be provided to entrepreneurs, - strive for comprehensive regulation of tourism law, - tourism needs a host so that it can be prioritized as an important branch of the economy.

Legislations the field of food irradiation

International Nuclear Information System (INIS)

1987-05-01

An outline is given of the national legislation in 39 countries in the field of food irradiation. Where available the following information is given for each country: form of legislation, object of legislation including information on the irradiation treatment, the import and export trade of irradiated food, the package labelling and the authorization and control of the irradiation procedures

Observation of $D^0 - \\overline{D}^0$ oscillations

CERN Document Server

AUTHOR|(CDS)2075808; Abellan Beteta, C; Adametz, A; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, Th; Bay, A; Beddow, J; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Corti, G; Couturier, B; Cowan, G A; Craik, D; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dickens, J; Dijkstra, H; Diniz Batista, P; Dogaru, M; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jans, E; Jansen, F; Jaton, P; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, V; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Luo, H; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Maino, M; Malde, S; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Mazurov, A; McCarthy, J; McNulty, R; Meadows, B; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nikodem, T; Nisar, S; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Schaack, P; Schiller, M; Schindler, H; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sobczak, K; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A

2013-01-01

We report a measurement of the time-dependent ratio of $D^0 \\to K^+\\pi^-$ to $D^0 \\to K^-\\pi^+$ decay rates in $D^{*+}$-tagged events using 1.0 fb$^{-1}$ of integrated luminosity recorded by the LHCb experiment. We measure the mixing parameters $x'^2=(-0.9 \\pm 1.3)$x$10^{-4}, y'=(7.2 \\pm 2.4)$x$10^{-3}$ and the ratio of doubly-Cabibbo-suppressed to Cabibbo-favored decay rates $R_D=(3.52 \\pm 0.15)$x$10^{-3}$, where the uncertainties include statistical and systematic sources. The result excludes the no-mixing hypothesis with a probability corresponding to 9.1 standard deviations and represents the first observation of $D^0-\\bar{D}^0$ oscillations from a single measurement.

European Society of Cardiology (ESC) Annual Congress Report From Barcelona 2017.

Science.gov (United States)

Satoh, Kimio; Takahashi, Jun; Matsumoto, Yasuharu; Tatebe, Shunsuke; Aoki, Tatsuo; Kikuchi, Yoku; Hao, Kiyotaka; Ohyama, Kazuma; Nogi, Masamichi; Suda, Akira; Kasahara, Shintaro; Sato, Koichi; Ichijo, Sadamitsu; Shimokawa, Hiroaki

2017-11-24

From August 26th to 30th, the 2017 Annual Congress of the European Society of Cardiology (ESC 2017) was held in Barcelona, Spain. Despite the terrorism tradegy just before the ESC congress, the congress attracted many medical professionals from all over the world to discuss the recent topics in cardiovascular medicine in more than 500 sessions, including COMPASS (Cardiovascular OutcoMes for People using Anticoagulation StrategieS Trial), CANTOS (Canakinumab Anti-Inflammatory Thrombosis Outcomes Study), and ORION (which assessed the effect of a novel siRNA inhibitor to PCSK9 on reductions in low-density lipoprotein cholesterol). Japanese cardiologists and the Japanese Circulation Society greatly contributed to the congress. This report briefly introduces some late-breaking registry results, late-breaking clinical trials, and ESC Guidelines from the ESC 2017 Congress.

Synthesis of Automated Vehicle Legislation

Science.gov (United States)

2017-10-01

This report provides a synthesis of issues addressed by state legislation regarding automated vehicles (AV); AV technologies are rapidly evolving and many states have developed legislation to govern AV testing and deployment and to assure safety on p...

As the Economic Crisis Hits Home, Colleges Seek Help from Congress

Science.gov (United States)

Field, Kelly

2008-01-01

Congress is crafting a second economic-stimulus bill, and the nation's colleges, hit by the deepening fiscal crisis, want a share of the money. Over the last few weeks, colleges and their lobbyists have bombarded members of Congress with letters and phone calls seeking money for research, student aid, and infrastructure. However, Congress is…

Nuclear liability legislation in Slovenia

International Nuclear Information System (INIS)

Skraban, A.

2000-01-01

This paper gives some basic data about nuclear installations in Slovenia, reviews Slovenian national legislation in the field of third-party liability for nuclear damage, applicability of the international nuclear liability treaties in the Slovenian legal system and outlines some main provisions of national legislation. It also aims to give some facts about history and present status of nuclear insurance pool and the insurance of nuclear risks in Slovenia. Paper finally indicates also some future legislative steps with respect to nuclear third party liability, at national and international level. (author)

Flexibility in radiation protection legislation

International Nuclear Information System (INIS)

Beaver, P.F.; Gill, J.R.

1980-01-01

The UK approach to radiation protection legislation is described in detail. The advantages are outlined of a flexible approach whereby the objectives of the legislation are clearly identified but the means of achieving these are left open or qualified by terms such as 'where reasonably practicable'. The roles and viewpoints of management and unions in such an approach are discussed especially with respect to legislation such as the Health and Safety at Work Act. Specific topics include requirements for notification of use, criteria for controlled areas and the tasks of the radiation protection adviser. (UK)

Branching fraction measurement of (B)over-bar(0)-> D(*)+pi(-) and B--> D-(*)0 pi(-) and isospin analysis of (B)over-bar -> D-(*)pi decays

NARCIS (Netherlands)

Chen, J.Y.; Peters, K.; Zhang, L.L.; Chen, S.; Wang, W.; Li, X.H.; Baak, M.A.; Raven, G.; Snoek, H.; David, P.; Schroder, H.; de Groot, N.; Liu, H.; van Bakel, N.; Yu, Z.

2007-01-01

Using 65×106 Υ(4S)→BB̄ events collected with the BABAR detector at the PEP-II e+e- storage ring at the Stanford Linear Accelerator Center, we measure the color-favored branching fractions B(B̄0→D+π- )=(2.55±0.05±0.16)×10-3, B(B̄0→D*+π-)=(2. 79±0.08±0.17)×10-3, B(B-→D0π-)=(4.90±0. 07±0.22)×10-3 and

Tropanol esters of metallocene carboxylic acids. Syntheses, labelling with 103Ru and sup(103m)Rh and organ distribution

International Nuclear Information System (INIS)

Wenzel, M.; Wu, Y.

1988-01-01

The tropanol esters of the carboxylic acids of ferrocene, 103 Ru-ruthenocene and sup(103m)Rh-rhodocinium were synthezised. The organ distribution of the 103 Ru or sup(103m)Rh labelled tropanol-esters were investigated. Only the 103 Ru labelled ester showed a high heart/blood ratio. (author)

Invitation to the 17th international congress on photosynthesis research in 2016

NARCIS (Netherlands)

Amerongen, van Herbert; Croce, Roberta

2016-01-01

The 17th International Congress on Photosynthesis will be held from August 7 to 12, 2016 in Maastricht, The Netherlands. The congress will include an opening reception, 15 plenary lectures, 28 scientific symposia, many poster sessions, displays by scientific companies, excursions, congress

Legislation

International Nuclear Information System (INIS)

2002-01-01

This bulletin contains information about activities of the Nuclear Regulatory Authority of the Slovak Republic (UJD). In this leaflet the legislation activities of the UJD are presented. The Nuclear Regulatory Authority (UJD) of the Slovak Republic, as the central body, performs legislative activities within its competence and defines binding criteria in the area of nuclear safety. In the area of nuclear safety the Act No.130/1998 Coll. 'on peaceful use of nuclear energy' (Atomic Act) is the principal document which came into force on July 1, 1998. Based on the Atomic Act UJD issued decrees on special materials and installations, limits for maximum quantities of nuclear materials at which nuclear damage is not presumed. Furthermore, the regulations are issued which deal with provision of physical protection of nuclear material and radioactive waste, professional ability of employees at nuclear installations, registration and control of nuclear materials, emergency planning for the case of an incident or an events on nuclear installations at their decommissioning, transportation of nuclear materials and radioactive waste. Simultaneously, other 6 regulations are just before the before the completion and they are in various stages of the of the legislative process. In addition, UJD performs remarkable activities in legislative area by preparation of comments to drafts of other relating generally binding legal provisions of the Slovak Republic. UJD also acts as the participant of the review procedure in the area of technical standards and publication. UJD also issues documents which have character of the recommendations, so called safety guides. These guides contain methods and approach how to meet safety requirements presented in binding documents, as acts and decrees. In accordance with the Atomic act it is possible to use nuclear energy or make business in the area of nuclear energy only the basis of the authorisation issued by UJD. Authorisations are following

Solvent--solvent extraction of rhodium-103m from ruthenium-103 employing a sulfate-carbon tetrachloride medium

International Nuclear Information System (INIS)

Epperson, C.E.; Landolt, R.R.; Kessler, W.V.

1976-01-01

/sup 103m/Rh in equilibrium with parent 103 Ru was separated in yields of 94 percent of those theoretically possible. 103 Ru chloride was first converted to the tetroxide which was then extracted from an aqueous solution of the equilibrium mixture with carbon tetrachloride

Ninth Biennial Congress of the Association of Physicians

African Journals Online (AJOL)

4 Mei 1974 ... The 9th Biennial Congress of the Association of. Physicians of South Africa takes place on the campus of the University of Pretoria during the first week in July. There is every reason to expect that this will be a particularly interesting and im- portant congress and every effort is being made to ensure its ...

Abstratcs of the 5th American Rabbit Congress

Directory of Open Access Journals (Sweden)

5th American Rabbit Congress Toluca, Estado de México, Mexico, September 8-11, 2014

2015-03-01

Full Text Available The 5th American Rabbit Congress was held in Toluca, Mexico State, Mexico from September 8th to the 11th, 2014. Research works representing 14 countries were accepted to take part at the congress, including papers from Algeria, Argentina, Brazil, China, Costa Rica, Cuba, Egypt, France, Hungary, Italy, México, Uruguay, the USA and Venezuela. These research works highlight the enormous interest, effort and commitment of the scientific community that bonds the trinomium of Research+Innovation+Technology Transfer, in favour of the integral development of rabbit rearing as an important primary activity that generates permanent employment, as well as healthy and nutritive meals for their respective countries for the XXI Century World. One major impact at this 5th American Rabbit Congress was the participation of Argentina, Brazil and China. The latter country’s report was presented by Laping Wu and Dong Wang (2014, showing that from 2005 to 2010, meat production of swine, beef and poultry underwent average growth of 2.6%, whereas rabbit meat production reported an annual average growth of 6.29%, reaching an annual volume of 761 000 tons, positioning China as the world’s main rabbit meat producer. This data highlights the great potential of rabbit production, both as an economic activity and a key strategy in the fight against hunger and poverty in many countries all over the world. During the congress, scientific works were presented related with the fields of Ethology, Housing & Welfare; Genetics; Reproduction; Digestive Physiology and Basic Nutrition; Feed Evaluation and Feeding; Pathology & Hygiene, Meat Quality, Safety & Dining; Management, Social & Economy. Furthermore, the meeting of the AB-WRSA chaired by the AB-WRSA founder, Dr. Steven Lukefahr, also took place at this congress, in which the new board of the American Branch was elected and the proposal put forward for the next American Rabbit Congress to be held in Costa

Legislative and Judicial Information Systems.

Science.gov (United States)

Becker, Louise Giovane

1983-01-01

Reviews computer applications in judicial, legal, and legislative information activities being used to support litigation and court administration, assist in searching for legislation and laws, aid criminal justice information systems, and provide appropriate bibliographic and reference assistance. Management issues in automating systems are…

Legal Principles and Legislative Instrumentalism

NARCIS (Netherlands)

Gribnau, J.L.M.; Soeteman, A.

2003-01-01

Instrumentalist legislation usually underestimates the importance of legal principles in modern law. Legal principles are the normative core of a value oriented conception of law. They function as essential criteria of evaluation for lawmaking by the legislator and the executive. In fact,

Development of [103Pd]-labeled-bis(N4-methylthiosemicarbazone) complexes as possible therapeutic agents

International Nuclear Information System (INIS)

Jalilian, A.R.; Sadeghi, M.; Kamrani, Y.Y.

2006-01-01

Due to interesting tumor seeking properties of bis-thiosemicarbazones, two radio palladium-bis-thiosemicarbazone complexes, i.e., [ 103 Pd]-pyruvaldehyde-bis(N 4 -methylthiosemicarbazone) ([ 103 Pd] PTSM) and [ 103 Pd]-diacetyl-bis(N 4 -methylthiosemicarbazone) ([ 103 Pd]ATSM) were prepared according to the analogy of radio copper homologs. Palladium-103 (t 1/2 = 16.96 d) was produced via the 103 Rh(p, n) 103 Pd nuclear reaction with proton energy 18 MeV. The final activity was eluted in form of Pd(NH 3 ) 2 Cl 2 in order to react with bis-thiosemicarbazones to yield [ 103 Pd]-labeled compounds. Chemical purity of the product was confirmed to be below the accepted limits by polarography. [ 103 Pd]-labeled bis-thiosemicarbazones were prepared with a radiochemical yield of more than 80% at room temperature after 60-90 min by vortexing a mixture of thiosemicarbazones and Pd activity in ethanol. The purification of the labeled compounds performed by reverse phase column chromatography using C 18 plus Sep-Pak. Radiochemical purity of more than 99% specific activity of about 12500-13 000 Ci/mol was obtained. The stability of the complexes was checked in final product and presence of human serum at 37 C up to 48 h. The partition co-efficients of the final complexes were determined. The initial physico-chemical properties of the labeled compounds were compared to those of their copper homologues. (orig.)

National Women's Science Congress

Indian Academy of Sciences (India)

TSC

This National Women's Science Congress is planned essentially to bring women to the forefront ... The following areas are indicative of this wide coverage, in each of which ... C. V. Raman, two great scientists of the world; Marie Curie Mahila.

8 CFR 103.41 - Genealogy request fees.

Science.gov (United States)

2010-01-01

... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Genealogy request fees. 103.41 Section 103...; AVAILABILITY OF RECORDS § 103.41 Genealogy request fees. (a) Genealogy search fee. See 8 CFR 103.7(b)(1). (b) Genealogy records fees. See 8 CFR 103.7(b)(1). (c) Manner of submission. When a request is submitted online...

Theoretical analysis of microdosimetric spectra and cluster formation for 103Pd and 125I photon emitters

International Nuclear Information System (INIS)

Reniers, B; Vynckier, S; Verhaegen, F

2004-01-01

In this work we have compared 125 I or 103 Pd from a microdosimetric point of view. The photon spectra at different positions around the seeds have first been calculated using EGSnrc Monte Carlo (MC) code. These photon spectra are used as input for the event-by-event MC code TRION to calculate the microdosimetric lineal energy (y) distribution for each isotope. The microdosimetric dose average lineal energy, y D , calculated in a sphere of 1 μm is 3.5 keV μm -1 for 125 I and 4.0 keV μm -1 for 103 Pd, agreeing well with values reported in the literature. y D in a 1 μm sphere diminishes slightly with the distance from the seed for 103 Pd. This is due to the spectral hardening caused by the presence of a gamma-ray of 357.5 keV in the initial spectrum of 103 Pd. In parallel with the calculation of the microdosimetric spectra, we have analysed the distribution of the size of the energy deposition clusters generated by these low energy photons in structures of 2 and 10 nm of radius. Due to Compton interactions, the fraction of very low energy electrons ( 125 I photons is 51%, whereas it is only 27% for 103 Pd. As these electrons deposit their energy very locally, the pattern of energy depositions contains more clusters of a few nm of radius for 125 I than for 103 Pd; the mean cluster orders are respectively 3.3 and 3.0 for 10 nm clusters. This is in opposition with the prediction based on the microdosimetric spectrum and the parameter y D and could be of importance for the damage to the cells

48 CFR 2905.403 - Requests from Members of Congress.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Requests from Members of Congress. 2905.403 Section 2905.403 Federal Acquisition Regulations System DEPARTMENT OF LABOR ACQUISITION PLANNING PUBLICIZING CONTRACT ACTIONS Release Of Information 2905.403 Requests from Members of Congress...

Annual report to Congress

International Nuclear Information System (INIS)

1987-01-01

This is the ninth Annual Report to Congress of the United States Department of Energy. It covers the activities of all elements of the Department except the independent Federal Regulatory Commission, which issues its own annual report. 88 refs., 43 tabs

Healthy public relations: the FDA's 1930s legislative campaign.

Science.gov (United States)

Kay, G

2001-01-01

In this article, I argue that the Food and Drug Administration (FDA) is an oft-overlooked government agency that acts to preserve and secure the public's health. From its early years as an agency charged with enforcement of the 1906 Pure Food and Drugs Act, the FDA not only protected the public's health but also made the public aware of its mission, using methods as diverse as displays at county fairs and at the 1933 Chicago World's Fair, radio programming, and active correspondence. The agency encouraged the public to protect itself, particularly in those arenas in which the FDA had no regulatory authority. In addition, it may have overstepped its boundaries when it actively solicited public support for a bill submitted to Congress in the early 1930s. In the dark days of the Great Depression, the FDA contended not only with limited resources and its own feelings of inadequacy in terms of what could and could not be done to protect the populace, but also with "guinea pig" books that horrified and angered many readers. By 1938, when the agency prevailed and the revisions to the 1906 Act passed Congress and were signed into law by President Franklin D. Roosevelt, the FDA had done all that a responsible public health agency should do, and more.

Experimental study of 103Pd stents for preventing the restenosis of biliary duct

International Nuclear Information System (INIS)

Gao Qinyi; Shu Qiang; Lu Xiangdong; Li Yaming; He Guijin; Pei Zhuguo; Xu Shuhe

2004-01-01

Objective: To explore the feasibility of preventing biliary duct restenosis with the stent treated with 103 Pd and to elucidate the mechanisms of the inhibition of the smooth muscle cell proliferation and the increase of apoptosis. Methods: The experimental dogs were randomly divided into common-stent group and 103 Pd stent group, each of 6 animals. Pathohistology, cell apoptosis, immunohistochemistry for proliferating cell nuclear antigen (PCNA), the expression of gene p53 by in situs hybridization, the test of the peripheral blood and measurement of radiation of tissue around the stent were studied. Results: The utmost intimal thickness of biliary duct in the 103 Pd stent group was found to be obviously less compared to that in common-stent group after 30 d, the percentages of the stenosis of the biliary duct were (54.73 ± 21.64)% and (17.61 ± 14.52)%, respectively, there was a significant difference between two groups (P 103 Pd stent group, and decreased in the common-stent group; the expression of PCNA of biliary smooth muscle cells of 103 Pd group was weaker compared with that in the common-group. Conclusion: 103 Pd stent may inhibit the proliferation of smooth muscle cells and prevent the restenosis of biliary duct. (authors)

Nuclear legislation in Czech Republic

International Nuclear Information System (INIS)

Stuller, J.

1996-01-01

The paper presents the status of nuclear legislation in the Czech Republic, specifying the fields of nuclear activities covered, partially covered and uncovered by the present legislation. The licensing process and the competence and powers of the State Office for Nuclear Safety are also briefly described

The impact of safety legislation

International Nuclear Information System (INIS)

Turner, J.L.; Gill, J.R.

1989-01-01

The impact of medicines legislation for radiopharmaceuticals is discussed with regard to product licensing, production and quality control, marketing authorisation within the EC, licensing exemptions and authorisation for administration. As regards safety legislation for radiopharmaceuticals the requirements of the Ionising Radiations Regulations 1985 are outlined. (UK)

48 CFR 3.103 - Independent pricing.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Independent pricing. 3.103 Section 3.103 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL IMPROPER BUSINESS PRACTICES AND PERSONAL CONFLICTS OF INTEREST Safeguards 3.103 Independent pricing. ...

Legislation for nuclear disaster

International Nuclear Information System (INIS)

Nagata, Shozo

2012-01-01

Fukushima nuclear disaster accident clarified problems on nuclear-related legislation and its application. Legislation for nuclear disaster (LNA) could not respond to severe accident because assumed size of accident was not enough. After emergency event corresponding to the article 15 of LNA, was reported by the operator, more than two hours passed by the issuance of Emergency State Declaration. Off-site center could not work at all. This article reviewed outline of LNA and introduced discussion on the reform of legislation and its application. Reform discussion should be focused on swift and effective response readiness to emergency: 1) operator's substantial nuclear emergency drilling, (2) reinforcement of government's headquarters for emergency response, (3) after nuclear emergency, government's headquarters remained to enhance resident's safety from radiation hazard and (4) enactment of nuclear emergency preparedness guidelines for local communities. (T. Tanaka)

Legislative coalitions with incomplete information.

Science.gov (United States)

Dragu, Tiberiu; Laver, Michael

2017-03-14

In most parliamentary democracies, proportional representation electoral rules mean that no single party controls a majority of seats in the legislature. This in turn means that the formation of majority legislative coalitions in such settings is of critical political importance. Conventional approaches to modeling the formation of such legislative coalitions typically make the "common knowledge" assumption that the preferences of all politicians are public information. In this paper, we develop a theoretical framework to investigate which legislative coalitions form when politicians' policy preferences are private information, not known with certainty by the other politicians with whom they are negotiating over what policies to implement. The model we develop has distinctive implications. It suggests that legislative coalitions should typically be either of the center left or the center right. In other words our model, distinctively, predicts only center-left or center-right policy coalitions, not coalitions comprising the median party plus parties both to its left and to its right.

48 CFR 405.403 - Requests from Members of Congress.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Requests from Members of Congress. 405.403 Section 405.403 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE... Members of Congress. The head of the contracting activity (HCA) is the agency head designee pursuant to...

22 CFR 214.38 - Submission of reports to the Library of Congress.

Science.gov (United States)

2010-04-01

... Congress. 214.38 Section 214.38 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ADVISORY COMMITTEE MANAGEMENT Operation of Advisory Committees § 214.38 Submission of reports to the Library of Congress. (a) Each advisory committee is to file with the Library of Congress eight copies of each of its reports...

Impact of the legislation on electric utilities

International Nuclear Information System (INIS)

De Long, M.

1982-01-01

The possible impact of Federal nuclear waste legislation on electric utilities is discussed. The proposed legislation will set forth a well defined program enabling utilities with nuclear plants to make long term plans under a statutory mandate committed to an available technology and implementation timetable. The legislation includes the necessary specificity for the utility companies to fulfill their responsibilities in describing their waste disposal plans to their customers, the concerned public, and state and local legislators

High-resolution 3D dose distribution measured for two low-energy x-ray brachytherapy seeds: 125I and 103Pd

International Nuclear Information System (INIS)

Massillon-JL, G.; Minniti, R.; Mitch, M.G.; Soares, C.G.; Hearn, R.A.

2011-01-01

In this work, we have investigated the 3D absorbed dose distribution around 125 I and 103 Pd low-energy photon brachytherapy seeds using a high-spatial-resolution gel scanning system to address the current difficulty in measuring absorbed dose at close distances to these sources as a consequence of high dose rate gradient. A new version of BANG-gel coupled with a small format laser CT scanner has been used. Measurements were performed with 100 μm resolution in all dimensions. In particular, radial dose function and absorbed dose rate in the plane parallel to the sources longitudinal-axis were derived at radial distances smaller than or equal to 1 cm. In addition, the energy dependence was evaluated, finding that, within measurement uncertainties, the gel response is independent of the energy for energy photon values between 20 keV and 1250 keV. We have observed that at distances larger than 1.4 mm from the source, the delivered dose is similar to predictions from published Monte Carlo calculations (MC) for the 125 I seed. For distances between 1 mm and 3 mm, differences in magnitude and shape are significant for the 103 Pd seed, where an enhancement is observed. In the enhancement region, a difference of up to 70% in the radial dose function was obtained. Such observation suggests a contribution from other radionuclides emitting beta-particles or electrons, and not considered by MC. To understand the effect, spectrometry measurements were performed. A small contribution of 102 Rh/ 102m Rh radionuclide relative to 103 Pd was observed and its importance on the absorbed dose measured at close distances to the seed is time dependent and consequently, avoids reproducible measurements. Finally, the results obtained in this work underscore the importance of using high-spatial-resolution and water-equivalent detectors for measuring absorbed dose in low-energy photon radiation fields.

An Overview of the International Congress on Whiplash Associated Disorders

Directory of Open Access Journals (Sweden)

Nikolai Bogduk

2003-01-01

Full Text Available Conferences such as the International Congress on Whiplash Associated Disorders, held in Berne on March 8-10, 2001, serve several purposes. Socially, they provide an opportunity for delegates to see, hear and meet leading experts in the field, and those experts get to meet one another. Academically, such conferences offer delegates a synopsis of current information, provided by plenary lectures, and the opportunity to hear or contribute new information, in the form of free papers. A measure of the success of such a conference is the extent to which new information presented advances knowledge and understanding in the field. This essay provides an overview of the congress at hand. It compares what was known before the congress with what more was known as a result of the congress.

7 CFR 1400.103 - Charitable organizations.

Science.gov (United States)

2010-01-01

... 7 Agriculture 10 2010-01-01 2010-01-01 false Charitable organizations. 1400.103 Section 1400.103... AND SUBSEQUENT CROP, PROGRAM, OR FISCAL YEARS Payment Limitation § 1400.103 Charitable organizations. (a) A charitable organization, including a club, society, fraternal organization, or religious...

The 33rd IGC, Oslo, Norway 2008; Geoscience World Congress 2008

Science.gov (United States)

Solheim, A.; Bjoerlykke, A.

2007-12-01

The International Geological Congress (IGC) has been arranged every four years since 1878. During the previous Congress in Florence, Italy, 2004, the Nordic countries were awarded the organisation of the 33rd IGC, which will be held in Oslo, Norway, August 6-14, 2008. We expect between 6000 and 9000 participants to the Congress, which also includes workshops, short-courses, and business meetings, as well as more than 50 pre -and post Congress excursions. The Congress is organised under the umbrella of IUGS and the patronage of UNESCO. The Congress will run with 40 parallel sessions and cover the whole width of the geosciences. About 500 symposia will run in 40 parallel sessions. There will be a major poster session, as well as a large exhibition (Geoexpo 2008), in which industry and other organisations will be able to exhibit their products and services. A number of international affiliations have announced their interest in organising annual business meetings during the Congress. In addition, a number of workshops and short-courses will be arranged. More than 50 excursions are planned for the two weeks before the Congress and one week after. These run in all the Nordic Countries, as well as in NW Russia, Ukraine, Greenland, Svalbard, and the Faeroes Islands. These excursions will give the participants a first-hand insight into Nordic Geosciences, as well as the Nordic natural and cultural heritage. Two major international events are important for the Congress. The "International Polar Year" (IPY) and the United Nations' "International Year of Planet Earth" (IYPE) are both running in the period 2007-2009. The Congress focuses on many of the main themes of IYPE, with major emphasis on "Geoscience and Society". Seven major themes will be treated in full-day plenary sessions of lectures given by invited lecturers. These plenary sessions will have a scientific part in the morning, a key-note lecture at lunch-time, and a societal part in the afternoon, followed by a

20 CFR 1001.131 - Secretary's annual report to Congress.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Secretary's annual report to Congress. 1001.131 Section 1001.131 Employees' Benefits OFFICE OF THE ASSISTANT SECRETARY FOR VETERANS' EMPLOYMENT... Compliance § 1001.131 Secretary's annual report to Congress. The Secretary shall report, after the end of...

Status of legislation

International Nuclear Information System (INIS)

Gilman, P.

1982-01-01

The Senate passed 69 to 6 legislation to provide a comprehensive nuclear waste policy. This legislation restates some things the Department of Energy is already doing. It modifies some others, and in some cases it provides new authorities, principally in those areas of state participation and in the area of financing of the program. Some of the provisions of the Senate bill are: schedule for a number of items in the disposal of nuclear waste, the first being an area referred to as away-from reactor storage; a timetable for geologic disposal; a plan for the long-term storage of nuclear waste for spent fuels; a financing mechanism; and states participation

29 CFR 1926.103 - Respiratory protection.

Science.gov (United States)

2010-07-01

... 29 Labor 8 2010-07-01 2010-07-01 false Respiratory protection. 1926.103 Section 1926.103 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... § 1926.103 Respiratory protection. Note: The requirements applicable to construction work under this...

7 CFR 1416.103 - Application process.

Science.gov (United States)

2010-01-01

... 7 Agriculture 10 2010-01-01 2010-01-01 false Application process. 1416.103 Section 1416.103 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT... PROGRAMS Livestock Compensation Program § 1416.103 Application process. (a) Applicants must submit to CCC...

Congressing kinetochores progressively load Ska complexes to prevent force-dependent detachment.

Science.gov (United States)

Auckland, Philip; Clarke, Nicholas I; Royle, Stephen J; McAinsh, Andrew D

2017-06-05

Kinetochores mediate chromosome congression by either sliding along the lattice of spindle microtubules or forming end-on attachments to their depolymerizing plus-ends. By following the fates of individual kinetochores as they congress in live cells, we reveal that the Ska complex is required for a distinct substep of the depolymerization-coupled pulling mechanism. Ska depletion increases the frequency of naturally occurring, force-dependent P kinetochore detachment events, while being dispensable for the initial biorientation and movement of chromosomes. In unperturbed cells, these release events are followed by reattachment and successful congression, whereas in Ska-depleted cells, detached kinetochores remain in a futile reattachment/detachment cycle that prevents congression. We further find that Ska is progressively loaded onto bioriented kinetochore pairs as they congress. We thus propose a model in which kinetochores mature through Ska complex recruitment and that this is required for improved load-bearing capacity and silencing of the spindle assembly checkpoint. © 2017 Auckland et al.

Development of [103Pd]-2-acetylpyridine 4N-methyl thiosemicarbazone complex for targeted therapy

International Nuclear Information System (INIS)

Jalilian, A.R.; Sadeghi, M.; Yari-Kamrani, Y.; Ensaf, M.R.

2006-01-01

Due to interesting biological properties of palladium-thiosemicarbazono complexes, production of a 103 Pd-labeled anti-cancer complex, i.e., [ 103 Pd]-2-acetylpyridine 4 N-methylthiosemicarbazone ([ 103 Pd]-APMTS) was developed. Palladium-103 (T 1/2 = 16.96 d) produced via the 103 Rh(p,n) 103 Pd nuclear reaction using natural rhodium target, was separated from the irradiated target material. Proton energy was 18 MeV with 200 μA irradiation for 15 hours (final activity 700 mCi of 103 Pd 2+ , RCY>95%, radionuclidic purity>99%). The final activity was eluted in form of Pd(NH 3 ) 2 Cl 2 in order to react with 2-acetylpyridine- 4 N-methylthiosemicarbazone to yield [ 103 Pd]-APMTS. Chemical purity of the final product was confirmed to be within the accepted limits by polarography. [ 103 Pd]-APMTS was prepared with a radiochemical yield of more than 80% at room temperature after 3 hours. The labeling reaction was optimized for time, temperature and radioactivity and ligand ratio. A mixture of APMTS and Pd activity in ethanol was heated at 90 deg C for 3 hours followed by reverse phase SPE purification using C 18 plus Sep-Pak. Radiochemical purity of more than 99% using RTLC and specific activity of about 12500 Ci/mol was obtained. The stability of the tracer was checked in the final product and the presence of human serum at 37 deg C up to 3 hours. The partition coefficient of the final complex was determined by octanol:saline buffer distribution. (author)

31 CFR 103.63 - Structured transactions.

Science.gov (United States)

2010-07-01

... Section 103.63 Money and Finance: Treasury Regulations Relating to Money and Finance FINANCIAL RECORDKEEPING AND REPORTING OF CURRENCY AND FOREIGN TRANSACTIONS General Provisions § 103.63 Structured transactions. No person shall for the purpose of evading the reporting requirements of § 103.22 with respect to...

48 CFR 2922.103-4 - Approvals.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Approvals. 2922.103-4 Section 2922.103-4 Federal Acquisition Regulations System DEPARTMENT OF LABOR SOCIOECONOMIC PROGRAMS APPLICATION OF LABOR LAWS TO GOVERNMENT ACQUISITIONS Basic Labor Policies 2922.103-4 Approvals. The “agency...

6th world congress of chemical engineering. Proceedings

International Nuclear Information System (INIS)

2002-01-01

The 6th World Congress of Chemical Engineering, held in Melbourne, was structured around 6 Vision Lectures which lead to 800 oral presentations and 600 poster presentations, spanning the entire range of chemical engineering. The main topics of the Congress were: environment, health and safety; energy; industrial applications; process simulation and control; management and education and the future. Items in INIS scope have been separately indexed

Evolution of European Union legislation of herbal medicinal products and its transposition to national legislation in 1965-2007: case Finland.

Science.gov (United States)

Koski, Sari M; Laitinen-Parkkonen, Pirjo; Airaksinen, Marja

2015-01-01

The study aim was to explore the progress of legislation relating to herbal medicinal products in the European Union and compare it with the corresponding progress of the legislation in Finland in 1965-2007. The study was carried out using content analysis. Data were searched from publicly available European Union directives and national acts. All definitions and safety-related requirements for herbal medicinal products were identified. The transposition of safety-related requirements into the national legislation was studied. Medicinal products from plant origins have been part of the European Union legislation since 1965. Most plant-based products have not initially been regarded as medicinal products but rather as some kind of medicine-like products. The official definition of herbal medicinal products was introduced in Directive 2004/24/EC and implemented into the Finnish legislation with the terminology to recognise herbal medicinal products as part of medicinal products. The current safety-related requirements of medicinal products concern analogously herbal medicinal products. Herbal medicinal products have had different definitions in pharmaceutical legislation over the study period in the European Union and Finland. The current definition places herbal medicinal products more clearly under the medicinal products' legislation. Safety-related requirements are now practically identical for all medicinal products. Transposition of the European Union legislation into the national legislation in Finland is apparent. Copyright © 2013 John Wiley & Sons, Ltd.

European Society of Cardiology Congress 2017 (August 26-30, 2017 - Barcelona, Spain).

Science.gov (United States)

Klischies, S

2017-12-01

The annual congress of the European Society of Cardiology (ESC) is the largest medical congress in Europe for this area of research and took place this year in Barcelona, Spain. The ESC Congress 2017 gathered more than 30,000 registered participants from over 140 countries together to share their knowledge in all cardiovascular fields, from basic science to management and prevention of cardiovascular diseases. The congress comprised 5 days of science and education with over 11,000 abstracts submitted, 500 expert sessions and over 200 exhibiting companies, making it the prime meeting platform for the profession. This year's ESC Congress Spotlight was "40 years of percutaneous coronary intervention (PCI)." PCI is a nonsurgical procedure used to treat narrowing of the coronary arteries of the heart found in coronary artery disease.

48 CFR 605.403 - Requests from members of Congress.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Requests from members of Congress. 605.403 Section 605.403 Federal Acquisition Regulations System DEPARTMENT OF STATE COMPETITION... members of Congress. The Procurement Executive is the agency head for the purposes of FAR 5.403. [59 FR...

48 CFR 1405.403 - Requests from Members of Congress.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Requests from Members of Congress. 1405.403 Section 1405.403 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR... from Members of Congress. For purposes of this subpart, the agency head is the HCA with the power of...

Cardiopulmonary Resuscitation Training in Schools Following 8 Years of Mandating Legislation in Denmark: A Nationwide Survey.

Science.gov (United States)

Malta Hansen, Carolina; Zinckernagel, Line; Ersbøll, Annette Kjær; Tjørnhøj-Thomsen, Tine; Wissenberg, Mads; Lippert, Freddy Knudsen; Weeke, Peter; Gislason, Gunnar Hilmar; Køber, Lars; Torp-Pedersen, Christian; Folke, Fredrik

2017-03-14

School cardiopulmonary resuscitation (CPR) training has become mandatory in many countries, but whether legislation has translated into implementation of CPR training is largely unknown. We assessed CPR training of students following 8 years of legislative mandates in Denmark. A nationwide cross-sectional survey of Danish school leadership (n=1240) and ninth-grade homeroom teachers (n=1381) was carried out for school year 2013-2014. Qualitative interviews and the Theory of Planned Behavior were used to construct the survey. Logistic regression models were employed to identify factors associated with completed CPR training. Information from 63.1% of eligible schools was collected: 49.3% (n=611) of leadership and 48.2% (n=665) of teachers responded. According to teachers, 28.4% (95% CI 25.0% to 32.0%) and 10.3% (95% CI 8.1% to 12.8%) of eligible classes had completed CPR and automated external defibrillator training, respectively. Among leadership, 60.2% (95% CI 56.2% to 64.1%) reported CPR training had occurred during the 3 years prior to the survey. Factors associated with completed CPR training included believing other schools were conducting training (odds ratio [OR] 9.68 [95% CI 4.65-20.1]), awareness of mandating legislation (OR 4.19 [95% CI 2.65-6.62]), presence of a school CPR training coordinator (OR 3.01 [95% CI 1.84-4.92]), teacher feeling competent to conduct training (OR 2.78 [95% CI 1.74-4.45]), and having easy access to training material (OR 2.08 [95% CI 1.57-2.76]). Despite mandating legislation, school CPR training has not been successfully implemented. Completed CPR training was associated with believing other schools were conducting training, awareness of mandating legislation, presence of a school CPR training coordinator, teachers teacher feeling competent to conduct training, and having easy access to training material. Facilitating these factors may increase rates of school CPR training. © 2017 The Authors. Published on behalf of the

29 CFR 784.102 - General legislative history.

Science.gov (United States)

2010-07-01

... 29 Labor 3 2010-07-01 2010-07-01 false General legislative history. 784.102 Section 784.102 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR STATEMENTS OF GENERAL... Aquatic Products Legislative History of Exemptions § 784.102 General legislative history. (a) As orginally...

Preparation of 103Pd seeds. Part 2. 'Molecular Plating' of 103Pd onto copper rod

International Nuclear Information System (INIS)

Chunfu Zhang; Yongxian Wang; Haibin Tian; Duanzhi Yin

2002-01-01

A method for 103 Pd 'molecular plating' onto the surface of the copper rod is reported. The optimal composition of the plating bath was: palladium chloride 2 g/l, ammonium hydroxide (28%) 150 ml/l, sodium hypophosphite 12 g/l, and ammonium chloride 37 g/l. The whole procedure of 103 Pd 'molecular plating' will last 50 minutes at 40 deg C. Valuable experience for the preparation of 103 Pd seeds is provided. (author)

49 CFR 238.103 - Fire safety.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Fire safety. 238.103 Section 238.103..., DEPARTMENT OF TRANSPORTATION PASSENGER EQUIPMENT SAFETY STANDARDS Safety Planning and General Requirements § 238.103 Fire safety. (a) Materials. (1) Materials used in constructing a passenger car or a cab of a...

7 CFR 94.103 - Analytical methods.

Science.gov (United States)

2010-01-01

... 7 Agriculture 3 2010-01-01 2010-01-01 false Analytical methods. 94.103 Section 94.103 Agriculture... POULTRY AND EGG PRODUCTS Voluntary Analyses of Egg Products § 94.103 Analytical methods. The analytical methods used by the Science and Technology Division laboratories to perform voluntary analyses for egg...

29 CFR 783.28 - General legislative history.

Science.gov (United States)

2010-07-01

... 29 Labor 3 2010-07-01 2010-07-01 false General legislative history. 783.28 Section 783.28 Labor... TO EMPLOYEES EMPLOYED AS SEAMEN Legislative History and Judicial Construction of the Exemptions § 783.28 General legislative history. As originally enacted in 1938, section 13(a)(3) of the Fair Labor...

14th South African Psychology Congress | Laher | African Safety ...

African Journals Online (AJOL)

In response to the xenophobic violence that erupted in South Africa in May 2008, 'Respecting diversity' was an aptly chosen theme for the 14th South African Psychology Congress, held at Emperors Palace in Johannesburg, South Africa from 26 to 29 August 2008. The congress was hosted by the Psychological Society of ...

Annual congress of the South African Society of Pathologists

International Nuclear Information System (INIS)

1981-01-01

The joint annual congress of the South African Society of Pathologists, International Academy of Pathology, South African Association of Clinical Biochemists and the Southern African Microbiology Society, was held from 13 to 15 July 1981 in Bloemfontein. This congress covered facets of clinical biochemistry, anatomical pathology, virology, microbiology, immunology and molecular biology

8 CFR 103.38 - Genealogy Program.

Science.gov (United States)

2010-01-01

... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Genealogy Program. 103.38 Section 103.38...; AVAILABILITY OF RECORDS § 103.38 Genealogy Program. (a) Purpose. The Department of Homeland Security, U.S. Citizenship and Immigration Services Genealogy Program is a fee-for-service program designed to provide...

Proceedings of the eighth Kerala Science Congress

International Nuclear Information System (INIS)

Iyengar, P.K.

1996-01-01

The Eighth Kerala Science Congress organised by the State Committee on Science, Technology and Environment, Government of Kerala was held at Kochi from 27-29 January 1996. The aim of this Science Congress is to support and catalyse scientific activity in different centres in the Kerala State. The topics covered in the proceedings are natural resources utilisation, ecology and environment, agriculture and allied areas, health care, technology, physical sciences, life sciences, engineering and biotechnology for development. Papers relevant to INIS are indexed separately. refs., figs., tabs

National legislative and regulatory activities

International Nuclear Information System (INIS)

2016-01-01

This section treats of the following National legislative and regulatory activities: 1 - France: General legislation, regulations and instruments; Nuclear trade (including non-proliferation); International co-operation; 2 - India: Licensing and regulatory infrastructure; Liability and compensation; 3 - Ireland: Nuclear safety and radiological protection (including nuclear emergency planning); Transport of radioactive material; Nuclear trade (including non-proliferation); 4 - Lithuania: Licensing and regulatory infrastructure; Nuclear safety and radiological protection (including nuclear emergency planning); Radioactive waste management; 5 - Luxembourg: Nuclear safety and radiological protection (including nuclear emergency planning); 6 - Slovak Republic: International co-operation; General legislation, regulations and instruments; 7 - Spain: Radioactive materials (including physical protection); Radioactive waste management; 8 - United States: Licensing and regulatory infrastructure

Maritime environmental penal law. International and German legislation

International Nuclear Information System (INIS)

Eller, Jan Frederik

2017-01-01

The book on maritime environmental penal law discusses the following issues: part I: introduction into the importance of oceanic environment and its thread, requirement of protective measures,; part II: focus of the study and terminology: oceanic pollution, maritime environmental legislation, international legislation; part 3: international legislative regulations concerning the protection of maritime environment: avoidance of environmental pollution, maritime legislative agreements, existing protective institutions; part 4: state penal power concerning maritime environmental protection; part 5: statutory offense according to German legislation; perspectives for regulations concerning criminal acts on sea.

The embryo research debate in Brazil: from the National Congress to the Federal Supreme Court.

Science.gov (United States)

Cesarino, Letícia; Luna, Naara

2011-04-01

New forms of life produced by biomedical research, such as human embryonic stem cells (hESC), have been the object of public debate beyond the scientific fields involved. This article brings to light the case of Brazil, where recently passed federal legislation has authorized research with in vitro human embryos. It focuses on the legislative debate in the Brazilian National Congress between 2003 and 2005 on the Biosafety Bill of Law, which cleared for hESC research a certain share of supernumerary and unviable human embryos frozen in the country's assisted reproduction clinics. The passing of this Bill triggered other public reactions, chiefly a Direct Action of Unconstitutionality in Brazil's Federal Supreme Court. This study adopts an anthropological perspective for describing and analyzing the chief arguments in both debates, in terms of how the notion of 'life' was deployed and negotiated by contending parties. If, on the one hand, the definition of life appeared firmly attached to a conception of both the in vitro embryo and the fetus as a human person, on the other a movement towards breaking down life along utilitarian lines was found when the potential beneficiaries of stem cell therapy came into the equation. In all cases, however, notions of life were negotiated from a hybrid continuum of (biological) facts and (religious, moral and juridical) values, and resonated in different ways with the idea of the individual as privileged mode of constructing personhood in the context of modern nation states.

Legislating for advocacy: The case of whistleblowing.

Science.gov (United States)

Watson, Chanel L; O'Connor, Tom

2017-05-01

The role of nurses as patient advocates is one which is well recognised, supported and the subject of a broad body of literature. One of the key impediments to the role of the nurse as patient advocate is the lack of support and legislative frameworks. Within a broad range of activities constituting advocacy, whistleblowing is currently the subject of much discussion in the light of the Mid Staffordshire inquiry in the United Kingdom (UK) and other instances of patient mistreatment. As a result steps to amend existing whistleblowing legislation where it exists or introduce it where it does not are underway. This paper traces the development of legislation for advocacy. The authors argue that while any legislation supporting advocacy is welcome, legislation on its own will not encourage or enable nurses to whistleblow.

Implementing the legislation

International Nuclear Information System (INIS)

Silverstrom, L.

1982-01-01

Leon Silverstrom explained how nuclear waste disposal legislation would be implemented. The legislation provides a framework that recognizes the tremendous number of views and opinions on the subject and provides a mechanism that will allow all these interests to be expressed before final decisions are reached. Implementing procedures are outlined for: (1) the final repository; (2) interim or last resort storage; (3) research and development; (4) the monitored retrievable storage phases. The whole process will involve: environmental assessments and licensing requirements for each phase; construction of a test and evaluation facility; provision for sharing information with the states and interested parties; and procedures for public hearings and state rejection of propoped sites

Legislative Basis of Pedagogical Education in Japan

Science.gov (United States)

Kuchai, Tetiana

2014-01-01

Legal framework policy of Japan in the field of education has been analyzed. The problem of influence of legislative materials on the development of education in Japan, its legislative support has been considered. It has been defined that directive materials affect the development of education system in Japan. Legislation policy of the country is…

The congressional viewpoint: Deficit reduction and risk legislation

Energy Technology Data Exchange (ETDEWEB)

Chakoff, H.E.

1995-12-31

This presentation will provide a current congressional status of legislation related to low-level waste and DOE cleanup. Key legislation discussed will include S. 755 for Privatization of the Uranium Enrichment Corporation and the markup of H.R. 1020, the Nuclear Waste Legislation. In addition, the session will include a discussion of legislation related to the approval of the Texas compact.

The congressional viewpoint: Deficit reduction and risk legislation

International Nuclear Information System (INIS)

Chakoff, H.E.

1995-01-01

This presentation will provide a current congressional status of legislation related to low-level waste and DOE cleanup. Key legislation discussed will include S. 755 for Privatization of the Uranium Enrichment Corporation and the markup of H.R. 1020, the Nuclear Waste Legislation. In addition, the session will include a discussion of legislation related to the approval of the Texas compact

31 CFR 103.57 - Civil penalty.

Science.gov (United States)

2010-07-01

... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Civil penalty. 103.57 Section 103.57... REPORTING OF CURRENCY AND FOREIGN TRANSACTIONS General Provisions § 103.57 Civil penalty. (a) For any... willfully participates in the violation, a civil penalty not to exceed $1,000. (b) For any willful violation...

Separation of [Rh-103m]-rhodocene-derivatives from the parent [103Ru]ruthenocen-derivatives and their organ distribution

International Nuclear Information System (INIS)

Wenzel, M.; Wu, Y.

1987-01-01

The radioactive decay of [ 103 Ru]ruthenocene derivatives leads to sup(103m)Rh labelled rhodocinium derivatives, which can be separated by the extraction of a lipophilic solution of the ruthenocen derivate with water. The separation factor sup(103m)Rh/ 103 Ru reaches values of 32:1 Rh 3+ ions are not liberated and extracted. The organ distribution of the sup(103m)Rh labelled rhodocinium derivatives gained from ruthenocene and from N-isopropyl-ruthenocene amphetamine is different from the distribution of the parent ruthenocene compound. The liver and kidney uptake of the rhodocinium-amphetamine is much higher than the uptake with ruthenocene amphetamine. (author)

Intelligence Issues for Congress

Science.gov (United States)

2013-04-23

open source information— osint (newspapers...by user agencies. Section 1052 of the Intelligence Reform Act expressed the sense of Congress that there should be an open source intelligence ...center to coordinate the collection, analysis, production, and dissemination of open source intelligence to other intelligence agencies. An Open Source

Mercury Study Report to Congress

Science.gov (United States)

EPA's Report to Congress on Mercury provides an assessment of the magnitude of U.S. mercury emissions by source, the health and environmental implications of those emissions, and the availability and cost of control technologies.

Abstracts of 3. congress of global anti-nuclear alliance

International Nuclear Information System (INIS)

2000-01-01

The 3 congress of global anti-nuclear alliance was held on 18-20 May, 2000 in Astana. There were 55 reports on different aspects of nuclear disarmament; nuclear safeguards; safe operation of nuclear power plants; rehabilitation of population and lands, damaged from many-years tests in Semipalatinsk site; radiobiological monitoring of ecosystems and others presented at the congress

Pacific Northwest Electric Power Planning and Conservation Act : Legislative History of the Act to Assist the Electrical Consumers of the Pacific Northwest through use of the Federal Columbia River Power System to Achieve Cost-Effective Energy Conservation : P.L. 96-501, 94 Stat. 2697.

Energy Technology Data Exchange (ETDEWEB)

United States. Bonneville Power Administration.

1981-01-01

The Pacific Northwest Electric Power Planning and Conservation Act became effective when it was signed into law by President Carter on December 5, 1980. This ended a four-year debate over legislation designed to plan and coordinate the region's energy future. This legislative history is an abbreviated version taken from the larger historical file maintained by the BPA Law Library. It is intended to assist BPA personnel and others who are studying the Northwest Power Act and working on its implementation. The documents included were selected for their value in determining what Congress meant in enacting the statute and to provide the researcher with a starting point for further investigation. These documents include: a history of the Act, a chronology of the legislative action leading to passage of the law; a section-by-section analysis of the Act; the Congressional Records of Senate and House debates on the bill and its amendments, and a list of Congressional committee hearings.

Potential of Congress Tourism in the Republic of Croatia in Comparison to Neighboring Destinations

Directory of Open Access Journals (Sweden)

Gregorić Marina

2016-12-01

Full Text Available The phenomenon of globalization has led to the development of various selective forms of tourism. One of them is MICE tourism known in Croatia as a business form of tourism. Business tourism is still a relatively new concept and covers all aspects of business travel. The development of business travel has led to the development of congress tourism as a separate form of business tourism which is the focus of this paper. Congress tourism is a lucrative segment of the tourist offer that often takes place out of the tourist season. It requires quality congress facilities which can meet the needs of the participants and organizers of the congress. The main role of congress tourism is to gather participants from different countries and promote different products, services, training, education and many other fields of business while at the same time it promotes the hosting destination and its tourism attractions. The aim of this paper is to research and determine the current situation, supply and demand of the Croatian meetings and congress industry in comparison with the neighbouring destinations, the Republic of Slovenia and the Republic of Serbia. The study and comparison between three destinations imply changes that need to take place to improve the congress offer, to detect what the competitive position of the Republic of Croatia is, which marketing activities to improve so that the Republic of Croatia can become a competitive destination in the region and Europe. Congress tourism as a form of business tourism in Croatia is growing. The most prominent cities in this form of tourism are Zagreb, Dubrovnik and Opatija. The objectives pursued in Croatian congress offer are: the number of participants in congresses, strengthening the quality of congress offer and infrastructure, ensuring coordinated actions of stakeholders and increasing the recognition and awareness of Croatia as a congress destination. Since joining the EU, Slovenia has become an

48 CFR 401.103 - Authority.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Authority. 401.103 Section... ACQUISITION REGULATION SYSTEM Purpose, Authority, Issuance 401.103 Authority. The AGAR and amendments thereto... delegated authority to promulgate Departmental acquisition regulations. ...

47 CFR 25.103 - Definitions.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 2 2010-10-01 2010-10-01 false Definitions. 25.103 Section 25.103 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS... communications satellites. (c) Communications satellite corporation. (1) The terms “communications satellite...

75 FR 70031 - Advisory Committee on the Records of Congress

Science.gov (United States)

2010-11-16

... NATIONAL ARCHIVES AND RECORDS ADMINISTRATION Advisory Committee on the Records of Congress AGENCY: National Archives and Records Administration. ACTION: Notice of meeting. SUMMARY: In accordance with the... meeting of the Advisory Committee on the Records of Congress. The committee advises NARA on the full range...

76 FR 31367 - Advisory Committee on the Records of Congress

Science.gov (United States)

2011-05-31

... NATIONAL ARCHIVES AND RECORDS ADMINISTRATION Advisory Committee on the Records of Congress AGENCY: National Archives and Records Administration. ACTION: Notice of meeting. SUMMARY: In accordance with the... meeting of the Advisory Committee on the Records of Congress. The committee advises NARA on the full range...

75 FR 32229 - Advisory Committee on the Records of Congress

Science.gov (United States)

2010-06-07

... NATIONAL ARCHIVES AND RECORDS ADMINISTRATION Advisory Committee on the Records of Congress AGENCY: National Archives and Records Administration. ACTION: Notice of meeting. SUMMARY: In accordance with the... meeting of the Advisory Committee on the Records of Congress. The committee advises NARA on the full range...

National Acid Precipitation Assessment Program Report to Congress: An Integrated Assessment

Energy Technology Data Exchange (ETDEWEB)

Uhart, M.; et al,

2005-08-01

Under Title IX of the 1990 Clean Air Act Amendments, Congress reauthorized the National Acid Precipitation Assessment Program (NAPAP) to continue coordinating acid rain research and monitoring, as it had done during the previous decade, and to provide Congress with periodic reports. In particular, Congress asked NAPAP to assess all available data and information to answer two questions: (1) What are the costs, benefits, and effectiveness of Title IV? This question addresses the costs and economic impacts of complying with the Acid Rain Program as well as benefit analyses associated with the various human health and welfare effects, including reduced visibility, damages to materials and cultural resources, and effects on ecosystems. (2) What reductions in deposition rates are needed to prevent adverse ecological effects? This complex questions addresses ecological systems and the deposition levels at which they experience harmful effects. The results of the assessment of the effects of Title IV and of the relationship between acid deposition rates and ecological effects were to be reported to Congress quadrennially, beginning with the 1996 report to Congress. The objective of this Report is to address the two main questions posed by Congress and fully communicate the results of the assessment to decision-makers. Given the primary audience, most of this report is not written as a technical document, although information supporting the conclusions is provided along with references.

Equality, Legal Certainty and Tax Legislation in the Netherlands
Fundamental Legal Principles as Checks on Legislative Power: A Case Study

Directory of Open Access Journals (Sweden)

Hans Gribnau

2013-03-01

Full Text Available Fundamental legal principles may function as a check on legislative power protecting citizens against arbitrary interferences with their liberty. This contribution deals with the principle of equality and the principle of certainty. First, the testing of legislation against the principle of equality is presented as a case study of constitutional review. In the Netherlands, the constitutional dialogue between the legislator and the Dutch Supreme Court revolving around the principle of equality demonstrates a fair amount of subtle details. As a result, constitutional review can hardly be called an all or nothing affair.Secondly, retroactive tax legislation is dealt with. The legislator does seem to take the principle of legal certainty, another fundamental legal principle, quite seriously, although no testing of statutory legislation is possible by the courts. With regard to retroactive tax legislation the Government has committed itself in a memorandum, requested by Parliament, to adhere to rules of conduct with regard to different situations where it deems retroactive tax legislation to be justified. Thus, a soft law instrument facilitates a dialogue between different partners in the business of law-making.

Congress smiles on research budgets

CERN Multimedia

Reichhardt, T

1998-01-01

Congress has agreed to match or exceed most of the funding requests for the major science agencies requested by President Clinton in February. Many of them will receive their largest budget increases for years (11 paragraphs).

Congress's Contempt Power: A Sketch

National Research Council Canada - National Science Library

Rosenberg, Morton; Tatelman, Todd B

2007-01-01

...), and/or to remove the obstruction (civil contempt). Although arguably any action that directly obstructs the effort of Congress to exercise its constitutional powers may constitute a contempt, in the last seventy years the contempt power...

Financing family planning services: is categorical legislation still needed?

Science.gov (United States)

Mcfarlane, D R; Meier, K J

1991-01-01

Federal and state funds have provided for family planning services in American since the 1960s. Since 1976, services have been funded principally through federal statutes Title X of the Public Health Service Act and Titles V, XIX, and XX of the Social Security Act as well as various state appropriations. While these statutes aim to ensure that women of lower socioeconomic status enjoy access to reproductive health care services, levels of public expenditure in this area vary widely among states. In 1987, public family planning expenditures/woman at risk ranged from $60.16 in Wisconsin to $9.41 in Florida. Within this range of expenditures, the relative importance of each funding source per state varies widely. States with the most robust Title XIX programs, Medicaid, however, have highest per woman family planning expenditures. Upon reviewing the complement of public funding sources and how they are spent at the state level, the authors argue that categorical legislation is still needed to protect access to contraceptive services in America. In particular, of funds from supporting statues, Medicaid is distributed most equitable across the country. These funds paid for 36% of all public outlays for family planning in 1987. Without categorical legislation, however, Medicaid is insufficient to maintain the national family planning effort; the 1987 contribution of $10.49/woman at risk of unwanted pregnancy was insufficient to provide minimum services. Title X requires grantees to follow regulations which ensure state uniformity of quality and service distribution; submission of annual 5-year plans to Congress on how family planning goals will be achieved; and also authorizes monies for training and research. Despite political attacks, family planning funding must remain separate from maternal and child health programs. Such independence will keep these services politically visible; allow use of the more extensive family planning delivery system; catalyze states to

Understanding Cancer Prognosis

Medline Plus

Full Text Available ... Plan & Budget Proposal Congressional Justification NCI Budget Fact Book Legislative Activities Hearings & Testimonies Current Congress Legislative History Committees of Interest Legislative Resources Recent Public Laws Careers Visitor Information Search Search Home About Cancer ...

Remarks on the 103Rh(n,n') sup(103m)Rh excitation curve

International Nuclear Information System (INIS)

Pazsit, A.; Peto, G.; Csikai, J.; Jozsa, I.; Bacso, J.

1975-01-01

The cross sections of the 103 Rh(n,n')sup(103m)Rh reaction have been measured at 2.7MeV and 14.8MeV neutron energies as well as for neutron spectra of 252 Cf and 239 Pu-α-Be sources; the results are 999+-111mb, 216+-26mb, 757+-53mb and 918+-64mb, respectively. (author)

Legislative vulnerability of minority groups.

Science.gov (United States)

Paula, Carlos Eduardo Artiaga; Silva, Ana Paula da; Bittar, Cléria Maria Lôbo

2017-12-01

Minorities are in an inferior position in society and therefore vulnerable in many aspects. This study analyzes legislative vulnerability and aims to categorize as "weak" or "strong" the protection conferred by law to the following minorities: elderly, disabled, LGBT, Indians, women, children/ adolescents and black people. In order to do so, it was developed a documental research in 30 federal laws in which legal provisions were searched to protect minorities. Next, the articles were organized in the following categories: civil, criminal, administrative, labor and procedural, to be analyzed afterwards. Legal protection was considered "strong" when there were legal provisions that observed the five categories and "weak" when it did not meet this criterion. It was noted that six groups have "strong" legislative protection, which elides the assertion that minorities are outside the law. The exception is the LGBT group, whose legislative protection is weak. In addition, consecrating rights through laws strengthens the institutional channels for minorities to demand their rights. Finally, it was observed that the legislative protection granted tominorities is not homogeneous but rather discriminatory, and there is an interference by the majority group in the rights regulation of vulnerable groups.

37 CFR 251.53 - Report to the Librarian of Congress.

Science.gov (United States)

2010-07-01

... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Report to the Librarian of... PROCEDURE Procedures of Copyright Arbitration Royalty Panels § 251.53 Report to the Librarian of Congress... Librarian of Congress a report incorporating its written determination. Such determination shall be...

Cross section measurement for the reaction /sup 103/Rh (n,n') /sup 103m/Rh

International Nuclear Information System (INIS)

Paulsen, A.; Liskien, H.; Vaninbroukx, R.; Widera, R.

1980-01-01

The excitation function for the reaction /sup 103/Rh (n,n') /sup 103m/Rh was measured by the activation technique from 0.2 to 6.1 MeV in 0.1-MeV steps and from 13.0 to 16.7 MeV in 1-MeV steps. This excitation function is normalized through an absolute measurement at 1.8 MeV. This measurement is based on n-p scattering for neutron flux determination and on liquid scintillation counting of /sup 103m/Rh separated from /sup 103/Pd solutions for the activity determination. The total uncertainty of the cross-section results is typically + or -5% above 0.5 MeV (about + or -10% above 13 MeV). Concurrence with existing data is good except below 0.35 MeV, where the present results are considerably higher

National congress of radiation protection; Congres national de radioprotection

Energy Technology Data Exchange (ETDEWEB)

NONE

2001-07-01

The congress of radiation protection tackled different areas of radiation protection. The impact of ionizing radiations on environment coming from radioactive activities. The biological radiation effects, the dosimetry, the different ways of doing relative to radiation protection,the risks analysis and the communications with populations, information about accidents and the lessons learned from them are included in this congress. (N.C.)

GAO Performance and Accountability Report 2001

National Research Council Canada - National Science Library

2001-01-01

The U.S. General Accounting Office is an independent, professional, nonpartisan agency in the legislative branch that is commonly called the investigative arm of the Congress or the Congress's "watchdog...

Annual report to Congress, FY 1992

International Nuclear Information System (INIS)

1993-07-01

The Office of Civilian Radioactive Waste Management (OCRWM) is responsible for disposing of the Nation's spent nuclear fuel from civilian nuclear power reactors and high-level radioactive waste from its defense activities in a cost-effective manner that protects the health and safety of the public and workers and the quality of the environment. To accomplish this mission OCRWM is developing a waste management system consisting of a geologic repository, a facility for monitored retrievable storage, and a system for transporting the waste. This is the ninth annual report submitted by the OCRWM to Congress. The OCRWM submits this report to inform Congress of its activities and expenditures during fiscal year 1992 (October 1, 1991 through September 30, 1992)

5 CFR 838.103 - Definitions.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Definitions. 838.103 Section 838.103 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) COURT ORDERS AFFECTING RETIREMENT BENEFITS Court Orders Generally Organization and Structure of Regulations on...

48 CFR 501.103 - Authority.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Authority. 501.103 Section... SERVICES ADMINISTRATION ACQUISITION REGULATION SYSTEM Purpose, Authority, Issuance 501.103 Authority. GSA's Senior Procurement Executive issues the GSAR under the authority of the Federal Property and...

National legislative and regulatory activities

International Nuclear Information System (INIS)

Anon.

2009-01-01

This part gathers the national legislative and regulatory activities. The subjects tackled are as follow: radiological protection (Belgium), transport of radioactive materials (Belgium, France), general legislation (Brazil, Ireland, Republic of Moldova, Serbia, Turkey), third part liability (Japan), radioactive waste management (Korea, Romania, Slovenia, Usa), regime of radioactive materials (Romania), organisation and structure (Switzerland), regime of nuclear installations (Usa), regulations on nuclear trade (Usa). (N.C)

Understanding Cancer Prognosis

Medline Plus

Full Text Available ... Budget Proposal NCI Congressional Justification NCI Budget Fact Book Careers at NCI Visitor Information Legislative Activities Hearings & ... Plan & Budget Proposal Congressional Justification NCI Budget Fact Book Legislative Activities Hearings & Testimonies Current Congress Legislative History ...

Understanding Cancer Prognosis

Medline Plus

Full Text Available ... Media Cancer Currents Blog About NCI NCI Overview History Contributing to Cancer Research Leadership Director's Page Deputy ... Information Legislative Activities Hearings & Testimonies Current Congress Legislative History Committees of Interest Legislative Resources Recent Public Laws ...

Understanding Cancer Prognosis

Medline Plus

Full Text Available ... Justification NCI Budget Fact Book Careers at NCI Visitor Information Legislative Activities Hearings & Testimonies Current Congress Legislative ... of Interest Legislative Resources Recent Public Laws Careers Visitor Information Search Search Home About Cancer Diagnosis and ...

Argentine psychiatry: report on the 30th Congress.

Science.gov (United States)

Brown, Paul

2016-04-01

To give a contextualised personal account of the 30th Annual Congress of the Argentine Association of Psychiatrists. Conference attendance and analysis of talks. The congress demonstrated that Argentine psychiatry is held back by oppressive political regimes and by government underfunding. The drug companies and third-party payers are entering the vacuum. Argentine trainees and consultants feel ill-prepared to meet the demands of the biomedical psychiatry. © The Royal Australian and New Zealand College of Psychiatrists 2015.

Annual report to Congress, 1993

Energy Technology Data Exchange (ETDEWEB)

1994-03-31

Created by Congress in 1977 as an independent entity within the Department of Energy, the Energy Information Administration (EIA) is the principal and authoritative source of comprehensive energy data for the Congress, the Federal Government, the States, and the public. With the mandate to ``collect, assemble, evaluate, analyze, and disseminate data and information,`` EIA`s mission has been defined to: maintain a comprehensive data and information program relevant to energy resources and reserves, energy production, energy demand, energy technologies, and related financial and statistical information relevant to the adequacy of energy resources to meet the Nation`s demands in the near and longer term future. Develop and maintain analytical tool and collection and processing systems; provide analyses that are accurate, timely, and objective; and provide information dissemination services. This annual report summarizes EIA`s activities and accomplishments in 1993.

29 CFR 4.103 - The Act.

Science.gov (United States)

2010-07-01

... 29 Labor 1 2010-07-01 2010-07-01 true The Act. 4.103 Section 4.103 Labor Office of the Secretary... Contract Act Introductory § 4.103 The Act. The McNamara-O'Hara Service Contract Act of 1965 (Pub. L. 89-286, 79 Stat. 1034, 41 U.S.C. 351 et seq.), hereinafter referred to as the Act, was approved by the...

41 CFR 105-50.401 - Reports submitted to the Congress.

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Reports submitted to the Congress. 105-50.401 Section 105-50.401 Public Contracts and Property Management Federal Property... Congress. (a) The Administrator of General Services will furnish annually to the respective Committees on...

Colombia: Issues for Congress

Science.gov (United States)

2011-03-18

30, 2010, at http://www.lasillavacia.com/ historia /14953. 22 Camila Osorio, “Esta Es la Cara de la Legislatura que Se Posesiona Hoy,” La Silla Vacía...website, July 19, 2010, at http://www.lasillavacia.com/ historia /16740; “New Congress Grants Santos Huge Majority,” Latin American Weekly Report

Key Senators Issue Call for `Meaningful' Climate Legislation

Science.gov (United States)

Showstack, Randy

With the U.S. Senate currently considering national energy legislation, Senators John McCain (R-Arizona) and Joseph Lieberman (D-Connecticut) plan to offer a modified version of their bipartisan, proposed Climate Stewardship Act of 2003 (S. 139) as an amendment. The amendment would establish a market driven system of greenhouse gas tradeable allowances to reduce emission. It would also provide for a program of scientific research on abrupt climate change in order to identify and understand past instances of abrupt change; and would establish a national greenhouse gas data base.

Legislation on university technology transfer and research management 2012

International Nuclear Information System (INIS)

2012-02-01

This book deals with legislation on university technology transfer in 2012, which includes invention promotion act, legislation on technology transfer and promotion of industrialization, legislation on industrial education and industrial cooperation, and special legislation on venture business. It lists the legislation related research and development by government department : fundamental law of scientific technique, law on evaluation and management of domestic research development business, national science and technology council and the patent office.

48 CFR 45.103 - General.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false General. 45.103 Section 45.103 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACT MANAGEMENT... voluntary consensus standards (see FAR 11.101(b)) and industry-leading practices and standards to manage...

48 CFR 825.103 - Exceptions.

Science.gov (United States)

2010-10-01

... article is likely to affect future acquisitions, include a recommendation that a copy of the determination... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Exceptions. 825.103 Section 825.103 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS SOCIOECONOMIC...

RUSSIAN FOREIGN POLICY AND CONGRESSES OF TROPPAU AND LAIBACH

Directory of Open Access Journals (Sweden)

Александр Владимирович Чернов

2014-12-01

Full Text Available The article describes the process of preparation and holding of congresses in Troppau and Laibach. At the beginning of 1820 there was a revolution of Spain. The Russian diplomats headed by Emperor Alexander I and J. Capodistria offered to convene the congress to develop the measures to combat the Spanish revolution. But the British and Austrians opposed that. However when Naples revolution started, Metternich requested permission for the suppression of the rebellion from Alexander I, but Russians insisted on the convocation of the conference. On the congress of Troppau the Russian delegation insisted on the development of the universal measures to the struggle against revolutions that had to be hold in a peaceful manner. The Austrians, who sought to the carrying out of one-sided armed intervention in Naples, were forced to agree with the Russian project. The Preliminary protocol was based on this project. On the congress J. Capodistria offered the new version of his project of the “universal union”. When the king of Neapolitan Ferdinand IV arrived to Laibach he immediately demanded the intervention in Naples. The Russian plan failed. Alexander I was forced to agree to the armed intervention.

37 CFR 251.56 - Order of the Librarian of Congress.

Science.gov (United States)

2010-07-01

... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Order of the Librarian of... PROCEDURE Procedures of Copyright Arbitration Royalty Panels § 251.56 Order of the Librarian of Congress. (a... the determination of a panel, the Librarian of Congress shall issue an order accepting the panel's...

Separation of (Rh-103m)-rhodocene-derivatives from the parent (/sup 103/Ru)ruthenocen-derivatives and their organ distribution

Energy Technology Data Exchange (ETDEWEB)

Wenzel, M.; Wu, Y.

1987-01-01

The radioactive decay of (/sup 103/Ru)ruthenocene derivatives leads to sup(103m)Rh labelled rhodocinium derivatives, which can be separated by the extraction of a lipophilic solution of the ruthenocen derivate with water. The separation factor sup(103m)Rh//sup 103/Ru reaches values of 32:1 Rh/sup 3 +/ ions are not liberated and extracted. The organ distribution of the sup(103m)Rh labelled rhodocinium derivatives gained from ruthenocene and from N-isopropyl-ruthenocene amphetamine is different from the distribution of the parent ruthenocene compound. The liver and kidney uptake of the rhodocinium-amphetamine is much higher than the uptake with ruthenocene amphetamine.

Model Legislation for GAAP and GASB.

Science.gov (United States)

Bissell, George E.

1987-01-01

The use of generally accepted accounting principles (GAAP) by all state and local governments may require legislation. Findings from a survey of states to get data on current accounting and financial reporting practices are summarized. Model legislation to provide uniformity in accounting and reporting is presented. (MLF)

37 CFR 201.23 - Transfer of unpublished copyright deposits to the Library of Congress.

Science.gov (United States)

2010-07-01

... copyright deposits to the Library of Congress. 201.23 Section 201.23 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES GENERAL PROVISIONS § 201.23 Transfer of unpublished copyright deposits to the Library of Congress. (a) General. This section prescribes...

16 CFR 1015.10 - Commission report of actions to Congress.

Science.gov (United States)

2010-01-01

... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Commission report of actions to Congress. 1015.10 Section 1015.10 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION GENERAL PROCEDURES FOR... U.S.C. 552(a) § 1015.10 Commission report of actions to Congress. On or before February 1 of each...

International Congress on Energy Efficiency and Energy Related Materials

CERN Document Server

Bahsi, Zehra; Ozer, Mehmet; ENEFM2013

2014-01-01

The International Congress on Energy Efficiency and Energy Related Materials (ENEFM2013) was held on 9-12 October, 2013. This three-day congress focused on the latest developments of sustainable energy technologies, materials for sustainable energy applications and environmental & economic perspectives of energy. These proceedings include 63 peer reviewed technical papers, submitted from leading academic and research institutions from over 23 countries, representing some of the most cutting edge research available. The papers included were presented at the congress in the following sessions: General Issues Wind Energy Solar Energy Nuclear Energy Biofuels and Bioenergy Energy Storage Energy Conservation and Efficiency Energy in Buildings   Economical and Environmental Issues Environment Energy Requirements Economic Development   Materials for Sustainable Energy Hydrogen Production and Storage Photovoltaic Cells Thermionic Converters Batteries and Superconductors Phase Change Materials Fuel Cells Supercon...

31 CFR 103.175 - Definitions.

Science.gov (United States)

2010-07-01

... REPORTING OF CURRENCY AND FOREIGN TRANSACTIONS Anti-Money Laundering Programs Special Due Diligence for...-money laundering program requirement; (viii) A broker or dealer in securities registered, or required to... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Definitions. 103.175 Section 103.175...

48 CFR 1.103 - Authority.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Authority. 1.103 Section 1... REGULATIONS SYSTEM Purpose, Authority, Issuance 1.103 Authority. (a) The development of the FAR System is in..., National Aeronautics and Space Administration, under their several statutory authorities. [48 FR 42103...

Inside and Outside the Policy Consensus: Science in a Time of Policy Upheaval in Congress

Science.gov (United States)

McCurdy, K. M.

2011-12-01

A public policy consensus in the United States typically lasts fifty years, an epoch in politics. During periods of relative stability, Constitutional provisions protect the status quo and Congressional procedures favor incremental changes. The consensus breaks down when elections bring members into the institutions with fundamentally different assumptions about the purpose of government. The ensuing policy upheaval brings change that is likely to be transformational with the new policy resembling little of what existed before. The important determinants of potential for policy upheaval and subsequent innovation are the magnitude of the electoral victory, committee specialization and seniority of the members remaining in Congress. The late 19th century policy arc that created the USGS and other rationally based government agencies used scientists to depoliticize important development decisions - e.g. where and when to build irrigation projects or research facilities. The country flourished through the 20th century as politicians of both parties agreed to keep science as a neutral advisor to their decision process. This consensus began to fray after WWII when nuclear physicists, among others, questioned DOD nuclear weapons development plans; the Sierra Club challenged dams on the Colorado River; and tragic mistakes such as thalidomide and DES became well known. Science became vulnerable to politicization as the prior consensus was dismantled incrementally election by election. The late 20th century saw increasingly small majority party margins and divided government became a regular election result instead of a rarity. Divided government lasted for one election cycle before party realignments in 1860, 1896 and 1934. Coincident with the recurring periods of divided government since 1980 without a recognizable realignment was a transformation in the view of science from "collaborator" to "enemy" in the policy process. Geosciences have been caught in the legislative

The Political Economy of Collective Labour Legislation in Taiwan

Directory of Open Access Journals (Sweden)

James W. Y. Wang

2010-01-01

Full Text Available This article provides a seminal analysis of collective labour legislation in Taiwan. A chronological review of Taiwan’s legislative process suggests that the context of incorporation, institutional framework, mechanisms for delivering reforms, and sequence of reforms together shape the legislative outcomes of labour reforms at the collective level. While most labour legislation was revised and passed after the preceding sequence of economic transition, the reform of collective labour rights was greatly constrained by the flexible labour-market structure. In order for politicians to form new alliances with labour organizations, legislation of collective labour rights was a strategy to cultivate support during electoral periods. Consequently, the industrial relations changed following the enactment of substantial reform-oriented labour legislation. Theore-tically, the historical analysis of legislative procedure unveils evolutionary reform paths for collective labour rights in new democracies. At the same time, empirically, Taiwan demonstrates an alternative reform path in combination with incremental steps and progressive agendas. For new democracies of small economy, a window of opportunity for the progress in collective labour legislation remains open today, albeit with limitations.

19 CFR 200.735-103 - Counseling service.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 3 2010-04-01 2010-04-01 false Counseling service. 200.735-103 Section 200.735-103 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION EMPLOYEE RESPONSIBILITIES AND CONDUCT General Provisions § 200.735-103 Counseling service. (a) The Chairman shall appoint a Designated Agency...

5 CFR 307.103 - Nature of VRAs.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Nature of VRAs. 307.103 Section 307.103 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS VETERANS RECRUITMENT APPOINTMENTS § 307.103 Nature of VRAs. VRAs are excepted appointments, made without competition, to positions...

Legislative Bargaining and Incremental Budgeting

OpenAIRE

Dhammika Dharmapala

2002-01-01

The notion of 'incrementalism', formulated by Aaron Wildavsky in the 1960's, has been extremely influential in the public budgeting literature. In essence, it entails the claim that legislators engaged in budgetary policymaking accept past allocations, and decide only on the allocation of increments to revenue. Wildavsky explained incrementalism with reference to the cognitive limitations of lawmakers and their desire to reduce conflict. This paper uses a legislative bargaining framework to u...

1st National Mechanics Congress

CERN Document Server

Nieuwstadt, F

1990-01-01

The Department of Applied Mechanics of the Royal Institution of Engineers in the Netherlands (Koninklijk Instituut van Ingenieurs) organised on April 2-4, 1990 the first National Applied Mechanics Congress about the theme: "Integration of Theory and Applications in Applied Mechanics" The idea behind this initiative was to bring together the Applied Mechanics communities in The Netherlands and Belgium and to create an environment in which new developments in the field could be discussed and in which connections to other disciplines could be established. Among an extensive list of possible subjects the following were selected as congress topics: - non-linear material behaviour, - chaos, - mechatronics, - liquid-solid interactions, - mathematics and applied mechanics, - integration of Applied Mechanics and other disciplines. Applied Mechanics comprises both solid mechanics and fluid mechanics. These can be subdivided further into: rheology, plasticity, theory of plates and shells, theory of elasticity, multibody...

FISITA 2012 World Automotive Congress

CERN Document Server

2013-01-01

Proceedings of the FISITA 2012 World Automotive Congress are selected from nearly 2,000 papers submitted to the 34th FISITA World Automotive Congress, which is held by Society of Automotive Engineers of China (SAE-China ) and the International Federation of Automotive Engineering Societies (FISITA). This proceedings focus on solutions for sustainable mobility in all areas of passenger car, truck and bus transportation. Volume 8: Vehicle Design and Testing (II) focuses on: •Automotive Reliability Technology •Lightweight Design Technology •Design for Recycling •Dynamic Modeling •Simulation and Experimental Validation •Virtual Design, Testing and Validation •Testing of Components, Systems and Full Vehicle Above all researchers, professional engineers and graduates in fields of automotive engineering, mechanical engineering and electronic engineering will benefit from this book.   SAE-China is a national academic organization composed of enterprises and professionals who focus on research, design a...

31 CFR 103.90 - Definitions.

Science.gov (United States)

2010-07-01

... definitions apply: (a) Money laundering means an activity criminalized by 18 U.S.C. 1956 or 1957, or an... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Definitions. 103.90 Section 103.90 Money and Finance: Treasury Regulations Relating to Money and Finance FINANCIAL RECORDKEEPING AND...

34 CFR 200.103 - Definitions.

Science.gov (United States)

2010-07-01

...) Children means— (1) Persons up through age 21 who are entitled to a free public education through grade 12... 34 Education 1 2010-07-01 2010-07-01 false Definitions. 200.103 Section 200.103 Education Regulations of the Offices of the Department of Education OFFICE OF ELEMENTARY AND SECONDARY EDUCATION...

48 CFR 1301.103 - Authority.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Authority. 1301.103... COMMERCE ACQUISITION REGULATIONS SYSTEM Purpose, Authority, Issuance 1301.103 Authority. The CAR is issued under the authority of section 22 of the Office of Federal Procurement Policy Act, as amended (41 U.S.C...

48 CFR 801.103 - Authority.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Authority. 801.103 Section... VETERANS AFFAIRS ACQUISITION REGULATION SYSTEM Purpose, Authority, Issuance 801.103 Authority. The Secretary issues the VAAR under the authority of 40 U.S.C. 121(c), Title 48 of the Code of Federal...

48 CFR 301.103 - Authority.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Authority. 301.103 Section... REGULATION SYSTEM Purpose, Authority, and Issuance 301.103 Authority. (b) The Assistant Secretary for Financial Resources (ASFR) prescribes the HHSAR under the authority of 5 U.S.C. 301 and section 205(c) of...

Dicty_cDB: SFF103 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFF103 (Link to dictyBase) - - - Contig-U11967-1 SFF103Z (Link... to Original site) - - SFF103Z 655 - - - - Show SFF103 Library SF (Link to library) Clone ID SFF103 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11967-1 Original site URL http://dict...nslated Amino Acid sequence ---rgsf*FLKIIITLLAYKIICTPNHMHLTRGNHETTDMNRFYGFQGEVVAKYSEMVFD LFSELFNWFPLAFVLDESF...*rkrlsnr**wfshhcflc skll*siw*swliykynxdkikittxklxtsexppmhsqk Frame C: ---rgsf*FLKIIITLLAYKIICT

77 FR 71019 - Advisory Committee on the Records of Congress; Meeting

Science.gov (United States)

2012-11-28

... NATIONAL ARCHIVES AND RECORDS ADMINISTRATION Advisory Committee on the Records of Congress; Meeting AGENCY: National Archives and Records Administration. ACTION: Notice of meeting. SUMMARY: In...) announces a meeting of the Advisory Committee on the Records of Congress. The committee advises NARA on the...

2002 NPDES CSO Report to Congress

Science.gov (United States)

This report, delivered to Congress on January 29, 2002, identifies progress made in implementing and enforcing combined sewer overflow (CSO) controls prior to, and because of, the 1994 CSO control policy.

40 CFR 406.103-406.104 - [Reserved

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 28 2010-07-01 2010-07-01 true [Reserved] 406.103-406.104 Section 406.103-406.104 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS GRAIN MILLS POINT SOURCE CATEGORY Wheat Starch and Gluten Subcategory §§ 406.103-406.104...

18 CFR 284.103-284.106 - [Reserved

Science.gov (United States)

2010-04-01

... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false [Reserved] 284.103-284.106 Section 284.103-284.106 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY... RELATED AUTHORITIES Certain Transportation by Interstate Pipelines §§ 284.103-284.106 [Reserved] ...

31 CFR 103.73 - Contents of summons.

Science.gov (United States)

2010-07-01

... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Contents of summons. 103.73 Section 103.73 Money and Finance: Treasury Regulations Relating to Money and Finance FINANCIAL RECORDKEEPING AND REPORTING OF CURRENCY AND FOREIGN TRANSACTIONS Summons § 103.73 Contents of summons. (a) Summons...

49 CFR 38.103 - Public information system.

Science.gov (United States)

2010-10-01

... 49 Transportation 1 2010-10-01 2010-10-01 false Public information system. 38.103 Section 38.103... SPECIFICATIONS FOR TRANSPORTATION VEHICLES Commuter Rail Cars and Systems § 38.103 Public information system. (a... information. Alternative systems or devices which provide equivalent access are also permitted. (b) [Reserved] ...

R'07 World Congress - Recovery of materials and energy for resource efficiency

Energy Technology Data Exchange (ETDEWEB)

NONE

2007-07-01

This final congress report summarises the topics dealt with at the R'07 World Congress on the recovery of materials and energy for resource efficiency. The congress was held in 2007 in Davos, Switzerland. Details on the organisation and participants are given and the experts who held plenary lectures are listed. Brief details are given on oral and poster sessions, along with details on how the proceedings of the congress can be obtained. Workshops held at the conference covered the following topics: Plastics recycling, biofuels and E-waste, workshops on zero wastes, scarce metals and the identification and management of social implications over the product life cycle (footprint). An Internet-address where the results of the sessions can be obtained is given along with a summary of excursions and social events held within the framework of the congress. Finally, participant feedback is presented in graphical form.

14 CFR 1250.103 - Discrimination prohibited.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Discrimination prohibited. 1250.103 Section 1250.103 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION NONDISCRIMINATION IN... Discrimination prohibited. ...

Does State Legislation Improve Nursing Workforce Diversity?

Science.gov (United States)

Travers, Jasmine; Smaldone, Arlene; Cohn, Elizabeth Gross

2015-08-01

A health-care workforce representative of our nation's diversity is a health and research priority. Although racial and ethnic minorities represent 37% of Americans, they comprise only 16% of the nursing workforce. The purpose of this study was to examine the effect of state legislation on minority recruitment to nursing. Using data from the National Conference of State Legislatures, American Association of Colleges of Nursing, and U.S. census, we compared minority enrollment in baccalaureate nursing programs of states (Texas, Virginia, Michigan, California, Florida, Connecticut, and Arkansas) before and 3 years after enacting legislation with geographically adjacent states without legislation. Data were analyzed using descriptive and chi-square statistics. Following legislation, Arkansas (13.8%-24.5%), California (3.3%-5.4%), and Michigan (8.0%-10.0%) significantly increased enrollment of Blacks, and Florida (11.8%-15.4%) and Texas (11.2%-13.9%) significantly increased enrollment of Hispanic baccalaureate nursing students. States that tied legislation to funding, encouragement, and reimbursement had larger enrollment gains and greater minority representation. © The Author(s) 2015.

An analysis of state legislation on community trails.

Science.gov (United States)

Eyler, Amy; Lankford, Tina; Chriqui, Jamie; Evenson, Kelly R; Kruger, Judy; Tompkins, Nancy; Voorhees, Carolyn; Zieff, Susan; Aytur, Semra; Brownson, Ross

2010-03-01

Trails provide opportunities for recreation, transportation and activity. The purpose of this article is to describe state legislation related to community trails, to analyze legislation content, and to evaluate legislation on inclusion of evidence-informed elements. State trail legislation from 2001 to 2008 was identified using online legislative databases. An analysis of evidence-informed elements included in the legislation was conducted. These elements included: funding, liability, accessibility, connectivity, and maintenance. Of the total 991 trail bills, 516 (52.0%) were appropriations bills, of which 167 (32.2%) were enacted. We analyzed 475 (48%) nonappropriation trail bills of which 139 (29.3%) were enacted. The percentage of enactment of appropriations bills decreased over time while enactment of nonappropriations trail bills increased. Over half of the nonappropriations trail bills included at least 1 evidence-informed element, most commonly funding. Few bills contained liability, connectivity, accessibility, or maintenance. There is opportunity for providing evidence-informed information to policy-makers to potentially influence bill content. The number of bills with a funding element demonstrates that fiscal support for trails is an important policy lever that state legislatures may use to support trails. Lastly, trails should be considered in over-all state-level physical activity legislation to provide opportunities for communities to be active.

40 CFR 57.103 - Definitions.

Science.gov (United States)

2010-07-01

... unavoidable failure of air pollution control equipment or process equipment or of a process to operate in a... pollutant in the ambient air by varying the emissions of that pollutant according to atmospheric conditions... 40 Protection of Environment 5 2010-07-01 2010-07-01 false Definitions. 57.103 Section 57.103...

<90 day storage training plan for the 103-B, 1701-BA, AND 1714-C buildings

International Nuclear Information System (INIS)

Snider, P.M.

1996-10-01

The 103-B, 1701-BA, and 1714C < 90 Day Storage Area stores characteristic wastes generated in the demolition of the 103-B, 1701-BA, and 1714-C Complex. Wastes (lead-based painted components) are packaged and stored in vendor shipment containers. This is the Environmental Restoration Contractor team training plan for the 103-B, 1701-BA, and 1714-C subgrade demolition < 90 Day Storage of Hazardous Waste. This document is intended to meet the requirements of Washington Administrative Code 173-303-330 and the Hanford Dangerous Waste Permit. Training unrelated to compliance with WAC 173-303-330 is not addressed in this training plan. WAC 173-303-330(1)(d)(2, 5, 6) requires that personnel be familiarized, where applicable, with waste feed cut-off systems, response to ground-water contamination incidents, and shutdown of operations. These are not applicable to 103-B, 1701-BA, and 1714-C Subgrade Demolition < 90 Day Storage, and therefore are not covered in this training plan

2004 NPDES CSO Report to Congress

Science.gov (United States)

This report, delivered to Congress on Thursday, August 26, 2004, presents a comprehensive characterization of CSOs and SSOs, including the extent of environmental and human health impacts caused by CSOs and SSOs.

55th MASA congress: challenges for medicine in S.A

International Nuclear Information System (INIS)

1987-01-01

This congress titled C hallenges for medicine in S.A. , is the 55th congress of the Medical Association of South Africa held on 9-11 March 1987 in Cape Town. This publication only contains the abstracts of papers delivered on different medical subjects. One of the abstracts briefly looks at the nuclear magnetic resonance technique in diagnosis

[Student program, congress grants and their potential influence on surgical career selection].

Science.gov (United States)

Jähne, J; Mittelstädt, A; Götzky, K

2017-11-01

Due to a decreased interest in surgical training the German Society of Surgery (GSS) has provided a specially sponsored student program at its annual clinical congress for many years in order to increase the number of applicants for a career in surgery. It remains unclear if this goal is reached because an evaluation has not yet been performed. At the clinical congress in 2014, 200 medical students participated in a special student program with the aid of a congress grant totaling 100,000 €. By means of a questionnaire it was asked how many of the participants in this special program have started a residency in surgery. Almost 17% of the participants of the student program answered and 13 students (6.5% of all participants) stated that they had started a surgical residency. All of these students claimed an interest in surgery even before participation in the congress. Those students who had not yet decided what kind of residency they should choose did not vote for surgery despite their visit to the congress. The student program and the congress grant at the annual clinical congress of the GSS do not result in an increased number of applicants for a residency in surgery. Both incentives might be not more than a strategic marketing instrument. An increased number of medical students applying for a residency in surgery is only to be expected if social developments (e. g. attention to a work-life balance) and their concomitant challenges are reflected in surgical day to day work.

Swiss legislation on dog ownership

CERN Multimedia

DSU Department

2008-01-01

The Swiss Permanent Mission in Geneva has requested CERN to inform the members of its personnel that a notice relating to Swiss legislation on dog ownership has been published on-line at the following address: http://www.eda.admin.ch/eda/en/home/topics/intorg/un/unge/gepri/pet.html This legislation is applicable to all international civil servants who own a dog. Relations with the Host States Service mailto:relations.secretariat@cern.ch http://www.cern.ch/relations/

State health agencies and the legislative policy process.

Science.gov (United States)

Williams-Crowe, S M; Aultman, T V

1994-01-01

A new era of health care reform places increasing pressure on public health leaders and agencies to participate in the public policy arena. Public health professionals have long been comfortable in providing the scientific knowledge base required in policy development. What has been more recent in its evolution, however, is recognition that they must also play an active role in leading and shaping the debate over policy. A profile of effective State legislative policy "entrepreneurs" and their strategies has been developed to assist health agencies in developing such a leadership position. Based on the experiences of State legislative liaison officers, specific strategies for dealing with State legislatures have been identified and are organized into five key areas--agency organization, staff skills, communications, negotiation, and active ongoing involvement. A public health agency must be organized effectively to participate in the legislative policy process. Typically, effective agencies centralize responsibility for policy activities and promote broad and coordinated participation throughout the organization. Playing a key role in the agency's political interventions, the legislative liaison office should be staffed with persons possessing excellent interpersonal skills and a high degree of technical competence. Of central importance to effective legislative policy entrepreneurship is the ability to communicate the agency's position clearly. This includes setting forward a focused policy agenda, documenting policy issues in a meaningful manner, and reaching legislators with the proper information. Once a matter is on the legislative agenda, the agency must be prepared to negotiate and build broad support for the measure. Finally, public health agencies must be active policy players. To take advantage of new opportunities for action, the public health (policy) leader must monitor the political environment continually.By working to anticipate and formulate

The 104th congress: challenges for mining

Energy Technology Data Exchange (ETDEWEB)

Altmeyer, T.

1995-03-01

The election of a Republican majority to the US Congress in autumn 1994 will inaugurate a period of change. The period ahead will see a Democrat president against a Republic Congress, both with a manifesto for change. The possible results of such changes on the mining industry are examined. They include: mining law; Clean Water Act; Superfund; Safe Drinking Water Act; Resource Conservation and Recovery Act; Endangered Species Act; wetlands; recognition of property rights; judicial reform; Occupational Safety and Health Act; health care reform; labor law reform; Water Resources Development Act; fast track trade agreements; issue linkage in track agreements; and the US-Chile free trade agreement.

39 CFR 10.3 - Post-employment activities.

Science.gov (United States)

2010-07-01

... 39 Postal Service 1 2010-07-01 2010-07-01 false Post-employment activities. 10.3 Section 10.3 Postal Service UNITED STATES POSTAL SERVICE THE BOARD OF GOVERNORS OF THE U.S. POSTAL SERVICE RULES OF CONDUCT FOR POSTAL SERVICE GOVERNORS (ARTICLE X) § 10.3 Post-employment activities. Governors are subject...

8 CFR 103.30 - Accounting for disclosures.

Science.gov (United States)

2010-01-01

... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Accounting for disclosures. 103.30 Section... DUTIES; AVAILABILITY OF RECORDS § 103.30 Accounting for disclosures. (a) An accounting of each disclosure of information for which accounting is required (see § 103.24 of this part) shall be attached to the...

17 CFR 248.103-248.119 - [Reserved

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false [Reserved] 248.103-248.119 Section 248.103-248.119 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing §§ 248.103-248.119 [Reserved] ...

48 CFR 922.103-5 - Contract clauses.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clauses. 922.103... PROGRAMS APPLICATION OF LABOR LAWS TO GOVERNMENT ACQUISITION Basic Labor Policies 922.103-5 Contract clauses. In accordance with FAR 22.101-1(e) and FAR 22.103-5, the contracting officer shall insert the...

12 CFR 509.103 - Civil money penalties.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Civil money penalties. 509.103 Section 509.103... PROCEDURE IN ADJUDICATORY PROCEEDINGS Local Rules § 509.103 Civil money penalties. (a) Assessment. In the... may serve an order of assessment of civil money penalty upon the party concerned. The assessment order...

41st WORLD CONGRESS OF ISMH - 19-21 May 2016 - Bucharest, Romania - Abstracts Book

Directory of Open Access Journals (Sweden)

Constantin Munteanu

2016-05-01

Full Text Available The logo of the congress is: „evergreen balneology - the way ahead”. ”The 41st ISMH Congress” will be a con-join congress with Romanian Society of Balneology and with Romanian Society of Physical and Rehabilitation Medicine &Balneoclimatology. There comes a time of reflection upon different aspects of balneology, after we have had congresses in Extreme Orient (Japan, 2014 and in Latin America (Brazil, 2015. We have seen and understood that there's a real world heritage and culture of thermalisme/balneotherapy whose cradle is Europe. Romania was dwelled since the beginning of the world history until today and archaeological remains of Greek, Roman, and Ottoman Empire culture are found all over the country together with archaeological remains our own culture. 41st ISMH World Congress was accredited by the European Accreditation Council for Continuing Medical Education (EACCME to provide the following CME activity for medical specialists. The EACCME is an institution of the European Union of Medical Specialists (UEMS, www.uems.net The '41st ISMH World Congress' is designated for up to 15 hours of European external CME credits. Pre Congress Training Courses – acreditated by Romanian College of Physicians with 3 credits (EMC, apart from the congress: Accreditation letter

European Automotive Congress

CERN Document Server

Clenci, Adrian

2016-01-01

The volume includes selected and reviewed papers from the European Automotive Congress held in Bucharest, Romania, in November 2015. Authors are experts from research, industry and universities coming from 14 countries worldwide. The papers are covering the latest developments in fuel economy and environment, automotive safety and comfort, automotive reliability and maintenance, new materials and technologies, traffic and road transport systems, advanced engineering methods and tools, as well as advanced powertrains and hybrid and electric drives.

Proceedings of the 3. Brazilian Congress on Geochemistry; 1. Congress on Geochemistry from Portuguese Language Countries - Abstracts

International Nuclear Information System (INIS)

1991-01-01

This congress presents topics about geochemistry, including litho-geochemistry, environmental geochemistry, hydro-geochemistry and surface geochemistry. Works on geochronology and nuclear methods in rocks and minerals are also described. (C.G.C.)

LEGISLATIVE, ACCOUNTING AND FISCAL NON-CONFORMITIES

Directory of Open Access Journals (Sweden)

PALIU – POPA LUCIA

2016-12-01

Full Text Available In the context of the debate analysis from the last decades on the relationship between accounting and taxation, independence or dependence of the accounting rules from the tax ones and taking into consideration that the independence of the two leads to permanent and even significant differences between the accounting and tax profit, I found that certain terms are regulated differently in accounting legislation in our country compared to fiscal one or the legislation in the economic field. Taken from this perspective the main objective of this scientific approach is the identification of accounting and tax legislative nonconformities and the proposal of the ways to solve them so as to eliminate, where possible, differentiated professional interpretations.

LEGISLATIVE, ACCOUNTING AND FISCAL NON-CONFORMITIES

Directory of Open Access Journals (Sweden)

PALIU – POPA LUCIA

2017-12-01

Full Text Available In the context of the debate analysis from the last decades on the relationship between accounting and taxation, independence or dependence of the accounting rules from the tax ones and taking into consideration that the independence of the two leads to permanent and even significant differences between the accounting and tax profit, I found that certain terms are regulated differently in accounting legislation in our country compared to fiscal one or the legislation in the economic field. Taken from this perspective the main objective of this scientific approach is the identification of accounting and tax legislative nonconformities and the proposal of the ways to solve them so as to eliminate, where possible, differentiated professional interpretations.

CFC legislation in the European Union

Directory of Open Access Journals (Sweden)

Cvjetković Cvjetana M.

2015-01-01

Full Text Available In this paper the author considers CFC legislation in the Member States of the European Union, and points to the official attitude of the institutions of the European Union toward CFC legislation. Special attention in this paper is focused on Judgment of the Court of Justice of the European Union in the case Cadbury Schweppes. The aim of the paper is to analyze CFC legislation in the Member States in order to determine its basic characteristics, as well as to determine its compatibility with freedoms guaranteed by the primary law of the European Union, i.e. with Judgment of the Court of Justice of the European Union in the Cadbury Schweppes case.

Measuring Stability and Security in Iraq: Report to Congress in Accordance with the Department of Defense Appropriations Act 2007 (Section 9010, Public Law 109-289)

National Research Council Canada - National Science Library

2006-01-01

This report to Congress includes specific performance indicators and measures of progress toward political, economic, and security stability in Iraq, as directed in Section 9010, DoD Defense Appropriations Act 2007...

International Youth Nuclear Congress

International Nuclear Information System (INIS)

Fern, A.

2017-01-01

International Youth Nuclear Congress (IYNC) was Initiated by an international YG group of enthusiasts in 1997. Mission statement developed at ENC1998 in Nice, France Growth in enthusiasm and support: IAEA, Nuclear Societies, companies. IYNC run by the Young Generation with full support of experienced advisors, nuclear societies and companies. First came to African continent when IYNC 2010 was hosted by South Africa

9th ISAAC Congress

CERN Document Server

Ruzhansky, Michael; Analytic Methods in Interdisciplinary Applications

2015-01-01

The book includes lectures given by the plenary and key speakers at the 9th International ISAAC Congress held 2013 in Krakow, Poland. The contributions treat recent developments in analysis and surrounding areas, concerning topics from the theory of partial differential equations, function spaces, scattering, probability theory, and others, as well as applications to biomathematics, queueing models, fractured porous media and geomechanics.

Congress, courts, and commerce: upholding the individual mandate to protect the public's health.

Science.gov (United States)

Hodge, James G; Brown, Erin C Fuse; Orenstein, Daniel G; O'Keefe, Sarah

2011-01-01

Among multiple legal challenges to the Patient Protection and Affordable Care Act (PPACA) is the premise that PPACA's "individual mandate" (requiring all individuals to obtain health insurance by 2014 or face civil penalties) is inviolate of Congress' interstate commerce powers because Congress lacks the power to regulate commercial "inactivity." Several courts initially considering this argument have rejected it, but federal district courts in Virginia and Florida have concurred, leading to numerous appeals and prospective review of the United States Supreme Court. Despite creative arguments, the dispositive constitutional question is not whether Congress' interstate commerce power extends to commercial inactivity. Rather, it is whether Congress may regulate individual decisions with significant economic ramifications in the interests of protecting and promoting the public's health. This article offers a counter-interpretation of the scope of Congress' interstate commerce power to regulate in furtherance of the public's health. © 2011 American Society of Law, Medicine & Ethics, Inc.

Role of Congress in the High Level Radioactive Waste Odyssey: The Wisdom and Will of the Congress - 13096

International Nuclear Information System (INIS)

Vieth, Donald L.; Voegele, Michael D.

2013-01-01

Congress has had a dual role with regard to high level radioactive waste, being involved in both its creation and its disposal. A significant amount of time has passed between the creation of the nation's first high level radioactive waste and the present day. The pace of addressing its remediation has been highly irregular. Congress has had to consider the technical, regulatory, and political issues and all have had specific difficulties. It is a true odyssey framed by an imperative and accountability, by a sense of urgency, by an ability or inability to finish the job and by consequences. Congress had set a politically acceptable course by 1982. However, President Obama intervened in the process after he took office in January 2009. Through the efforts of his Administration, by the end of 2012, the US government has no program to dispose of high level radioactive waste and no reasonable prospect of a repository for high level radioactive waste. It is not obvious how the US government program will be reestablished or who will assume responsibility for leadership. The ultimate criteria for judging the consequences are 1) the outcome of the ongoing NRC's Nuclear Waste Confidence Rulemaking and 2) the concomitant permissibility of nuclear energy supplying electricity from operating reactors in the US. (authors)

Legislative Framework Required for Africa's M-Economy

DEFF Research Database (Denmark)

Williams, Idongesit

2014-01-01

This article discusses the importance of developing legislative frameworks for the development of an m - economy in Africa......This article discusses the importance of developing legislative frameworks for the development of an m - economy in Africa...

Accountability legislation: Implications for financial and performance reporting

Directory of Open Access Journals (Sweden)

Daphne Rixon

2012-03-01

Full Text Available The purpose of this case study is to first examine the implications of accountability legislation on the financial and performance reporting of a public sector agency in the Canadian province of Newfoundland and Labrador and secondly, to compare the level of accountability with Stewart’s (1984 ladder of accountability. This paper is based on the first phase of a two-phase study. The first phase focuses on the initial impacts of accountability legislation on agencies and the challenges created by the legislation’s ‘one size fits all’ approach. The second phase of this study will examine the impact of the legislation on stakeholders after it has been in operation for five years. The second phase will include interviews with stakeholders to ascertain the level of satisfaction with the new legislation. The first phase of the study is significant since it highlights how governments could consider stakeholder needs when drafting such legislation. This research contributes to the body of literature on stakeholder accountability since there is a paucity of research focused specifically on the impact of accountability legislation on public sector agencies. An important contribution of this paper is the introduction of a framework for legislated accountability reporting. The main theoretical frameworks used to analyse the findings are Stewart’s (1984 ladder of accountability in conjunction with Friedman and Miles (2006 ladder of stakeholder management and engagement.

DIFFERENT CONCENTRATIONS OF POWDERED EGG YOLK ADDED TO THE ACP-103® EXTENDER IN SWINE SEMEN CONSERVATION

Directory of Open Access Journals (Sweden)

Ricardo Toniolli

2016-04-01

Full Text Available Many attempts have been made to improve the conservation of boar semen. Egg yolk is known to have cryoprotectant properties. This study aimed to test different concentrations of egg yolk added to the coconut milk powder extender (ACP-103®, and verify which one is better to maintain sperm viability. The ejaculated (36 were diluted in ACP-103® supplemented with different concentrations of egg yolk (0%, 1%, 3%, 5% and 7%. The conservation occurred at 17 °C, and vigor and motility analysis were carried out daily. On days 1 (D0, 3 (D2 and 5 (D4 the semen was evaluated for vitality, morphology and osmotic resistance. For statistical nonparametric analysis Kruskal-Wallis and Dunn’s tests were performed, and for parametric data ANOVA and Tukey test were used. A decrease in vigor and motility was observed in all treatments. Treatments T2, T3 and T4 better maintained spermatic on D0 (2.4±0.8, 2.5±1.1, and 2.8±0.9, respectively, with no signi cant differences among them. The same was observed for motility (77±15%, 74±23%, and 81±16% on D0. Analyses of vitality, morphology and osmotic resistance did not show statistical difference among treatments. In conclusion, the concentration of egg yolk (7% added to the ACP-103® can be e ectively used as extender to maintain sperm viability.

Firework related injury and legislation: the epidemiology of firework injuries and the effect of legislation in Northern Ireland.

Science.gov (United States)

Fogarty, B J; Gordon, D J

1999-02-01

The efficacy of legislation in reducing firework associated injuries is uncertain as is the nature of the problem within the United Kingdom (UK). In September 1996 the legislation governing firework sale in Northern Ireland was relaxed thus equalling that of the rest of the UK. For the 2 years following the change in legislation we prospectively assessed those patients who were admitted with a firework injury over the Halloween period. We then compared these results with retrospective data for the 3 years prior to the change in firework law. In the pre-legislation series the mean number of patients admitted annually was 0.38 per 100,000 while in the post-legislation series the mean was 0.43 per 100,000. Blast injury to the hand was the commonest injury accounting for 53% of cases in both series. Burn injuries were the second commonest form of injury comprising 30% of all admissions. Of those admitted with a hand injury 47% had at least one finger terminalised and nearly half of those patients admitted with burns (44%) required skin grafting. We conclude that early evidence suggests that liberalisation of the law on firework sale has not resulted in a significant increase in firework related injuries requiring hospital admission.

37 CFR 202.19 - Deposit of published copies or phonorecords for the Library of Congress.

Science.gov (United States)

2010-07-01

... appropriate officials of the Library of Congress, and shall be based upon the acquisition policies of the... or phonorecords for the Library of Congress. 202.19 Section 202.19 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES PREREGISTRATION AND...

Legislating Interprofessional Regulatory Collaboration in Nova Scotia

Directory of Open Access Journals (Sweden)

William Lahey

2013-10-01

Full Text Available To shift health professions regulation from traditional to ‘collaborative’ self-regulation, Nova Scotia has adopted legislation which will: make all self-regulating health professions members of the Regulated Health Professions Network; mandate the Network to facilitate voluntary collaboration among its members; and enable regulators to work together on investigations of patient complaints, to adjust scopes of practice on an ongoing basis and to adjudicate appeals of unsuccessful applicants for registration. The goals are to give health professions regulation the capacity to enable and support the functioning of interprofessional teams. The legislation was adopted primarily for two reasons: collaborative development and unanimous support by all of the province’s self-regulating professions; and alignment with the government’s health care reform agenda and its emphasis on collaborative team-based care. Contrary to the approach of several other provinces, the legislation will enable but not require regulators to collaborate on the premise that consensual collaboration is more likely to happen, to be meaningful and to yield tangible benefits. Support for this approach can be taken from the impressive collaborative work on which the legislation is based. Evaluation will be critical, and the five-year review required by the legislation will give Nova Scotia the opportunity to test not only the legislation but the ideas on which it is based. The extent of the legislation’s reliance on voluntary process will prove to be either its greatest strength or its greatest weakness.

New Ontario power legislation aims to protect consumers

Energy Technology Data Exchange (ETDEWEB)

Anon.

2000-09-01

New legislation designed to improve regulation of the electricity sector in Ontario was introduced by the provincial government in June 2000, the first such legislation since the government mandated an open electricity market with the Energy Competition Act of 1998. The new legislation is described as narrowly focused on putting limits on local power rate increases. The legislation was introduced in combination with a directive to the Ontario Energy Board, and is designed to ensure that the Board approves municipal electric utility rates only when certain conditions are met. The Energy Minister was at great pains to point out that the legislation should not be interpreted as the government interfering in the marketplace, it is merely to help the utility wires side of the business during a two-year transition period. Municipal authorities reacted unfavorably to the legislation because it appears to require them to return significant assets to their utilities, assets that they considered as theirs under municipal restructuring. Energy Probe, an environmental advocacy group, suggested an alternative to the legislation, i. e., the government should allow the price increases requested by the municipal utilities to go through, but to leave consumers whole, it should impose a windfall profits tax on municipal governments, use the proceeds to reduce debt retirement taxes in the electricity bill, a leftover from Ontario Hydro's debt and stranded nuclear waste liabilities, and eliminate the province's own electricity tax on consumers. No direct reaction has been received from the Minister to date. If the legislation is passed in its present form it will prevent municipalities from using windfall profits from their utilities to justify rate hikes.

The relationship between administrative court control and legislative control

International Nuclear Information System (INIS)

Beckmann, M.

1986-01-01

The legislator can determine the extent of control of administrative courts by reduction of substantive conditions. The author has the opinion that the judicial control cannot be stricter than the legislative control. For the range of the control of administrative courts is decisive, to what extent the legislator is forced to proper legislative settlements. In this context the author discusses the Kalkar-decision of the Federal Constitutional Court of 1978. (CW) [de

17th International Congress of Biometeorology (ICB) 2005. Vol. 1. Proceedings

International Nuclear Information System (INIS)

Anon.

2005-01-01

The theme of the 17th International Congress of Biometeorology is adaptation to weather, climate, and climate change. Volume 1 of the congress proceedings contains 141 contributions. They are sorted under the following lecture topics: agriculture and forest, air pollution, animals, artificial/indoor/urban, climate change, history of biometeorology, human. (uke)

Dissolution Threats and Legislative Bargaining

DEFF Research Database (Denmark)

Becher, Michael; Christiansen, Flemming Juul

2015-01-01

Chief executives in many parliamentary democracies have the power to dissolve the legislature. Despite a well-developed literature on the endogenous timing of parliamentary elections, political scientists know remarkably little about the strategic use of dissolution power to influence policymaking....... To address this gap, we propose and empirically evaluate a theoretical model of legislative bargaining in the shadow of executive dissolution power. The model implies that the chief executive's public support and legislative strength, as well as the time until the next constitutionally mandated election...

Сoncept of national legislative initiative and its types

Directory of Open Access Journals (Sweden)

А. Л. Крутько

2015-11-01

Full Text Available . National legislative initiative is a new instrument of popular wills demonstration as compared to different forms of direct democracy. In most of developed democracies this institution regulated at the constitutional/ legislative level. But in the modern Ukraine its constitutional legal regulation is absent, due disregard of its possibilities and lack of understanding of its essence. Paper objective. This article an aim is to analyze in details the definition of «national legislative initiative» and determinate its basic types according to theoretical insights and foreign current law. Recent research and publications analysis. The domestic and foreign scholars works on scientific research of national legislative initiative institution such as V.N. Rudenko, O.M. Mudra, V.M. Shapoval, V.F. Nesterovich, J. F. Zimmerman and etc. Their works were foundational at the time of writing. Paper main body. With the help of big definition dictionary and new encyclopedic dictionary it was found the etymology of the concept «initiative» which is characterized as the basis, also found meaning of «legislative initiative», «national initiative» and «national legislative initiative». It was argued impossibility an identification of «national initiative» with «national legislative initiative». The current definitions of the national legislative initiative were analyzed in the article. It was noted that suggested terms were limited only by identification of institute’s apparent indicator and withhold essence. This is precisely why four types of the national legislative initiative’s realization are briefly examined for the complex determination of the definition. These types depending on what role the legislator are assigning to citizen, who are the main actors of initiative. And on the basis of this analysis the author provided his own definition of «the national legislative initiative». The author had notes that the proposed definition was not

United Nations Peacekeeping: Issues for Congress

National Research Council Canada - National Science Library

Browne, Marjorie A

2008-01-01

A major issue facing the United Nations, the United States, and the 110th Congress is the extent to which the United Nations has the capacity to restore or keep the peace in the changing world environment...

United Nations Peacekeeping: Issues for Congress

National Research Council Canada - National Science Library

Browne, Marjorie A

2007-01-01

A major issue facing the United Nations, the United States, and the 110th Congress is the extent to which the United Nations has the capacity to restore or keep the peace in the changing world environment...

Hostile reception greets Bottomley Congress speech.

Science.gov (United States)

1990-04-04

Health Minister Virginia Bottomley's attempts to persuade delegates that there are 'exciting' opportunities for nurses in the Government's plans for the health service failed, as she faced growing hostility from the audience at RCN Congress last week.

SAE-China Congress 2014

CERN Document Server

2015-01-01

These Proceedings gather outstanding papers submitted to the 2014 SAE-China Congress, the majority of which are from China, the most dynamic car market in the world. The book covers a wide range of automotive topics, presenting the latest technical achievements in the industry. Many of the approaches it presents can help technicians to solve the practical problems that most affect their daily work.

The Association of Academic Health Sciences Libraries' legislative activities and the Joint Medical Library Association/Association of Academic Health Sciences Libraries Legislative Task Force.

Science.gov (United States)

Zenan, Joan S

2003-04-01

The Association of Academic Health Sciences Libraries' (AAHSL's) involvement in national legislative activities and other advocacy initiatives has evolved and matured over the last twenty-five years. Some activities conducted by the Medical Library Association's (MLA's) Legislative Committee from 1976 to 1984 are highlighted to show the evolution of MLA's and AAHSL's interests in collaborating on national legislative issues, which resulted in an agreement to form a joint legislative task force. The history, work, challenges, and accomplishments of the Joint MLA/AAHSL Legislative Task Force, formed in 1985, are discussed.

Legislative amendments and informal politics in the European Union

DEFF Research Database (Denmark)

Cross, James P.; Hermansson, Henrik

2017-01-01

the Commission’s proposals and the final legislative outcome passed by the European Union. It does so by implementing minimum edit distance algorithms to measure changes between legislative proposals and outcomes. The findings suggest that legislative amendments are determined by the formal and informal...... institutional structures in which negotiations take place and characteristics of the proposal itself. Our conclusions contribute to the ongoing debate on the nature and distribution of legislative powers in the European Union....

The Solvay Council, 1911: ``A kind of private congress''

Science.gov (United States)

Staley, Richard

2011-04-01

The photograph of its participants gathered around the conference table at the first Solvay Congress in physics has long presented an iconic image of physics in the early twentieth century, and the event has commonly been celebrated for its distinctive role in the propagation of quantum theory, as well as for the rich heritage in subsequent conferences that it initiated. Yet it is not often appreciated just how unusual this first congress or ``council'' was. Convened and funded by the Belgian industrialist Ernst Solvay, it was conceived and planned by the Berlin physical chemist Walther Nernst, with a zealous attention to detail that extended to entreating participants to keep its proceedings confidential until it had actually occurred. Kept private to facilitate later public notice, I will argue that this conference also helped fashion a distinctive (and selective) view of the past. This paper combines an examination of the planning and conduct of the congress with a study of the earliest uses of general concepts of ``classical'' theory from the late nineteenth century, in order to argue that the Solvay congress was important not just to the wider propagation of quantum theory, but to the formation of the conceptual framework within which we now cast this era and its physics: the contrast between classical and modern theory.

Altitude Stress During Participation of Medical Congress

Science.gov (United States)

Kim, Soon Bae; Kim, Jong Sung; Kim, Sang Jun; Cho, Su Hee

2016-01-01

Medical congresses often held in highlands. We reviewed several medical issues associated with altitude stress especially while physicians have participated medical congress held in high altitude. Altitude stress, also known as an acute mountain sickness (AMS), is caused by acute exposure to low oxygen level at high altitude which is defined as elevations at or above 1,200 m and AMS commonly occurs above 2,500 m. Altitude stress with various symptoms including insomnia can also be experienced in airplane. AMS and drunken state share many common features in symptoms, neurologic manifestations and even show multiple microbleeds in corpus callosum and white matter on MRI. Children are more susceptible to altitude stress than adults. Gradual ascent is the best method for the prevention of altitude stress. Adequate nutrition (mainly carbohydrates) and hydration are recommended. Consumption of alcohol can exacerbate the altitude-induced impairments in judgment and the visual senses and promote psychomotor dysfunction. For prevention or treatment of altitude stress, acetazolamide, phosphodiesterase inhibitors, dexamethasone and erythropoietin are helpful. Altitude stress can be experienced relatively often during participation of medical congress. It is necessary to remind the harmful effect of AMS because it can cause serious permanent organ damage even though the symptoms are negligible in most cases. PMID:27621942

Educational Policy Making in the State Legislature: Legislator as Policy Expert.

Science.gov (United States)

Weaver, Sue Wells; Geske, Terry G.

1997-01-01

Examines the legislator's role as education policy expert in the legislative policymaking process. In a study of Louisiana state legislators, analysis of variance was used to determine expert legislators' degree of influence in formulating educational policy, given differences in policy types, information sources, and legislators' work roles.…

Annual congress of the South African Society of Pathologists: congress brochure

International Nuclear Information System (INIS)

1980-01-01

The 1980 annual congress of the South African Society of Pathologists was held in cooperation with the Southern African Society for Haematology, International Academy of Pathology, South African Association of Clinical Biochemistry and the Southern African Microbiology Society on the 7-9th July at the South African Institute for Medical Research. The subjects covered in this abstracts include virology, microbiology, histopathology, immunology, and chemical pathology. It seems that the use of isotopes as tracers is very popular in pathology and relative fields

7 CFR 1280.103 - Certified organization.

Science.gov (United States)

2010-01-01

... 7 Agriculture 10 2010-01-01 2010-01-01 false Certified organization. 1280.103 Section 1280.103 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... organization. Certified organization means any organization which has been certified by the Secretary pursuant...

47 CFR 24.103 - Construction requirements.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 2 2010-10-01 2010-10-01 false Construction requirements. 24.103 Section 24.103 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES PERSONAL... formula developed or generally used by industry, provided that such formula is based on the technical...

30 CFR 903.761 - Areas designated unsuitable for surface coal mining by act of Congress.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by act of Congress. 903.761 Section 903.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, applies to surface coal mining...

30 CFR 933.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by Act of Congress. 933.761 Section 933.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated Unsuitable for Coal Mining by Act of Congress, with...

Legislative policy in Brazil : limits and possibilities

NARCIS (Netherlands)

De, Paula F.

2018-01-01

This doctoral thesis discusses the limits and possibilities for developing a new legislative-regulatory policy in Brazil, understood as a public policy whose purpose is to improve the process of drafting legislation and regulation and to increase the quality of rules. It considers the

Tradition and change in power industry legislation

International Nuclear Information System (INIS)

Baur, J.F.; Boerner, B.; Friauf, K.H.; Salzwedel, J.; Selmer, P.

1986-01-01

On September 24-25, 1985 the 15th conference of the Institute for Energy Law took place in Cologne. This book contains five of the lectures held at the conference. They deal with the following subjects: Constitutional restrictions of autonomous energy policy of the Land governments; compulsory connection to and use of district heating; is there any necessity for amending the anti-trust law for reasons of energy policy; environmental law - planning law - gaps in the legislation concerning the energy sector; Energy Industry Law - are there legislative deficiencies, or is it an adequate, correct legislative instrument. (HSCH) [de

Public Safety Communications: Policy, Proposals, Legislation and Progress

National Research Council Canada - National Science Library

Moore, Linda K

2005-01-01

Since September 11, 2001, the effectiveness of America's communications capabilities in support of the information needs of first responders and other public safety workers has been a matter of concern to Congress...

14 CFR 1251.103 - Discrimination prohibited.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Discrimination prohibited. 1251.103 Section... OF HANDICAP General Provisions § 1251.103 Discrimination prohibited. (a) General. No qualified... of, or otherwise be subjected to discrimination under any program or activity which receives Federal...

Evidence and argument in policymaking: development of workplace smoking legislation

Directory of Open Access Journals (Sweden)

Bero Lisa A

2009-06-01

Full Text Available Abstract Background We sought to identify factors that affect the passage of public health legislation by examining the use of arguments, particularly arguments presenting research evidence, in legislative debates regarding workplace smoking restrictions. Methods We conducted a case-study based content analysis of legislative materials used in the development of six state workplace smoking laws, including written and spoken testimony and the text of proposed and passed bills and amendments. We coded testimony given before legislators for arguments used, and identified the institutional affiliations of presenters and their position on the legislation. We compared patterns in the arguments made in testimony to the relative strength of each state's final legislation. Results Greater discussion of scientific evidence within testimony given was associated with the passage of workplace smoking legislation that provided greater protection for public health, regardless of whether supporters outnumbered opponents or vice versa. Conclusion Our findings suggest that an emphasis on scientific discourse, relative to other arguments made in legislative testimony, might help produce political outcomes that favor public health.

30 CFR 942.761 - Areas designated unsuitable for surface coal mining by act of Congress.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by act of Congress. 942.761 Section 942.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining...

30 CFR 910.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by Act of Congress. 910.761 Section 910.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining...

30 CFR 937.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

Science.gov (United States)

2010-07-01

... mining by Act of Congress. 937.761 Section 937.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... WITHIN EACH STATE OREGON § 937.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining and...

30 CFR 921.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by Act of Congress. 921.761 Section 921.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining...

30 CFR 912.761 - Areas designated unsuitable for surface coal mining by act of Congress.

Science.gov (United States)

2010-07-01

... mining by act of Congress. 912.761 Section 912.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... WITHIN EACH STATE IDAHO § 912.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining and...

30 CFR 947.761 - Areas designated unsuitable for surface coal mining by act of Congress.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by act of Congress. 947.761 Section 947.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining...

30 CFR 939.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by Act of Congress. 939.761 Section 939.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining...

30 CFR 941.761 - Areas designated unsuitable for surface coal mining by act of Congress.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by act of Congress. 941.761 Section 941.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining...

30 CFR 922.761 - Areas designated unsuitable for surface coal mining by act of Congress.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by act of Congress. 922.761 Section 922.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining...

30 CFR 905.761 - Areas designated unsuitable for surface coal mining by act of Congress.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface coal mining by act of Congress. 905.761 Section 905.761 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION... Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining...

Role of Congress in the High Level Radioactive Waste Odyssey: The Wisdom and Will of the Congress - 13096

Energy Technology Data Exchange (ETDEWEB)

Vieth, Donald L. [DOE/NVOO Project Manager for Yucca Mountain, 1982 thru 1987, 1154 Cheltenham Place, Maineville, OH 45039 (United States); Voegele, Michael D. [Nye County Nuclear Waste Repository Project Office, 7404 Oak Grove Ave, Las Vegas, NV 89117 (United States)

2013-07-01

Congress has had a dual role with regard to high level radioactive waste, being involved in both its creation and its disposal. A significant amount of time has passed between the creation of the nation's first high level radioactive waste and the present day. The pace of addressing its remediation has been highly irregular. Congress has had to consider the technical, regulatory, and political issues and all have had specific difficulties. It is a true odyssey framed by an imperative and accountability, by a sense of urgency, by an ability or inability to finish the job and by consequences. Congress had set a politically acceptable course by 1982. However, President Obama intervened in the process after he took office in January 2009. Through the efforts of his Administration, by the end of 2012, the US government has no program to dispose of high level radioactive waste and no reasonable prospect of a repository for high level radioactive waste. It is not obvious how the US government program will be reestablished or who will assume responsibility for leadership. The ultimate criteria for judging the consequences are 1) the outcome of the ongoing NRC's Nuclear Waste Confidence Rulemaking and 2) the concomitant permissibility of nuclear energy supplying electricity from operating reactors in the US. (authors)

Moral autonomy in Australian legislation and military doctrine

Directory of Open Access Journals (Sweden)

Richard Adams

2013-09-01

Full Text Available Australian legislation and military doctrine stipulate that soldiers ‘subjugate their will’ to government, and fight in any war the government declares. Neither legislation nor doctrine enables the conscience of soldiers. Together, provisions of legislation and doctrine seem to take soldiers for granted. And, rather than strengthening the military instrument, the convention of legislation and doctrine seems to weaken the democratic foundations upon which the military may be shaped as a force for justice. Denied liberty of their conscience, soldiers are denied the foundational right of democratic citizenship and construed as utensils of the State. This article critiques the idea of moral agency in Australian legislation and military doctrine and is concerned with the obligation of the State to safeguard the moral integrity of individual soldiers, so soldiers might serve with a fully formed moral assurance to advance justice in the world. Beyond its explicit focus on the convention of Australian thought, this article raises questions of far-reaching relevance. The provisos of Australian legislation and doctrine are an analogue of western thinking. Thus, this discussion challenges many assumptions concerning military duty and effectiveness. Discussion will additionally provoke some reassessment of the expectations democratic societies hold of their soldiers.

Environmental Legislation in China: Achievements, Challenges and Trends

Directory of Open Access Journals (Sweden)

Zhilin Mu

2014-12-01

Full Text Available Compared to the environmental legislation of many developed countries, China’s environmental legislation was initiated late, beginning in 1979, but nevertheless has obtained considerable achievements. As many as thirty environmental laws have provided rules regarding prevention and control of pollution, resource utilization, and ecological protection in China. However, China’s environmental legislation still faces a series of challenges and problems, including that the sustainable development concept has not yet been fully implemented, as well as presence of gaps and non-coordination phenomena between laws and regulations, unclear responsibility, imperfect system design, imbalance between rights and obligations, higher impacts resulted from the GDP-centralized economy, lack of operability and instruments in the legal content, as well as difficulty of public participation. In contrast, China’s environmental legislation has improved, as a result of learning from experience in developed countries and introducing innovations stimulated by domestic environmental pressure. Looking into the future, increased attention to environmental protection and ecological consciousness paid by China’s new leaders will bring a valuable opportunity to China’s further development concerning environmental legislation. In the future, there are prospects for the gradual improvement of legal approaches, continuous improvements of legislation to mitigate environmental problems, and more opportunities to strengthen public participation can be predicted.

38 CFR 13.103 - Investments by Federal fiduciaries.

Science.gov (United States)

2010-07-01

... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Investments by Federal fiduciaries. 13.103 Section 13.103 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS VETERANS BENEFITS ADMINISTRATION, FIDUCIARY ACTIVITIES § 13.103 Investments by Federal fiduciaries. (a...

Colombian mining legislation

International Nuclear Information System (INIS)

Mendoza Delgado, Eva Isolina

2004-01-01

The paper makes a historical recount of the mining legislation in Colombia, it is about the more relevant aspects of the Code of Mines, like they are the title miner, obligations, economic aspects, integration of mining areas and of the benefits contemplated in the law 685 of 2001

Full journal publication of abstracts presented at the Nordic Congress of General Practice in 2009 and 2011

DEFF Research Database (Denmark)

Waldorff, Frans Boch; Petersen, Kristine; Vinther, Siri

2017-01-01

journal publications within a 36-month follow-up from both congresses. In cases of doubt, the first author was contacted directly. Main outcome measures: Full journal publication within 36 months after the congress. Results: A total of 200 abstracts were analyzed. Of these, 85 (42.5%) were identified...... articles within 36 months. Key points: Congress abstracts accepted for Nordic Congress of General Practice are not indexed in international search databases. Less than half of the abstracts accepted for oral or poster presentation at two consecutive Nordic Congresses of General Practice were published...... as full text articles within 36 months. Future congress committees could address this aspect in order to increase the visibility of and accessibility to research within the field of general practice....

EPA Reports to Congress on Technology Transfer

Science.gov (United States)

Agencies are required to report to the Congress annually on their technology transfer activities. These reports summarize technology transfer activities of the EPA’s federal laboratories, by fiscal year.

Nineteenth Latin-American congress on chemistry

International Nuclear Information System (INIS)

1990-01-01

This publication deals with different in-scope papers presented at the 19. Latin-American congress on chemistry, held in Buenos Aires (Argentine Republic) from November 5-9, 1990. The original document where these papers are contained, consists of 567 pages

8th Asia oceania congress of nuclear medicine and biology final program abstracts

International Nuclear Information System (INIS)

2004-01-01

The eighth Asia and Oceania congress of nuclear medicine and biology was held in Beijing, China, October 9-13 2004. The congress also held satellite meeting in Hong Kong SAR, China October 16-17 2004 and in Shanghai, China October 15 2005 respectively. The congress was sponsored by Chinese Society of Nuclear Medicine and organized by Asia and Oceania Federation of Nuclear Medicine and Biology. The final program includes 379 pieces abstracts, whose contents contain nuclear medicine diagnosis and therapy and biology

Designing Pension Plans to Incorporate Recent Legislation.

Science.gov (United States)

Biggs, John H.

1983-01-01

Two proposals before Congress threaten to offset the delicate balance in pension plan design. The significance of the normal retirement feature in plan design, some possible program design changes, and how the pension arrangements of higher education institutions would be affected are discussed. (MLW)

42 CFR 93.103 - Research misconduct.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Research misconduct. 93.103 Section 93.103 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

10 CFR 835.103 - Education, training and skills.

Science.gov (United States)

2010-01-01

... 10 Energy 4 2010-01-01 2010-01-01 false Education, training and skills. 835.103 Section 835.103... § 835.103 Education, training and skills. Individuals responsible for developing and implementing... education, training, and skills to discharge these responsibilities. [63 FR 59682, Nov. 4, 1998] ...

SAE-China Congress 2015

CERN Document Server

2016-01-01

These proceedings gather outstanding papers submitted to the 2015 SAE-China Congress, the majority of which are from China, the biggest car maker as well as most dynamic car market in the world. The book covers a wide range of automotive topics, presenting the latest technical achievements in the industry. Many of the approaches presented can help technicians to solve the practical problems that most affect their daily work.

The Association of Academic Health Sciences Libraries' legislative activities and the Joint Medical Library Association/Association of Academic Health Sciences Libraries Legislative Task Force

OpenAIRE

Zenan, Joan S.

2003-01-01

The Association of Academic Health Sciences Libraries' (AAHSL's) involvement in national legislative activities and other advocacy initiatives has evolved and matured over the last twenty-five years. Some activities conducted by the Medical Library Association's (MLA's) Legislative Committee from 1976 to 1984 are highlighted to show the evolution of MLA's and AAHSL's interests in collaborating on national legislative issues, which resulted in an agreement to form a joint legislative task forc...

43 CFR 20.506 - Appropriations, legislation and lobbying.

Science.gov (United States)

2010-10-01

... money appropriated by any enactment of Congress to pay for any personal service, advertisement, telegram... appropriations which they deem necessary for the efficient conduct of the public business (18 U.S.C. 1913). (b...

XXII EAACI congress, Paris (France)

African Journals Online (AJOL)

Ehab

2017-04-13

Apr 13, 2017 ... Please visit our website for details of ESPAI 2017 Congress and the WATS! I also encourage you all to hurry and register to participate in the World Allergy Organization Symposium. (Hot Topics in Allergy: Pediatric and Regulatory Aspects) that will be held in Rome/Vatican City, on April 27-29,. 2017. There.

8 CFR 103.34 - Security of records systems.

Science.gov (United States)

2010-01-01

... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Security of records systems. 103.34 Section 103.34 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS POWERS AND DUTIES; AVAILABILITY OF RECORDS § 103.34 Security of records systems. The security of records systems...

Photonuclear excitation of 103Rh by synchrotron radiation

International Nuclear Information System (INIS)

Yoshihara, Kenji; Kaji, Harumi; Sekine, Tsutomu; Mukoyama, Takeshi

1989-01-01

Photonuclear excitation of the 103 Rh nucleus was studied using synchrotron radiation. Formation of the excited state was confirmed by observing K X-rays emitted following the isomeric transition of the 103m Rh with a low-energy photon spectrometer. The intensity of induced activity due to 103 Rh(γ,γ') 103m Rh reaction was determined carefully by subtracting the fluorescent K X-rays due to natural background radiation. The integral cross-section for isomer production of 103m Rh by resonance absorption of photons at 295 keV is found to be (2.1±0.8) x 10 -28 cm 2 eV and is compared with that estimated from the previous experimental value for the 1277-keV level. (author)

Photonuclear excitation of 103Rh by synchrotron radiation

International Nuclear Information System (INIS)

Kaji, Harumi; Yoshihara, Kenji; Mukoyama, Takeshi; Nakajima, Tetsuo

1989-01-01

Photonuclear excitation of 103 Rh nucleus was studied by the use of synchrotron radiation at KEK. Formation of excited state was confirmed by observing Rh K X-rays emitted following the isomeric transition of 103m Rh with a low-energy photon spectrometer. The induced activity due to 103 Rh(γ,γ') 103m Rh reaction was determined carefully by subtracting the fluorescent K X-rays due to natural background radiation. The integral cross-section for 103m Rh by resonance absorption at 295 keV is found to be (1∼2)x10 -28 cm 2 ·eV and is compared with that estimated from the previous experimental value for the 1277-keV level and the calculated value

Terrorism and anti-terror legislation - the terrorised legislator? A comparison of counter-terrorism legislation and its implications on human rights in the legal systems of the United Kingdom, Spain, Germany, and France

NARCIS (Netherlands)

Oehmichen, Anna

2009-01-01

The thesis deals with the history of terrorism and counter-terrorism legislation, focussing on the legislation in the UK, Spain, Germany and France, in the last 30 years, and analysing its compatibility with national and European human rights standards.

31 CFR 103.83 - Oral communications.

Science.gov (United States)

2010-07-01

... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Oral communications. 103.83 Section... AND REPORTING OF CURRENCY AND FOREIGN TRANSACTIONS Administrative Rulings § 103.83 Oral communications... response to oral requests. Oral opinions or advice by Treasury, the Customs Service, the Internal Revenue...

24 CFR 954.103 - Housing strategy.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Housing strategy. 954.103 Section... INDIAN HOME PROGRAM Applying for Assistance § 954.103 Housing strategy. Grantees are not required to submit a housing strategy to receive HOME funds. However, the application must demonstrate how the...

Ferrocene, ruthenocene or rhodocene analogues of Haloperidol. Synthesis and organ distribution after labelling with 103Ru or 103mRh

International Nuclear Information System (INIS)

Wenzel, M.; Wu, Y.

1988-01-01

Ferrocene-Haloperidol was synthesized by N-alkylation of 4-(4'-chlorophenyl)-4-hydroxypiperidine with 1-ferrocenyl-4-chlor-butan-1-on. By heating the ferrocene-haloperidol with 103 RuCl 3 the 103 Ru-labelled ruthenocene-haloperidol was obtained. This compound showed a high affinity for lung but not for brain in rats and mice. The decay of the 103 Ru labelled compound results in the formation of the 103m Rh labelled rhodocene-haloperidol, which is rapidly oxidized by air to the corresponding rhodocinium-haloperidol. This compound can be separated by extraction and TLC. (author)

2nd World Congress on Computer Science and Information Engineering (CSIE 2011)

CERN Document Server

Cao, Lei; Su, Weilian; Wang, Tingkai; Yang, Huamin; Recent Advances in Computer Science and Information Engineering : Volume 1

2012-01-01

CSIE 2011 is an international scientific Congress for distinguished scholars engaged in scientific, engineering and technological research, dedicated to build a platform for exploring and discussing the future of Computer Science and Information Engineering with existing and potential application scenarios. The congress has been held twice, in Los Angeles, USA for the first and in Changchun, China for the second time, each of which attracted a large number of researchers from all over the world. The congress turns out to develop a spirit of cooperation that leads to new friendship for addressing a wide variety of ongoing problems in this vibrant area of technology and fostering more collaboration over the world.   The congress, CSIE 2011, received 2483 full paper and abstract submissions from 27 countries and regions over the world. Through a rigorous peer review process, all submissions were refereed based on their quality of content, level of innovation, significance, originality and legibility. 688 papers...

Autopsy issues in German Federal Republic transplantation legislation until 1997.

Science.gov (United States)

Schweikardt, Christoph

2014-01-01

This article analyzes the relevance of autopsy issues for German Federal Republic transplantation legislation until 1997 against the background of legal traditions and the distribution of constitutional legislative powers. It is based on Federal Ministry of Justice records and German Parliament documents on transplantation legislation. Transplantation and autopsy legislation started with close ties in the 1970s. Viewing transplantation legislation as relevant for future autopsy regulation contributed to the decision to stall transplantation legislation, because the interests of the federal government and the medical profession converged to avoid subsequent restrictions on the practice of conducting autopsies and procuring tissues for transplantation. Sublegal norms were insufficient for the prosecution of the organ trade and area-wide transplantation regulation after the reunification of Germany. In contrast to autopsy issues, legislative power for transplantation issues was extended to the federal level by an amendment to the constitution, allowing decision making for Germany as a whole.

Legislation on violence against women: overview of key components.

Science.gov (United States)

Ortiz-Barreda, Gaby; Vives-Cases, Carmen

2013-01-01

This study aimed to determine if legislation on violence against women (VAW) worldwide contains key components recommended by the Pan American Health Organization (PAHO) and the United Nations (UN) to help strengthen VAW prevention and provide better integrated victim protection, support, and care. A systematic search for VAW legislation using international legal databases and other electronic sources plus data from previous research identified 124 countries/territories with some type of VAW legislation. Full legal texts were found for legislation from 104 countries/territories. Those available in English, Portuguese, and Spanish were downloaded and compiled and the selection criteria applied (use of any of the common terms related to VAW, including intimate partner violence (IPV), and reference to at least two of six sectors (education, health, judicial system, mass media, police, and social services) with regard to VAW interventions (protection, support, and care). A final sample from 80 countries/territories was selected and analyzed for the presence of key components recommended by PAHO and the UN (reference to the term "violence against women" in the title; definitions of different types of VAW; identification of women as beneficiaries; and promotion of (reference to) the participation of multiple sectors in VAW interventions). Few countries/territories specifically identified women as the beneficiaries of their VAW legislation, including those that labeled their legislation "domestic violence" law ( n = 51), of which only two explicitly mentioned women as complainants/survivors. Only 28 countries/territories defined the main forms of VAW (economic, physical, psychological, and sexual) in their VAW legislation. Most highlighted the role of the judicial system, followed by that of social services and the police. Only 28 mentioned the health sector. Despite considerable efforts worldwide to strengthen VAW legislation, most VAW laws do not incorporate the key

International Energy and Environmental Congress: Proceedings

Energy Technology Data Exchange (ETDEWEB)

1993-09-01

This document contains information presented at the International Energy and Environmental Congress `93 proceedings. Symposiums included demand-side management strategic directions; federal energy management; corporate energy management; and pollution control technologies. Individual reports from the symposiums are processed separately for the data bases.

Legislative processes in transition : comparative study of the legislative processes in Finland, Slovenia and the United Kingdom as a source of inspiration for enhancing the efficiency of the Dutch legislative process

NARCIS (Netherlands)

Voermans, W.; Napel, H.-M. ten; Diamant, M.; Groothuis, M.; Steunenberg, B.; Passchier, R.; Pack, S.

2012-01-01

The main research question of the current study is when whether the efficiency of the Dutch legislative procedure for parliamentary acts indeed constitutes a problem, in particular if compared to the achievements of legislative processes in several other European countries and, if that turns out to

New protein sources and food legislation

DEFF Research Database (Denmark)

Belluco, Simone; Halloran, Afton Marina Szasz; Ricci, Antonia

2017-01-01

Growing global food demand has generated a greater interest in the consumption of new and diversified protein sources. Novel foodstuffs represent a challenge for food law as they need proper safety assessments before obtaining market permission. The case of edible insects and European law is a good...... representation of this issue because a selection of food grade insect species may be available on the European market in the coming years. However, European legislation does not explicitly address edible insects. Consequently, this has left a grey area, allowing different interpretations of the legislation among....... Particular attention will be paid to the evolution of legislation and to the experiences of both EU and non-EU countries. In recent years, a number of different stakeholders have supported the legalization of edible insect consumption in Europe, but market permission is just the first step towards a new...

DEVELOPMENTS IN THE CONSTITUTIONAL REVIEW. CONSTITUTIONAL COURT BETWEEN THE STATUS OF NEGATIVE LEGISLATOR AND THE STATUS OF POSITIVE CO-LEGISLATOR

Directory of Open Access Journals (Sweden)

Marieta Safta

2012-11-01

Full Text Available The study wants to emphasize that Constitutional Courts belonging to the European model depart from their traditional role as ”negative legislator” – which refers to the effect of their acts consisting in removal from the legal system of those rules contrary to the Basic Law -, becoming, to a certain extent, a ”positive legislator”. Official interpreters of the Constitution, Constitutional Courts assume, sometimes, a role of co-legislators, creating provisions they deduct from the Constitution - when controlling the absence of legislation or legislative omissions -, and revealing the content of constitutional and even infraconstitutional rules accordingly with the Constitution in their case-law, whose effects are nothing but specific forms of „impulse” or „coercion” of the legislator to proceed in a certain sense, and whose continuous development guides the evolution of the entire legal system. Case – law selected presents ways in which the Constitutional Court of Romania is associated to law-making activity. Without minimizing in any way its traditional role as "negative legislator", the study refers mainly to acts and situations that give expression to the creative role of the Constitutional Court of Romania.

36 CFR 705.5 - Disposition and use of copies and phonorecords by the Library of Congress.

Science.gov (United States)

2010-07-01

... and phonorecords by the Library of Congress. 705.5 Section 705.5 Parks, Forests, and Public Property LIBRARY OF CONGRESS REPRODUCTION, COMPILATION, AND DISTRIBUTION OF NEWS TRANSMISSIONS UNDER THE PROVISIONS... phonorecords by the Library of Congress. (a) All copies and phonorecords acquired under this part will be...

Tank 241-C-103 headspace flammability

International Nuclear Information System (INIS)

Huckaby, J.L.

1994-01-01

Information regarding flammable vapors, gases, and aerosols is presented for the purpose of resolving the tank 241-C-103 headspace flammability issue. Analyses of recent vapor and liquid samples, as well as visual inspections of the tank headspace, are discussed in the context of tank dynamics. This document is restricted to issues regarding the flammability of gases, vapors, and an aerosol that may exist in the headspace of tank 241-C-103. While discussing certain information about the organic liquid present in tank 241-C-103, this document addresses neither the potential for, nor consequences of, a pool fire involving this organic liquid; they will be discussed in a separate report

Tank 241-C-103 headspace flammability

Energy Technology Data Exchange (ETDEWEB)

Huckaby, J.L.

1994-01-01

Information regarding flammable vapors, gases, and aerosols is presented for the purpose of resolving the tank 241-C-103 headspace flammability issue. Analyses of recent vapor and liquid samples, as well as visual inspections of the tank headspace, are discussed in the context of tank dynamics. This document is restricted to issues regarding the flammability of gases, vapors, and an aerosol that may exist in the headspace of tank 241-C-103. While discussing certain information about the organic liquid present in tank 241-C-103, this document addresses neither the potential for, nor consequences of, a pool fire involving this organic liquid; they will be discussed in a separate report.

Politics of the U.S. Federal budget process.

Science.gov (United States)

Elwood, Thomas W

U.S. Congress members are influenced in three ways: 1) through the acquisition of money to finance political campaigns; 2) by acquiring enough votes to enable them to be reelected; and 3) obtaining expert information on topics of personal interest. Federal spending patterns have a strong impact on the first two items. The ability to funnel money into a congressional district or state provides an excellent opportunity for a legislator to remain in office. Congress often appears to be highly irrational but individual legislators find it in their rational self-interest to behave in ways that are detrimental to the collective interest of Congress as an institution and to the collective good of society. Every year, leaders of both parties begin a legislative session with the intention of producing both a concurrent budget resolution and a set of spending bills according to schedule. Usually, they fail dismally. This article discusses the reasons why such failures tend to occur regularly.

31 CFR 103.81 - Submitting requests.

Science.gov (United States)

2010-07-01

... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Submitting requests. 103.81 Section 103.81 Money and Finance: Treasury Regulations Relating to Money and Finance FINANCIAL RECORDKEEPING... which the request is made. (b) A request filed by a corporation shall be signed by a corporate officer...

19 CFR 191.103 - Additional requirements.

Science.gov (United States)

2010-04-01

... which the alcohol was withdrawn; (iv) Date of withdrawal; (v) Serial number of the tax-paid stamp or... 19 Customs Duties 2 2010-04-01 2010-04-01 false Additional requirements. 191.103 Section 191.103 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE...

29 CFR 1918.103 - Head protection.

Science.gov (United States)

2010-07-01

... 29 Labor 7 2010-07-01 2010-07-01 false Head protection. 1918.103 Section 1918.103 Labor... must ensure that head protection complies with any of the following consensus standards: (i) ANSI Z89.1... as head protection devices that are constructed in accordance with one of the above consensus...

The World Congress of Paediatric Cardiology and Cardiac Surgery: "The Olympics of our profession".

Science.gov (United States)

Hugo-Hamman, Christopher; Jacobs, Jeffery Phillip

2012-12-01

The first World Congress of Paediatric Cardiology was held in London, United Kingdom, in 1980, organised by Dr. Jane Somerville and Prof. Fergus Macartney. The idea was that of Jane Somerville, who worked with enormous energy and enthusiasm to bring together paediatric cardiologists and surgeons from around the world. The 2nd World Congress of Paediatric Cardiology took place in New York in 1985, organised by Bill Rashkind, Mary Ellen Engle, and Eugene Doyle. The 3rd World Congress of Paediatric Cardiology was held in Bangkok, Thailand, in 1989, organised by Chompol Vongraprateep. Although cardiac surgeons were heavily involved in these early meetings, a separate World Congress of Paediatric Cardiac Surgery was held in Bergamo, Italy, in 1988, organised by Lucio Parenzan. Thereafter, it was recognised that surgeons and cardiologists working on the same problems and driven by a desire to help children should really rather meet together. A momentous decision was taken to initiate a Joint World Congress of Paediatric Cardiology and Cardiac Surgery. A steering committee was established with membership comprising the main organisers of the four separate previous Congresses, and additional members were recruited in an effort to achieve numerical equality of cardiologists and surgeons and a broad geographical representation. The historic 1st "World Congress of Paediatric Cardiology and Cardiac Surgery" took place in Paris in June, 1993, organised by Jean Kachaner. The next was to be held in Japan, but the catastrophic Kobe earthquake in 1995 forced relocation to Hawaii in 1997. Then followed Toronto, Canada (2001, organised by Bill Williams and Lee Benson), Buenos Aires, Argentina (2005, organised by Horatio Capelli and Guillermo Kreutzer), and most recently Cairns, Australia (2009, organised by Jim Wilkinson). Having visited Europe (1993), Asia-Pacific (1997), North America (2001), South America (2005), and Australia (2009), and reflecting the "African Renaissance", the

Congress and Budget Policy in Jalisco, 1990-2014

Directory of Open Access Journals (Sweden)

José Said Sánchez Martínez

2016-09-01

Full Text Available Subnational studies in Mexico have pointed out the huge power of governors and the weakness of local Congresses in the design of budget policy. However, it is important to provide more evidence on the Congresses’s performance to attain a better understanding of this situation. Based on a case study of the Mexican state of Jalisco, the purposes of this paper are: a to present empirical evidence on the exercise of budgetary functions; b to explore whether the government status has an effect on the Congress behavior and its relationship with the Executive branch; and c to establish the impact of ammendments on budget policies.

30 CFR 762.14 - Applicability to lands designated as unsuitable by Congress.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Applicability to lands designated as unsuitable by Congress. 762.14 Section 762.14 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND... Congress. Pursuant to appropriate petitions, lands listed in § 761.11 of this chapter are subject to...

Legislations combating counterfeit drugs in Hong Kong.

Science.gov (United States)

Lai, C W; Chan, W K

2013-08-01

To understand legislation combating counterfeit drugs in Hong Kong. This study consisted of two parts. In part I, counterfeit drugs–related ordinances and court cases were reviewed. In part II, indepth interviews of the stakeholders were described. Hong Kong. All Hong Kong ordinances were screened manually to identify those combating counterfeit drugs. Court cases were searched for each of the identified cases. Then, the relevant judgement justifications were analysed to identify sentencing issues. Indepth interviews with the stakeholders were conducted to understand their perceptions about such legislation. Trade Marks Ordinance, Patents Ordinance, Trade Descriptions Ordinance, and Pharmacy and Poisons Ordinance were current legislative items combating counterfeit drugs. Sentencing criteria depended on: intention to deceive, quantity of seized drugs, presence of expected therapeutic effect or toxic ingredients, previous criminal records, cooperativeness with Customs officers, honest confessions, pleas of guilty, types of drugs, and precautionary measures to prevent sale of counterfeit drugs. Stakeholders’ perceptions were explored with respect to legislation regarding the scale and significance of the counterfeit drug problem, penalties and deterrents, drug-specific legislation and authority, and inspections and enforcement. To plug the loopholes, a specific law with heavy penalties should be adopted. This could be supplemented by non-legal measures like education of judges, lawyers, and the public; publishing the names of offending pharmacies; and emphasising the role of pharmacists to the public.

V Congress of Spanish Geochemistry

International Nuclear Information System (INIS)

1993-01-01

This proceedings book present the lectures of V Spanish geochemistry Congress. The sessions were: 1.- Materials geochemistry and geologic process. 2.- Geochemistry prospection 3.- Environmental geochemistry 4.- Isotopic geochemistry 5.- Organic geochemistry 6.- Natural materials geochemistry for industry 7.- Hydrogeochemistry 8.- Mathematical models in geochemistry 9.- Analysis methods in geochemistry 10.-Training of geochemistry 11.-Cosmochemistry

42 CFR 84.103 - Man tests; performance requirements.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Man tests; performance requirements. 84.103 Section 84.103 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OCCUPATIONAL SAFETY AND HEALTH RESEARCH AND RELATED ACTIVITIES APPROVAL OF RESPIRATORY PROTECTIVE DEVICES Self-Contained Breathing Apparatus § 84.103 Man tests;...

7 CFR 762.103 - Full faith and credit.

Science.gov (United States)

2010-01-01

... 7 Agriculture 7 2010-01-01 2010-01-01 false Full faith and credit. 762.103 Section 762.103... AGRICULTURE SPECIAL PROGRAMS GUARANTEED FARM LOANS § 762.103 Full faith and credit. (a) Fraud and misrepresentation. The loan guarantee constitutes an obligation supported by the full faith and credit of the United...

Transportation of radioactive materials: legislative and regulatory information system

International Nuclear Information System (INIS)

Fore, C.S.; Heiskell, M.M.

1980-01-01

The transportation of radioactive materials, as well as hazardous materials in general, has been an issue of ever-increasing concern and an object of numerous regulations and legislative actions worldwide. The Transportation Technology Center of the US Department of Energy's Sandia Laboratories in Albuquerque, New Mexico, is currently involved in developing a national program to assure the safe shipment of radioactive materials. At Oak Ridge National Laboratory (ORNL), Oak Ridge, Tennessee, this overall effort is being supported in a specialized manner. As part of the Logistics Modeling program at ORNL, the Ecological Sciences Information Center has developed comprehensive data bases containing legislative and regulatory actions relevant to the transportation of hazardous materials. The data bases are separated according to status level of the legislation. The Current Legislation Data Base includes all new legislative actions introduced during the present year (1980) or those bills carried over from the previous year's sessions. The second data file, Historical Legislation Data Base, consists of all legislative actions since 1976 that have passed and become public laws, as well as those actions that were unsuccessful and were classified as denied by law. Currently the data bases include state-, local-, and federal, level legislation, with emphasis on the transportation of radioactive materials. Because of their relevance to the transportation issues, actions involving related subject areas such as, disposal and storage of radioactive wastes, moratoriums on power plant construction, and remedial actions studies, special agencies to regulate shipment of radioactive materials, and requirements of advanced notification, permits and escorts are also included in the data bases

Access to Legislation in Europe: Overview and Future Trends

Directory of Open Access Journals (Sweden)

Martynas Mockus

2013-08-01

Full Text Available The article analyses problems facing electronic legislation development (especially legislation processes of publishing acts in EU and EFTA member countries. All European countries were publishing acts officially on paper until the end of year 2000. The way of publishing acts officially was the same in all Europe countries, except that some counties had one “official journal” in which legal acts and other official documents and legal notices were published, and other countries had separate legal gazettes for acts publishing and an official gazette for publishing other official documents and legal notices. At the beginning of 2001 Norway started to publish acts officially in digital form, and only 12-20 times a year paper editions to present the statutes and regulations enacted since the publication of the previous issue are published. In 2002 Estonia decided to finish the publishing of paper editions, and started to publish acts only electronically. Till 2011 more than 10 European countries started to publish acts officially in digital format. Author discusses the advantages, principles, and legitimate expectation of electronic legislation. For future electronic legislation information systems developments the following principles should be a guide: broad/universal and equal access to legislation, reliability of the means of publicity, integrity of information, easy access to the requisite information. The advantages of digital act forms, and internet based publications are instantaneous outreach to the public, free of charge, information easily accessible and retrievable, voluminous technical acts easier to handle, no printing costs, more environmentally-friendly, more and more people use ICT to seek information, no time constraints to the availability of data, legal certainty will be granted. The author thinks that before creating future digital legislation information systems, some procedures shall be done. If we want to have pan

Access to Legislation in Europe: Overview and Future Trends

Directory of Open Access Journals (Sweden)

Martynas Mockus

2011-12-01

Full Text Available The article analyses problems facing electronic legislation development (especially legislation processes of publishing acts in EU and EFTA member countries.All European countries were publishing acts officially on paper until the end of year 2000. The way of publishing acts officially was the same in all Europe countries, except that some counties had one “official journal” in which legal acts and other official documents and legal notices were published, and other countries had separate legal gazettes for acts publishing and an official gazette for publishing other official documents and legal notices.At the beginning of 2001 Norway started to publish acts officially in digital form, and only 12-20 times a year paper editions to present the statutes and regulations enacted since the publication of the previous issue are published. In 2002 Estonia decided to finish the publishing of paper editions, and started to publish acts only electronically. Till 2011 more than 10 European countries started to publish acts officially in digital format.Author discusses the advantages, principles, and legitimate expectation of electronic legislation. For future electronic legislation information systems developments the following principles should be a guide: broad/universal and equal access to legislation, reliability of the means of publicity, integrity of information, easy access to the requisite information. The advantages of digital act forms, and internet based publications are instantaneous outreach to the public, free of charge, information easily accessible and retrievable, voluminous technical acts easier to handle, no printing costs, more environmentally-friendly, more and more people use ICT to seek information, no time constraints to the availability of data, legal certainty will be granted.The author thinks that before creating future digital legislation information systems, some procedures shall be done. If we want to have pan

Legislator's guide to low-level radioactive waste management

International Nuclear Information System (INIS)

Jordan, J.M.; Melson, L.G.

1981-05-01

The purpose of the guide is to provide state legislators and their staff with information on low-level radioactive waste management, issues of special concern to the states, and policy options. During 1979, producers of low-level radioactive wastes (LLW) faced a crisis. Two of the three commercial disposal sites were temporarily closed and some LLW producers were running short on storage space. For hospitals, clinics, research organizations, and some industries, this meant potential curtailment of activities that produced these materials. Commercial nuclear reactors were not as hard hit during the crisis because they have larger storage areas. The two sites at Beatty, Nevada, and Hanford, Washington, reopened and the immediate crisis was averted. However, the longer term problem of shortage of disposal capacity was just beginning to be recognized. States should be concerned with this problem for several reasons. First, all states produce LLW although the volumes differ among states. Second, states have the responsibility to protect the public health and welfare of their citizens. Third, states may be given the authority to regulate LLW disposal if they enter into agreements with the federal government (Agreement States Program), and 26 states have that authority. Fourth, because of the long-term monitoring and surveillance necessary at a disposal site, states rather than private industry will be held responsible for ensuring that the disposal site is performing safely. Finally, Congress established a policy in 1980 that each state is responsible for the safe disposal of LLW generated within its borders. This policy also includes provisions that could lead to excluding states from using disposal facilities unless they have entered into regional agreements with other states. Two primary options exist for a state: developing its own disposal facility for LLW generated within its borders or joining with other states to develop a regional disposal facility

Brazilian nuclear legislation. Revision n.1/2002

International Nuclear Information System (INIS)

Matos, Gilberto Cardoso de

2002-01-01

This work intends to facilitate the access to the Brazilian nuclear legislation and other legal instruments, foreseeing the use of nuclear energy and ionizing radiation in health, work and environment areas up to 2002. Legislation on the civil liability of nuclear damage, the law of licensing taxes, controlling and inspection are also included