WorldWideScience

Sample records for leg power slj

  1. Leg power among malaysian netball players | Geok | African Journal ...

    African Journals Online (AJOL)

    The purpose of the study was to compare the leg power among Malaysian national netball players according to their age and playing position. The Vertical Jump Test was chosen to measure the leg power by using “Digital Indication Jump Meter” device. The results of the Vertical Jump Test were used to compare the leg ...

  2. SLJ's Tech Survey Part Two

    Science.gov (United States)

    Brewer, Sally; Milam, Peggy

    2005-01-01

    Library media specialists are gung ho on technology, but they often lack the cash to take advantage of it, according to "SLJ"'s first-ever tech survey. Earlier this year, they reported on the various ways that school librarians use technology--from creating Web sites to policy-making to training students and colleagues. This time, they…

  3. Dicty_cDB: SLJ344 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLJ344 (Link to dictyBase) - - - Contig-U16255-1 SLJ344P (Link... to Original site) SLJ344F 253 SLJ344Z 273 SLJ344P 526 - - Show SLJ344 Library SL (Link to library) Clone ID SLJ344 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...Amino Acid sequence GTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTT TGGSTTGSHTTTGGSTTGSHTTTG---...li tilffniqrlykkkkkkkkkknkp*tklkin*kk Frame B: GTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTT

  4. THE EFFECTS OF SINGLE LEG HOP PROGRESSION AND DOUBLE LEGS HOP PROGRESSION EXERCISE TO INCREASE SPEED AND EXPLOSIVE POWER OF LEG MUSCLE

    Directory of Open Access Journals (Sweden)

    Nining W. Kusnanik

    2015-05-01

    Full Text Available The main purpose of this study was to determine the effect of single leg hop progression and double legs hop progression exercise to increase speed and explosive power of leg muscles. Plyometric is one of the training methods that can increase explosive power. There are many models of plyometric training including single leg hop progression and double leg hop progression. This research was experimental using match subject design techniques. The subjects of this study were 39 students who joined basketball school club. There were 3 groups in this study: Group 1 were 13 students who given sin¬gle leg hop progression exercise, Group 2 were 13 students who given double legs hop progression exercise, Group 3 were 13 students who given conventional exercise. The data was collected during pre test and post test by testing 30m speed running and vertical jump. The data was analyzed using Analysis of Varians (Anova. It was found that there were significantly increased on speed and explosive power of leg muscles of Group 1 and Group 2. It can be stated that single leg hop progression exercise was more effective than double leg hop progression exercise. The recent findings supported the hypothesis that single leg hop progression and double legs hop progression exercise can increase speed and explosive power of leg muscles. These finding were supported by some previous studies (Singh, et al, 2011; Shallaby, H.K., 2010. The single leg hop progression is more effective than double legs hop progression. This finding was consistent with some previous evidences (McCurdy, et al, 2005; Makaruk et al, 2011.

  5. Is chair rise performance a useful measure of leg power?

    Science.gov (United States)

    Hardy, Rebecca; Cooper, Rachel; Shah, Imran; Harridge, Stephen; Guralnik, Jack; Kuh, Diana

    2010-01-01

    Chair rise performance, which is simple to assess in a home or clinic setting, has been used as a method of predicting leg power deficit in older adults. More recently, chair rise performance has been assessed in younger populations as a baseline for assessment of subsequent age-related declines in function and power. However, as rising from a chair repeatedly not only requires lower limb strength and power but also good balance and coordination, it may not be purely a measure of leg power especially among these younger, well functioning groups who are yet to experience agerelated declines and deficits in function. The aim of this study was to assess whether chair rise performance can be considered as a predictor of leg power, and hence of deficits in this, in men and women in mid-life. We assessed the relationship of chair rise performance with leg extensor power (LEP), measured using the Nottingham Power Rig (NPR), and with standing balance performance. LEP was measured in a clinic setting in a sub-sample of 81 men and 93 women from the MRC National Survey of Health and Development, a nationally representative cohort born in Britain in 1946. The time taken to rise from a chair 10 times and standing balance time were assessed during home visits at the same age. Increasing LEP was associated with better chair rise performance among those who completed 10 chair rises in ≥15 seconds, after adjustment for body size (p=0.008). Better standing balance performance was associated with better chair rise performance in men, but not women. That LEP and standing balance are both related to chair rise time in men suggests that chair rise time should not be thought of purely as a proxy measure of leg power in middle-aged populations. This has implications for longitudinal studies which want to study age-related decline in chair rise performance.

  6. Happy Days: "SLJ's" Job Satisfaction Survey

    Science.gov (United States)

    Kenney, Brian

    2009-01-01

    "School Library Journal's" ("SLJ's") Job Satisfaction Survey, conducted online in spring 2008, asked school and public librarians about their salaries, pay raises, and opportunities for advancement; level of job satisfaction; major causes of dissatisfaction; on-the-job challenges; and how well they were prepared for their positions, among other…

  7. Sensitivity of sensor-based sit-to-stand peak power to the effects of training leg strength, leg power and balance in older adults

    NARCIS (Netherlands)

    Regterschot, G Ruben H; Folkersma, Marjanne; Zhang, Wei; Baldus, Heribert; Stevens, Martin; Zijlstra, Wiebren

    Increasing leg strength, leg power and overall balance can improve mobility and reduce fall risk. Sensor-based assessment of peak power during the sit-to-stand (STS) transfer may be useful for detecting changes in mobility and fall risk. Therefore, this study investigated whether sensor-based STS

  8. A REVIEW OF THE RELATIONSHIP BETWEEN LEG POWER AND SELECTED CHRONIC DISEASE IN OLDER ADULTS

    Science.gov (United States)

    STROLLO, S.E.; CASEROTTI, P.; WARD, R.E.; GLYNN, N.W.; GOODPASTER, B.H.; STROTMEYER, E.S.

    2016-01-01

    Objective This review investigates the relationship between leg muscle power and the chronic conditions of osteoarthritis, diabetes mellitus, and cardiovascular disease among older adults. Current literature assessing the impact of chronic disease on leg power has not yet been comprehensively characterized. Importantly, individuals with these conditions have shown improved leg power with training. Methods A search was performed using PubMed to identify original studies published in English from January 1998 to August 2013. Leg power studies, among older adults ≥ 50 years of age, which assessed associations with osteoarthritis, diabetes mellitus, and/or cardiovascular disease were selected. Studies concerning post-surgery rehabilitation, case studies, and articles that did not measure primary results were excluded. Results Sixteen studies met inclusion criteria, addressing osteoarthritis (n=5), diabetes mellitus (n=5), and cardiovascular disease (n=6). Studies generally supported associations of lower leg power among older adults with chronic disease, although small sample sizes, cross-sectional data, homogenous populations, varied disease definitions, and inconsistent leg power methods limited conclusions. Conclusions Studies suggest that osteoarthritis, diabetes mellitus, and cardiovascular disease are associated with lower leg power compared to older adults without these conditions. These studies are limited, however, by the heterogeneity in study populations and a lack of standardized measurements of leg power. Future larger studies of more diverse older adults with well-defined chronic disease using standard measures of leg power and interventions to improve leg power in these older adults with chronic disease are needed. PMID:25651453

  9. Towards Biomimetic Virtual Constraint Control of a Powered Prosthetic Leg.

    Science.gov (United States)

    Gregg, Robert D; Sensinger, Jonathon W

    2014-01-01

    This brief presents a novel control strategy for a powered prosthetic ankle based on a biomimetic virtual constraint. We first derive a kinematic constraint for the "effective shape" of the human ankle-foot complex during locomotion. This shape characterizes ankle motion as a function of the Center of Pressure (COP)-the point on the foot sole where the resultant ground reaction force is imparted. Since the COP moves monotonically from heel to toe during steady walking, we adopt the COP as a mechanical representation of the gait cycle phase in an autonomous feedback controller. We show that our kinematic constraint can be enforced as a virtual constraint by an output linearizing controller that uses only feedback available to sensors onboard a prosthetic leg. Using simulations of a passive walking model with feet, we show that this novel controller exactly enforces the desired effective shape whereas a standard impedance (i.e., proportional-derivative) controller cannot. This work provides a single, biomimetic control law for the entire single-support period during robot-assisted locomotion.

  10. Predictive current control with instantaneous reactive power minimization for a four-leg indirect matrix converter

    OpenAIRE

    Garcia, Cristian F.; Rivera, Marco E.; Rodriguez, Jose R.; Wheeler, Patrick; Pena, Ruben S.

    2017-01-01

    This paper presents the experimental valida¬tion of a predictive current control strategy with minimiza¬tion of the instantaneous reactive input power for a Four-Leg Indirect Matrix Converter (4Leg-IMC). The topology includes an input matrix converter stage, which provides the dc voltage for a four-leg voltage source converter (VSC) output stage. The VSC’s fourth leg provides a path for the zero sequence load current. The control technique is based on a finite control set model predictive con...

  11. A review of the relationship between leg power and selected chronic disease in older adults

    DEFF Research Database (Denmark)

    Strollo, S. E.; Caserotti, Paolo; Ward, R. E.

    2015-01-01

    OBJECTIVE: This review investigates the relationship between leg muscle power and the chronic conditions of osteoarthritis, diabetes mellitus, and cardiovascular disease among older adults. Current literature assessing the impact of chronic disease on leg power has not yet been comprehensively...... associations with osteoarthritis, diabetes mellitus, and/or cardiovascular disease were selected. Studies concerning post-surgery rehabilitation, case studies, and articles that did not measure primary results were excluded. RESULTS: Sixteen studies met inclusion criteria, addressing osteoarthritis (n=5......), diabetes mellitus (n=5), and cardiovascular disease (n=6). Studies generally supported associations of lower leg power among older adults with chronic disease, although small sample sizes, cross-sectional data, homogenous populations, varied disease definitions, and inconsistent leg power methods limited...

  12. Association between Thigh Muscle Volume and Leg Muscle Power in Older Women.

    Directory of Open Access Journals (Sweden)

    Ulrich Lindemann

    Full Text Available The construct of sarcopenia is still discussed with regard to best appropriate measures of muscle volume and muscle function. The aim of this post-hoc analysis of a cross-sectional experimental study was to investigate and describe the hierarchy of the association between thigh muscle volume and measurements of functional performance in older women. Thigh muscle volume of 68 independently living older women (mean age 77.6 years was measured via magnetic resonance imaging. Isometric strength was assessed for leg extension in a movement laboratory in sitting position with the knee flexed at 90° and for hand grip. Maximum and habitual gait speed was measured on an electronic walk way. Leg muscle power was measured during single leg push and during sit-to-stand performance. Thigh muscle volume was associated with sit-to-stand performance power (r = 0.628, leg push power (r = 0.550, isometric quadriceps strength (r = 0.442, hand grip strength (r = 0.367, fast gait speed (r = 0.291, habitual gait speed (r = 0.256, body mass index (r = 0.411 and age (r = -0.392. Muscle power showed the highest association with thigh muscle volume in healthy older women. Sit-to-stand performance power showed an even higher association with thigh muscle volume compared to single leg push power.

  13. Lower Limb Symmetry: Comparison of Muscular Power Between Dominant and Nondominant Legs in Healthy Young Adults Associated With Single-Leg-Dominant Sports.

    Science.gov (United States)

    Vaisman, Alex; Guiloff, Rodrigo; Rojas, Juan; Delgado, Iris; Figueroa, David; Calvo, Rafael

    2017-12-01

    Achieving a symmetrical power performance (difference symmetry does not act as a viable comparison. To (1) compare maximal muscular power between the dominant and nondominant legs in healthy young adults, (2) evaluate the effect of a single-leg-dominant sport activity performed at the professional level, and (3) propose a parameter of normality for maximal power difference in the lower limbs of this young adult population. Controlled laboratory study. A total of 78 healthy, male, young adults were divided into 2 groups according to sport activity level. Group 1 consisted of 51 nonathletes (mean ± SD age, 20.8 ± 1.5 years; weight, 71.9 ± 10.5 kg) who participated in less than 8 hours a week of recreational physical activity with nonspecific training; group 2 consisted of 27 single-leg-dominant professional soccer players (age, 18.4 ± 0.6 years; weight, 70.1 ± 7.5 kg) who specifically trained and competed at their particular activity 8 hours or more a week. For assessment of maximal leg power, both groups completed the single-leg squat jump test. Dominance was determined when participants completed 2 of 3 specific tests with the same extremity. Statistical analysis included the Student t test. No statistical difference was found for maximal power between dominant and nondominant legs for nonathletes ( t = -1.01, P = .316) or single-leg-dominant professional soccer players ( t = -1.10, P = .281). A majority (95%) of participants studied showed a power difference of less than 15% between their lower extremities. Among young healthy adults, symmetrical power performance is expected between lower extremities independent of the existence of dominance and difference in sport activity level. A less than 15% difference in power seems to be a proper parameter to define symmetrical power performance assessed by vertical single-leg jump tests.

  14. Hop performance and leg muscle power in athletes: Reliability of a test battery.

    Science.gov (United States)

    Kockum, Britta; Heijne, Annette I-L M

    2015-08-01

    To measure the absolute and relative reliability and the smallest real difference (SRD) in three commonly used hop tests, two leg-power tests and the single-leg squat jump. Methodological study. Clinical setting. Fourteen healthy athletes (seven women and seven men) were evaluated in a standardized test-retest design. The Intra-class correlation coefficient (ICC2.1), Standard Error of Measurement (SEM) and SRD were calculated for the vertical jump, one-leg hop for distance, side-hop, single-leg squat jump and knee-flexion and knee-extension power tests. All tests showed good to excellent ICC (0.84-0.98). The SEM (%) ranged between 3.4 and 11.1 for the four hop tests and between 8.1 and 12.4 for the leg-power tests. The SRD (%) for the hop tests ranged between 9.3 and 30.7 and for the three power tests between 22.4 and 34.3. The absolute reliability of this test protocol showed good to excellent ICC values and measurement errors of approximately 10%. This instrument can be recommended for determining function in terms of power in healthy athletes or late in the rehabilitation process. The tests' methodological errors must be considered and caution should be taken regarding the standardization procedure during testing. Copyright © 2014 Elsevier Ltd. All rights reserved.

  15. SLJ's 2011 Technology Survey: Things Are Changing. Fast

    Science.gov (United States)

    Kenney, Brian

    2011-01-01

    Despite the funding challenges nearly all school libraries face, many media specialists are optimistic about the role of technology in the school library, according to "School Library Journal's" ("SLJ") 2011 Technology Survey. But in spite of the general optimism, others point to some significant obstacles: technological innovations are often…

  16. Leg muscle power in 12-year-old black and white Tunisian football players.

    Science.gov (United States)

    Ben Ayed, Karim; Latiri, Imed; Dore, Eric; Tabka, Zouhair

    2011-04-01

    This study examined leg muscle power of young male Tunisian black and white football players and extended the analysis to determine whether there is a relationship between cycling peak power output (PPO) and some field tests. A total of 113 children (white group (WG) = n = 56; black group (BG) = n = 57) participated in this investigation. Anthropometric data included age, body mass (BM), height, leg length (LL), body mass index (BMI), and leg muscle volume (LMV). Cycling PPO was measured including a force-velocity test. Peak power output (PPO; W and W/kg), Fopt (optimal braking force), and Vopt (optimal velocity) were significantly higher in the WG compared with the BG (p force-velocity test as explanatory factors showed that 33% of the variance of PPO of BG was explained by qualitative factors that may be related to cycling skill, muscle composition, and socioeconomic and training status.

  17. Active Snubber Circuit for High Power Inverter Leg

    DEFF Research Database (Denmark)

    Rasmussen, Tonny Wederberg; Johansen, Morten Holst

    2009-01-01

    Abstract— High power converters in the conventional 6 pulse configuration with 6 switching elements IGBTs (Insulated Gate Bipolar Transistor) are pushed to the limit of power. Especially the switching loss is high. This reduces the switching frequency due to cooling problems. Passive snubber...... indicating that the switching loss is reduced. Comparison between hard switched, passive and active snubber is done....

  18. Effect of Ladder Drill Exercise on Speed, Surrounding, and Power Leg Muscle

    Directory of Open Access Journals (Sweden)

    Ketut Chandra Adinata Kusuma

    2017-10-01

    Full Text Available This study aimed at finding the effect of ladder drill training upon: (1 run speed, (2 agility, and (2 power of leg muscle. This study is an experimental research. This study utilized one group pre test-post test design. There were total people as the subject of this research. Data collection technique used 30-meter sprint test to measure run speed, Illinois agility test to measure agility, and vertical jump test to measure power of leg muscle. Data analysis technique which was used for normality test, homogeneity test/F-test, and T-test with significant level 5% by using SPSS 16.0.0. Based on the finding, there was effect of ladder drill training upon run speed with sig value=0.007, agility and power of leg muscle with sig value=0.000. Based on the data analysis, it could be concluded that there was significant effect of ladder drill training upon run speed, agility and power of leg muscle.

  19. Kicking Back Cognitive Ageing: Leg Power Predicts Cognitive Ageing after Ten Years in Older Female Twins.

    Science.gov (United States)

    Steves, Claire J; Mehta, Mitul M; Jackson, Stephen H D; Spector, Tim D

    2016-01-01

    Many observational studies have shown a protective effect of physical activity on cognitive ageing, but interventional studies have been less convincing. This may be due to short time scales of interventions, suboptimal interventional regimes or lack of lasting effect. Confounding through common genetic and developmental causes is also possible. We aimed to test whether muscle fitness (measured by leg power) could predict cognitive change in a healthy older population over a 10-year time interval, how this performed alongside other predictors of cognitive ageing, and whether this effect was confounded by factors shared by twins. In addition, we investigated whether differences in leg power were predictive of differences in brain structure and function after 12 years of follow-up in identical twin pairs. A total of 324 healthy female twins (average age at baseline 55, range 43-73) performed the Cambridge Neuropsychological Test Automated Battery (CANTAB) at two time points 10 years apart. Linear regression modelling was used to assess the relationships between baseline leg power, physical activity and subsequent cognitive change, adjusting comprehensively for baseline covariates (including heart disease, diabetes, blood pressure, fasting blood glucose, lipids, diet, body habitus, smoking and alcohol habits, reading IQ, socioeconomic status and birthweight). A discordant twin approach was used to adjust for factors shared by twins. A subset of monozygotic pairs then underwent magnetic resonance imaging. The relationship between muscle fitness and brain structure and function was assessed using linear regression modelling and paired t tests. A striking protective relationship was found between muscle fitness (leg power) and both 10-year cognitive change [fully adjusted model standardised β-coefficient (Stdβ) = 0.174, p = 0.002] and subsequent total grey matter (Stdβ = 0.362, p = 0.005). These effects were robust in discordant twin analyses, where within

  20. Lower Limb Force, Velocity, Power Capabilities during Leg Press and Squat Movements.

    Science.gov (United States)

    Padulo, Johnny; Migliaccio, Gian Mario; Ardigò, Luca Paolo; Leban, Bruno; Cosso, Marco; Samozino, Pierre

    2017-12-01

    The aim was to compare lower-limb power, force, and velocity capabilities between squat and leg press movements. Ten healthy sportsmen performed ballistic lower-limb push-offs against 5-to-12 different loads during both the squat and leg press. Individual linear force-velocity and polynomial power-velocity relationships were determined for both movements from push-off mean force and velocity measured continuously with a pressure sensor and linear encoder. Maximal power output, theoretical maximal force and velocity, force-velocity profile and optimal velocity were computed. During the squat, maximal power output (17.7±3.59 vs. 10.9±1.39 W·kg -1 ), theoretical maximal velocity (1.66±0.29 vs. 0.88±0.18 m·s -1 ), optimal velocity (0.839±0.144 vs. 0.465±0.107 m·s -1 ), and force-velocity profile (-27.2±8.5 vs. -64.3±29.5 N·s·m -1 ·kg -1 ) values were significantly higher than during the leg press (p=0.000, effect size=1.72-3.23), whereas theoretical maximal force values (43.1±8.6 vs. 51.9±14.0 N·kg -1 , p=0.034, effect size=0.75) were significantly lower. The mechanical capabilities of the lower-limb extensors were different in the squat compared with the leg press with higher maximal power due to much higher velocity capabilities (e.g. ability to produce force at high velocities) even if moderately lower maximal force qualities. © Georg Thieme Verlag KG Stuttgart · New York.

  1. Short- and long-term reliability of leg extensor power measurement in middle-aged and older adults.

    Science.gov (United States)

    Hurst, Christopher; Batterham, Alan M; Weston, Kathryn L; Weston, Matthew

    2018-05-01

    Muscular power is important for maintaining physical functioning with aging. Proper quantification of the reliability of muscular power tests is crucial to inform monitoring of individuals and sample size planning for interventional studies. This study evaluated short- and long-term reliability of leg extensor power measurement in 72 adults (age 62.7 ± 8.6 years). Participants completed four repeat trials on the Nottingham leg extensor power rig, with a further trial twelve weeks later. Mean change, typical error, and intraclass correlation coefficients (ICC) were calculated. For short-term reliability, mean change in power output was trivial after two trials (1.2-4.8%). Typical errors were small following four trials in the dominant leg of males (10.9-5.8%), three in the non-dominant leg of males (9.9-6.2%) and the dominant leg of females (10.0-9.6%) and two in the non-dominant leg in females (8.3%). Intraclass correlation coefficients (ICCs) were very high (0.88-0.96). For long-term reliability, mean change remained trivial (1.0-2.5%), typical errors remained small (5.8-8.6%), and ICCs very high (0.94-0.96). The leg extensor power rig is a reliable method for assessing lower body muscular power, both short- and long-term, with only minimal habituation effects.

  2. The effects of anthropometry and leg muscle power on drive and transition phase of acceleration

    DEFF Research Database (Denmark)

    Nikolaidis, Pantelis T.; Ingebrigtsen, Jørgen; Jeffreys, Ian

    2016-01-01

    Background: The aim of this study was to examine the effect of anthropometry and leg muscle power on accelerative ability and its phases (drive and transition). METHODS: Thirty-six soccer players (age 12.4±1.2 years, body mass 49.9±8.9 kg and height 154.2±10.3 cm) were tested twice, in the beginn...

  3. Comparison of the Power Knee and C-Leg during step-up and sit-to-stand tasks.

    Science.gov (United States)

    Wolf, Erik J; Everding, Vanessa Q; Linberg, Alison A; Czerniecki, Joseph M; Gambel, Jeffrey M

    2013-07-01

    For U.S. military service members with transfemoral amputations there are different prosthetic knee systems available that function differently. For example the C-Leg(®) (C-Leg, Otto Bock Healthcare, GmbH, Duderstadt, Germany) is a passive microprocessor knee, and the Power Knee™ (PK, Ossur, Reykjavík, Iceland) provides active positive power generation at the knee joint. This study examined both step-up and sit-to-stand tasks performed by service members using C-Leg and PK systems to determine if the addition of positive power generation to a prosthetic knee can improve symmetry and reduce impact to the remaining joints. For both tasks, average peak sagittal knee powers and vertical ground reaction forces (GRFs) were greater for the intact limb versus the amputated limb across PK and C-Leg groups. For the sit-to-stand task, peak knee power of the amputated limb was greater for PK users versus C-Leg users. Vertical GRFs of the intact limb were greater for the C-Leg versus the PK. The performance of the PK relative to the C-Leg during a STS task illustrated few differences between components and no effect on the intact limb. Published by Elsevier B.V.

  4. Factors Determining the Size of Sealing Clearance in Hydraulic Legs of Powered Supports

    Science.gov (United States)

    Buyalich, Gennady; Buyalich, Konstantin; Byakov, Maxim

    2017-11-01

    The factors that directly influence the formation of a sealing clearance between the piston and the working cylinder in hydraulic legs of powered supports are considered in this article, the size thereof has a direct effect on the tightness of the legs and, as a result, on the safety of work at the production face. A detailed description of these factors is given, which is supported by the dependencies obtained from the results of finite element modeling of various types of legs under various strength and geometric parameters, external load types and locations in the support section. The problems of formation of radial deformations of a working cylinder loaded with working fluid pressure are considered, and their dependence on the level of this pressure and extension. Based on the simulation results, the mechanisms for the formation of additional clearances due to rod and cylinder misalignments are described, and the conditions and causes of the resonant phenomena development are given. The classification of these factors according to the degree of generalization and the functional interaction between each other is proposed.

  5. ACTN3 R577X polymorphism and explosive leg-muscle power in elite basketball players.

    Science.gov (United States)

    Garatachea, Nuria; Verde, Zoraida; Santos-Lozano, Alejandro; Yvert, Thomas; Rodriguez-Romo, Gabriel; Sarasa, Francisco J; Hernández-Sánchez, Sonsoles; Santiago, Catalina; Lucia, Alejandro

    2014-03-01

    To determine the association of the ACTN3 R577X polymorphism with leg-muscle explosive power in Spanish (white) elite basketball players and controls. 100 (60 men) elite basketball players (cases) and 283 nonathletic controls. The authors assessed power performance by means of the vertical-squat and countermovement-jump tests. Genotype distributions did not differ between groups (cases: 37.0% [RR], 42.0% [RX], and 21.0% [XX]; controls: 31.8% [RR], 49.8% [RX], and 18.4% [XX]; P = .353). The authors did not observe any effect of the ACTN3 R577X polymorphism on study phenotypes in either group, including when they performed the analyses separately in men and women. They found no association between the ACTN3 R577X polymorphism and the likelihood of being an elite basketball player using the dominant or the recessive model, and the results remained unaltered when the analyses were adjusted for sex, weight, height, and age or when performed for men and women separately. Although the ACTN3 R577X is associated with explosive muscle performance and this phenotype is important in the sport of basketball (ie, during jumps), the authors found no association with leg explosive power in elite basket players or with the status of being this type of athlete.

  6. Closed-loop design of 4-leg inverter for transformer-less on-line Uninterrupted Power Supply (UPS) system

    International Nuclear Information System (INIS)

    Vyawahare, Dhanashree; Jagannath, K.

    2014-01-01

    Uninterrupted power supplies are inevitable in safety critical systems of nuclear power plants, hospitals, airports etc. With recent developments in power electronics and digital signal processors, it is possible to make modular, cost effective, easily expandable and energy efficient UPS systems. Galvanic isolation, voltage level matching and generation of 3-phase, 4-wire system mainly require bulky transformers. Loads are also not equally distributed on all the three phases. Thus the chances of unbalance in loads are very likely. Nonlinear loads like switched mode power supplies of computers, rectifiers, etc., are unavoidable. Such loads cause distortion in output voltages. Using specially designed transformers cannot take care of all these issues efficiently. As an alternative to the use of inverter transformer, the idea of using the 4-leg inverter in on-line UPS system is proposed in this paper. 4-leg inverter has an additional neutral leg which can be used to provide neutral connection. Also the 4-leg inverter has inherent capability of controlling the zero sequence currents and to cater unbalanced as well as nonlinear loads. Thus the system can be made transformer-less with the use of 4-leg inverter. This definitely helps in reducing the footprint and weight of the UPS system. Various topologies and different ways of generating the 3-phase four wire outputs are studied. Use of 4-leg inverter and its closed-loop design for unbalance and nonlinear loads is studied in detail. (author)

  7. Normalized knee-extension strength or leg-press power after fast-track total knee arthroplasty

    DEFF Research Database (Denmark)

    Aalund, Peter K; Larsen, Kristian; Hansen, Torben Bæk

    2013-01-01

    : Cross-sectional, exploratory study. SETTING: Laboratory at a regional hospital. PARTICIPANTS: Thirty-nine individuals with an average age of 65.5±10.3 yrs, who all had unilateral TKA 28 days prior. INTERVENTIONS: None. MAIN OUTCOME MEASURES: The patients performed maximal isometric knee extensions......OBJECTIVE: (s): To investigate which of the two muscle-impairment measures for the operated leg, normalized knee extension strength or leg press power, is more closely associated to performance-based and self-reported measures of function shortly following total knee arthroplasty (TKA). DESIGN...... and dynamic leg presses to determine their body-mass normalized knee extension strength and leg press power, respectively. The 10-m fast speed walking and 30-s chair stand tests were used to determine performance-based function, while the Western Ontario McMaster University Osteoarthritis Index (WOMAC...

  8. The App Squad: SLJ's Advisors Weigh in on Kids' Book Apps

    Science.gov (United States)

    Ishizuka, Kathy

    2011-01-01

    In this article, "School Library Journal's" ("SLJ") advisors talk about book apps for kids. They discuss what they like, what one should look for in discerning the best for kids and teens, and where this all might be headed.

  9. STS-47 MS Jemison works in the Spacelab Japan (SLJ) module aboard OV-105

    Science.gov (United States)

    1992-01-01

    STS-47 Mission Specialist (MS) Mae C. Jemison appears to be clicking her heels in zero gravity in the center aisle of the Spacelab Japan (SLJ) science module aboard the Earth-orbiting Endeavour, Orbiter Vehicle (OV) 105. Making her first flight in space, Dr. Jemison was joined by five other NASA astronauts and a Japanese payload specialist for eight days of research in support of the SLJ mission, a joint effort between Japan and United States.

  10. Effects of uneven temperature of IGBT and diode on switching characteristics of bridge legs in MW-level power converters

    DEFF Research Database (Denmark)

    Luo, Haoze; Iannuzzo, Francesco; Blaabjerg, Frede

    2016-01-01

    This paper proposes an independent temperature test method for switching characteristic evaluation of high-power single switch modules. For high-power bridge legs, the commutation occurs between two discrete IGBT modules. To simulate the junction differences between two modules caused by mission ...

  11. Pelvic movement strategies and leg extension power in patients with end-stage medial compartment knee osteoarthritis

    DEFF Research Database (Denmark)

    Kierkegaard, Signe; Jørgensen, Peter Bo; Dalgas, Ulrik

    2015-01-01

    INTRODUCTION: During movement tasks, patients with medial compartment knee osteoarthritis use compensatory strategies to minimise the joint load of the affected leg. Movement strategies of the knees and trunk have been investigated, but less is known about movement strategies of the pelvis during...... compartment knee osteoarthritis use greater pelvic movements during advanced functional performance tests, particularly when these involve descending tasks. Further studies should investigate if it is possible to alter these movement strategies by an intervention aimed at increasing strength and power...... advancing functional tasks, and how these strategies are associated with leg extension power. The aim of the study was to investigate pelvic movement strategies and leg extension power in patients with end-stage medial compartment knee osteoarthritis compared with controls. MATERIALS AND METHODS: 57...

  12. Individual Leg and Joint Work during Sloped Walking for People with a Transtibial Amputation Using Passive and Powered Prostheses

    Directory of Open Access Journals (Sweden)

    Jana R. Jeffers

    2017-12-01

    Full Text Available People with a transtibial amputation using passive-elastic prostheses exhibit reduced prosthetic ankle power and push-off work compared to non-amputees and compensate by increasing their affected leg (AL hip joint work and unaffected leg (UL ankle, knee, and hip joint and leg work during level-ground walking. Use of a powered ankle–foot prosthesis normalizes step-to-step transition work during level-ground walking over a range of speeds for people with a transtibial amputation, but the effects on joint work during level-ground, uphill, and downhill walking have not been assessed. We investigated how use of passive-elastic and powered ankle–foot prostheses affect leg joint biomechanics during level-ground and sloped walking. 10 people with a unilateral transtibial amputation walked at 1.25 m/s on a dual-belt force-measuring treadmill at 0°, ±3°, ±6°, and ±9° using their own passive-elastic and a powered prosthesis (BiOM T2, BionX Medical Technologies, Inc., Bedford, MA, USA while we measured kinematic and kinetic data. We calculated AL and UL prosthetic, ankle, knee, hip, and individual leg positive, negative, and net work. Use of a powered compared to passive-elastic ankle–foot prosthesis resulted in greater AL prosthetic and individual leg net work on uphill and downhill slopes. Over a stride, AL prosthetic positive work was 23–30% greater (p < 0.05 during walking on uphill slopes of +6°, and +9°, prosthetic net work was up to 10 times greater (more positive (p ≤ 0.005 on all uphill and downhill slopes and individual leg net work was 146 and 82% more positive (p < 0.05 at uphill slopes of +6° and +9°, respectively, with use of the powered compared to passive-elastic prosthesis. Greater prosthetic positive and net work through use of a powered ankle–foot prosthesis during uphill and downhill walking improves mechanical work symmetry between the legs, which could decrease metabolic cost and improve functional

  13. Unifying the Gait Cycle in the Control of a Powered Prosthetic Leg.

    Science.gov (United States)

    Quintero, David; Martin, Anne E; Gregg, Robert D

    2015-08-01

    This paper presents a novel control strategy for an above-knee powered prosthetic leg that unifies the entire gait cycle, eliminating the need to switch between controllers during different periods of gait. Current control methods divide the gait cycle into several sequential periods each with independent controllers, resulting in many patient-specific control parameters and switching rules that must be tuned by clinicians. Having a single controller could reduce the number of control parameters to be tuned for each patient, thereby reducing the clinical time and effort involved in fitting a powered prosthesis for a lower-limb amputee. Using the Discrete Fourier Transformation, a single virtual constraint is derived that exactly characterizes the desired actuated joint motion over the entire gait cycle. Because the virtual constraint is defined as a periodic function of a monotonically increasing phase variable, no switching or resetting is necessary within or across gait cycles. The output function is zeroed using feedback linearization to produce a single, unified controller. The method is illustrated with simulations of a powered knee-ankle prosthesis in an amputee biped model and with examples of systematically generated output functions for different walking speeds.

  14. Venogram - leg

    Science.gov (United States)

    Phlebogram - leg; Venography - leg; Angiogram - leg ... into a vein in the foot of the leg being looked at. An intravenous (IV) line is ... vein. A tourniquet may be placed on your leg so the dye flows into the deeper veins. ...

  15. Temporary core liquid level depression during cold-leg small-break LOCA effect of break size and power level

    International Nuclear Information System (INIS)

    Koizumi, Y.; Kumamaru, H.; Mimura, Y.; Kukita, Y.; Tasaka, K.

    1989-01-01

    Cold-leg small break LOCA experiments (0.5-10% break) were conducted at the large scale test facility (LSTF), a volumetrically-scaled (1/48) simulator of a PWR, of the ROSA-IV Program. When a break area was less than 2.5% of the scaled cold-leg flow area, the core liquid level was temporarily further depressed to the bottom elevation of the crossover leg during the loop seal clearing early in the transient only by the manometric pressure balance since no coolant remained in the upper portion of the primary system. When the break size was larger than 5%, the core liquid level was temporarily further depressed lower than the bottom elevation of the crossover leg during the loop seal clearing since coolant remained at the upper portion of the primary system; the steam generator (SG) U-tube upflow side and the SG inlet plenum, due to counter current flow limiting by updrafting steam while the coolant drained. The amount of coolant trapped there was dependent on the vapor velocity (core power); the larger the core power, the lower the minimum core liquid level. The RELAP5/MOD2 code reasonable predicted phenomena observed in the experiments. (orig./DG)

  16. STS-47 MS Jemison works at SLJ Rack 5 during crew station review at KSC

    Science.gov (United States)

    1992-01-01

    STS-47 Mission Specialist (MS) Mae C. Jemison, wearing clean suit, flips centrifuge switch on Spacelab Japan (SLJ) Rack 5 Frog Environmental Unit during training and review activities at the Kennedy Space Center (KSC). Jemison is inside the SLJ laboratory module installed in Endeavour's, Orbiter Vehicle (OV) 105's, payload bay (PLB). OV-105 is currently undergoing pre-flight processing in a high bay area of KSC's Orbiter Processing Facility (OPF). View provided by KSC with alternate KSC number KSC-92PC-1645.

  17. STS-47 MS Davis and MS Jemison conduct LBNP experiment in the SLJ module

    Science.gov (United States)

    1992-01-01

    At the aft end of the Spacelab Japan (SLJ) science module, STS-47 Mission Specialist (MS) N. Jan Davis (foreground) readies Rack 9 Automatic Blood Pressure System (ABPS) controls as MS Mae C. Jemison, inside the cylindrical fabric lower body negative pressure (LBNP) device, waits for the LBNP experiment to begin. LBNP device is sealed around Jemison's waist. It is attached to the SLJ floor and has a controller that operates a pump to change the pressure inside. Davis will monitor Jemison's pulse rate, blood pressure, and cardiac dimensions and functions.

  18. Locating hot and cold-legs in a nuclear powered steam generation system

    Science.gov (United States)

    Ekeroth, Douglas E.; Corletti, Michael M.

    1993-01-01

    A nuclear reactor steam generator includes a reactor vessel for heating water and a steam generator with a pump casing at the lowest point on the steam generator. A cold-leg pipe extends horizontally between the steam generator and the reactor vessel to return water from the steam generator to the reactor vessel. The bottom of the cold-leg pipe is at a first height above the bottom of the reactor vessel. A hot-leg pipe with one end connected to the steam generator and a second end connected to the reactor vessel has a first pipe region extending downwardly from the steam generator to a location between the steam generator and the reactor vessel at which a bottom of the hot-leg pipe is at a second height above the bottom of the reactor vessel. A second region extends from that location in a horizontal direction at the second height to the point at which the hot-leg pipe connects to the reactor vessel. A pump is attached to the casing at a location below the first and second heights and returns water from the steam generator to the reactor vessel over the cold-leg. The first height is greater than the second height and the bottom of the steam generator is at a height above the bottom of the reactor vessel that is greater than the first and second heights. A residual heat recovery pump is below the hot-leg and has an inlet line from the hot-leg that slopes down continuously to the pump inlet.

  19. Energetic and Peak Power Advantages of Series Elastic Actuators in an Actuated Prosthetic Leg for Walking and Running

    Directory of Open Access Journals (Sweden)

    Martin Grimmer

    2014-02-01

    Full Text Available A monoarticular series elastic actuator (SEA reduces energetic and peak power requirements compared to a direct drive (DD in active prosthetic ankle-foot design. Simulation studies have shown that similar advantages are possible for the knee joint. The aims of this paper were to investigate the advantages of a monoarticular SEA-driven hip joint and to quantify the energetic benefit of an SEA-driven leg (with monoarticular hip, knee and ankle SEAs, assuming that damping (negative power is passively achieved. The hip SEA provided minor energetic advantages in walking (up to 29% compared to the knee and the ankle SEA. Reductions in required peak power were observed only for speeds close to preferred walking speed (18% to 27%. No energetic advantages were found in running, where a DD achieved the best performance when optimizing for energy. Using an SEA at each leg joint in the sagittal plane reduced the positive work by 14% to 39% for walking and by 37% to 75% for running. When using an SEA instead of a DD, the contribution of the three leg joints to doing positive work changed: the knee contributed less and the hip more positive work. For monoarticular SEAs, the ankle joint motor did most of the positive work.

  20. STS-47 MS Davis and MS Jemison with LBNP device in SLJ module aboard OV-105

    Science.gov (United States)

    1992-01-01

    STS-47 Mission Specialist (MS) N. Jan Davis (left) and MS Mae C. Jemison prepare the lower body negative pressure (LBNP) device for the LBNP experiment in the Spacelab Japan (SLJ) science module aboard the Earth-orbiting Endeavour, Orbiter Vehicle (OV) 105. Displayed on the aft end cone in the background is an Auburn University banner.

  1. Control strategy for Single-phase Transformerless Three-leg Unified Power Quality Conditioner Based on Space Vector Modulation

    DEFF Research Database (Denmark)

    Lu, Yong; Xiao, Guochun; Wang, Xiongfei

    2016-01-01

    The unified power quality conditioner (UPQC) is known as an effective compensation device to improve PQ for sensitive end-users. This paper investigates the operation and control of a single-phase three-leg UPQC (TL-UPQC), where a novel space vector modulation method is proposed for naturally...... solving the coupling problem introduced by the common switching leg. The modulation method is similar to the well-known space vector modulation widely used with three-phase voltage source converters, which thus brings extra flexibility to the TL-UPQC system. Two optimized modulation modes with either...... reduced switching loss or harmonic distortion are derived, evaluated, and discussed, in order to demonstrate the flexibility brought by the space vector modulated TL-UPQC. Simulations and experimental results are presented to verify the feasibility and effectiveness of the proposed space vector modulation...

  2. Test-retest reliability of maximal leg muscle power and functional performance measures in patients with severe osteoarthritis (OA)

    DEFF Research Database (Denmark)

    Villadsen, Allan; Roos, Ewa M.; Overgaard, Søren

    Abstract : Purpose To evaluate the reliability of single-joint and multi-joint maximal leg muscle power and functional performance measures in patients with severe OA. Background Muscle power, taking both strength and velocity into account, is a more functional measure of lower extremity muscle...... and scheduled for unilateral total hip (n=9) or knee (n=11) replacement. Patients underwent a test battery on two occasions separated by approximately one week (range 7 to 11 days). Muscle power was measured using: 1. A linear encoder, unilateral lower limb isolated single-joint dynamic movement, e.g. knee...... activity compared with the traditionally used isometric and/or isokinetic muscle strength. More functional measures are preferred to determine muscle function and as outcomes in exercise studies in patients with OA. Methods Subjects: 20 patients (mean age 68.7±7.2, BMI 29.0±3.9) diagnosed with severe OA...

  3. STS-47 crew and backups pose for portrait in SLJ module at KSC during training

    Science.gov (United States)

    1992-01-01

    STS-47 Endeavour, Orbiter Vehicle (OV) 105, crewmembers and backup payload specialists, wearing clean suits, pose for a group portrait in the Spacelab Japan (SLJ) module. The team is at the Kennedy Space Center's (KSC's) Orbiter Processing Facility (OPF) to inspect SLJ configuration and OV-105 preparations. Kneeling, from left, are backup Payload Specialist Chiaki Naito-Mukai; Mission Specialist (MS) N. Jan Davis; and backup Payload Specialist Takao Doi. Standing, from the left, are Pilot Curtis L. Brown,Jr; MS and Payload Commander Mark C. Lee; MS Jerome Apt; Payload Specialist Mamoru Mohri; Commander Robert L. Gibson; MS Mae C. Jemison; and backup Payload Specialist Stanely L. Koszelak. Mohri, Mukai, and Doi represent the National Space Development Agency of Japan (NASDA). View provided by KSC with alternate KSC number KSC-92PC-1647.

  4. Effects on strength, power, and flexibility in adolescents of nonperiodized vs. daily nonlinear periodized weight training.

    Science.gov (United States)

    Moraes, Eveline; Fleck, Steven J; Ricardo Dias, Marcelo; Simão, Roberto

    2013-12-01

    The aim of this study was to compare 2 models of resistance training (RT) programs, nonperiodized (NP) training and daily nonlinear periodized (DNLP) training, on strength, power, and flexibility in untrained adolescents. Thirty-eight untrained male adolescents were randomly assigned to 1 of 3 groups: a control group, NP RT program, and DNLP program. The subjects were tested pretraining and after 4, 8, and 12 weeks for 1 repetition maximum (1RM) resistances in the bench press and 45° leg press, sit and reach test, countermovement vertical jump (CMVJ), and standing long jump (SLJ). Both training groups performed the same sequence of exercises 3 times a week for a total of 36 sessions. The NP RT consisted of 3 sets of 10-12RM throughout the training period. The DNLP training consisted of 3 sets using different training intensities for each of the 3 training sessions per week. The total volume of the training programs was not significantly different. Both the NP and DNLP groups exhibited a significant increase in the 1RM for the bench press and 45° leg press posttraining compared with that pretraining, but there were no significant differences between groups (p ≤ 0.05). The DNLP group's 1RM changes showed greater percentage improvements and effect sizes. Training intensity for the bench press and 45° leg press did not significantly change during the training. In the CMVJ and SLJ tests, NP and DNLP training showed no significant change. The DNLP group showed a significant increase in the sit and reach test after 8 and 12 weeks of training compared with pretraining; this did not occur with NP training. In summary, in untrained adolescents during a 12-week training period, a DNLP program can be used to elicit similar and possible superior maximal strength and flexibility gains compared with an NP multiset training model.

  5. STS-47 crew in SLJ module make notes during shift changeover aboard OV-105

    Science.gov (United States)

    1992-01-01

    During STS-47 aboard Endeavour, Orbiter Vehicle (OV) 105, six of the seven crewmembers supporting the Spacelab Japan (SLJ) mission share this shift changeover scene in the spacelab science module. From the foreground, are Mission Specialist (MS) Mae C. Jemison, MS and Payload Commander (PLC) Mark C. Lee, Commander Robert L. Gibson, MS N. Jan Davis, Pilot Curtis L. Brown, Jr, and Payload Specialist Mamoru Mohri. Mohri represents Japan's National Space Development Agency (NASDA). Photo was taken by MS Jerome Apt.

  6. STS-47 Mission Specialist (MS) Jemison conducts AFTE in SLJ module on OV-105

    Science.gov (United States)

    1992-01-01

    STS-47 Mission Specialist (MS) Mae C. Jemison, wearing autogenic feedback training system 2 suit, conducts the Autogenic Feedback Training Experiment (AFTE) in Spacelab Japan (SLJ) science module aboard Endeavour, Orbiter Vehicle (OV) 105. AFTE's objective is to teach astronauts to use biofeedback rather than drugs to combat nausea and other effects of space motion sickness. Jemison's physical responses are monitored by sensors attached to the suit.

  7. STS-47 crew poses for Official onboard (in space) portrait in SLJ module

    Science.gov (United States)

    1992-01-01

    STS-47 crewmembers assemble for their traditional onboard (in-flight) portrait in the Spacelab Japan (SLJ) science module aboard the Earth-orbiting Endeavour, Orbiter Vehicle (OV) 105. Left to right (front) are Mission Specialist N. Jan Davis, MS and Payload Commander (PLC) Mark C. Lee, and Payload Specialist Mamoru Mohri; and (rear) Pilot Curtis L. Brown, Jr, MS Jerome Apt, Commander Robert L. Gibson, and MS Mae C. Jemison.

  8. Analysis and Sliding Mode Control of Four-Wire Three-Leg Shunt Active Power Filter

    Directory of Open Access Journals (Sweden)

    Farid Hamoudi

    2015-01-01

    Full Text Available In this paper, the analysis and the sliding mode control application for a shunt active filter is presented. The active filter is based on a three-leg split-capacitor voltage source inverter which is used to compensate harmonics and unbalance in the phase currents, and therefore to cancel neutral current. The proposed sliding mode control is formulated from the multivariable state model established in dq0 frames. The selection of the sliding mode functions takes in account simultaneously, the current tracking and the dc-bus regulation and balancing, without the need of outer loops for the dc-bus control. A particular attention is given to the sliding mode functions design in order to optimize the convergence of the zero-sequence error and the dc-bus voltage unbalance. The effectiveness of the proposed control has been verified through computer simulation where satisfactory results are obtained over different conditions.

  9. An Improved Control Strategy for a Four-Leg Grid-Forming Power Converter under Unbalanced Load Conditions

    Directory of Open Access Journals (Sweden)

    Mohammad Reza Miveh

    2016-01-01

    Full Text Available This paper proposes an improved multiloop control strategy for a three-phase four-leg voltage source inverter (VSI operating with highly unbalanced loads in an autonomous distribution network. The main objective is to balance the output voltages of the four-leg inverter under unbalanced load conditions. The proposed control strategy consists of a proportional-integral (PI voltage controller and a proportional current loop in each phase. The voltage controller and the current control loop are, respectively, used to regulate the instantaneous output voltage and generate the pulse width modulation (PWM voltage command with zero steady-state tracking error and fast transient response. A voltage decoupling feedforward path is also used to enhance the system robustness. Since the outer voltage loop operates in the synchronous reference frame, tuning and stability analysis of the PI controller is far from being straightforward. In order to cope with this challenge, the stationary reference frame equivalent of the voltage controller in the rotating frame is derived. Subsequently, a systematic design based on a frequency response approach is provided. Simulation results are also carried out using the DIgSILENT PowerFactory software to verify the effectiveness of the suggested control strategy.

  10. Assessing the force-velocity characteristics of the leg extensors in well-trained athletes: the incremental load power profile.

    Science.gov (United States)

    Sheppard, Jeremy M; Cormack, Stuart; Taylor, Kristie-Lee; McGuigan, Michael R; Newton, Robert U

    2008-07-01

    The purpose of this research project was to evaluate the methodology of an iso-inertial force-velocity assessment utilizing a range of loads and a group of high-performance athletes. A total of 26 subjects (19.8 +/- 2.6 years, 196.3 +/- 9.6 cm, 88.6 +/- 8.9 kg) participated in this study. Interday reliability of various force-time measures obtained during the performance of countermovement jumps with a range of loads was examined, followed by a validity assessment of the various measures' ability to discriminate among performance levels, while the ability of the test protocol to detect training-induced changes was assessed by comparing results before and after an intensive 12-week training period. Force and velocity variables were observed to be reliable (intraclass correlation coefficient 0.74-0.99). Large effect size statistic (ES > 0.50) differences among player groups were observed for peak power (1.36-2.25), relative peak power (1.57-2.42), and peak force (0.74-0.95). Significant (p 0.50) improvements were observed in the kinetic values after the intensive training period. The results of this study indicate that the incremental load power profile is an acceptably reliable, valid, and sensitive method of assessing force and power capabilities of the leg extensors in high-performance and elite volleyball players.

  11. Uneven temperature effect evaluation in high-power IGBT inverter legs and relative test platform design

    DEFF Research Database (Denmark)

    Luo, Haoze; Li, Wuhua; He, Xiangning

    2017-01-01

    This paper presents a high-power IGBT testing platform for uneven temperature conditions and its design criteria. Considering the influence of layout parasitic parameters on the measurement results, commutation rules and independent junction temperature control, a universal high-power switching c...

  12. Promise of a low power mobile CPU based embedded system in artificial leg control.

    Science.gov (United States)

    Hernandez, Robert; Zhang, Fan; Zhang, Xiaorong; Huang, He; Yang, Qing

    2012-01-01

    This paper presents the design and implementation of a low power embedded system using mobile processor technology (Intel Atom™ Z530 Processor) specifically tailored for a neural-machine interface (NMI) for artificial limbs. This embedded system effectively performs our previously developed NMI algorithm based on neuromuscular-mechanical fusion and phase-dependent pattern classification. The analysis shows that NMI embedded system can meet real-time constraints with high accuracies for recognizing the user's locomotion mode. Our implementation utilizes the mobile processor efficiently to allow a power consumption of 2.2 watts and low CPU utilization (less than 4.3%) while executing the complex NMI algorithm. Our experiments have shown that the highly optimized C program implementation on the embedded system has superb advantages over existing PC implementations on MATLAB. The study results suggest that mobile-CPU-based embedded system is promising for implementing advanced control for powered lower limb prostheses.

  13. The Effects of High-Intensity versus Low-Intensity Resistance Training on Leg Extensor Power and Recovery of Knee Function after ACL-Reconstruction

    DEFF Research Database (Denmark)

    Bieler, Theresa; Sobol, Nanna Aue; Andersen, Lars L

    2014-01-01

    OBJECTIVE: Persistent weakness is a common problem after anterior cruciate ligament- (ACL-) reconstruction. This study investigated the effects of high-intensity (HRT) versus low-intensity (LRT) resistance training on leg extensor power and recovery of knee function after ACL-reconstruction. METH...

  14. Contribution of Leg Muscle Explosive Power and Eye-Hand Coordination to The Accuracy Smash of Athletes in Volleyball Club of Universitas Islam Riau

    Directory of Open Access Journals (Sweden)

    Mimi Yulianti

    2017-11-01

    Full Text Available The purpose of this study was to determine the contribution of leg muscle explosive power and eye-hand coordination. The type of research was correlational. The population in this study was all athletes who actively follow the training as many as 20 people and using total sampling technique. Thus the sample in this study amounted to 20 men athletes. The data were collected using the measurement test on the three variables: the leg muscle explosive power data was using vertical jump test, eyehand coordination was using ballwerfen und fangen test and smash accuracy was using smash accuracy test. The data were analyzed by product moment correlation and double correlation and then continued with contribution of the determinant formula. Based on data analysis found that there was contribution of leg muscle explosive power equal to 35,52%, eye-hand coordination equal to 20,79%, and both equal to 40,70% regarding to the accuracy smash of volleyball atletes of Universitas Islam Riau. It was concluded that there was contribution of leg muscle explosive power and eye-hand coordination to the smash accuracy of volleyball athlete of Universitas Islam Riau.

  15. STS-47 MS Jemison trains in SLJ module at MSFC Payload Crew Training Complex

    Science.gov (United States)

    1992-01-01

    STS-47 Endeavour, Orbiter Vehicle (OV) 105, Mission Specialist (MS) Mae C. Jemison, wearing Autogenic Feedback Training System 2 suit, works with the Frog Embryology Experiment in a General Purpose Workstation (GPWS) in the Spacelab Japan (SLJ) module mockup at the Payload Crew Training Complex. The experiment will study the effects of weightlessness on the development of frog eggs fertilized in space. The Payload Crew Training Complex is located at the Marshall Space Flight Center (MSFC) in Huntsville, Alabama. View provided with alternate number 92P-139.

  16. STS-47 crew poses for portrait after having been named to the SLJ mission

    Science.gov (United States)

    1990-01-01

    STS-47 crewmembers pose for portrait after having been named to the Spacelab Japan (SLJ) mission scheduled for flight aboard Endeavour, Orbiter Vehicle (OV) 105. NASA and the National Space Development Agency of Japan (NASDA) recently named the four to the mission. Posing in front of the flags of the United States (U.S.) and Japan are (left to right) Mission Specialist (MS) Mae C. Jemison, Japanese NASDA Payload Specialist Mamoru Mohri, MS N. Jan Davis, and MS and Payload Commander (PLC) Mark C. Lee.

  17. STS-47 crewmembers work in the Spacelab Japan (SLJ) module aboard OV-105

    Science.gov (United States)

    1992-01-01

    STS-47 Mission Specialist (MS) Jerome Apt responds to a crewmate's query during a shift changeover in the Spacelab Japan (SLJ) science module aboard the Earth-orbiting Endeavour, Orbiter Vehicle (OV) 105. Apt, positioned in front of Rack 3's general purpose workstation (GPWS), talks to MS and Payload Commander (PLC) Mark C. Lee (foreground, partially out of frame). Behind Apt and in front of the spacelab tunnel hatch are MS Mae C. Jemison (left) and MS N. Jan Davis. Note that Commander Robert L. Gibson freefloats above the GPWS during the discussion.

  18. The effect of 8-week plyometric training on leg power, jump and sprint performance in female soccer players.

    Science.gov (United States)

    Ozbar, Nurper; Ates, Seda; Agopyan, Ani

    2014-10-01

    The aim of this study was to determine the effect of 8-week plyometric training (PT) on the leg power and jump and sprint performance in female soccer players. Eighteen female soccer players from Women Second League (age = 18.2 ± 2.3 years, height = 161.3 ± 5.4 cm, body mass = 56.6 ± 7.2 kg) were randomly assigned to control (n = 9) and plyometric (n = 9) groups. Both groups continued together with regular technical and tactical soccer training for 4 days a week. Additionally, the plyometric group underwent PT for 8 weeks, 1 day per week, 60-minute session duration. During the 8-week period, the control group was hindered from any additional conditioning training. All players' jumps (triple hop, countermovement jump, and standing broad jump), running speed (20 m), and peak power were evaluated before and after 8 weeks. No significant difference was found between the groups at pretest variables (p > 0.05). Significant improvements were found in the posttest of both the groups (p ≤ 0.05), except for 20-m sprint test in the control group (p > 0.05). Triple hop distance, countermovement jump, standing broad jump, peak power, and 20-m sprint test values were all significantly improved in the plyometric group, compared with the control group (p ≤ 0.05). We concluded that short duration PT is an improved important component of athletic performance in female soccer players. The results indicate that safe, effective, and alternative PT can be useful to strength and conditioning coaches, especially during competition season where less time is available for training.

  19. Effects of a powered ankle-foot prosthesis on kinetic loading of the unaffected leg during level-ground walking

    OpenAIRE

    Grabowski, Alena M; D?Andrea, Susan

    2013-01-01

    Background People with a lower-extremity amputation that use conventional passive-elastic ankle-foot prostheses encounter a series of stress-related challenges during walking such as greater forces on their unaffected leg, and may thus be predisposed to secondary musculoskeletal injuries such as chronic joint disorders. Specifically, people with a unilateral transtibial amputation have an increased susceptibility to knee osteoarthritis, especially in their unaffected leg. Previous studies hav...

  20. STS-47 MS Jemison works with FTS equipment in SLJ module aboard OV-105

    Science.gov (United States)

    1992-01-01

    STS-47 Mission Specialist Mae C. Jemison injects a fluid into a mannequin's hand during research in the Spacelab Japan (SLJ) science module aboard the Earth-orbiting Endeavour, Orbiter Vehicle (OV) 105. Working at Rack 9, Jemison conducts this Fluid Therapy System (FTS) experiment procedure. FTS will examine the effect of low gravity on the administration of intravenous (IV) fluids in space. Since gravity assists in the delivery and flow of IV fluids on Earth, researchers want to determine what problems the absence of gravity would cause if an IV had to be administrated to an astronaut in space. A new device that converts contaminated water into a sterile solution that can be used in IVs is part of the experiment. MS and Payload Commander Mark C. Lee is partially visible at lower right.

  1. Leg Swelling

    Science.gov (United States)

    ... ed. New York, N.Y.: The McGraw Hill Companies; 2016. http://www.accessmedicine.com. Accessed Dec. 31, ... http://www.mayoclinic.org/symptoms/leg-swelling/basics/definition/SYM-20050910 . Mayo Clinic Footer Legal Conditions and ...

  2. Block-step asymmetry 5 years after large-head metal-on-metal total hip arthroplasty is related to lower muscle mass and leg power on the implant side.

    Science.gov (United States)

    Hjorth, M H; Stilling, M; Lorenzen, N D; Jakobsen, S S; Soballe, K; Mechlenburg, I

    2014-06-01

    Metal-on-metal articulations mimic the human hip anatomy, presumably lower dislocation rates and increase the range-of-motion. This study aims to measure the muscle mass and power of both legs in patients with unilateral metal-on-metal total hip arthroplasty, and to investigate their effect on block-step test, spatio-temporal gait parameters and self-reported function. Twenty-eight patients (7 women), mean age 50 (28-68) years, participated in a 5-7 year follow-up. Patients had received one type unilateral large-head metal-on-metal total hip articulation, all of which were well-functioning at follow-up. Mean muscle mass was measured by the total-body Dual energy X-ray Absorption scans, and muscle power was measured in a leg extensor power rig. Block-step test and spatio-temporal gait parameters were measured with an inertial measurement unit. Self-reported function was assessed by the Hip Disability and Osteoarthritis Outcome Score. We found a significant difference between the mean muscle mass of the implant-side leg and the non-implant-side leg in hip, thigh and calf areas (Ppower (P=0.025). Correlations between mean muscle mass and mean muscle power were significant for both the implant-side leg (r=0.45, P=0.018) and the non-implant-side leg (r=0.51, P=0.007). The difference in mean muscle power between legs correlated with block-step test asymmetry during ascending (r=0.40, P=0.047) and descending (r=0.53, P=0.006). Correlations between self-reported function and power of the implant-side leg were not significant. Young patients have not fully regained muscle mass, muscle power and function 5-7 years after metal-on-metal total hip arthroplasty. Copyright © 2014. Published by Elsevier Ltd.

  3. CHANGES IN DEVELOPMENT OF EHPLOSIVE POWER OF LEGS UNDER THE INFLUENCE OF PLYOMETRIC TRAINING METHOD BY VOLLEYBALL PLAYERS

    Directory of Open Access Journals (Sweden)

    Vladan Milić

    2009-11-01

    Full Text Available With goal to examine effects of plyometric training program on development of jumping strength for volleyball players, it was organized an experimental research on pattern of 23 volleyball players from cadet team and 23 students from high-school. For needs of this research four tests are valid for estimation, jump in block with left and right leg and jump in spike with left and right leg. Experiment has been realized in the second part on conditional preparations, and lasted for six weeks with two or three trainings per week. Control group had physical education lessons at their schools twice a week. On the results of research and discussion we can say that the model of training we used for development of jumping as a basic factor in experimental group brought statistically bigger difference in improving jumping that it brought in control group.

  4. Broken Leg

    Science.gov (United States)

    ... the leg, which can result in a fracture. Stress fractures outside of sport situations are more common in people who have: ... shoes. Choose the appropriate shoe for your favorite sports or activities. And ... can prevent stress fractures. Rotate running with swimming or biking. If ...

  5. A Three-Phase Four-Leg Inverter-Based Active Power Filter for Unbalanced Current Compensation Using a Petri Probabilistic Fuzzy Neural Network

    Directory of Open Access Journals (Sweden)

    Kuang-Hsiung Tan

    2017-12-01

    Full Text Available A three-phase four-leg inverter-based shunt active power filter (APF is proposed to compensate three-phase unbalanced currents under unbalanced load conditions in grid-connected operation in this study. Since a DC-link capacitor is required on the DC side of the APF to release or absorb the instantaneous apparent power, the regulation control of the DC-link voltage of the APF is important especially under load variation. In order to improve the regulation control of the DC-link voltage of the shunt APF under variation of three-phase unbalanced load and to compensate the three-phase unbalanced currents effectively, a novel Petri probabilistic fuzzy neural network (PPFNN controller is proposed to replace the traditional proportional-integral (PI controller in this study. Furthermore, the network structure and online learning algorithms of the proposed PPFNN are represented in detail. Finally, the effectiveness of the three-phase four-leg inverter-based shunt APF with the proposed PPFNN controller for the regulation of the DC-link voltage and compensation of the three-phase unbalanced current has been demonstrated by some experimental results.

  6. Night Leg Cramps

    Science.gov (United States)

    Symptoms Night leg cramps By Mayo Clinic Staff Night leg cramps, also called nocturnal leg cramps, are painful, involuntary contractions or spasms of muscles in your legs, usually occurring when you're in bed. Night ...

  7. Leg Injuries and Disorders

    Science.gov (United States)

    Your legs are made up of bones, blood vessels, muscles, and other connective tissue. They are important for motion ... falling, or having an accident can damage your legs. Common leg injuries include sprains and strains, joint ...

  8. Peripheral artery disease - legs

    Science.gov (United States)

    Peripheral vascular disease; PVD; PAD; Arteriosclerosis obliterans; Blockage of leg arteries; Claudication; Intermittent claudication; Vaso-occlusive disease of the legs; Arterial insufficiency of ...

  9. Successful Multi-Leg Completion of KS-13 ML-1 & Increased Power Generation of Puna Geothermal Venture (PGV), Hawai'i

    Science.gov (United States)

    Drakos, P. S.; Spielman, P.; Peters, B.

    2017-12-01

    Located in the Puna district on the Big Island in Hawaii, Puna Geothermal Venture (PGV) is the only geothermal power plant in the state. PGV is comprised of two air-cooled power plants with a total generating capacity of 38 MW. Commercial operation commenced in 1993 and the project was acquired by Ormat in June 2004. Over the years, generation has increased by upgrading the plant through resource development and with the addition of a bottoming OEC (Ormat Energy Converter) in 2011. The geothermal reservoir at PGV is hosted within a step-over along the axis of the Kilauea Lower East Rift Zone (LERZ). Subsurface permeability at PGV is controlled by sub-vertical and rift-parallel fractures/faults and dike swarms which are the result of active tectonic dilation across the rift and shallow volcanic activity related to Kilauea. At PGV, the location and attitude of these fractures are well constrained at depth by drilling to be orientated at N63°E and dipping at 5° NW. These fractures are aligned en-echelon and form a major left-step along the rift axis which results in a localized zone of enhanced dilation. In 2016, a program was initiated to increase injection capacity and enthalpy in the PGV wellfield. Existing injection well KS-13 was selected as a candidate for re-drill based on a comprehensive resource model and reservoir modeling predictions. KS-13 ML1 was designed as a multi-leg completion from the existing KS-13 well, whereby the final completion is a forked well composed of the original wellbore and the newly completed second wellbore. The target area for the new multi-leg (ML) were large aperture, steeply dipping fractures associated with the 1955 eruptive fissure. Well KS-13 ML1 was drilled using PGV's Rig and a retrievable whipstock to mill a casing exit window. With the original wellbore temporarily plugged, a multi-rate water loss test was performed and an injectivity of 6 gpm/psi was measured. Following the removal of the whipstock ramp and packer from

  10. The effects of anthropometry and leg muscle power on drive and transition phase of acceleration: a longitudinal study on young soccer players.

    Science.gov (United States)

    Nikolaidis, Pantelis T; Ingebrigtsen, Jorgen; Jeffreys, Ian

    2016-10-01

    The aim of this study was to examine the effect of anthropometry and leg muscle power on accelerative ability and its phases (drive and transition). Thirty-six soccer players (age 12.4±1.2 years, body mass 49.9±8.9 kg and height 154.2±10.3 cm) were tested twice, in the beginning and in the end of competitive season, for anthropometric characteristics, countermovement jump and 20-meter acceleration (split 0-10 meters and 10-20 meters, indices of drive and transition, respectively). The soccer players were grouped according to seasonal changes in 20-meter acceleration (Δacc) in responders (Δacc≤-0.10 s), control (-0.05≤Δacc≤0.08 s) and non-responders (Δacc≥0.10 s). Compared with the non-responders at baseline, the responders were younger (-2.0 years [-2.8;-1.1]), shorter (-10.1 cm [-19.4;-0.7]), with higher body fat percentage (7.7% [2.7%;12.6%]) and fat mass (4.1 kg [0.7;7.4]), and lower performance in the countermovement jump (-8.9 cm [-13.9;-4.0]) and 20 m acceleration (0.63 s [0.39;0.87]); during the season they had smaller body mass gain (-2.8 kg [-5.4;-0.1]), decreased Body Mass Index (BMI, -1.0 kg/m2 [-1.9;0]) and greater improvement in the 20-meter acceleration (-0.33 s [-0.38;-0.28]). The effect size for these between-group differences was large (η2≥0.18). The Δacc and Δ10-20 were moderately correlated with body mass difference (r=0.48 and r=0.53, P<0.01, respectively) and ΔBMI (r=0.50 and r=0.51, P<0.01, respectively), whereas the Δ0-10 was correlated with ΔBMI (r=0.34, P<0.05) and ΔCMJ (r=-0.34, P<0.05). The findings indicated that the changes in body mass had the largest effect on changes in accelerative ability and on both two phases (drive and transition). On the contrary, changes in leg muscle power had impact only on the drive phase of the acceleration.

  11. Design of a Four-Branch LCL-Type Grid-Connecting Interface for a Three-Phase, Four-Leg Active Power Filter

    Directory of Open Access Journals (Sweden)

    Wu Cao

    2015-02-01

    Full Text Available Compared with the three-phase, two-split-capacitor active power filter (3P2C-APF, the three-phase, four-leg active power filter (3P4L-APF has been widely used in three-phase, four-wire grid utility for power quality control due to its numerous advantages, such as higher current output capability, particularly in phase N, lower current and easier voltage control on the DC-side. However, designing the grid-connecting interface, which is between the voltage source converter (VSC and grid utility, is rather difficult due to the higher requirement for current ripple filtering in phase N, cross-coupling in four phases and lack of relevant design methodology and specification. In this paper, a four-branch LCL-type (4B-LCL grid-connecting interface is proposed for 3P4L-APF, which features better current ripple filtering performance without decreasing the current output capability in all phases. First, this paper describes the mathematical models of 4B-LCL in the fully-complex-vector form from the zero and non-zero sequence perspective, resulting in two independent and uniform equivalent circuits without cross coupling terms. Then, the 4B-LCL parameter design method based on the most comprehensive performance index is proposed, including three main stages as the specification: performance index requirement determination, fulfillment of that requirement, and verification. Finally, the validity and effectiveness of the proposed design are proven by the simulated and experimental results of a 3P4L-APF with 4B-LCL.

  12. Active and Inactive Leg Hemodynamics during Sequential Single-Leg Interval Cycling.

    Science.gov (United States)

    Gordon, Nicole; Abbiss, Chris R; Ihsan, Mohammed; Maiorana, Andrew J; Peiffer, Jeremiah J

    2018-01-11

    Leg order during sequential single-leg cycling (i.e. exercising both legs independently within a single session) may affect local muscular responses potentially influencing adaptations. This study examined the cardiovascular and skeletal muscle hemodynamic responses during double-leg and sequential single-leg cycling. Ten young healthy adults (28 ± 6 y) completed six 1-min double-leg intervals interspersed with one minute of passive recovery and, on a separate occasion, 12 (six with one leg followed by six with the other leg) 1-min single-leg intervals interspersed with one minute of passive recovery. Oxygen consumption, heart rate, blood pressure, muscle oxygenation, muscle blood volume and power output were measured throughout each session. Oxygen consumption, heart rate and power output were not different between sets of single-leg intervals but the average of both sets was lower than the double-leg intervals. Mean arterial pressure was higher during double-leg compared with sequential single-leg intervals (115 ± 9 mmHg vs. 104 ± 9 mmHg; p<0.05) and higher during the initial compared with second set of single-leg intervals (108 ± 10 mmHg vs. 101 ± 10 mmHg; p<0.05). The increase in muscle blood volume from baseline was similar between the active single-leg and double-leg (267 ± 150 μM[BULLET OPERATOR]cm vs. 214 ± 169 μM[BULLET OPERATOR]cm; p=0.26). The pattern of change in muscle blood volume from the initial to second set of intervals was significantly different (p<0.05) when the leg was active in the initial (-52.3 ± 111.6%) compared with second set (65.1 ± 152.9%). These data indicate that the order in which each leg performs sequential single-leg cycling influences the local hemodynamic responses, with the inactive muscle influencing the stimulus experienced by the contralateral leg.

  13. Promethus Hot Leg Piping Concept

    International Nuclear Information System (INIS)

    AM Girbik; PA Dilorenzo

    2006-01-01

    The Naval Reactors Prime Contractor Team (NRPCT) recommended the development of a gas cooled reactor directly coupled to a Brayton energy conversion system as the Space Nuclear Power Plant (SNPP) for NASA's Project Prometheus. The section of piping between the reactor outlet and turbine inlet, designated as the hot leg piping, required unique design features to allow the use of a nickel superalloy rather than a refractory metal as the pressure boundary. The NRPCT evaluated a variety of hot leg piping concepts for performance relative to SNPP system parameters, manufacturability, material considerations, and comparison to past high temperature gas reactor (HTGR) practice. Manufacturability challenges and the impact of pressure drop and turbine entrance temperature reduction on cycle efficiency were discriminators between the piping concepts. This paper summarizes the NRPCT hot leg piping evaluation, presents the concept recommended, and summarizes developmental issues for the recommended concept

  14. Leg lengthening - slideshow

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/presentations/100127.htm Leg lengthening - series—Indications To use the sharing features ... with lengthening procedures are the bones of the leg, the tibia and the femur. Surgical treatment may ...

  15. Arterial bypass leg - slideshow

    Science.gov (United States)

    ... medlineplus.gov/ency/presentations/100155.htm Arterial bypass leg - series—Normal anatomy To use the sharing features ... Overview The arteries which supply blood to the leg originate from the aorta and iliac vessels. Review ...

  16. Leg lengthening and shortening

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/002965.htm Leg lengthening and shortening To use the sharing features on this page, please enable JavaScript. Leg lengthening and shortening are types of surgery to ...

  17. Foot, leg, and ankle swelling

    Science.gov (United States)

    Swelling of the ankles - feet - legs; Ankle swelling; Foot swelling; Leg swelling; Edema - peripheral; Peripheral edema ... Foot, leg, and ankle swelling is common when the person also: Is overweight Has a blood clot in the leg Is older Has ...

  18. RELAP5 simulation of a large break Loss of Coolant Accident (LOCA) in the hot leg of the primary system in Angra 2 nuclear power plant

    International Nuclear Information System (INIS)

    Andrade, Delvonei Alves de; Sabundjian, Gaiane

    2004-01-01

    The objective of this work is to present the simulation of a large break loss of coolant accident - LBLOCA in the hot leg of the primary loop in Angra 2, with RELAP5/MOD3.2.2g code. This accident is described in the Final Safety Report Analysis of Angra 2 - FSAR and consists basically of the hot leg total break, in loop 20 of the plant. The area considered for the rupture is 4480 cm 2 , which corresponds to 100% of the pipe flow area. Besides, this work also has the objective of verifying the efficiency of the emergency core coolant system - ECCS in case of accidents and transients. The thermal-hydraulic processes inherent to the accident phenomenology, such as hot leg vaporization and consequently core vaporization causing an inappropriate flow distribution in the reactor core, can lead to a reduction in the liquid level, until the ECCS is capable to reflood it

  19. Venous leg ulcers.

    Science.gov (United States)

    Nelson, E Andrea; Adderley, Una

    2016-01-15

    Leg ulcers usually occur secondary to venous reflux or obstruction, but 20% of people with leg ulcers have arterial disease, with or without venous disorders. Between 1.5 and 3.0 in 1000 people have active leg ulcers. Prevalence increases with age to about 20 in 1000 people aged over 80 years. We conducted a systematic overview, aiming to answer the following clinical questions: What are the effects of treatments for venous leg ulcers? What are the effects of organisational interventions for venous leg ulcers? What are the effects of advice about self-help interventions in people receiving usual care for venous leg ulcers? What are the effects of interventions to prevent recurrence of venous leg ulcers? We searched: Medline, Embase, The Cochrane Library, and other important databases up to March 2014 (Clinical Evidence overviews are updated periodically; please check our website for the most up-to-date version of this overview). At this update, searching of electronic databases retrieved 116 studies. After deduplication and removal of conference abstracts, 63 records were screened for inclusion in the overview. Appraisal of titles and abstracts led to the exclusion of 43 studies and the further review of 20 full publications. Of the 20 full articles evaluated, four systematic reviews were updated and four RCTs were added at this update. We performed a GRADE evaluation for 23 PICO combinations. In this systematic overview, we categorised the efficacy for 13 interventions based on information about the effectiveness and safety of advice to elevate leg, advice to keep leg active, compression stockings for prevention of recurrence, compression bandages and stockings to treat venous leg ulcers, laser treatment (low level), leg ulcer clinics, pentoxifylline, skin grafting, superficial vein surgery for prevention of recurrence, superficial vein surgery to treat venous leg ulcers, therapeutic ultrasound, and topical negative pressure.

  20. Leg extension power is a pre-disaster modifiable risk factor for post-traumatic stress disorder among survivors of the Great East Japan Earthquake: a retrospective cohort study.

    Science.gov (United States)

    Momma, Haruki; Niu, Kaijun; Kobayashi, Yoritoshi; Huang, Cong; Otomo, Atsushi; Chujo, Masahiko; Tadaura, Hiroko; Nagatomi, Ryoichi

    2014-01-01

    Post-traumatic stress disorder (PTSD) is a common psychological problem following natural disasters. Although pre-disaster risk factors are important for early detection and proactive support, the examination of such has been limited to sociodemographic factors, which were largely unaffected by the disasters. We examined the association between pre-disaster physical functioning and lifestyle and PTSD symptoms five months after the earthquake in the Great East Japan Earthquake survivors who were participating in a pre-existing cohort study. We designed a retrospective cohort study of a cooperative association in Sendai from August 2010 to August 2011. In 2010, lifestyle, physical condition, and sociodemographic factors were examined by self-reported questionnaires completed by 522 employees of this organization. We also measured the leg extension power of all the participants. PTSD symptoms were evaluated by the Japanese version of the Impact of Event Scale-Revised (IES-R-J) following the earthquake of 2011. In multivariate linear regression analysis, leg extension power (β = -0.128, P = 0.025), daily drinking (β  = 0.203, P = 0.006), and depressive symptoms (β  = 0.139, P = 0.008) were associated with total score of the IES-R-J among men. Moreover, for the IES-R-J subscale, leg extension power was also negatively associated with Intrusion (β = -0.114, P = 0.045) and Hyperarousal (β = -0.163, P = 0.004) after adjusting for all other significant variables. For women, hypertension (β  = 0.226, P = 0.032) and depressive symptoms (β  = 0.205, P = 0.046) were associated with the total score of the IES-R-J. Leg extension power is a potentially modifiable pre-disaster risk factor among men for attenuating the severity of PTSD symptoms associated with great disasters such as the Great East Japan Earthquake among men.

  1. Leg extension power is a pre-disaster modifiable risk factor for post-traumatic stress disorder among survivors of the Great East Japan Earthquake: a retrospective cohort study.

    Directory of Open Access Journals (Sweden)

    Haruki Momma

    Full Text Available BACKGROUND: Post-traumatic stress disorder (PTSD is a common psychological problem following natural disasters. Although pre-disaster risk factors are important for early detection and proactive support, the examination of such has been limited to sociodemographic factors, which were largely unaffected by the disasters. We examined the association between pre-disaster physical functioning and lifestyle and PTSD symptoms five months after the earthquake in the Great East Japan Earthquake survivors who were participating in a pre-existing cohort study. METHODS: We designed a retrospective cohort study of a cooperative association in Sendai from August 2010 to August 2011. In 2010, lifestyle, physical condition, and sociodemographic factors were examined by self-reported questionnaires completed by 522 employees of this organization. We also measured the leg extension power of all the participants. PTSD symptoms were evaluated by the Japanese version of the Impact of Event Scale-Revised (IES-R-J following the earthquake of 2011. RESULTS: In multivariate linear regression analysis, leg extension power (β = -0.128, P = 0.025, daily drinking (β  = 0.203, P = 0.006, and depressive symptoms (β  = 0.139, P = 0.008 were associated with total score of the IES-R-J among men. Moreover, for the IES-R-J subscale, leg extension power was also negatively associated with Intrusion (β = -0.114, P = 0.045 and Hyperarousal (β = -0.163, P = 0.004 after adjusting for all other significant variables. For women, hypertension (β  = 0.226, P = 0.032 and depressive symptoms (β  = 0.205, P = 0.046 were associated with the total score of the IES-R-J. CONCLUSIONS: Leg extension power is a potentially modifiable pre-disaster risk factor among men for attenuating the severity of PTSD symptoms associated with great disasters such as the Great East Japan Earthquake among men.

  2. Dynamically Stable Legged Locomotion.

    Science.gov (United States)

    1983-01-27

    balanced itself in 31) using a tabular ctontrol sclwnme. With only thUiee actuated degrees it used a shuffling gait to balance that reminds one of Charlie ... Chaplin . * The present study explores the control of a physical one-legged hopping machine. The objective of using a machine with only one leg was to

  3. Lyden-af-Leg

    DEFF Research Database (Denmark)

    Toft, Herdis

    Præsentation af seniorforsker-projekt Lyden-af-Leg i et traderingsperspektiv og med indledende fokus på YouTube som traderings-platform.......Præsentation af seniorforsker-projekt Lyden-af-Leg i et traderingsperspektiv og med indledende fokus på YouTube som traderings-platform....

  4. Evaluation of a postulated loss of coolant accident (LOCA) due to a 160 cm2 break in a cold leg of Angra 2 nuclear power plant

    International Nuclear Information System (INIS)

    Azevedo, Carlos Vicente Goulart de; Palmieri, Elcio Tadeu; Aronne, Ivan Dionysio

    2002-01-01

    The development of a qualified full nodalization of Angra2 NPP for RELAP5/Mod 3.2.2 gamma, aiming at the evaluation of a comprehensive number of accidents and transients, thus providing suitable safety analysis support for licensing purposes, is being carried out within the framework of CNEN internal technical cooperation, involving some of its institutes (CDTN, IPEN and IEN) and the Reactors Coordination (CODRE). This work presents a simulation of a postulated Angra2 small cold leg break loss of coolant accident (SBLOCA). A 160 cm 2 break is supposed to occur at one cold leg between the main coolant pump and the reactor vessel and is described in the Angra2 Final Safety Analysis Report, section 15.6.4.1.3.4. The simulation of several types of transients and accidents is necessary to verify the adequate performance of the modeled logic and systems. In general, the analysis of such and accident allows to demonstrate the safety Injection System performance and the reliable transition between the high pressure safety injection, the accumulator injection and the residual heat removal phases. Furthermore, it is assumed that some components are out of service due to fail or repair in order to make a conservative analysis. The results showed a compatible behavior of the molded systems and that the simulated Emergency Core Cooling System was able to provide sufficient cooling to avoid any damage to the core. (author)

  5. On the biomimetic design of agile-robot legs.

    Science.gov (United States)

    Garcia, Elena; Arevalo, Juan Carlos; Muñoz, Gustavo; Gonzalez-de-Santos, Pablo

    2011-01-01

    The development of functional legged robots has encountered its limits in human-made actuation technology. This paper describes research on the biomimetic design of legs for agile quadrupeds. A biomimetic leg concept that extracts key principles from horse legs which are responsible for the agile and powerful locomotion of these animals is presented. The proposed biomimetic leg model defines the effective leg length, leg kinematics, limb mass distribution, actuator power, and elastic energy recovery as determinants of agile locomotion, and values for these five key elements are given. The transfer of the extracted principles to technological instantiations is analyzed in detail, considering the availability of current materials, structures and actuators. A real leg prototype has been developed following the biomimetic leg concept proposed. The actuation system is based on the hybrid use of series elasticity and magneto-rheological dampers which provides variable compliance for natural motion. From the experimental evaluation of this prototype, conclusions on the current technological barriers to achieve real functional legged robots to walk dynamically in agile locomotion are presented.

  6. On the Biomimetic Design of Agile-Robot Legs

    Directory of Open Access Journals (Sweden)

    Pablo Gonzalez-de-Santos

    2011-11-01

    Full Text Available The development of functional legged robots has encountered its limits in human-made actuation technology. This paper describes research on the biomimetic design of legs for agile quadrupeds. A biomimetic leg concept that extracts key principles from horse legs which are responsible for the agile and powerful locomotion of these animals is presented. The proposed biomimetic leg model defines the effective leg length, leg kinematics, limb mass distribution, actuator power, and elastic energy recovery as determinants of agile locomotion, and values for these five key elements are given. The transfer of the extracted principles to technological instantiations is analyzed in detail, considering the availability of current materials, structures and actuators. A real leg prototype has been developed following the biomimetic leg concept proposed. The actuation system is based on the hybrid use of series elasticity and magneto-rheological dampers which provides variable compliance for natural motion. From the experimental evaluation of this prototype, conclusions on the current technological barriers to achieve real functional legged robots to walk dynamically in agile locomotion are presented.

  7. On the Biomimetic Design of Agile-Robot Legs

    Science.gov (United States)

    Garcia, Elena; Arevalo, Juan Carlos; Muñoz, Gustavo; Gonzalez-de-Santos, Pablo

    2011-01-01

    The development of functional legged robots has encountered its limits in human-made actuation technology. This paper describes research on the biomimetic design of legs for agile quadrupeds. A biomimetic leg concept that extracts key principles from horse legs which are responsible for the agile and powerful locomotion of these animals is presented. The proposed biomimetic leg model defines the effective leg length, leg kinematics, limb mass distribution, actuator power, and elastic energy recovery as determinants of agile locomotion, and values for these five key elements are given. The transfer of the extracted principles to technological instantiations is analyzed in detail, considering the availability of current materials, structures and actuators. A real leg prototype has been developed following the biomimetic leg concept proposed. The actuation system is based on the hybrid use of series elasticity and magneto-rheological dampers which provides variable compliance for natural motion. From the experimental evaluation of this prototype, conclusions on the current technological barriers to achieve real functional legged robots to walk dynamically in agile locomotion are presented. PMID:22247667

  8. RESTLESS LEGS SYNDROME

    Directory of Open Access Journals (Sweden)

    Dmitriy Valer'evich Artem'ev

    2009-01-01

    Full Text Available The paper describes the epidemiology, etiology, pathogenesis, clinical picture, diagnosis, differential diagnosis, and treatment of restless legs syndrome. Recommendations are given how to choose therapeutic modalities and drugs in relation to different factors.

  9. Restless legs syndrome.

    Science.gov (United States)

    Venkateshiah, Saiprakash B; Ioachimescu, Octavian C

    2015-07-01

    Restless legs syndrome is a common sensorimotor disorder characterized by an urge to move, and associated with uncomfortable sensations in the legs (limbs). Restless legs syndrome can lead to sleep-onset or sleep-maintenance insomnia, and occasionally excessive daytime sleepiness, all leading to significant morbidity. Brain iron deficiency and dopaminergic neurotransmission abnormalities play a central role in the pathogenesis of this disorder, along with other nondopaminergic systems, although the exact mechanisms are still. Intensive care unit patients are especially vulnerable to have unmasking or exacerbation of restless legs syndrome because of sleep deprivation, circadian rhythm disturbance, immobilization, iron deficiency, and use of multiple medications that can antagonize dopamine. Published by Elsevier Inc.

  10. Analysis of the body mass index and leg profiles of Asian women after total leg sculpture.

    Science.gov (United States)

    Tsai, Feng-Chou; Chen, Chien-Hao; Lin, Chan-Yi; Ho, Li-Yung

    2009-08-01

    In addition to the conventional methods used to improve leg contours, total leg sculpture, including liposuction, selective neurectomy, and transilluminated powered phlebectomy, provides a one-time solution of leg contour problems, which is a major aesthetic concern among Asian women. The authors present the postoperative results of total leg sculpture and determine any significance and correlation between the leg variables and body mass index by statistical analysis. Thirty female patients who underwent total leg sculpture between 2005 and 2008 were included in the study, and prospective analysis of the patients' data was performed during a follow-up period of 1 year. Local measurement variables and body mass index were recorded, and the correlation between them was determined by Pearson's correlation and regression analysis. A paired t test was used to compare the postoperative outcomes. Subjectively, all patient results were satisfactory. There were significant differences between preoperative and postoperative measurements for all variables for total leg sculpture. Body mass index was strongly correlated with all leg indexes, and there was a significant positive correlation between the index and variables related to the buttocks and upper thigh. The satisfactory postoperative leg variables were buttocks circumference (87.85 cm), thigh circumference (T60, 44.20 cm), maximal calf circumference (32.24 cm), and calf ratio (0.78). Each preoperative body mass index increment represents a 0.3 percent circumference improvement around the buttocks after surgery. No obvious morbidities or long-term hospital stays were noted. Total leg sculpture provides a combined aesthetic solution for improving limb contours with minimal morbidity. Patients with larger body mass index values exhibit better aesthetic improvement than those with smaller values.

  11. Comparative study of reference currents and DC bus voltage control for Three-Phase Four-Wire Four-Leg SAPF to compensate harmonics and reactive power with 3D SVM.

    Science.gov (United States)

    Chebabhi, A; Fellah, M K; Kessal, A; Benkhoris, M F

    2015-07-01

    In this paper the performances of three reference currents and DC bus voltage control techniques for Three-Phase Four-Wire Four-Leg SAPF are compared for balanced and unbalanced load conditions. The main goals are to minimize the harmonics, reduce the magnitude of neutral current, eliminate the zero-sequence current components caused by single-phase nonlinear loads and compensate the reactive power, and on the other hand improve performances such as robustness, stabilization, trajectory pursuit, and reduce time response. The three techniques are analyzed mathematically and simulation results are compared. The techniques considered for comparative study are the PI Control, Sliding Mode Control and the Backstepping Control. Synchronous reference frame theory (SRF) in the dqo-axes is used to generate the reference currents, of the inverter. Copyright © 2015 ISA. Published by Elsevier Ltd. All rights reserved.

  12. Venous leg ulcers.

    Science.gov (United States)

    Nelson, E Andrea

    2011-12-21

    Leg ulcers usually occur secondary to venous reflux or obstruction, but 20% of people with leg ulcers have arterial disease, with or without venous disorders. Between 1.5 and 3.0/1000 people have active leg ulcers. Prevalence increases with age to about 20/1000 in people aged over 80 years. We conducted a systematic review and aimed to answer the following clinical questions: What are the effects of standard treatments, adjuvant treatments, and organisational interventions for venous leg ulcers? What are the effects of advice about self-help interventions in people receiving usual care for venous leg ulcers? What are the effects of interventions to prevent recurrence of venous leg ulcers? We searched: Medline, Embase, The Cochrane Library, and other important databases up to June 2011 (Clinical Evidence reviews are updated periodically; please check our website for the most up-to-date version of this review). We included harms alerts from relevant organisations such as the US Food and Drug Administration (FDA) and the UK Medicines and Healthcare products Regulatory Agency (MHRA). We found 101 systematic reviews, RCTs, or observational studies that met our inclusion criteria. We performed a GRADE evaluation of the quality of evidence for interventions. In this systematic review we present information relating to the effectiveness and safety of the following interventions: compression bandages and stockings, cultured allogenic (single or bilayer) skin replacement, debriding agents, dressings (cellulose, collagen, film, foam, hyaluronic acid-derived, semi-occlusive alginate), hydrocolloid (occlusive) dressings in the presence of compression, intermittent pneumatic compression, intravenous prostaglandin E1, larval therapy, laser treatment (low-level), leg ulcer clinics, multilayer elastic system, multilayer elastomeric (or non-elastomeric) high-compression regimens or bandages, oral treatments (aspirin, flavonoids, pentoxifylline, rutosides, stanozolol, sulodexide

  13. Inter-tester Reliability of the Hand-held dynamometer and the Leg Extensor Power Rig applied on Patients after Total Hip Arthroplasty

    DEFF Research Database (Denmark)

    Mikkelsen, Lone Ramer; Mechlenburg, Inger; Petersen, Annemette Krintel

    INTRODUCTION: Rehabilitation has an increasing focus on intensive resistance training early after joint replacement (1,2). This increases the requests for measuring changes in the muscle strength and muscle power over time. Hand-held dynamometer (HHD) is a device used to measure isometric muscle...

  14. Inter-tester Reliability of the Hand-held dynamometer and the Leg Extensor Power Rig applied on Patients after Total Hip Arthroplasty

    DEFF Research Database (Denmark)

    Mikkelsen, Lone Ramer; Petersen, Annemette Krintel; Mikkelsen, Søren Søndergaard

    Background: Rehabilitation has an increasing focus on intensive resistance training early after joint replacement. This increases the requests for measuring changes in the muscle strength and muscle power over time. Hand-held dynamometer (HHD) is a device used to measure isometric muscle strength...

  15. A new balancing three level three dimensional space vector modulation strategy for three level neutral point clamped four leg inverter based shunt active power filter controlling by nonlinear back stepping controllers.

    Science.gov (United States)

    Chebabhi, Ali; Fellah, Mohammed Karim; Kessal, Abdelhalim; Benkhoris, Mohamed F

    2016-07-01

    In this paper is proposed a new balancing three-level three dimensional space vector modulation (B3L-3DSVM) strategy which uses a redundant voltage vectors to realize precise control and high-performance for a three phase three-level four-leg neutral point clamped (NPC) inverter based Shunt Active Power Filter (SAPF) for eliminate the source currents harmonics, reduce the magnitude of neutral wire current (eliminate the zero-sequence current produced by single-phase nonlinear loads), and to compensate the reactive power in the three-phase four-wire electrical networks. This strategy is proposed in order to gate switching pulses generation, dc bus voltage capacitors balancing (conserve equal voltage of the two dc bus capacitors), and to switching frequency reduced and fixed of inverter switches in same times. A Nonlinear Back Stepping Controllers (NBSC) are used for regulated the dc bus voltage capacitors and the SAPF injected currents to robustness, stabilizing the system and to improve the response and to eliminate the overshoot and undershoot of traditional PI (Proportional-Integral). Conventional three-level three dimensional space vector modulation (C3L-3DSVM) and B3L-3DSVM are calculated and compared in terms of error between the two dc bus voltage capacitors, SAPF output voltages and THDv, THDi of source currents, magnitude of source neutral wire current, and the reactive power compensation under unbalanced single phase nonlinear loads. The success, robustness, and the effectiveness of the proposed control strategies are demonstrated through simulation using Sim Power Systems and S-Function of MATLAB/SIMULINK. Copyright © 2016 ISA. Published by Elsevier Ltd. All rights reserved.

  16. Validity and reliability of an iPhone App to assess time, velocity and leg power during a sit-to-stand functional performance test.

    Science.gov (United States)

    Ruiz-Cárdenas, Juan Diego; Rodríguez-Juan, Juan José; Smart, Rowan R; Jakobi, Jennifer M; Jones, Gareth R

    2018-01-01

    The purposes of this study were: (i) Analyze the concurrent validity and reliability of an iPhone App for measuring time, velocity and power during a single sit-to-stand (STS) test compared with measurements recorded from a force plate; and (ii) Evaluate the relationship between the iPhone App measures with age and functional performance. Forty-eight healthy individuals (age range: 26-81 years) were recruited. All participants completed a STS test on a force plate with the movement recorded on an iPhone 6 at 240 frames-per-second. Functional ability was also measured using isometric handgrip strength and self-paced walking time tests. Intraclass correlation coefficients (ICC), Pearson's correlation coefficient, Cronbach's alpha (α) and Bland-Altman plots with 95% confidence intervals (CI) were used to test validity and reliability between instruments. The results showed a good agreement between all STS measurement variables; time (ICC=0.864, 95%CI=0.77-0.92; α=0.926), velocity (ICC=0.912, 95%CI=0.85-0.95; α=0.953) and power (ICC=0.846, 95%CI=0.74-0.91; α=0.917) with no systematic bias between instruments for any variable analyzed. STS time, velocity and power derived from the iPhone App show moderate to strong associations with age (|r|=0.63-0.83) and handgrip strength (|r|=0.4-0.64) but not the walking test. The results of this study identify that this iPhone App is reliable for measuring STS and the derived values of time, velocity and power shows strong associations with age and handgrip strength. Copyright © 2017 Elsevier B.V. All rights reserved.

  17. ORTHOPEDIC LEG BRACE

    Science.gov (United States)

    Myers, William Neil (Inventor)

    2005-01-01

    Knee braces generally have been rigid in both the knee bending direction and in the knee straightening direction unless a manually operated release is incorporated in them to allow the knee to bend. Desirably a braced knee joint should effectively duplicate the compound, complex, actions of a normal knee. The key to knee braces is the knee joint housing. The housing herein carries a number of cam action pawls. with teeth adapted to engage the internal teeth of a ratchet ring mounted in the housing. Cam action return springs and the shape of the cam action pawl teeth allow rotation of the ratchet ring in a leg straightening direction while still supporting a load. The leg can then be extended during walking while at the same time being prevented by the cam action pawls from buckling in the knee bending direction.

  18. Legāti

    OpenAIRE

    Segliņa, Aiga

    2010-01-01

    Autore teorētiski analizē legāta jēdzienu testamentārās mantošanas ietvaros un atspoguļo praktiska pētījuma rezultātus. Teorētiskā daļa apskata legāta nodibināšanas formu un spēkā esamību, tā iegūšanu un atraidīšanu, izpildi un zaudēšanu, novēlējuma robežas un aprobežojumus. Pētījums veikts aptaujas veidā ar mērķi noskaidrot, cik liela Latvijas iedzīvotāju daļa apzinās legāta nodrošinātās priekšrocības testamentārajā mantošanā. Apskatīts notāra neitralitātes jautājums attiecībā pret mantošana...

  19. Interaction Between Leg Muscle Performance and Sprint Acceleration Kinematics

    Directory of Open Access Journals (Sweden)

    Lockie Robert G.

    2015-12-01

    Full Text Available This study investigated relationships between 10 m sprint acceleration, step kinematics (step length and frequency, contact and flight time, and leg muscle performance (power, stiffness, strength. Twenty-eight field sport athletes completed 10 m sprints that were timed and filmed. Velocity and step kinematics were measured for the 0-5, 5-10, and 0-10 m intervals to assess acceleration. Leg power was measured via countermovement jumps (CMJ, a fivebound test (5BT, and the reactive strength index (RSI defined by 40 cm drop jumps. Leg stiffness was measured by bilateral and unilateral hopping. A three-repetition maximum squat determined strength. Pearson’s correlations and stepwise regression (p ≤ 0.05 determined velocity, step kinematics, and leg muscle performance relationships. CMJ height correlated with and predicted velocity in all intervals (r = 0.40-0.54. The 5BT (5-10 and 0-10 m intervals and RSI (5-10 m interval also related to velocity (r = 0.37-0.47. Leg stiffness did not correlate with acceleration kinematics. Greater leg strength related to and predicted lower 0-5 m flight times (r = -0.46 to -0.51, and a longer 0-10 m step length (r = 0.38. Although results supported research emphasizing the value of leg power and strength for acceleration, the correlations and predictive relationships (r2 = 0.14-0.29 tended to be low, which highlights the complex interaction between sprint technique and leg muscle performance. Nonetheless, given the established relationships between speed, leg power and strength, strength and conditioning coaches should ensure these qualities are expressed during acceleration in field sport athletes.

  20. Interaction Between Leg Muscle Performance and Sprint Acceleration Kinematics.

    Science.gov (United States)

    Lockie, Robert G; Jalilvand, Farzad; Callaghan, Samuel J; Jeffriess, Matthew D; Murphy, Aron J

    2015-12-22

    This study investigated relationships between 10 m sprint acceleration, step kinematics (step length and frequency, contact and flight time), and leg muscle performance (power, stiffness, strength). Twenty-eight field sport athletes completed 10 m sprints that were timed and filmed. Velocity and step kinematics were measured for the 0-5, 5-10, and 0-10 m intervals to assess acceleration. Leg power was measured via countermovement jumps (CMJ), a five-bound test (5BT), and the reactive strength index (RSI) defined by 40 cm drop jumps. Leg stiffness was measured by bilateral and unilateral hopping. A three-repetition maximum squat determined strength. Pearson's correlations and stepwise regression (p ≤ 0.05) determined velocity, step kinematics, and leg muscle performance relationships. CMJ height correlated with and predicted velocity in all intervals (r = 0.40-0.54). The 5BT (5-10 and 0-10 m intervals) and RSI (5-10 m interval) also related to velocity (r = 0.37-0.47). Leg stiffness did not correlate with acceleration kinematics. Greater leg strength related to and predicted lower 0-5 m flight times (r = -0.46 to -0.51), and a longer 0-10 m step length (r = 0.38). Although results supported research emphasizing the value of leg power and strength for acceleration, the correlations and predictive relationships (r(2) = 0.14-0.29) tended to be low, which highlights the complex interaction between sprint technique and leg muscle performance. Nonetheless, given the established relationships between speed, leg power and strength, strength and conditioning coaches should ensure these qualities are expressed during acceleration in field sport athletes.

  1. Stable walking with asymmetric legs

    International Nuclear Information System (INIS)

    Merker, Andreas; Rummel, Juergen; Seyfarth, Andre

    2011-01-01

    Asymmetric leg function is often an undesired side-effect in artificial legged systems and may reflect functional deficits or variations in the mechanical construction. It can also be found in legged locomotion in humans and animals such as after an accident or in specific gait patterns. So far, it is not clear to what extent differences in the leg function of contralateral limbs can be tolerated during walking or running. Here, we address this issue using a bipedal spring-mass model for simulating walking with compliant legs. With the help of the model, we show that considerable differences between contralateral legs can be tolerated and may even provide advantages to the robustness of the system dynamics. A better understanding of the mechanisms and potential benefits of asymmetric leg operation may help to guide the development of artificial limbs or the design novel therapeutic concepts and rehabilitation strategies.

  2. Hot Leg Piping Materials Issues

    International Nuclear Information System (INIS)

    V. Munne

    2006-01-01

    With Naval Reactors (NR) approval of the Naval Reactors Prime Contractor Team (NRPCT) recommendation to develop a gas cooled reactor directly coupled to a Brayton power conversion system as the space nuclear power plant (SNPP) for Project Prometheus (References a and b) the reactor outlet piping was recognized to require a design that utilizes internal insulation (Reference c). The initial pipe design suggested ceramic fiber blanket as the insulation material based on requirements associated with service temperature capability within the expected range, very low thermal conductivity, and low density. Nevertheless, it was not considered to be well suited for internal insulation use because its very high surface area and proclivity for holding adsorbed gases, especially water, would make outgassing a source of contaminant gases in the He-Xe working fluid. Additionally, ceramic fiber blanket insulating materials become very friable after relatively short service periods at working temperatures and small pieces of fiber could be dislodged and contaminate the system. Consequently, alternative insulation materials were sought that would have comparable thermal properties and density but superior structural integrity and greatly reduced outgassing. This letter provides technical information regarding insulation and materials issues for the Hot Leg Piping preconceptual design developed for the Project Prometheus space nuclear power plant (SNPP)

  3. Leg cramps and restless legs syndrome during pregnancy.

    Science.gov (United States)

    Hensley, Jennifer G

    2009-01-01

    Sleep disturbance during pregnancy can result in excessive daytime sleepiness, diminished daytime performance, inability to concentrate, irritability, and the potential for an increased length of labor and increased risk of operative birth. Sleep disturbance may be the result of a sleep disorder, such as leg cramps, a common yet benign disorder, or restless legs syndrome, a sensorimotor disorder. Both disrupt sleep, are distressing to the pregnant woman, and mimic one another and other serious disorders. During pregnancy, up to 30% of women can be affected by leg cramps, and up to 26% can be affected by restless legs syndrome.

  4. [Swollen leg with blisters].

    Science.gov (United States)

    Rafeiner, Ph; Templeton, A J; Vonesch, H J

    2005-10-05

    We report the case of a 84-year-old woman suffering from strong pain in her right leg initially resembling thrombosis of deep veins. Eight hours after admission a superficial blister developed at the calf with following hemorrhagic aspect and spontanous eruption of clear yellowish fluid. Later on a new blister appeared at the thigh. The patient died 33 hours after admission of streptococcal toxic shock syndrome. The latter was based on a necrotizing fasciitis. Streptoccus pyogenes (group A) could be cultivated from the blood and fluid of the blister. We discuss the clinical presentation of necrotizing fasciitis with "pain out of proportion" as characteristic complaint and the appropriate management.

  5. Textiloma in the leg

    Directory of Open Access Journals (Sweden)

    Patel Amol

    2007-01-01

    Full Text Available Textiloma is defined as a tumor formed due to retained gauze. It is rarely reported in the musculoskeletal system. We are presenting a case with a soft tissue swelling over the lateral aspect of the lower third of the leg, come for implant removal of the distal tibia and fibular fracture. We removed the soft tissue mass enbloc thinking it to be a benign tumor. On cutting the mass on the operation table, a gauze piece encased by fibrous tissue was found. Textiloma can present as tumoral forms and can mimic as a pseudo-tumor.

  6. Radial deformations of working cylinder of hydraulic Legs depending on their extension

    OpenAIRE

    Buyalich, Gennadiy Daniilovich; Buyalich, K. G.; Voyevodin, V. V.

    2015-01-01

    Current methods of calculation of parameters of hydraulic legs of powered supports are in most cases analytical and do not consider all complex of factors. Finite element model was developed to study this problem and used to analyze the influence of hydraulic legs extension on radial deformations of cylinder of different producers of powered supports at variation of hydraulic fluid pressure. It was revealed that radial deformations of cylinders along the axis of hydraulic legs increase in mag...

  7. Differences in take-off leg kinetics between horizontal and vertical single-leg rebound jumps.

    Science.gov (United States)

    Kariyama, Yasushi; Hobara, Hiroaki; Zushi, Koji

    2017-06-01

    This study aimed to clarify the differences between the horizontal single-leg rebound jump (HJ) and vertical single-leg rebound jump (VJ) in terms of three-dimensional joint kinetics for the take-off leg, while focusing on frontal and transverse plane movements. Eleven male track and field athletes performed HJ and VJ. Kinematic and kinetic data were calculated using data recorded with a motion capture system and force platforms. The hip abduction torque, trunk lateral flexion torque (flexion for the swing-leg side), hip external and internal torque, trunk rotational torque, and the powers associated with these torques were larger when performing HJ because of resistance to the impact ground reaction force and because of pelvic and posture control. Pelvic rotation was noted in HJ, and this was controlled not only by the hip and trunk joint torque from the transverse plane but also by the hip abduction torque. Therefore, hip and trunk joint kinetics in the frontal and transverse plane play an important role in a single-leg jump, regardless of the jumping direction, and may also play a more important role in HJ than in VJ.

  8. Differentiating nocturnal leg cramps and restless legs syndrome.

    Science.gov (United States)

    Rana, Abdul Qayyum; Khan, Fatima; Mosabbir, Abdullah; Ondo, William

    2014-07-01

    Leg pain and discomfort are common complaints in any primary physician's clinic. Two common causes of pain or discomfort in legs are nocturnal leg cramps (NLC) and restless leg syndrome (RLS). NLC present as painful and sudden contractions mostly in part of the calf. Diagnosis of NLC is mainly clinical and sometimes involves investigations to rule out other mimics. RLS is a condition characterized by the discomfort or urge to move the lower limbs, which occurs at rest or in the evening/night. The similarity of RLS and leg cramps poses the issue of errors in diagnosing and differentiating the two. In this paper we review the pathopysiology of each entity and their diagnosis as well as treatment. The two conditions are then compared to appreciate the differences and similarities. Finally, suggestions are recommended for complete assessment.

  9. Klinefelter Syndrome With Leg Ulcers

    Directory of Open Access Journals (Sweden)

    Narendra G

    1999-01-01

    Full Text Available Leg ulcers are frequently caused by venous insufficiency, arterial insufficiency, neuropathy, or a combination of these factors. Klinefelter syndrome in association with chronic leg ulcers have been reported earlier. We report a case of Klinefelter syndrome with non- healing ulcer. The diagnosis of the Klinefelter syndrome was confirmed by karyotyping.

  10. Immobilization tests and periodic leg movements in sleep for the diagnosis of restless leg syndrome.

    Science.gov (United States)

    Montplaisir, J; Boucher, S; Nicolas, A; Lesperance, P; Gosselin, A; Rompré, P; Lavigne, G

    1998-03-01

    Patients with restless leg syndrome (RLS) complain of motor restlessness, usually occurring while they rest in the evening. Two immobilization tests have been described to assess leg restlessness in these patients. In the first test, the patient sits in bed with his or her legs outstretched while electromyograms are recorded from right and left anterior tibialis muscles for an hour (Suggested Immobilization Test [SIT]); in the second test, the legs are immobilized in a stretcher (Forced Immobilization Test [FIT]). In the current study, the SIT and the FIT were compared in patients with RLS and normal control subjects matched for age and sex. More leg movements were seen in patients than in controls during immobilization tests, especially the SIT. These movements were periodic, occurring at a frequency of approximately one every 12 seconds. The SIT (index > 40) was found to discriminate between RLS and control subjects better than the FIT (index > 25). Patients were also recorded during two consecutive nights to measure periodic leg movements in sleep (PLMS). A SIT index greater than 40 and a PLMS index greater than 11 (highest PLMS index of 2 consecutive nights) were found to discriminate patients with RLS from control subjects with similar power. With each of these two measures, the clinical diagnosis was correctly predicted in 81% of patients and 81% of the control subjects. The SIT has several advantages over the measure of the PLMS index; it does not require an all-night polygraphic recording and can be administered several times a day to measure circadian fluctuation of motor restlessness.

  11. Physiological responses to incremental, interval, and continuous counterweighted single-leg and double-leg cycling at the same relative intensities.

    Science.gov (United States)

    MacInnis, Martin J; Morris, Nathaniel; Sonne, Michael W; Zuniga, Amanda Farias; Keir, Peter J; Potvin, Jim R; Gibala, Martin J

    2017-07-01

    We compared physiological responses to incremental, interval, and continuous counterweighted single-leg and double-leg cycling at the same relative intensities. The primary hypothesis was that the counterweight method would elicit greater normalized power (i.e., power/active leg), greater electromyography (EMG) responses, and lower cardiorespiratory demand. Graded-exercise tests performed by 12 men (age: 21 ± 2 years; BMI: 24 ± 3 kg/m 2 ) initially established that peak oxygen uptake ([Formula: see text]; 76 ± 8.4%), expired ventilation ([Formula: see text]; 71 ± 6.8%), carbon dioxide production ([Formula: see text]; 71 ± 6.8%), heart rate (HRpeak; 91 ± 5.3%), and power output (PPO; 56 ± 3.6%) were lower during single-leg compared to double-leg cycling (main effect of mode; p cycling were performed at greater absolute power outputs but lower normalized power outputs compared to single-leg cycling (p  0.05), but semitendinosus was activated to a greater extent for single-leg cycling (p = 0.005). Single-leg interval and continuous cycling elicited lower mean [Formula: see text], [Formula: see text], [Formula: see text], HR and ratings of perceived exertion compared to double-leg cycling (p cycling elicits lower cardiorespiratory and perceptual responses than double-leg cycling at greater normalized power outputs.

  12. A Biological Micro Actuator: Graded and Closed-Loop Control of Insect Leg Motion by Electrical Stimulation of Muscles

    Science.gov (United States)

    Cao, Feng; Zhang, Chao; Vo Doan, Tat Thang; Li, Yao; Sangi, Daniyal Haider; Koh, Jie Sheng; Huynh, Ngoc Anh; Aziz, Mohamed Fareez Bin; Choo, Hao Yu; Ikeda, Kazuo; Abbeel, Pieter; Maharbiz, Michel M.; Sato, Hirotaka

    2014-01-01

    In this study, a biological microactuator was demonstrated by closed-loop motion control of the front leg of an insect (Mecynorrhina torquata, beetle) via electrical stimulation of the leg muscles. The three antagonistic pairs of muscle groups in the front leg enabled the actuator to have three degrees of freedom: protraction/retraction, levation/depression, and extension/flexion. We observed that the threshold amplitude (voltage) required to elicit leg motions was approximately 1.0 V; thus, we fixed the stimulation amplitude at 1.5 V to ensure a muscle response. The leg motions were finely graded by alternation of the stimulation frequencies: higher stimulation frequencies elicited larger leg angular displacement. A closed-loop control system was then developed, where the stimulation frequency was the manipulated variable for leg-muscle stimulation (output from the final control element to the leg muscle) and the angular displacement of the leg motion was the system response. This closed-loop control system, with an optimized proportional gain and update time, regulated the leg to set at predetermined angular positions. The average electrical stimulation power consumption per muscle group was 148 µW. These findings related to and demonstrations of the leg motion control offer promise for the future development of a reliable, low-power, biological legged machine (i.e., an insect–machine hybrid legged robot). PMID:25140875

  13. A biological micro actuator: graded and closed-loop control of insect leg motion by electrical stimulation of muscles.

    Directory of Open Access Journals (Sweden)

    Feng Cao

    Full Text Available In this study, a biological microactuator was demonstrated by closed-loop motion control of the front leg of an insect (Mecynorrhina torquata, beetle via electrical stimulation of the leg muscles. The three antagonistic pairs of muscle groups in the front leg enabled the actuator to have three degrees of freedom: protraction/retraction, levation/depression, and extension/flexion. We observed that the threshold amplitude (voltage required to elicit leg motions was approximately 1.0 V; thus, we fixed the stimulation amplitude at 1.5 V to ensure a muscle response. The leg motions were finely graded by alternation of the stimulation frequencies: higher stimulation frequencies elicited larger leg angular displacement. A closed-loop control system was then developed, where the stimulation frequency was the manipulated variable for leg-muscle stimulation (output from the final control element to the leg muscle and the angular displacement of the leg motion was the system response. This closed-loop control system, with an optimized proportional gain and update time, regulated the leg to set at predetermined angular positions. The average electrical stimulation power consumption per muscle group was 148 µW. These findings related to and demonstrations of the leg motion control offer promise for the future development of a reliable, low-power, biological legged machine (i.e., an insect-machine hybrid legged robot.

  14. Restless legs syndrome

    Directory of Open Access Journals (Sweden)

    Ovallath S

    2012-10-01

    Full Text Available Sujith Ovallath, P DeepaJames Parkinson's Movement Disorder Research Centre, Kannur Medical College, Kerala, IndiaBackground: Restless legs syndrome (RLS is a common sleep-related disorder characterized by abnormal sensation and an urge to move the lower limbs. Symptoms occur at rest in the evening or at night, and they are alleviated by moving the affected extremity or by walking. Although the exact etiopathogenesis of RLS remains elusive, the rapid improvement of symptoms with dopaminergic agents suggests that dopaminergic system dysfunction may be a basic mechanism. Dopaminergic agents are the best-studied agents, and are considered first-line treatment of RLS.Objective: To review the diagnostic criteria, clinical features, etiopathogenesis, and the treatment options of RLS.Methods: The suggestions are based on evidence from studies published in peer-reviewed journals, or upon a comprehensive review of the medical literature.Results/conclusion: Extensive data are available for proving the link between the dopaminergic system and RLS. A possible genetic link also has been studied extensively. Dopamine agonists, especially pramipexole and ropinirole, are particularly useful in the treatment of RLS. Pharmacological treatment should however be limited to those patients who suffer from clinically relevant RLS with impaired sleep quality or quality of life.Keywords: dopamine, levodopa, pramipexole

  15. Restless legs syndrome: literature review

    Directory of Open Access Journals (Sweden)

    Emmanouil Symvoulakis

    Full Text Available Restless legs syndrome is a distressing condition, with negative effects on sleep and daytime activities that affect personal, family and occupational life. The overall impact of restless legs syndrome on quality of life is comparable to that of chronic and frustrating conditions such as depression and diabetes. Misdiagnosis and inappropriate treatment may increase patients' suffering in terms of uncertainty, overuse or misuse of care services and lack of trust. Presenting a synthesis of the main topics in the literature on restless legs syndrome facilitates for a better understanding and its management in primary care settings.

  16. Measurement of body fat using leg to leg bioimpedance

    OpenAIRE

    Sung, R; Lau, P; Yu, C; Lam, P; Nelson, E

    2001-01-01

    AIMS—(1) To validate a leg to leg bioimpedance analysis (BIA) device in the measurement of body composition in children by assessment of its agreement with dual energy x ray absorptiometry (DXA) and its repeatability. (2) To establish a reference range of percentage body fat in Hong Kong Chinese children.
METHODS—Sequential BIA and DXA methods were used to determine body composition in 49 children aged 7-18 years; agreement between the two methods was calculated. Repea...

  17. GABAergic inhibition of leg motoneurons is required for normal walking behavior in freely moving Drosophila

    Science.gov (United States)

    Gowda, Swetha B. M.; Paranjpe, Pushkar D.; Reddy, O. Venkateswara; Thiagarajan, Devasena; Palliyil, Sudhir; Reichert, Heinrich

    2018-01-01

    Walking is a complex rhythmic locomotor behavior generated by sequential and periodical contraction of muscles essential for coordinated control of movements of legs and leg joints. Studies of walking in vertebrates and invertebrates have revealed that premotor neural circuitry generates a basic rhythmic pattern that is sculpted by sensory feedback and ultimately controls the amplitude and phase of the motor output to leg muscles. However, the identity and functional roles of the premotor interneurons that directly control leg motoneuron activity are poorly understood. Here we take advantage of the powerful genetic methodology available in Drosophila to investigate the role of premotor inhibition in walking by genetically suppressing inhibitory input to leg motoneurons. For this, we have developed an algorithm for automated analysis of leg motion to characterize the walking parameters of wild-type flies from high-speed video recordings. Further, we use genetic reagents for targeted RNAi knockdown of inhibitory neurotransmitter receptors in leg motoneurons together with quantitative analysis of resulting changes in leg movement parameters in freely walking Drosophila. Our findings indicate that targeted down-regulation of the GABAA receptor Rdl (Resistance to Dieldrin) in leg motoneurons results in a dramatic reduction of walking speed and step length without the loss of general leg coordination during locomotion. Genetically restricting the knockdown to the adult stage and subsets of motoneurons yields qualitatively identical results. Taken together, these findings identify GABAergic premotor inhibition of motoneurons as an important determinant of correctly coordinated leg movements and speed of walking in freely behaving Drosophila. PMID:29440493

  18. Nice snake, shame about the legs.

    Science.gov (United States)

    Coates; Ruta

    2000-12-01

    Snakes are one of the most extraordinary groups of terrestrial vertebrates, with numerous specializations distinguishing them from other squamates (lizards and their allies). Their musculoskeletal system allows creeping, burrowing, swimming and even gliding, and their predatory habits are aided by chemo- and thermoreceptors, an extraordinary degree of cranial kinesis and, sometimes, powerful venoms. Recent discoveries of indisputable early fossil snakes with posterior legs are generating intense debate about the evolutionary origin of these reptiles. New cladistic analyses dispute the precise significance and phylogenetic placement of these fossils. These conflicting hypotheses imply radically different scenarios of snake origins and relationships with wide biological implications.

  19. An Ultralightweight and Living Legged Robot.

    Science.gov (United States)

    Vo Doan, Tat Thang; Tan, Melvin Y W; Bui, Xuan Hien; Sato, Hirotaka

    2018-02-01

    In this study, we describe the most ultralightweight living legged robot to date that makes it a strong candidate for a search and rescue mission. The robot is a living beetle with a wireless electronic backpack stimulator mounted on its thorax. Inheriting from the living insect, the robot employs a compliant body made of soft actuators, rigid exoskeletons, and flexure hinges. Such structure would allow the robot to easily adapt to any complex terrain due to the benefit of soft interface, self-balance, and self-adaptation of the insect without any complex controller. The antenna stimulation enables the robot to perform not only left/right turning but also backward walking and even cessation of walking. We were also able to grade the turning and backward walking speeds by changing the stimulation frequency. The power required to drive the robot is low as the power consumption of the antenna stimulation is in the order of hundreds of microwatts. In contrast to the traditional legged robots, this robot is of low cost, easy to construct, simple to control, and has ultralow power consumption.

  20. Leg pain and gynecologic malignancy.

    Science.gov (United States)

    Singh, Lilly; Stevens, Erin E

    2013-09-01

    Gynecologic malignancies affect more than 83 000 women in the United States, each year. Because the disease involves the pelvis, many patients have side effects distal to this area in their lower extremities. The differential diagnosis of leg pain can be divided into vascular, neurologic, and musculoskeletal causes. In this review article, we address numerous etiologies of leg pain, reviewing the prevalence of disease, physical examination findings, diagnostic as well as treatment modalities.

  1. Restless Legs Syndrome and Leg Motor Restlessness in Parkinson's Disease.

    Science.gov (United States)

    Suzuki, Keisuke; Miyamoto, Masayuki; Miyamoto, Tomoyuki; Hirata, Koichi

    2015-01-01

    Sleep disturbances are important nonmotor symptoms in Parkinson's disease (PD) that are associated with a negative impact on quality of life. Restless legs syndrome (RLS), which is characterized by an urge to move the legs accompanied by abnormal leg sensations, can coexist with PD, although the pathophysiology of these disorders appears to be different. RLS and PD both respond favorably to dopaminergic treatment, and several investigators have reported a significant relationship between RLS and PD. Sensory symptoms, pain, motor restlessness, akathisia, and the wearing-off phenomenon observed in PD should be differentiated from RLS. RLS in PD may be confounded by chronic dopaminergic treatment; thus, more studies are needed to investigate RLS in drug-naïve patients with PD. Recently, leg motor restlessness (LMR), which is characterized by an urge to move the legs that does not fulfill the diagnostic criteria for RLS, has been reported to be observed more frequently in de novo patients with PD than in age-matched healthy controls, suggesting that LMR may be a part of sensorimotor symptoms intrinsic to PD. In this paper, we provide an overview of RLS, LMR, and PD and of the relationships among these disorders.

  2. Restless legs syndrome and periodic leg movements of sleep.

    Science.gov (United States)

    Rye, David B; Trotti, Lynn Marie

    2012-11-01

    Women are more commonly affected than men by restless legs syndrome, and prevalence is highest amongst those of northern European heritage. The motor manifestations include nonvolitional myoclonus (periodic leg movements). Disinhibition of spinal sensorimotor circuits may underlie these primary features and can be affected by peripheral as well as supraspinal networks. Insufficient mobilizable iron stores increase expressivity in some individuals. The sensorimotor features are relieved by dopamine, especially dopamine agonists, gabapentin and its derivatives, and opioids. A diagnosis relies on recognition of key primary and supportive features, and treatments are generally well tolerated, efficacious, and life-changing. Copyright © 2012 Elsevier Inc. All rights reserved.

  3. Leg ulcers due to hyperhomocysteinemia

    Directory of Open Access Journals (Sweden)

    Krupa Shankar D

    2006-01-01

    Full Text Available Chronic leg ulcers are rare in young adults and generally indicate a vascular cause. We report a case of a 26-year-old man with leg ulcers of eight months duration. Doppler study indicated venous incompetence and a postphlebitic limb. However, as the distribution and number of ulcers was not consistent with stasis alone and no features of collagen vascular disease were noted, a hyperviscosity state was considered and confirmed with significantly elevated homocysteine level in the serum. Administration of vitamins B1, B2, B6 and B12, trimethyl-glycine, mecobalamine, folic acid and povidone iodine dressings with culture-directed antibiotic therapy led to a satisfactory healing of ulcers over a period of one month. Hyperhomocysteinemia must be considered in the differential diagnosis of leg ulcers in young individuals.

  4. Cross-legged Gods and One-legged Foresters

    NARCIS (Netherlands)

    Petrovskaia, N.I.

    The present article is a re-evaluation of a marvellous element in a medieval Welsh romance, Chwedl Iarlles y Ffynnawn ‘Tale of the Lady of the Fountain’, also known as Owein. One of the characters encountered by the hero is a one-eyed one-legged dark giant forester who appears to have a particular

  5. Scaling of the Spring in the Leg during Bouncing Gaits of Mammals

    Science.gov (United States)

    Lee, David V.; Isaacs, Michael R.; Higgins, Trevor E.; Biewener, Andrew A.; McGowan, Craig P.

    2014-01-01

    Trotting, bipedal running, and especially hopping have long been considered the principal bouncing gaits of legged animals. We use the radial-leg spring constant krad to quantify the stiffness of the physical leg during bouncing gaits. The radial-leg is modeled as an extensible strut between the hip and the ground and krad is determined from the force and deflection of this strut in each instance of stance. A Hookean spring is modeled in-series with a linear actuator and the stiffness of this spring krad is determined by minimizing the work of the actuator while reproducing the measured force-deflection dynamics of an individual leg during trotting or running, and of the paired legs during hopping. Prior studies have estimated leg stiffness using kleg, a metric that imagines a virtual-leg connected to the center of mass. While kleg has been applied extensively in human and comparative biomechanics, we show that krad more accurately models the spring in the leg when actuation is allowed, as is the case in biological and robotic systems. Our allometric analysis of krad in the kangaroo rat, tammar wallaby, dog, goat, and human during hopping, trotting, or running show that krad scales as body mass to the two-third power, which is consistent with the predictions of dynamic similarity and with the scaling of kleg. Hence, two-third scaling of locomotor spring constants among mammals is supported by both the radial-leg and virtual-leg models, yet the scaling of krad emerges from work-minimization in the radial-leg model instead of being a defacto result of the ratio of force to length used to compute kleg. Another key distinction between the virtual-leg and radial-leg is that krad is substantially greater than kleg, as indicated by a 30–37% greater scaling coefficient for krad. We also show that the legs of goats are on average twice as stiff as those of dogs of the same mass and that goats increase the stiffness of their legs, in part, by more nearly aligning their

  6. The one-leg standing radiograph

    OpenAIRE

    Pinsornsak, P.; Naratrikun, K.; Kanitnate, S.; Sangkomkamhang, T.

    2016-01-01

    Objectives The purpose of this study was to compare the joint space width between one-leg and both-legs standing radiographs in order to diagnose a primary osteoarthritis of the knee. Methods Digital radiographs of 100 medial osteoarthritic knees in 50 patients were performed. The patients had undergone one-leg standing anteroposterior (AP) views by standing on the affected leg while a both-legs standing AP view was undertaken while standing on both legs. The severity of the osteoarthritis wa...

  7. Back Pain with Leg Pain.

    Science.gov (United States)

    Vulfsons, Simon; Bar, Negev; Eisenberg, Elon

    2017-07-01

    The clinical diagnostic dilemma of low back pain that is associated with lower limb pain is very common. In relation to back pain that radiates to the leg, the International Association for the Study of Pain (IASP) states: "Pain in the lower limb should be described specifically as either referred pain or radicular pain. In cases of doubt no implication should be made and the pain should be described as pain in the lower limb." Bogduks' editorial in the journal PAIN (2009) helps us to differentiate and define the terms somatic referred pain, radicular pain, and radiculopathy. In addition, there are other pathologies distal to the nerve root that could be relevant to patients with back pain and leg pain such as plexus and peripheral nerve involvement. Hence, the diagnosis of back pain with leg pain can still be challenging. In this article, we present a patient with back and leg pain. The patient appears to have a radicular pain syndrome, but has no neurological impairment and shows signs of myofascial involvement. Is there a single diagnosis or indeed two overlapping syndromes? The scope of our article encompasses the common diagnostic possibilities for this type of patient. A discussion of treatment is beyond the scope of this article and depends on the final diagnosis/diagnoses made.

  8. Kan leg skabe fremtidens vindere?

    DEFF Research Database (Denmark)

    Holm, Claus

    2006-01-01

    Dansk Boldspil Union skruer ned for den præstationsorienterede tilgang til børnefodbold. I stedet skal børnenes leg med bolden i fokus. Målet er at forhindre massivt frafald i børne- og ungdomsfodbolden og højne niveauet hos topspillerne....

  9. Doppler ultrasound exam of an arm or leg

    Science.gov (United States)

    Peripheral vascular disease - Doppler; PVD - Doppler; PAD - Doppler; Blockage of leg arteries - Doppler; Intermittent claudication - Doppler; Arterial insufficiency of the legs - Doppler; Leg pain and ...

  10. A comparison of one-legged and two-legged countermovement jumps

    NARCIS (Netherlands)

    van Soest, A J; Roebroeck, M.E.; Bobbert, M F; Huijing, P A; van Ingen Schenau, G J

    1985-01-01

    Ten well-trained male volleyball players performed one-legged and two-legged vertical countermovement jumps. Ground reaction forces, cinematographic data, and electromyographic data were recorded. Jumping height in one-legged jumps was 58.5% of that reached in two-legged jumps. Mean net torques in

  11. [Restless legs syndrome and nocturnal leg pain : Differential diagnosis and treatment].

    Science.gov (United States)

    Hornyak, M; Stiasny-Kolster, K; Evers, S; Happe, S

    2011-09-01

    Pain in the legs belongs to the five most frequent regional pain symptoms. Restless legs syndrome (RLS) presents a particular differential diagnosis for pain in the legs, which is characterized by a nocturnal urge to move the legs often associated with painful sensations in the legs. It is one of the most common neurological disorders and probably the leading cause of nocturnal pain in the legs. In this overview, the diagnosis and therapy of RLS as well as aspects of pain therapy of the disorder are presented. In addition, the differential diagnoses for exclusion of other specific causes of nocturnal pain in the legs are discussed.

  12. [Etiological diagnosis of leg ulcers].

    Science.gov (United States)

    Debure, Clélia

    2010-09-20

    Etiological diagnosis of leg ulcers must be the first step of treatment, even if we know that veinous disease is often present. We can build a clinical decisional diagram, which helps us to understand and not forget the other causes of chronic wounds and choose some basic examination, like ultrasound and histological findings. This diagnosis helps to choose the right treatment in order to cure even the oldest venous ulcers. Educational programs should be improved to prevent recurrence.

  13. Thick legs - not always lipedema.

    Science.gov (United States)

    Reich-Schupke, Stefanie; Altmeyer, Peter; Stücker, Markus

    2013-03-01

    Due to its increased presence in the press and on television, the diagnosis of lipedema is on the way to becoming a trendy diagnosis for those with thick legs. Despite this, one must recognize that lipedema is a very rare disease. It is characterized by disproportional obesity of the extremities, especially in the region of the hip and the legs, hematoma development after minimal trauma, and increased pressure-induced or spontaneous pain. Aids for making the correct diagnosis are (duplex) sonography, the waist-hip index or the waist-height index and lymphoscintigraphy. Important differential diagnoses are constitutional variability of the legs, lipohypertrophy in obesity, edema in immobility, edema in chronic venous insufficiency and rheumatic diseases. The symptom-based therapy of lipedema consists of conservative (compression, manual lymphatic drainage, exercise) and surgical treatments (liposuction). Until now there is no curative therapy. Obesity is an important risk factor for the severity and prognosis of lipedema. Further studies for a better understanding of the pathogenesis of lipedema and in the end possible curative treatments are urgently needed. © The Authors | Journal compilation © Blackwell Verlag GmbH, Berlin.

  14. PELATIHAN PLIOMETRIK ALTERNATE LEG BOUND DAN DOUBLE LEG BOUND MENINGKATKAN DAYA LEDAK OTOT TUNGKAI PADA SISWA PUTRA KELAS VII SMP NEGERI 3 SUKAWATI TAHUN PELAJARAN 2012/2013

    Directory of Open Access Journals (Sweden)

    Komang Ayu Tri Widhiyanti

    2013-11-01

    Full Text Available This study was conducted to know the improvement the explosive power of leg muscle. It was done through 5 set 12 repetitions during 6 weeks in the field of SMP Negeri 3 Sukawati started from 4 p.m. until 6 p.m. There were 3 groups applied in this study such as group 1 (control group that was instructed to kick a ball, group 2 (plyometric training of alternate leg bound, and group 3 (plyometric training of double leg bound. The sample was 14 male students who were in the seventh grade class of SMP Negeri 3 Sukawati in the academic year 2012/2013. The data was gained by doing the movement of alternate leg bound and double leg bound that each movement was done three times before and after the training. The hypothesis was examined by using independent t-test with the result 0.05 (p<0.05. Based on the different result of analysis test in each group, the gain score of the group 2 with the group 1 about 0,51 that shows the significant differences p = 0,00, the gain score of the group 2 with the group 3 about 0,31 that shows the significant differences p = 0,00, the gain score of the group 3 with the group 1 about 0,20 that shows the significant differences p = 0,00. Thus, alternate leg bound plyometric training is more effective than double leg bound. It is expected that the coach and the gym teacher to apply alternate leg bound plyometric training as an alternative to improve the explosive power of leg muscle.

  15. Analytical Study of Active Prosthetic Legs

    Science.gov (United States)

    Ono, Kyosuke; Katsumata, Mie

    Walking with prosthesis has not been well analyzed mathematically and it seems that the design of powered prosthesis has been done empirically so far. This paper presents a dynamic simulation of a normal human walking and walking with an active prosthesis. We also studied the two controlling methods of a powered thigh prosthesis based on multi-body simulation of human walking. First we measured the normal human walking gait, then, we showed that a 3-DOF human walking model can walk on level ground by applying tracking control to the measured walking gait within a certain range of tuned walking period. Next, we applied the tracking control and self-excited control to the powered thigh prosthesis and compared the robustness and efficiency of the two control methods by numerical simulation. As a result, we found that the self-excited control can significantly decrease the hip joint torque and specific cost to 1/3 compared with the tracking control. Moreover, the self-excited control is superior to the tracking control because tuning for the walking period is not needed for the active prosthetic leg.

  16. Power

    DEFF Research Database (Denmark)

    Elmholdt, Claus Westergård; Fogsgaard, Morten

    2016-01-01

    In this chapter, we will explore the dynamics of power in processes of creativity, and show its paradoxical nature as both a bridge and a barrier to creativity in organisations. Recent social psychological experimental research (Slighte, de Dreu & Nijstad, 2011) on the relation between power...... and floating source for empowering people in the organisation. We will explore and discuss here the potentials, challenges and pitfalls of power in relation to creativity in the life of organisations today. The aim is to demonstrate that power struggles may be utilised as constructive sources of creativity...

  17. Epilepsy and restless legs syndrome.

    Science.gov (United States)

    Geyer, James D; Geyer, Emery E; Fetterman, Zachary; Carney, Paul R

    2017-03-01

    Restless legs syndrome (RLS) is a common neurological movement disorder occurring in approximately 10% of the general population. The prevalence of moderately severe RLS is 2.7% overall (3.7% for women and 1.7% for men). Epilepsy is also a common neurological disorder with significant associated morbidity and impact on quality of life. We evaluated the severity and frequency of primary RLS in patients with localization-related temporal lobe epilepsy (TLE) and investigated the role of prodromal RLS symptoms as a warning sign and lateralizing indicator. All epilepsy patients seen in the outpatient clinic were screened for movement disorders from 2005 to 2015. Ninety-eight consecutive patients with localization-related TLE (50 right TLE and 48 left TLE) who met inclusion criteria were seen in the outpatient clinic. The control group consisted of 50 individuals with no history or immediate family history of epilepsy. Each patient was evaluated with the International Restless Legs Study Group (IRLSSG) questionnaire, NIH RLS diagnostic criteria, ferritin level, and comprehensive sleep screening including polysomnography. Furthermore, patients with obstructive sleep apnea or a definite cause of secondary restless legs syndrome such as low serum ferritin or serum iron levels were also excluded from the study. There was a significant association between the type of epilepsy and whether or not patients had RLS χ 2 (1)=10.17, prestlessness was typically described as moderately severe. The RLS symptoms were more common and somewhat more severe in the right TLE group than the left TLE group. Copyright © 2016 Elsevier Inc. All rights reserved.

  18. Quinine for Nocturnal Leg Cramps

    Science.gov (United States)

    Man-Son-Hing, Malcolm; Wells, George; Lau, Anita

    1998-01-01

    OBJECTIVE With respect to the use of quinine for the treatment of nocturnal leg cramps, to determine whether the findings of a previously performed meta-analysis of published data are altered with the addition of unpublished data, and whether publication bias is present in this area. DESIGN A meta-analysis of eight (four published and four unpublished) randomized, double-blind, placebo-controlled trials, seven of which had a crossover design. SETTING Randomized trials that were available as of July 1997. SUBJECTS Ambulatory patients (659) who suffered from regular nocturnal leg cramps. MAIN RESULTS When individual patient data from all crossover studies were pooled, persons had 3.60 (95% confidence interval [CI] 2.15, 5.05) fewer cramps in a 4-week period when taking quinine compared with placebo. This compared with an estimate of 8.83 fewer cramps (95% CI 4.16, 13.49) from pooling published studies alone. The corresponding relative risk reductions were 21% (95% CI 12%, 30%) and 43% (95% CI 21%, 65%), respectively. Compared with placebo, the use of quinine was associated with an increased incidence of side effects, particularly tinnitus. Publication bias is present in the reporting of the efficacy of quinine for this indication, as almost all published studies reported larger estimates of its efficacy than did unpublished studies. CONCLUSIONS This study confirms that quinine is efficacious in the prevention of nocturnal leg cramps. However, its benefit may not be as large as reported from the pooling of published studies alone. Given the side effect profile of quinine, nonpharmacologic therapy (e.g., regular passive stretching of the affected muscle) is the best first-line treatment. For persons who find this ineffective and whose quality of life is significantly affected, a trial of quinine is warranted. Prescribing physicians must closely monitor the risks and benefits in individual patients. Publication bias is present in this area even though there is

  19. Leg oxygen uptake in the initial phase of intense exercise is slowed by a marked reduction in oxygen delivery

    DEFF Research Database (Denmark)

    Christensen, Peter Møller; Nyberg, Michael Permin; Mortensen, Stefan Peter

    2013-01-01

    The present study examined if a marked reduction in oxygen delivery, unlike findings with moderate intensity exercise, would slow leg oxygen uptake (VO2) kinetics during intense exercise (86±3% of incremental test peak power). Seven healthy males (26±1 years, mean±SEM) performed one-legged knee-e...

  20. Leg fluid accumulation during prolonged sitting.

    Science.gov (United States)

    Vena, Daniel; Rubianto, Jonathan; Popovic, Milos; Yadollahi, Azadeh

    2016-08-01

    The accumulation of fluid in the legs due to sedentariness can be a health risk in extreme cases. Negative health impacts associated with leg fluid accumulation include leg edema and risk of blood clots. Furthermore, fluid accumulating in the legs is accompanied by fluid shift into the upper body which is also associated with health risks such as: increased blood pressure when lying down, respiratory problems in people with heart failure, and increased sleep apnea. Understanding the pattern by which fluid accumulates in the legs can aid in the development of devices for reducing leg fluid accumulation. The purpose of this study was to characterize the time course of fluid accumulation over a two-and-half-hour seated period. Non-obese participants with sleep apnea and no other co-morbidities were included in the sample as part of a larger study. Leg fluid was measured continuously using a method of bioelectrical impedance. Participants were first asked to lie supine for 30 minutes as a washout, and then sat with their legs still for two and a half hours. The main finding of this study is that the pattern of leg fluid accumulation differed in the first 45 minutes compared to the latter 105 minutes. In the first 45 minutes, fluid accumulated according to first order exponential function. In the latter period, fluid accumulated according to a linear function. The initial exponential accumulation is likely due to the large increase in capillary pressure caused by rapid blood flow into the legs due to gravity, leading to substantial filtration of blood plasma into the tissue spaces. The latter linear portion likely represents continued slow filtration of fluid out of the vasculature and into the tissue spaces. This is the first study to show that fluid accumulation in the legs is a combination of an exponential and linear functions. The linear increase identifies that there is no foreseeable point in which leg fluid stops accumulating while sitting for prolonged periods.

  1. Running with a load increases leg stiffness.

    Science.gov (United States)

    Silder, Amy; Besier, Thor; Delp, Scott L

    2015-04-13

    Spring-mass models have been used to characterize running mechanics and leg stiffness in a variety of conditions, yet it remains unknown how running while carrying a load affects running mechanics and leg stiffness. The purpose of this study was to test the hypothesis that running with a load increases leg stiffness. Twenty-seven subjects ran at a constant speed on a force-measuring treadmill while carrying no load, and while wearing weight vests loaded with 10%, 20%, and 30% of body weight. We measured lower extremity motion and created a scaled musculoskeletal model of each subject, which we used to estimate lower extremity joint angles and leg length. We estimated dimensionless leg stiffness as the ratio of the peak vertical ground reaction force (normalized to body weight) and the change in stance phase leg length (normalized to leg length at initial foot contact). Leg length was calculated as the distance from the center of the pelvis to the center-of-pressure under the foot. We found that dimensionless leg stiffness increased when running with load (p=0.001); this resulted from an increase in the peak vertical ground reaction force (pleg length (p=0.025). When running with load, subjects had longer ground contact times (pleg stiffness to accommodate an added load. Copyright © 2015 Elsevier Ltd. All rights reserved.

  2. Restless legs syndrome and periodic leg movements in patients with movement disorders: Specific considerations.

    Science.gov (United States)

    Högl, Birgit; Stefani, Ambra

    2017-05-01

    Restless legs syndrome is a frequent neurological disorder with potentially serious and highly distressing treatment complications. The role and potential implications of periodic leg movements during sleep range from being a genetic risk marker for restless legs syndrome to being a cardiovascular risk factor. The diagnosis of restless legs syndrome in patients with daytime movement disorders is challenging and restless legs syndrome needs to be differentiated from other sleep-related movement disorders. This article provides an update on the diagnosis of restless legs syndrome as an independent disorder and the role of periodic leg movements and reviews the association of restless legs syndrome with Parkinson's disease and other movement disorders. © 2017 International Parkinson and Movement Disorder Society. © 2017 International Parkinson and Movement Disorder Society.

  3. Unilateral Eccentric Contraction of the Plantarflexors Leads to Bilateral Alterations in Leg Dexterity.

    Science.gov (United States)

    Nagamori, Akira; Valero-Cuevas, Francisco J; Finley, James M

    2016-01-01

    Eccentric contractions can affect musculotendon mechanical properties and disrupt muscle proprioception, but their behavioral consequences are poorly understood. We tested whether repeated eccentric contractions of plantarflexor muscles of one leg affected the dexterity of either leg. Twenty healthy male subjects (27.3 ± 4.0 yrs) compressed a compliant and slender spring prone to buckling with each isolated leg. The maximal instability they could control (i.e., the maximal average sustained compression force, or lower extremity dexterity force, LED force ) quantified the dexterity of each leg. We found that eccentric contractions did not affect LED force , but reduced force variability (LED SD ). Surprisingly, LED force increased in the non-exposed, contralateral leg. These effects were specific to exposure to eccentric contractions because an effort-matched exposure to walking did not affect leg dexterity. In the exposed leg, eccentric contractions (i) reduced voluntary error corrections during spring compressions (i.e., reduced 0.5-4 Hz power of LED force ); (ii) did not change spinal excitability (i.e., unaffected H-reflexes); and (iii) changed the structure of the neural drive to the α-motoneuron pool (i.e., reduced EMG power within the 4-8 Hz physiological tremor band). These results suggest that repeated eccentric contractions alter the feedback control for dexterity in the exposed leg by reducing muscle spindle sensitivity. Moreover, the unexpected improvement in LED force in the non-exposed contralateral leg was likely a consequence of crossed-effects on its spinal and supraspinal feedback control. We discuss the implications of these bilateral effects of unilateral eccentric contractions, their effect on spinal and supraspinal control of dynamic foot-ground interactions, and their potential to facilitate rehabilitation from musculoskeletal and neuromotor impairments.

  4. Unilateral eccentric contraction of the plantarflexors leads to bilateral alterations in leg dexterity

    Directory of Open Access Journals (Sweden)

    Akira Nagamori

    2016-11-01

    Full Text Available Eccentric contractions can affect musculotendon mechanical properties and disrupt muscle proprioception, but their behavioral consequences are poorly understood. We tested whether repeated eccentric contractions of plantarflexor muscles of one leg affected the dexterity of either leg. Twenty healthy male subjects (27.3+/-4.0 yrs compressed a compliant and slender spring prone to buckling with each isolated leg. The maximal instability they could control (i.e., the maximal average sustained compression force, or lower extremity dexterity force, LEDForce quantified the dexterity of each leg. We found that eccentric contractions did not affect LEDForce, but reduced force variability (LEDSD. Surprisingly, LEDForce increased in the non-exposed, contralateral leg. These effects were specific to exposure to eccentric contractions because an effort-matched exposure to walking did not affect leg dexterity. In the exposed leg, eccentric contractions (i reduced voluntary error corrections during spring compressions (i.e., reduced 0.5-4 Hz power of LEDForce; (ii did not change spinal excitability (i.e., unaffected H-reflexes; and (iii changed the structure of the neural drive to the alpha-motoneuron pool (i.e., reduced EMG power within the 4-8 Hz physiological tremor band. These results suggest that repeated eccentric contractions alter the feedback control for dexterity in the exposed leg by reducing muscle spindle sensitivity. Moreover, the unexpected improvement in LEDForce in the non-exposed contralateral leg was likely a consequence of crossed-effects on its spinal and supraspinal feedback control. We discuss the implications of these bilateral effects of unilateral eccentric contractions, their effect on spinal and supraspinal control of dynamic foot-ground interactions, and their potential to facilitate rehabilitation from musculoskeletal and neuromotor impairments.

  5. Restless legs syndrome mimicking S1 radiculopathy.

    Science.gov (United States)

    Zambelis, Th; Wolgamuth, B R; Papoutsi, S N; Economou, N T

    2016-01-01

    Α case of a chronic idiopathic form of a severe type of Restless Legs Syndrome (RLS), which developed during pregnancy and persisted after this, misdiagnosed for 34 years as radiculopathy S1, is reported. In spite of the thorough clinical and laboratory investigation, in addition to constant changes of the therapeutic approach, the diagnosis of S1 radiculopathy could not be confirmed, resulting in a chronic clinical course; the latter was characterized by relapses and remissions not attributed or linked in any way to the treatment (various types of). In fact, it was due to a routine workup in a sleep clinic, where the patient was referred because of a coincident chronic insomnia (Restless Legs Syndrome is a known and important cause of insomnia/chronic insomnia), which resulted in a proper diagnosis and treatment of this case. With the use of Restless Legs Syndrome appropriate treatment (Pramipexole 0.18 mg taken at bedtime, a dopaminergic agent and Level A recommended drug for Restless Legs Syndrome) an excellent response and immediate elimination of symptoms was achieved. Restless Legs Syndrome may present with a variety of symptoms (with the most prominent shortly being reported with the acronym URGE: Urge to move the legs usually associated with unpleasant leg sensations, Rest induces symptoms, Getting active brings relief, Evening and night deteriorate symptoms); given the fact that Restless Legs Syndrome presents with a great variety and heterogeneity of symptoms (mostly pain, dysesthesia and paresthesia), which may occur in several other diseases (the so called "RLS mimics"), proper diagnosis of Restless Legs Syndrome usually fails. Restless Legs Syndrome misinterpreted as S1 radiculopathy, to the best of our knowledge, has not been reported yet in the literature. Here, case history, clinical course and common RLS mimics are presented. Different forms of Restless Legs Syndrome manifestations, which are commonly -as in this case- misinterpreted due to their

  6. Intensive treatment of leg lymphedema

    Directory of Open Access Journals (Sweden)

    Pereira de Godoy Jose

    2010-01-01

    Full Text Available Background: Despite of all the problems caused by lymphedema, this disease continues to affect millions of people worldwide. Thus, the identification of the most efficacious forms of treatment is necessary. Aim: The aim of this study was to evaluate a novel intensive outpatient treatment for leg lymphedema. Methods: Twenty-three legs of 19 patients were evaluated in a prospective randomized study. The inclusion criteria were patients with Grade II and III lymphedema, where the difference, measured by volumetry, between the affected limb below the knee and the healthy limb was greater than 1.5 kg. Intensive treatment was carried out for 6- to 8-h sessions in the outpatient clinic. Analysis of variance was utilized for statistical analysis with an alpha error of 5% (P-value < 0.05 being considered significant. Results: All limbs had significant reductions in size with the final mean loss being 81.1% of the volume of edema. The greatest losses occurred in the first week (P-value < 0.001. Losses of more than 90% of the lymphedema occurred in 9 (39.13% patients; losses of more than 80% in 13 (56.52%, losses of more than 70% in 17 (73.91% and losses of more than 50% were recorded for 95.65% of the patients; only 1 patient lost less than 50% (37.9% of the edema. Conclusion: The intensive treatment of lymphedema in the outpatient clinic can produce significant reductions in the volume of edema over a short period of time and can be recommended for any grade of lymphedema, in particular the more advanced degrees.

  7. Leg blood flow during static exercise.

    Science.gov (United States)

    Kilbom, A; Persson, J

    1982-01-01

    Leg blood flow was studied with the constant infusion dye technique during static exercise of the thigh muscles (quadriceps) and during hand-grips at 15 and 25-30% of MVC. Blood flow and oxygen uptake in the leg increased in quadriceps exercise and reached their highest values (around 1.21/min and 165 ml/min respectively) at 25-30% of MVC, whereas leg vascular resistance decreased. Regional circulatory adaptations and the oxygen uptake - leg blood flow relationship were in close agreement with the responses found in dynamic leg exercise. In view of the marked rise in intramuscular pressure previously observed during quadriceps contractions, a restriction of blood flow and an increased vascular resistance had been expected. Involuntary activation of leg muscles other than the quadriceps may explain the finding. Contractions of the contralateral quadriceps induced a slight increase in leg blood flow, whereas hand-grips had no influence on blood flow or vascular resistance in the leg. The distribution of the cardiac output during static contractions is discussed, and it is concluded that during hand-grips the increase in blood flow is predominantly distributed to the upper part of the body.

  8. Børns leg og eksperimenterende virksomhed

    DEFF Research Database (Denmark)

    Damgaard Warrer, Sarah; Broström, Stig

    Børns leg og eksperimenterende virksomhed er et rigt felt med mange perspektiver, indgangsvinkler og nuancer. I denne bog kædes leg og det eksperimenterende og skabende sammen som to gensidigt forbundne fænomener og belyses i pædagogisk og didaktisk perspektiv. Desuden beskrives potentialet i båd...

  9. Effect of leg length on ROM, VJ and leg dexterity in dance.

    Science.gov (United States)

    Wyon, M A; Nevill, A M; Dekker, K; Brown, D D; Clarke, F; Pelly, J; Koutedakis, Y

    2010-09-01

    We investigated the associations between leg length and specific ballet movements in different skill groups. Volunteers were from an undergraduate dance programme (n=18), a pre-professional school (n=43) and from an elite classical ballet company (n=45). Individual data were collected for anthropometry, vertical jump, leg dexterity, and leg active and passive ROM. ANCOVA identified both main effects as significant with regard to vertical jump (gender Peffects with gender, skill or leg length. Active and passive range of motion noted gender (P=0.001) and skill (Peffects of leg length on fundamental ballet skills. The longer legs that benefit vertical jump have a negative influence on range of motion and leg dexterity except for highly skilled dancers, who through skill, seem to have overcome the effects of some of these dichotomies. Georg Thieme Verlag KG Stuttgart . New York.

  10. Steerable Hopping Six-Legged Robot

    Science.gov (United States)

    Younse, Paulo; Aghazarian, Hrand

    2010-01-01

    The figure depicts selected aspects of a six-legged robot that moves by hopping and that can be steered in the sense that it can be launched into a hop in a controllable direction. This is a prototype of hopping robots being developed for use in scientific exploration of rough terrain on remote planets that have surface gravitation less than that of Earth. Hopping robots could also be used on Earth, albeit at diminished hopping distances associated with the greater Earth gravitation. The upper end of each leg is connected through two universal joints to an upper and a lower hexagonal frame, such that the tilt of the leg depends on the relative position of the two frames. Two non-back-driveable worm-gear motor drives are used to control the relative position of the two frames along two axes 120 apart, thereby controlling the common tilt of all six legs and thereby, further, controlling the direction of hopping. Each leg includes an upper and a lower aluminum frame segment with a joint between them. A fiberglass spring, connected via hinges to both segments, is used to store hopping energy prior to launch into a hop and to cushion the landing at the end of the hop. A cable for loading the spring is run into each leg through the center of the universal joints and then down along the center lines of the segments to the lower end of the leg. A central spool actuated by a motor with a harmonic drive and an electromagnetic clutch winds in all six cables to compress all six springs (thereby also flexing all six legs) simultaneously. To ensure that all the legs push off and land in the same direction, timing- belt pulley drives are attached to the leg segments, restricting the flexing and extension of all six legs to a common linear motion. In preparation for a hop, the spool can be driven to load the spring legs by an amount corresponding to a desired hop distance within range. The amount of compression can be computed from the reading of a shaft-angle encoder that

  11. Frustrated spin-1/2 ladder with ferro- and antiferromagnetic legs

    Science.gov (United States)

    Maiti, Debasmita; Dey, Dayasindhu; Kumar, Manoranjan

    2018-01-01

    Two-leg spin-1/2 ladder systems consisting of a ferromagnetic leg and an antiferromagnetic leg are considered where the spins on the legs interact through antiferromagnetic rung couplings J1 . These ladders can have two geometrical arrangements either zigzag or normal ladder and these systems are frustrated irrespective of their geometry. This frustration gives rise to incommensurate spin density wave, dimer and spin fluid phases in the ground state. The magnetization in the systems decreases linearly with J12, and the systems show an incommensurate phase for 0.0 power law decay which is very similar to Heisenberg antiferromagnetic chain in external magnetic field. In large J1 limit, the normal ladder behaves like a collection of singlet dimers, whereas the zigzag ladder behaves as a one dimensional spin-1/2 antiferromagnetic chain.

  12. Ultrasonography of the lower leg: technique, anatomy and pathologic conditions

    Energy Technology Data Exchange (ETDEWEB)

    Thain, L.M.F. [Univ. of Western Ontario, London Health Sciences Centre, Departments of Diagnostic Radiology and Nuclear Medicine, London, Ontario (Canada); Lee, S.L. [Univ. of Western Ontario, Dept. of Anaestesia, London, Ontario (Canada); Downey, D.B. [Univ. of Western Ontario, Diagnostic Ultrasound, London Health Sciences Centre, Dept. of Diagnostic Radiology and Nuclear Medicine, London, Ontario (Canada)

    2001-10-01

    Ultrasonography (US) is a useful modality for examining the lower leg, particularly in patients who have sustained muscular, tendinous or bony injuries. This paper will demonstrate the proper technique for US examination of each compartment of the lower leg. The bones, muscles and tendons of the lower leg (i.e., patellar tendon, superficial posterior fascial compartment [gastrocnemius, plantaris, soleus], deep posterior fascial compartment [tibialis posterior, flexor digitorum longus, flexor hallucis longus], lateral fascial compartment [peroneus longus, peroneus brevis], anterior faccial compartment [tibialis anterior, extensor digitorum longus, extensor hallucis longus], tibia and the fibula) will be reviewed with respect to their surface anatomy, US appearance and common pathologic conditions. A linear array high-frequency (at least 7.5 MHz) transducer should be used. One with variable centre frequency is useful to allow the examination of both deep and superficial areas in the same patient without switching transducers. Power Doppler is used to identify areas of increased blood flow, often due to inflammation or active healing. The transducer must be maintained perpendicular to the long axis of tendons to avoid anisotropy artifacts, which give a false appearance of decreased echogenicity. Structures should be followed from origin to insertion in the long and short axes. (author)

  13. Ultrasonography of the lower leg: technique, anatomy and pathologic conditions

    International Nuclear Information System (INIS)

    Thain, L.M.F.; Lee, S.L.; Downey, D.B.

    2001-01-01

    Ultrasonography (US) is a useful modality for examining the lower leg, particularly in patients who have sustained muscular, tendinous or bony injuries. This paper will demonstrate the proper technique for US examination of each compartment of the lower leg. The bones, muscles and tendons of the lower leg (i.e., patellar tendon, superficial posterior fascial compartment [gastrocnemius, plantaris, soleus], deep posterior fascial compartment [tibialis posterior, flexor digitorum longus, flexor hallucis longus], lateral fascial compartment [peroneus longus, peroneus brevis], anterior faccial compartment [tibialis anterior, extensor digitorum longus, extensor hallucis longus], tibia and the fibula) will be reviewed with respect to their surface anatomy, US appearance and common pathologic conditions. A linear array high-frequency (at least 7.5 MHz) transducer should be used. One with variable centre frequency is useful to allow the examination of both deep and superficial areas in the same patient without switching transducers. Power Doppler is used to identify areas of increased blood flow, often due to inflammation or active healing. The transducer must be maintained perpendicular to the long axis of tendons to avoid anisotropy artifacts, which give a false appearance of decreased echogenicity. Structures should be followed from origin to insertion in the long and short axes. (author)

  14. Scaling of the spring in the leg during bouncing gaits of mammals.

    Science.gov (United States)

    Lee, David V; Isaacs, Michael R; Higgins, Trevor E; Biewener, Andrew A; McGowan, Craig P

    2014-12-01

    Trotting, bipedal running, and especially hopping have long been considered the principal bouncing gaits of legged animals. We use the radial-leg spring constant [Formula: see text] to quantify the stiffness of the physical leg during bouncing gaits. The radial-leg is modeled as an extensible strut between the hip and the ground and [Formula: see text] is determined from the force and deflection of this strut in each instance of stance. A Hookean spring is modeled in-series with a linear actuator and the stiffness of this spring [Formula: see text] is determined by minimizing the work of the actuator while reproducing the measured force-deflection dynamics of an individual leg during trotting or running, and of the paired legs during hopping. Prior studies have estimated leg stiffness using [Formula: see text], a metric that imagines a virtual-leg connected to the center of mass. While [Formula: see text] has been applied extensively in human and comparative biomechanics, we show that [Formula: see text] more accurately models the spring in the leg when actuation is allowed, as is the case in biological and robotic systems. Our allometric analysis of [Formula: see text] in the kangaroo rat, tammar wallaby, dog, goat, and human during hopping, trotting, or running show that [Formula: see text] scales as body mass to the two-third power, which is consistent with the predictions of dynamic similarity and with the scaling of [Formula: see text]. Hence, two-third scaling of locomotor spring constants among mammals is supported by both the radial-leg and virtual-leg models, yet the scaling of [Formula: see text] emerges from work-minimization in the radial-leg model instead of being a defacto result of the ratio of force to length used to compute [Formula: see text]. Another key distinction between the virtual-leg and radial-leg is that [Formula: see text] is substantially greater than [Formula: see text], as indicated by a 30-37% greater scaling coefficient for [Formula

  15. High-Intensity Jump Training Is Tolerated during 60 Days of Bed Rest and Is Very Effective in Preserving Leg Power and Lean Body Mass: An Overview of the Cologne RSL Study.

    Directory of Open Access Journals (Sweden)

    Andreas Kramer

    Full Text Available Space agencies are looking for effective and efficient countermeasures for the degrading effects of weightlessness on the human body. The aim of this study was to assess the effects of a novel jump exercise countermeasure during bed rest on vitals, body mass, body composition, and jump performance.23 male participants (29±6 years, 181±6 cm, 77±7 kg were confined to a bed rest facility for 90 days: a 15-day ambulatory measurement phase, a 60-day six-degree head-down-tilt bed rest phase (HDT, and a 15-day ambulatory recovery phase. Participants were randomly allocated to the jump training group (JUMP, n = 12 or the control group (CTRL, n = 11. A typical training session consisted of 4x10 countermovement jumps and 2x10 hops in a sledge jump system. The training group had to complete 5-6 sessions per week.Peak force for the reactive hops (3.6±0.4 kN as well as jump height (35±4 cm and peak power (3.1±0.2 kW for the countermovement jumps could be maintained over the 60 days of HDT. Lean body mass decreased in CTRL but not in JUMP (-1.6±1.9 kg and 0±1.0 kg, respectively, interaction effect p = 0.03. Resting heart rate during recovery was significantly increased for CTRL but not for JUMP (interaction effect p<0.001.Participants tolerated the near-daily high-intensity jump training and maintained high peak forces and high power output during 60 days of bed rest. The countermeasure was effective in preserving lean body mass and partly preventing cardiac deconditioning with only several minutes of training per day.

  16. Leg pain (Osgood-Schlatter) (image)

    Science.gov (United States)

    Leg pain in older children or young adolescents can occur for many reasons. An Osgood-Schlatter lesion results from continued trauma to the anterior tibial bone and causes a visible lump below the knee.

  17. Support Leg Loading in Punt Kicking

    Science.gov (United States)

    Kermond, John; Konz, Stephen

    1978-01-01

    Maximum distance in football punt kicking is associated with a maximum force transfer to the ball rather than a maximum force transfer through the ground via the support leg. For maximum distance, tred lightly. (Author)

  18. Sturge-Weber syndrome - legs (image)

    Science.gov (United States)

    ... nervous system (neurocutaneous) and is associated with Port Wine Stain, red vascular markings on the face and other parts of the body (shown here on the legs). This is an unusual case, due to the large size of the lesion ( ...

  19. Leg or foot amputation - dressing change

    Science.gov (United States)

    ... patientinstructions/000018.htm Leg or foot amputation - dressing change To use the sharing features on this page, please enable JavaScript. You will need to change the dressing on your limb. This will help ...

  20. Compromised Agency: The Case of BabyLegs

    Directory of Open Access Journals (Sweden)

    Max Liboiron

    2017-09-01

    Full Text Available The concept of agency is ubiquitous in STS, particularly regarding cases of alternative ways of knowing and doing science such as civic, citizen, and feminist sciences, among others. Yet the focus on agency often glosses over the constraints placed on agents, particularly within asymmetrical power relations. This article follows the case of BabyLegs, a do-it-yourself monitoring tool for marine microplastic pollution, and the attempt to keep the technology open source within an intellectual property (IP system set up to privatize it. The tactics used to design BabyLegs as a feminine, silly, doll-tool to discredit the device in the eyes of an IP system that valued traditional gender roles lead to the eventual success of keeping the device open source. Yet, those same tactics also reinforced and reproduced the structures of power and essentialism they were designed to resist. I characterize this technological ambivalence as compromise, and argue that all agency exercised within asymmetrical power relations is compromised. This is not to say resistance is futile, but that agency is never pure, and this recognition lets us be more intentional in how we might compromise as practitioners of diverse scientific knowledges.

  1. Conjoined legs: Sirenomelia or caudal regression syndrome?

    OpenAIRE

    Das, Sakti Prasad; Ojha, Niranjan; Ganesh, G Shankar; Mohanty, Ram Narayan

    2013-01-01

    Presence of single umbilical persistent vitelline artery distinguishes sirenomelia from caudal regression syndrome. We report a case of a12-year-old boy who had bilateral umbilical arteries presented with fusion of both legs in the lower one third of leg. Both feet were rudimentary. The right foot had a valgus rocker-bottom deformity. All toes were present but rudimentary. The left foot showed absence of all toes. Physical examination showed left tibia vara. The chest evaluation in sitting re...

  2. Efficiency and Speed in Legged Robots

    Science.gov (United States)

    2011-03-22

    which we substitute into (4.42) : ( -mv s J O=-km+ mvc -k __ c __ V v 2 c c 46 (4.43) (4.44) (4.45) (4.46) to fInd the switching curve m 3 s...Legged Mechanisms. IVSS. Traverse City, MI Muench, P., Alexander, J., Quinn, R., & Aschenbeck, K. (2005) Pneumatic Spring for Legged Walker. SPIE

  3. Flexural characteristics of a stack leg

    International Nuclear Information System (INIS)

    Cook, J.

    1979-06-01

    A 30 MV tandem Van de Graaff accelerator is at present under construction at Daresbury Laboratory. The insulating stack of the machine is of modular construction, each module being 860 mm in length. Each live section stack module contains 8 insulating legs mounted between bulkhead rings. The design, fabrication (from glass discs bonded to stainless steel discs using an epoxy film adhesive) and testing of the stack legs is described. (U.K.)

  4. Three cross leg flaps for lower leg reconstruction of Gustilo type III C open fracture

    Directory of Open Access Journals (Sweden)

    Kazufumi Sano

    2016-01-01

    Full Text Available A 60 year old male had Gustilo type III C open fracture of the right lower leg. After radical debridement, the large open defect including certain loss of the bone tissue was successfully augmented and covered, by consecutive three cross-leg flaps, which consisted of the free rectus abdominis musculocutaneous flap, the fibula osteocutaneous flap and the conventional sural flap. Although indication for amputation or preservation is decided with multiple factors in each case, a strategic combination of cross-leg flap, free flap, external fixation and vascular delay could increase the potential of preservation of the lower leg with even disastrous Gustilo type III C.

  5. Roll type conducting polymer legs for rigid-flexible thermoelectric generator

    Directory of Open Access Journals (Sweden)

    Teahoon Park

    2017-07-01

    Full Text Available A roll-type conducting polymer film was explored as a flexible organic p-type thermoelectric leg using poly(3,4-ethylenedioxythiophene (PEDOT doped with tosylate. The PEDOT films were prepared through solution casting polymerization and rolled up for a roll-type leg. Due to the high flexibility, the roll-type PEDOT leg enabled easy contact to both top and bottom electrodes. Simulation on the dynamic heat transfer and convective cooling for a vertically roosted rod- and roll-type PEDOT leg showed that the temperature difference (ΔT between the hot and cold sides of the leg was much higher in the roll than that of the rod. The PEDOT legs were integrated with n-type Bi2Te3 blocks, to give a 36-couple rigid-flexible thermoelectric generator (RF-TEG. The maximum output voltage from the 36-couple RF-TEG under a ΔT of 7.9 K was determined as 36.7 mV along with a high output power of 115 nW. A wearable RF-TEG was prepared upon the combination of the 36-couple RF-TEG with an arm warmer, to afford an output voltage of 10.6 mV, which was generated constantly and steadily from human wrist heat.

  6. The miracle of the black leg: E astern neglect of Western addition to the hagiography of Saints Cosmas and Damian.

    Science.gov (United States)

    Jović, Nebojša J; Theologou, Marios

    2015-01-01

    The Christian miracle tales strongly support the identification of Sts. Cosmas and Damian as doctors. The most famous of the saints' posthumous miracles, is that of the Black Leg. The main source of this story is the Golden Legend by Jacobus da Varagine, collection of fanciful hagiographies compiled in the 13th century. Saints Cosmas and Damian miraculously transplanted the black leg of the Ethiopian man onto the white body of the verger with "cancerous" leg. Saints appeared to the patient in a dream, amputated his diseased leg and replaced it with the leg of a recently died man. This dramatic cure was attractive for many western artists. The iconography of this miracle was depicted for the first time in a Florentine panel of ca.1370. The color of the leg later attracted special attention. Since the 1990's the Miracle of the Black Leg, presented in a (neo) Byzantine style, appeared in Greece. The miracle of Holy Unmercenaries has no proper historical foundation in the Books of the lives of the Saints in the Orthodox Churches. Action focused on replacement of the affected leg with one from cadaveric donor was unknown to the eastern Christianity. Exploration of available orthodox hagiographical sources related to the healing powers of Sts. Cosmas and Damian showed remarkable neglect of that miracle. Some contemporary Greek authors find appropriate to disregard it.

  7. Early childhood television viewing predicts explosive leg strength and waist circumference by middle childhood

    Directory of Open Access Journals (Sweden)

    Fitzpatrick Caroline

    2012-07-01

    Full Text Available Abstract Background The relationship between early childhood television viewing and physical fitness in school age children has not been extensively studied using objective outcome measures. Methods Using a sample of 1314 children from the Québec Longitudinal Study of Child Development, we examine the association between parental reports of weekly hours of television viewing, assessed at 29 and 53 months of age, and direct measures of second grade muscular fitness using performances on the standing long jump test (SLJ and fourth grade waist circumference. Results Controlling for many potentially confounding child and family variables, each hour per week of television watched at 29 months corresponded to a .361 cm decrease in SLJ, 95% CI between -.576 and -.145. A one hour increase in average weekly television exposure from 29 to 53 months was associated with a further .285 cm reduction in SLJ test performance, 95% CI between -.436 and -.134 cm and corresponded to a .047 cm increase in waistline circumference, 95% CI between .001 and .094 cm. Interpretation Watching television excessively in early childhood, may eventually compromise muscular fitness and waist circumference in children as they approach pubertal age.

  8. Genetic parameters for claw and leg health, foot and leg conformation, and locomotion in Danish Holsteins

    DEFF Research Database (Denmark)

    Laursen, M. V.; Boelling, D.; Mark, Thomas

    2009-01-01

    The purpose of this study was to estimate the genetic correlations among claw and leg health and potential indicator traits. Claw health was defined as absence of heel horn erosion, interdigital dermatitis, interdigital phlegmon, interdigital hyperplasia, laminitis, and sole ulcer. Leg health...

  9. Modelling and Control of Robotic Leg as Assistive Device

    Science.gov (United States)

    Jingye, Yee; Zain, Badrul Aisham bin Md

    2017-10-01

    The ageing population (people older than 60 years old) is expected to constitute 21.8% of global population by year 2050. When human ages, bodily function including locomotors will deteriorate. Besides, there are hundreds of thousands of victims who suffer from multiple health conditions worldwide that leads to gait impairment. A promising solution will be the lower limb powered-exoskeleton. This study is to be a start-up platform to design a lower limb powered-exoskeleton for a normal Malaysian male, by designing and simulating the dynamic model of a 2-link robotic leg to observe its behaviour under different input conditions with and without a PID controller. Simulink in MATLAB software is used as the dynamic modelling and simulation software for this study. It is observed that the 2-links robotic leg behaved differently under different input conditions, and perform the best when it is constrained and controlled by PID controller. Simulink model is formed as a foundation for the upcoming researches and can be modified and utilised by the future researchers.

  10. One-legged endurance training: leg blood flow and oxygen extraction during cycling exercise

    DEFF Research Database (Denmark)

    Rud, B; Foss, O; Krustrup, Peter

    2012-01-01

    Aim: As a consequence of enhanced local vascular conductance, perfusion of muscles increases with exercise intensity to suffice the oxygen demand. However, when maximal oxygen uptake (VO(2) max) and cardiac output are approached, the increase in conductance is blunted. Endurance training increases...... muscle metabolic capacity, but to what extent that affects the regulation of muscle vascular conductance during exercise is unknown. Methods: Seven weeks of one-legged endurance training was carried out by twelve subjects. Pulmonary VO(2) during cycling and one-legged cycling was tested before and after...... training, while VO(2) of the trained leg (TL) and control leg (CL) during cycling was determined after training. Results: VO(2) max for cycling was unaffected by training, although one-legged VO(2) max became 6.7 (2.3)% (mean ± SE) larger with TL than with CL. Also TL citrate synthase activity was higher...

  11. A laboratory grid simulator based on three-phase four-leg inverter

    DEFF Research Database (Denmark)

    Li, Fei; Wang, Xiongfei; Chen, Zhe

    2011-01-01

    This paper presents the design and implementation of a laboratory grid simulator which is used to test the grid-connected devices according to the strict standards. Three-phase four-leg inverter with direct voltage control in Natural Frame is adopted in this grid simulator, which significantly...... and power quality. Experimental results verify the functionality and performances of the designed grid simulator....

  12. Therapeutic advances in restless legs syndrome (RLS).

    Science.gov (United States)

    Högl, Birgit; Comella, Cynthia

    2015-09-15

    Levodopa and dopamine agonists have been the main treatment for restless legs syndrome during the past decades. Although their efficacy has been well documented over the short term, long-term dopaminergic treatment is often complicated by augmentation, loss of efficacy, and other side effects. Recent large randomized controlled trials provide new evidence for the efficacy of high-potency opioids and α2δ ligands, and several post hoc analyses, meta-analyses, algorithms, and guidelines have been published, often with a specific focus, for example, on augmentation, or on management of restless legs syndrome during pregnancy. Several new contributions to understanding the pathophysiology of restless legs syndrome have been published, but at this time, whether they will have an impact on treatment possibilities in the future cannot be estimated. © 2015 International Parkinson and Movement Disorder Society.

  13. Conjoined legs: Sirenomelia or caudal regression syndrome?

    Directory of Open Access Journals (Sweden)

    Sakti Prasad Das

    2013-01-01

    Full Text Available Presence of single umbilical persistent vitelline artery distinguishes sirenomelia from caudal regression syndrome. We report a case of a12-year-old boy who had bilateral umbilical arteries presented with fusion of both legs in the lower one third of leg. Both feet were rudimentary. The right foot had a valgus rocker-bottom deformity. All toes were present but rudimentary. The left foot showed absence of all toes. Physical examination showed left tibia vara. The chest evaluation in sitting revealed pigeon chest and elevated right shoulder. Posterior examination of the trunk showed thoracic scoliosis with convexity to right. The patient was operated and at 1 year followup the boy had two separate legs with a good aesthetic and functional results.

  14. Leg Spasticity and Ambulation in Multiple Sclerosis

    Directory of Open Access Journals (Sweden)

    Swathi Balantrapu

    2014-01-01

    Full Text Available Background. Spasticity of the legs is common in multiple sclerosis (MS, but there has been limited research examining its association with ambulatory outcomes. Objective. This study examined spasticity of the legs and its association with multiple measures of ambulation in persons with MS. Methods. The sample included 84 patients with MS. Spasticity of the legs was measured using a 5-point rating scale ranging between 0 (normal and 4 (contracted. Patients completed the 6-minute walk (6 MW, timed 25 foot walk (T25FW, and timed up-and-go (TUG, and O2 cost of walking was measured during the 6 MW. The patients undertook two walking trials on a GAITRite (CIR systems, Inc. for measuring spatial and temporal parameters of gait. The patients completed the Multiple Sclerosis Walking Scale-12 (MSWS-12 and wore an accelerometer over a seven-day period. Results. 52% (n=44 of the sample presented with spasticity of the legs. Those with leg spasticity had significantly worse ambulation as measured by 6 MW (P=0.0001, d=-0.86, T25FW (P=0.003,d=0.72, TUG (P=0.001, d=0.84, MSWS-12 (P=0.0001,d=1.09, O2 cost of walking (P=0.001, d=0.75, average steps/day (P<0.05, d=-0.45, and walking velocity (P<0.05, d=-0.53 and cadence (P<0.05, d=-0.46. Conclusion. Leg spasticity was associated with impairments in ambulation, including alterations in spatiotemporal parameters and free-living walking.

  15. Energy metabolism during repeated sets of leg press exercise leading to failure or not

    DEFF Research Database (Denmark)

    Gorostiaga, Esteban M; Navarro-Amézqueta, Ion; Calbet, José A L

    2012-01-01

    This investigation examined the influence of the number of repetitions per set on power output and muscle metabolism during leg press exercise. Six trained men (age 34 ± 6 yr) randomly performed either 5 sets of 10 repetitions (10REP), or 10 sets of 5 repetitions (5REP) of bilateral leg press...... exercise, with the same initial load and rest intervals between sets. Muscle biopsies (vastus lateralis) were taken before the first set, and after the first and the final sets. Compared with 5REP, 10REP resulted in a markedly greater decrease (P...

  16. The Molecular Genetics of Restless Legs Syndrome.

    Science.gov (United States)

    Rye, David B

    2015-09-01

    Restless legs syndrome (RLS) is a common sensorimotor trait defined by symptoms that interfere with sleep onset and maintenance in a clinically meaningful way. Nonvolitional myoclonus while awake and asleep is a sign of the disorder and an informative endophenotype. The genetic contributions to RLS/periodic leg movements are substantial, are among the most robust defined to date for a common disease, and account for much of the variance in disease expressivity. The disorder is polygenic, as revealed by recent genome-wide association studies. Experimental studies are revealing mechanistic details of how these common variants might influence RLS expressivity. Copyright © 2015 Elsevier Inc. All rights reserved.

  17. Nocturnal leg cramps in older people

    Science.gov (United States)

    Butler, J; Mulkerrin, E; O'Keeffe, S

    2002-01-01

    Nocturnal leg cramps are common in older people. Such cramps are associated with many common diseases and medications. Physiological methods may be useful for preventing cramps in some people, but there have been no controlled trials of these approaches. Quinine is moderately effective in preventing nocturnal leg cramps. However, there are concerns about the risk/benefit ratio with this drug. In patients with severe symptoms, a trial of 4–6 weeks' treatment with quinine is probably still justified, but the efficacy of treatment should be monitored, for example using a sleep and cramp diary. PMID:12415081

  18. Symptom Severity of Restless Legs Syndrome Predicts Its Clinical Course.

    Science.gov (United States)

    Lee, Chung Suk; Kim, Tae; Lee, Sumin; Jeon, Hong Jun; Bang, Young Rong; Yoon, In-Young

    2016-04-01

    This study examines the clinical course of restless legs syndrome according to its severity and factors associated with the remission of restless legs syndrome symptoms. The remission or persistence of restless legs syndrome symptoms was investigated by considering patients with restless legs syndrome at the sleep clinic of Seoul National University Bundang Hospital. All subjects were observed for at least 18 months, and an incidence of remission was defined as having no restless legs syndrome symptoms for at least 1 year. Restless legs syndrome severity was evaluated by the International Restless Legs Syndrome Study Group Rating Scale. A total of 306 patients participated in this study. Over the observation periods of 4.1 ± 1.6 years, the cumulative incidence of remission is 32.5% (95% confidence interval [CI], 27.0-38.0) and decreased with baseline restless legs syndrome severity (P restless legs syndrome cases, respectively. Most cases of remission (82/96) were observed within 1 year, and the remission occurred sooner for mild restless legs syndrome. The hazard ratios of remission by Cox proportional hazards model were lower for moderate (0.556; 95% CI, 0.340-0.909) and severe to very severe (0.193; 95% CI, 0.108-0.343) restless legs syndrome than for mild restless legs syndrome. The remission incidence was lower for those patients who had a family history of restless legs syndrome and were older at restless legs syndrome diagnosis. Mild restless legs syndrome severity, no family history, and young age at restless legs syndrome diagnosis were significant predictors of restless legs syndrome remission. More than 80% of patients with severe restless legs syndrome showed a chronic clinical course. Copyright © 2016 Elsevier Inc. All rights reserved.

  19. Clinical characteristics of leg restlessness in Parkinson's disease compared with idiopathic Restless Legs Syndrome.

    Science.gov (United States)

    Zhu, Xiao-Ying; Liu, Ye; Zhang, Xiao-Jin; Yang, Wen-Hao; Feng, Ya; Ondo, William G; Tan, Eng-King; Wu, Yun-Cheng

    2015-10-15

    There is limited data on motor restlessness in Parkinson's disease (PD). Here we evaluate for clinical differences between cohorts of idiopathic Restless Legs Syndrome (iRLS), PD patients with leg restlessness, and PD with RLS. We examined 276 consecutive PD patients for leg restlessness symptoms, we compared clinical features of PD patients with RLS, PD patients with leg restlessness but not meeting RLS criteria, PD patient without RLS and iRLS. A total of 262 PD patients who satisfied the inclusion criteria were analyzed. After excluding 23 possible secondary RLS or mimics, 28 were diagnosed with RLS and 18 with leg motor restlessness (LMR). Compared with iRLS patients, PD patients with RLS or LMR had older age of RLS/LMR onset, shorter duration of leg restlessness, less positive family history, different seasonal trends and more unilaterality of leg restlessness symptom (Pleg restlessness. PD with LMR had less severe Parkinsonism (Pleg restlessness (P<0.01) symptoms than PD with RLS. Clinical characteristics of PD patients with RLS and LMR were different from iRLS, differentiating these various subtypes can facilitate optimal treatment. Copyright © 2015 Elsevier B.V. All rights reserved.

  20. Task driven optimal leg trajectories in insect-scale legged microrobots

    Science.gov (United States)

    Doshi, Neel; Goldberg, Benjamin; Jayaram, Kaushik; Wood, Robert

    Origami inspired layered manufacturing techniques and 3D-printing have enabled the development of highly articulated legged robots at the insect-scale, including the 1.43g Harvard Ambulatory MicroRobot (HAMR). Research on these platforms has expanded its focus from manufacturing aspects to include design optimization and control for application-driven tasks. Consequently, the choice of gait selection, body morphology, leg trajectory, foot design, etc. have become areas of active research. HAMR has two controlled degrees-of-freedom per leg, making it an ideal candidate for exploring leg trajectory. We will discuss our work towards optimizing HAMR's leg trajectories for two different tasks: climbing using electroadhesives and level ground running (5-10 BL/s). These tasks demonstrate the ability of single platform to adapt to vastly different locomotive scenarios: quasi-static climbing with controlled ground contact, and dynamic running with un-controlled ground contact. We will utilize trajectory optimization methods informed by existing models and experimental studies to determine leg trajectories for each task. We also plan to discuss how task specifications and choice of objective function have contributed to the shape of these optimal leg trajectories.

  1. Leg Length, Body Proportion, and Health: A Review with a Note on Beauty

    Science.gov (United States)

    Bogin, Barry; Varela-Silva, Maria Inês

    2010-01-01

    Decomposing stature into its major components is proving to be a useful strategy to assess the antecedents of disease, morbidity and death in adulthood. Human leg length (femur + tibia), sitting height (trunk length + head length) and their proportions, for example, (leg length/stature), or the sitting height ratio (sitting height/stature × 100), among others) are associated with epidemiological risk for overweight (fatness), coronary heart disease, diabetes, liver dysfunction and certain cancers. There is also wide support for the use of relative leg length as an indicator of the quality of the environment for growth during infancy, childhood and the juvenile years of development. Human beings follow a cephalo-caudal gradient of growth, the pattern of growth common to all mammals. A special feature of the human pattern is that between birth and puberty the legs grow relatively faster than other post-cranial body segments. For groups of children and youth, short stature due to relatively short legs (i.e., a high sitting height ratio) is generally a marker of an adverse environment. The development of human body proportions is the product of environmental x genomic interactions, although few if any specific genes are known. The HOXd and the short stature homeobox-containing gene (SHOX) are genomic regions that may be relevant to human body proportions. For example, one of the SHOX related disorders is Turner syndrome. However, research with non-pathological populations indicates that the environment is a more powerful force influencing leg length and body proportions than genes. Leg length and proportion are important in the perception of human beauty, which is often considered a sign of health and fertility. PMID:20617018

  2. Estimation of peak heat flux onto the targets for CFETR with extended divertor leg

    International Nuclear Information System (INIS)

    Zhang, Chuanjia; Chen, Bin; Xing, Zhe; Wu, Haosheng; Mao, Shifeng; Luo, Zhengping; Peng, Xuebing; Ye, Minyou

    2016-01-01

    Highlights: • A hypothetical geometry is assumed to extend the outer divertor leg in CFETR. • Density scan SOLPS simulation is done to study the peak heat flux onto target. • Attached–detached regime transition in out divertor occurs at lower puffing rate. • Unexpected delay of attached–detached regime transition occurs in inner divertor. - Abstract: China Fusion Engineering Test Reactor (CFETR) is now in conceptual design phase. CFETR is proposed as a good complement to ITER for demonstrating of fusion energy. Divertor is a crucial component which faces the plasmas and handles huge heat power for CFETR and future fusion reactor. To explore an effective way for heat exhaust, various methods to reduce the heat flux to divertor target should be considered for CFETR. In this work, the effect of extended out divertor leg on the peak heat flux is studied. The magnetic configuration of the long leg divertor is obtained by EFIT and Tokamak Simulation Code (TSC), while a hypothetical geometry is assumed to extend the out divertor leg as long as possible inside vacuum vessel. A SOLPS simulation is performed to study peak heat flux of the long leg divertor for CFETR. D 2 gas puffing is used and increasing of the puffing rate means increase of plasma density. Both peak heat flux onto inner and outer targets are below 10 MW/m 2 is achieved. A comparison between the peak heat flux between long leg and conventional divertor shows that an attached–detached regime transition of out divertor occurs at lower gas puffing gas puffing rate for long leg divertor. While for the inner divertor, even the configuration is almost the same, the situation is opposite.

  3. A modular artificial neural net for controlling a six-legged walking system.

    Science.gov (United States)

    Cruse, H; Bartling, C; Cymbalyuk, G; Dean, J; Dreifert, M

    1995-01-01

    A system that controls the leg movement of an animal or a robot walking over irregular ground has to ensure stable support for the body and at the same time propel it forward. To do so, it has to react adaptively to unpredictable features of the environment. As part of our study of the underlying mechanisms, we present here a model for the control of the leg movement of a 6-legged walking system. The model is based on biological data obtained from the stick insect. It represents a combined treatment of realistic kinematics and biologically motivated, adaptive gait generation. The model extends a previous algorithmic model by substituting simple networks of artificial neurons for the algorithms previously used to control leg state and interleg coordination. Each system controlling an individual leg consists of three subnets. A hierarchically superior net contains two sensory and two 'premotor' units; it rhythmically suppresses the output of one or the other of the two subordinate nets. These are continuously active. They might be called the 'swing module' and the 'stance module' because they are responsible for controlling the swing (return stroke) and the stance (power stroke) movements, respectively. The swing module consists of three motor units and seven sensory units. It can produce appropriate return stroke movements for a broad range of initial and final positions, can cope with mechanical disturbances of the leg movement, and is able to react to an obstacle which hinders the normal performance of the swing movement. The complete model is able to walk at different speeds over irregular surfaces. The control system rapidly reestablishes a stable gait when the movement of the legs is disturbed.

  4. Dynamics and Optimal Feet Force Distributions of a Realistic Four-legged Robot

    Directory of Open Access Journals (Sweden)

    Saurav Agarwal

    2012-08-01

    Full Text Available This paper presents a detailed dynamic modeling of realistic four-legged robot. The direct and inverse kinematic analysis for each leg has been considered in order to develop an overall kinematic model of the robot, when it follows a straight path. This study also aims to estimate optimal feet force distributions of the said robot, which is necessary for its real-time control. Three different approaches namely, minimization of norm of feet forces (approach 1, minimization of norm of joint torques (approach 2 and minimization of norm of joint power (approach 3 have been developed. Simulation result shows that approach 3 is more energy efficient foot force formulation than other two approaches. Lagrange-Euler formulation has been utilized to determine the joint torques. The developed dynamic models have been examined through computer simulation of continuous gait of the four-legged robot.

  5. [The influence of the leg load and the support mobility under leg on the anticipatory postural adjustment].

    Science.gov (United States)

    Kazennikov, O V; Kireeva, T B; Shlykov, V Iu

    2015-01-01

    Anticipatory postural adjustment is an essential part of equilibrium maintainance during standing in human. So changes in stance condition could affect both control of equilibrium and anticipatory adjustment. Anticipatory changes in the stabilogram of each leg were studied in standing subject during the early stage of quick right arm lifting while legs were on two separated supports. The center of pressure (CP) movement was analyzed in three variants of experiment: both legs on immovable support, with only right leg on the movable support and with only left leg on the moveable support. In each standing condition subject stood with symmetrical load on two legs or with the load voluntary transferred to one leg. The anticipatory CP shift depended on the mobility of the support under the leg and on loading of the leg. While standing on unmovable supports with symmetrical load on the legs before lifting of the right arm CP of right leg shifted backward and CP of left leg--forward. While standing with one leg on movable support the anticipatory CP shift of this leg was small and did not depend on the load on the leg. However the shift of CP of the leg that was placed on the unmovable support depended on the load in the same way as in the case when both legs were on unmovable supports. Results suggested that since on movable support the support and proprioceptive afferent flow from distal part of the leg that was did not supply unambiguous information about body position, the role of distal joints in posture control is reduced.

  6. High performance p-type segmented leg of misfit-layered cobaltite and half-Heusler alloy

    International Nuclear Information System (INIS)

    Hung, Le Thanh; Van Nong, Ngo; Snyder, G. Jeffrey; Viet, Man Hoang; Balke, Benjamin; Han, Li; Stamate, Eugen; Linderoth, Søren; Pryds, Nini

    2015-01-01

    Highlights: • p-type segmented leg of oxide and half-Heusler was for the first time demonstrated. • The maximum conversion efficiency reached a value of about 5%. • The results are among the highest reported values so far for oxide-based legs. • Oxide-based segmented leg is very promising for generating electricity. - Abstract: In this study, a segmented p-type leg of doped misfit-layered cobaltite Ca 2.8 Lu 0.15 Ag 0.05 Co 4 O 9+δ and half-Heusler Ti 0.3 Zr 0.35 Hf 0.35 CoSb 0.8 Sn 0.2 alloy was fabricated and characterized. The thermoelectric properties of single components, segmented leg, and the electrical contact resistance of the joint part were measured as a function of temperature. The output power generation characteristics of segmented legs were characterized in air under various temperature gradients, ΔT, with the hot side temperature up to 1153 K. At ΔT ≈ 756 K, the maximum conversion efficiency reached a value of ∼5%, which is about 65% of that expected from the materials without parasitic losses. The long-term stability investigation for two weeks at the hot and cold side temperatures of 1153/397 K shows that the segmented leg has good durability as a result of stable and low electrical resistance contacts

  7. An automatic hinge system for leg orthoses

    NARCIS (Netherlands)

    Rietman, J. S.; Goudsmit, J.; Meulemans, D.; Halbertsma, J. P. K.; Geertzen, J. H. B.

    2004-01-01

    This paper describes a new automatic hinge system for leg orthoses, which provides knee stability in stance, and allows knee-flexion during swing. Indications for the hinge system are a paresis or paralysis of the quadriceps muscles. Instrumented gait analysis was performed in three patients, fitted

  8. An automatic hinge system for leg orthoses

    NARCIS (Netherlands)

    Rietman, J.S.; Goudsmit, J.; Meulemans, D.; Halbertsma, J.P.K.; Geertzen, J.H.B.

    This paper describes a new, automatic hinge system for leg orthoses, which provides knee stability in stance, and allows knee-flexion during swing. Indications for the hinge system are a paresis or paralysis of the quadriceps muscles. Instrumented gait analysis was performed in three patients,

  9. Chronic leg ulcer caused by Mycobacterium immunogenum

    NARCIS (Netherlands)

    Loots, Miriam A. M.; de Jong, Menno D.; van Soolingen, Dick; Wetsteyn, José C. F. M.; Faber, William R.

    2005-01-01

    Rare tropical skin diseases are seen more frequently in Western countries because of the increased popularity of visiting tropical regions. A 55-year-old white man developed a painless leg ulcer after traveling in Guatemala and Belize. A mycobacterium was cultured from a biopsy specimen and was

  10. X-Ray Exam: Femur (Upper Leg)

    Science.gov (United States)

    ... Staying Safe Videos for Educators Search English Español X-Ray Exam: Femur (Upper Leg) KidsHealth / For Parents / X- ... Muscles, and Joints Broken Bones Getting an X-ray (Video) X-Ray (Video) View more Partner Message About Us ...

  11. The restless legs syndrome (Ekbom's syndrome)

    African Journals Online (AJOL)

    1983-04-30

    Apr 30, 1983 ... same distribution as the paraesthesiae; and (v) anxiety, tension or mild depression. Paraesthesiae or creeping sensations are usually confined to the calves. They are extremely unpleasant and deep-seated in muscles or bones rather than in the skin, mostly affecting the legs between the knee and ankle.

  12. Leg og læring

    DEFF Research Database (Denmark)

    Pedersen, Annette

    2008-01-01

    Leg synes at have et potentiale som metode til at fremme læring. Men hvordan? Legen har en vis grad af parallelitet med den virkelige verden i dens interaktive og relationelle strukturer. Det bliver muligt at finde nye meninger i interaktioner, som refererer til vante interaktionsformer, men...

  13. Functional scoliosis caused by leg length discrepancy

    Science.gov (United States)

    Daniszewska, Barbara; Zolynski, Krystian

    2010-01-01

    Introduction Leg length discrepancy (LLD) causes pelvic obliquity in the frontal plane and lumbar scoliosis with convexity towards the shorter extremity. Leg length discrepancy is observed in 3-15% of the population. Unequalized lower limb length discrepancy leads to posture deformation, gait asymmetry, low back pain and discopathy. Material and methods In the years 1998-2006, 369 children, aged 5 to 17 years (209 girls, 160 boys) with LLD-related functional scoliosis were treated. An external or internal shoe lift was applied. Results Among 369 children the discrepancy of 0.5 cm was observed in 27, 1 cm in 329, 1.5 cm in 9 and 2 cm in 4 children. During the first follow-up examination, within 2 weeks, the adjustment of the spine to new static conditions was noted and correction of the curve in 316 examined children (83.7%). In 53 children (14.7%) the correction was observed later and was accompanied by slight low back pain. The time needed for real equalization of limbs was 3 to 24 months. The time needed for real equalization of the discrepancy was 11.3 months. Conclusions Leg length discrepancy equalization results in elimination of scoliosis. Leg length discrepancy < 2 cm is a static disorder; that is why measurements should be performed in a standing position using blocks of adequate thickness and the position of the posterior superior iliac spine should be estimated. PMID:22371777

  14. Omnidirectional Wheel-Legged Hybrid Mobile Robot

    Directory of Open Access Journals (Sweden)

    István Vilikó

    2015-06-01

    Full Text Available The purpose of developing hybrid locomotion systems is to merge the advantages and to eliminate the disadvantages of different type of locomotion. The proposed solution combines wheeled and legged locomotion methods. This paper presents the mechatronic design approach and the development stages of the prototype.

  15. Parallel kinematics robot with five legs

    NARCIS (Netherlands)

    Lambert, P.

    2011-01-01

    Robot with multiple degrees of freedom comprising five legs (2) linked at a first of their ends to a base ( 3), and at a second of their ends opposite to the first ends to a mobile platform (4), which platform carries at least one tool (5, 6, 121, 12 "), and wherein the robot further comprises an

  16. Template model inspired leg force feedback based control can assist human walking.

    Science.gov (United States)

    Zhao, Guoping; Sharbafi, Maziar; Vlutters, Mark; van Asseldonk, Edwin; Seyfarth, Andre

    2017-07-01

    We present a novel control approach for assistive lower-extremity exoskeletons. In particular, we implement a virtual pivot point (VPP) template model inspired leg force feedback based controller on a lower-extremity powered exoskeleton (LOPES II) and demonstrate that it can effectively assist humans during walking. It has been shown that the VPP template model is capable of stabilizing the trunk and reproduce a human-like hip torque during the stance phase of walking. With leg force and joint angle feedback inspired by the VPP template model, our controller provides hip and knee torque assistance during the stance phase. A pilot experiment was conducted with four healthy subjects. Joint kinematics, leg muscle electromyography (EMG), and metabolic cost were measured during walking with and without assistance. Results show that, for 0.6 m/s walking, our controller can reduce leg muscle activations, especially for the medial gastrocnemius (about 16.0%), while hip and knee joint kinematics remain similar to the condition without the controller. Besides, the controller also reduces 10% of the net metabolic cost during walking. This paper demonstrates walking assistance benefits of the VPP template model for the first time. The support of human walking is achieved by a force feedback of leg force applied to the control of hip and knee joints. It can help us to provide a framework for investigating walking assistance control in the future.

  17. Interleaved power converter

    Science.gov (United States)

    Zhu, Lizhi

    2007-11-13

    A power converter architecture interleaves full bridge converters to alleviate thermal management problems in high current applications, and may, for example, double the output power capability while reducing parts count and costs. For example, one phase of a three phase inverter is shared between two transformers, which provide power to a rectifier such as a current doubler rectifier to provide two full bridge DC/DC converters with three rather than four high voltage inverter legs.

  18. Interventions for leg cramps in pregnancy.

    Science.gov (United States)

    Zhou, Kunyan; West, Helen M; Zhang, Jing; Xu, Liangzhi; Li, Wenjuan

    2015-08-11

    Leg cramps are a common problem in pregnancy. Various interventions have been used to treat them, including drug, electrolyte and vitamin therapies, and non-drug therapies. To assess the effectiveness and safety of different interventions for treating leg cramps in pregnancy. We searched the Cochrane Pregnancy and Childbirth Group's Register (31 March 2015) and reference lists of retrieved studies. Randomised controlled trials (RCTs) of any intervention (drug, electrolyte, vitamin or non-drug therapies) for treatment of leg cramps in pregnancy compared with placebo, no treatment or other treatment. Quinine was excluded for its known adverse effects (teratogenicity). Cluster-RCTS were considered for inclusion. Quasi-RCTs and cross-over studies were excluded. Two review authors independently assessed trials for inclusion and risk of bias, extracted data and checked them for accuracy. We included six studies (390 women). Four trials compared oral magnesium with placebo/no treatment, two compared oral calcium with no treatment, one compared oral vitamin B versus no treatment, and one compared oral calcium with oral vitamin C. Two of the trials were well-conducted and reported, the other four had design limitations. The process of random allocation was sub-optimal in three studies, and blinding was not attempted in two. Outcomes were reported in different ways, precluding the use of meta-analysis and limiting the strength of our conclusions.The 'no treatment' group in one four-arm trial has been used as the comparison group for the composite outcome (intensity and frequency of leg cramps) in magnesium, calcium, and vitamin B versus no treatment. This gives it disproportionate weight in the overall analysis, thus interpretation of these results should be cautious. Oral magnesium versus placebo/no treatmentMagnesium (taken orally for two to four weeks) did not consistently reduce the frequency of leg cramps compared with placebo or no treatment. Outcomes that showed

  19. Protection against high intravascular pressure in giraffe legs

    DEFF Research Database (Denmark)

    Petersen, Karin K; Hørlyck, Arne; Østergaard, Kristine Hovkjær

    2013-01-01

    The high blood pressure in giraffe leg arteries renders giraffes vulnerable to edema. We investigated in 11 giraffes whether large and small arteries in the legs and the tight fascia protect leg capillaries. Ultrasound imaging of foreleg arteries in anesthetized giraffes and ex vivo examination...

  20. Immediate effects of the trunk stabilizing exercise on static balance parameters in double-leg and one-leg stances

    OpenAIRE

    Kim, Jwa-jun; Park, Se-yeon

    2016-01-01

    [Purpose] The purpose of this study was to evaluate the immediate effect of stabilizing exercise using the PNF technique on standing balance in one-leg and double-leg stances. [Subjects and Methods] The present study recruited 34 healthy participants from a local university. The Participants performed four balance tests (double-leg stance with and without vision, one-leg stance with and without vision), before and after exercise. The exercise consisted of exercises performed using PNF techniq...

  1. Clinical quality indicators of venous leg ulcers

    DEFF Research Database (Denmark)

    Kjaer, Monica L; Mainz, Jan; Soernsen, Lars T

    2005-01-01

    and reliable evidence-based quality indicators of venous leg ulcer care. A Scandinavian multidisciplinary, cross-sectional panel of wound healing experts developed clinical quality indicators on the basis of scientific evidence from the literature and subsequent group nominal consensus of the panel......; an independent medical doctor tested the feasibility and reliability of these clinical indicators, assessing the quality of medical technical care on 100 consecutive venous leg ulcer patients. Main outcome measures were healing, recurrence, pain, venous disease diagnosis, differential diagnosis and treatment......%) were assessed for venous surgery. Distal arterial pressure was measured following initial examination in 33 of the patients (34%). All patients (100%) were prescribed compression therapy. Of the 98 patients, 11 (11%) had ulcers recur in 3 months and 72 (73%) healed in 12 months, which is in line...

  2. Is preeclampsia associated with restless legs syndrome?

    OpenAIRE

    Ramirez, J O; Cabrera, S A S; Hidalgo, H; Cabrera, S G; Linnebank, M; Bassetti, C L; Kallweit, U

    2013-01-01

    OBJECTIVE: Restless legs syndrome (RLS) is a common neurologic disorder. Secondary RLS includes pregnancy and iron deficiency. Prevalence of RLS in pregnancy ranges from 11% to 27%. We aimed to assess the frequency and characteristics of RLS in pregnancy in a Peruvian population and to evaluate the possible pregnancy or delivery complications due to RLS. METHODS: We assessed 218 consecutive expectant mothers at the inpatient clinic of the Hospital San Bartolome in Lima, Peru. Assessment wa...

  3. Genetic aspects of restless legs syndrome

    OpenAIRE

    Dhawan, V; Ali, M; Chaudhuri, K R

    2006-01-01

    Restless legs syndrome (RLS), also known as Ekbom syndrome, is a common movement disorder with sensorimotor symptoms occurring during sleep and quiet wakefulness. The underlying cause for RLS is unknown but genetic influences play a strong part in the pathogenesis of RLS, particularly when the condition starts at a young age. This review explores the genetic basis of RLS and related phenotypic variations. Recently, three loci showing vulnerability to RLS have been described in French‐Canadian...

  4. Restless legs syndrome and pregnancy: A review

    OpenAIRE

    Srivanitchapoom, Prachaya; Pandey, Sanjay; Hallett, Mark

    2014-01-01

    Restless legs syndrome (RLS) is a common sensorimotor neurological disorder that is diagnosed according to the revised criteria of the International RLS Study Group (IRLSSG). The pathophysiology of RLS is still unknown and its prevalence is influenced by ethnicity, age, and gender. RLS is divided into two types by etiology: primary or idiopathic and secondary. Primary RLS is strongly influenced by a genetic component while secondary RLS is caused by other associated conditions such as end-sta...

  5. Proprioceptive Actuation Design for Dynamic Legged locomotion

    Science.gov (United States)

    Kim, Sangbae; Wensing, Patrick; Biomimetic Robotics Lab Team

    Designing an actuator system for highly-dynamic legged locomotion exhibited by animals has been one of the grand challenges in robotics research. Conventional actuators designed for manufacturing applications have difficulty satisfying challenging requirements for high-speed locomotion, such as the need for high torque density and the ability to manage dynamic physical interactions. It is critical to introduce a new actuator design paradigm and provide guidelines for its incorporation in future mobile robots for research and industry. To this end, we suggest a paradigm called proprioceptive actuation, which enables highly- dynamic operation in legged machines. Proprioceptive actuation uses collocated force control at the joints to effectively control contact interactions at the feet under dynamic conditions. In the realm of legged machines, this paradigm provides a unique combination of high torque density, high-bandwidth force control, and the ability to mitigate impacts through backdrivability. Results show that the proposed design provides an impact mitigation factor that is comparable to other quadruped designs with series springs to handle impact. The paradigm is shown to enable the MIT Cheetah to manage the application of contact forces during dynamic bounding, with results given down to contact times of 85ms and peak forces over 450N. As a result, the MIT Cheetah achieves high-speed 3D running up to 13mph and jumping over an 18-inch high obstacle. The project is sponsored by DARPA M3 program.

  6. Sleep board review question: restless legs

    Directory of Open Access Journals (Sweden)

    Omobomi O

    2018-02-01

    Full Text Available No abstract available. Article truncated after 150 words. Ms. Jones (not her real name is a 63-year-old woman who states that she gets very fidgety when sitting in a theater, watching a movie or when flying long distances on a plane. She is unable to find words to describe the sensation but she states that moving her legs make them feel better. Lately, she has been getting this feeling almost every night. She reports no leg discomfort in the daytime. She denies muscle cramps her legs. She had some recent investigations done by her primary care physician because of complaints of fatigue. Which of the following will be helpful in the diagnosis and management in this patient? 1. An overnight polysomnogram showing apnea hypopnea index of 1.6 events per hour and no periodic limb movements (PLMs 2. Ferritin level of 18 ng/ml (normal range 20-200 ng/ml 3. Serum Bicarbonate of 29 mEq/L (normal range 23-29 mEq/L 4. Thyroid …

  7. Restless Legs Syndrome Among the Elderly

    Directory of Open Access Journals (Sweden)

    Pei-Hao Chen

    2009-12-01

    Full Text Available Restless legs syndrome is a sleep and movement disorder that affects 5–15% of the general population, with an increased prevalence among the elderly population. It not only affects quality of life but also increases risk of mortality among older adults. The diagnosis is based on clinical symptoms of the patient by four minimal essential criteria. Restless legs syndrome can be divided into primary or secondary causes. Examination should be performed to rule out potentially treatable illnesses, such as iron deficiency, renal failure or peripheral neuropathy, especially among elderly patients. The initial approach to restless legs syndrome should be nonpharmacologic management, such as good sleep hygiene, regular exercise, cognitive behavioral therapy and avoidance of certain aggravating drugs. An algorithm based on scientific evidence and expert opinion was developed for guidance of treatment. Combination or change of medication can be applied to resistant or difficult cases. Since elderly patients are prone to treatment-related side effects, the best strategy is to start medication cautiously and at the lowest recommended dosage.

  8. Can't Curb the Urge to Move? Living with Restless Legs Syndrome

    Science.gov (United States)

    ... Sleep? Wise Choices Recognizing Restless Legs Restless legs syndrome brings all 4 of these characteristics: A strong urge to move your legs, often with unpleasant feelings like tingling, burning or throbbing in the legs. Symptoms that get better ... Legs Syndrome Fact Sheet What Is Restless Legs Syndrome? Brain ...

  9. Restless Legs Syndrome and Leg Motor Restlessness in Parkinson’s Disease

    Directory of Open Access Journals (Sweden)

    Keisuke Suzuki

    2015-01-01

    Full Text Available Sleep disturbances are important nonmotor symptoms in Parkinson’s disease (PD that are associated with a negative impact on quality of life. Restless legs syndrome (RLS, which is characterized by an urge to move the legs accompanied by abnormal leg sensations, can coexist with PD, although the pathophysiology of these disorders appears to be different. RLS and PD both respond favorably to dopaminergic treatment, and several investigators have reported a significant relationship between RLS and PD. Sensory symptoms, pain, motor restlessness, akathisia, and the wearing-off phenomenon observed in PD should be differentiated from RLS. RLS in PD may be confounded by chronic dopaminergic treatment; thus, more studies are needed to investigate RLS in drug-naïve patients with PD. Recently, leg motor restlessness (LMR, which is characterized by an urge to move the legs that does not fulfill the diagnostic criteria for RLS, has been reported to be observed more frequently in de novo patients with PD than in age-matched healthy controls, suggesting that LMR may be a part of sensorimotor symptoms intrinsic to PD. In this paper, we provide an overview of RLS, LMR, and PD and of the relationships among these disorders.

  10. Effect of Renal Transplantation in Restless Legs Syndrome.

    Science.gov (United States)

    Kahvecioglu, Serdar; Yildiz, Demet; Buyukkoyuncu, Nilufer; Celik, Huseyin; Tufan, Fatih; Kılıç, Ahmet Kasım; Gul, Bulent; Yildiz, Abdulmecid

    2016-02-01

    Restless legs syndrome is a disorder in which patients have irresistible urge to move legs during rest. Restless legs syndrome seems to be common in end-stage renal disease. After a successful renal transplant, symptoms ameliorate with renal function improvement and restless legs syndrome is seen less in this population. Here, we aimed to investigate restless legs syndrome frequency and associated factors in renal transplant patients. In a cross-sectional study with 193 patients (116 hemodialysis patients, 45 transplant patients, and 32 controls), the presence of restless legs syndrome was assessed using the Restless Legs Syndrome Questionnaire. Medical history, demographic, and laboratory data were collected from the patients' medical records. Patients were questioned about the presence of restless legs syndrome using the Restless Legs Syndrome Questionnaire. Patients were evaluated with Beck Depression Scale for depression and Pittsburgh tests for sleep disturbances. While the rate of restless legs syndrome was similar between transplants and controls, it was significantly greater in hemodialysis patients. Hemodialysis patients and controls had similar depression scores that were higher compared with transplant patients. Pittsburgh score was similar in transplant patients and controls and significantly increased in the hemodialysis patients. The rate of insomnia was significantly higher in the hemodialysis patients compared with the other 2 groups. Logistic regression analysis revealed independent correlates of restless legs syndrome as insomnia, Beck depression score, and being on hemodialysis. Linear regression analysis showed that independent correlates of higher Pittsburgh score were higher depression score, higher age, and presence of restless legs syndrome. The prevalence of restless legs syndrome is significantly lower in transplant patients than it is in patients on maintenance dialysis. In renal transplant patients, restless legs syndrome frequency was

  11. Leg movements during wakefulness in restless legs syndrome: time structure and relationships with periodic leg movements during sleep.

    Science.gov (United States)

    Ferri, Raffaele; Manconi, Mauro; Plazzi, Giuseppe; Bruni, Oliviero; Cosentino, Filomena I I; Ferini-Strambi, Luigi; Zucconi, Marco

    2012-05-01

    Approximately one third of patients with restless legs syndrome (RLS) also show periodic leg movements (PLM) during relaxed wake fulness (PLMW). In contrast with the large amount of data published on periodic leg movements during sleep (PLMS), PLMW have received less attention from the scientific community. The objective of this study was to evaluate the correlations/differences of time-structure and response to a dopamine-agonist between PLMW and PLMS in patients with RLS. Ninety idiopathic RLS patients and 28 controls were recruited. Subjects underwent clinical and neurophysiological evaluation, hematological screening, and one or two consecutive full-night polysomnographic studies. A subset of patients received 0.25mg of pramipexole or placebo before the second recording. Polysomnographic recordings were scored and LM activity was analyzed during sleep and during the epochs of wakefulness occurring during the first recording hour. RLS patients had higher LM activity during wakefulness than controls, but with a similar periodicity. Even if correlated, the ability of the PLMW index to predict the PLMS index decreased with increasing LM activity. Intermovement intervals during wakefulness showed one peak only at approximately 4s, gradually decreasing with increasing interval in both patients and controls. The effect of pramipexole was very limited and involved the small periodic portion of LM activity during wakefulness. PLMW index and PLMS index were correlated; however, the magnitude of this correlation was not sufficient to suggest that PLMW can be good predictors of PLMS. Short-interval LM activity during wakefulness and sleep might be linked to the severity of sleep disruption in RLS patients and the differences between their features obtained during wakefulness or sleep might be relevant for the diagnosis of sleep disturbances in RLS. Copyright © 2012 Elsevier B.V. All rights reserved.

  12. Restless legs syndrome and nocturnal leg cramps: a review and guide to diagnosis and treatment.

    Science.gov (United States)

    Tipton, Philip W; Wszołek, Zbigniew K

    2017-12-22

    Restless legs syndrome (RLS) and nocturnal leg cramps (NLCs) are common disorders affecting 7.0% and 24.1% of the population in some European countries, respectively. Patients suffering from RLS experience uncomfortable nocturnal sensations in the legs with the urge to move that dissipates while moving. NLC is characterized by abrupt muscle contraction, most often in the gastrocnemius or foot muscles, which occurs at night and may result in significant sleep disturbances. The diagnosis of these disorders has presented a challenge to health care providers because of symptom overlap with other sensory and motor disturbances with nocturnal predominance. Treatment options and approaches are lacking, partially because of our currently incomplete understanding of the pathophysiological mechanisms underlying these conditions. We reviewed the medical literature to provide a comprehensive assessment of RLS and NLC with a focus on improved diagnostic accuracy and treatment approaches.

  13. Actigraphic assessment of periodic leg movements in patients with restless legs syndrome.

    Science.gov (United States)

    Cippà, Maria A T; Baumann, Christian R; Siccoli, Massimiliano M; Bassetti, Claudio L; Poryazova, Rositsa; Werth, Esther

    2013-10-01

    The diagnosis of restless legs syndrome (RLS) relies upon diagnostic criteria which are based on history only, and dopaminergic treatment is not normally the first choice of treatment for all patients. It would be worthwhile to identify patients non-responsive to dopaminergic treatment beforehand, because they may suffer from a restless legs-like syndrome and may require alternative treatment. We included retrospectively 24 adult patients fulfilling the four essential criteria for restless legs and 12 age-matched healthy controls. They were investigated by ambulatory actigraphy from both legs over three nights, and patients started treatment with dopamine agonists after this diagnostic work-up. We examined 12 responders to dopaminergic treatment and 12 non-responders and studied the association between response to dopaminergic treatment and the periodic limb movement index (PLMI) as assessed with actigraphy. Demographic characteristics, excessive daytime sleepiness and fatigue at baseline were similar in all three groups. Baseline RLS severity was similar between responders and non-responders [International Restless Legs Severity Scale (IRLS): 25 ± 9 and 24 ± 8]. Group comparisons of PLMI before treatment initiation showed significant differences between the three groups. Post-hoc pairwise comparisons revealed that healthy controls had significantly lower PLMI (4.9 ± 4.5) than responders (29.3 ± 22.7) and non-responders (13.3 ± 11.2). Similarly, the PLMI in responders was lower than in non-responders. PLMI day-to-day variability did not differ between responders and non-responders and there was no correlation between treatment effect, as assessed by the decrease of the IRLS and baseline PLMI. Our retrospective study indicates that actigraphy to assess periodic limb movements may contribute to a better diagnosis of dopamine-responsive restless legs syndrome. © 2013 European Sleep Research Society.

  14. Profile of altered brain iron acquisition in restless legs syndrome

    Science.gov (United States)

    Ponnuru, Padmavathi; Wang, Xin-Sheng; Patton, Stephanie M.; Allen, Richard P.; Earley, Christopher J.

    2011-01-01

    Restless legs syndrome is a neurological disorder characterized by an urgency to move the legs during periods of rest. Data from a variety of sources provide a compelling argument that the amount of iron in the brain is lower in individuals with restless legs syndrome compared with neurologically normal individuals. Moreover, a significant percentage of patients with restless legs syndrome are responsive to intravenous iron therapy. The mechanism underlying the decreased iron concentrations in restless legs syndrome brains is unknown. We hypothesize that the source of the brain iron deficit is at the blood–brain interface. Thus we analysed the expression of iron management proteins in the epithelial cells of the choroid plexus and the brain microvasculature in post-mortem tissues. The choroid plexus, obtained at autopsy, from 18 neurologically normal controls and 14 individuals who had primary restless legs syndrome was subjected to histochemical staining for iron and immunostaining for iron management proteins. Iron and heavy chain ferritin staining was reduced in the epithelial cells of choroid plexus in restless legs syndrome. Divalent metal transporter, ferroportin, transferrin and its receptor were upregulated in the choroid plexus in restless legs syndrome. Microvessels were isolated from the motor cortex of 11 restless legs syndrome and 14 control brains obtained at autopsy and quantitative immunoblot analyses was performed. Expression of heavy chain ferritin, transferrin and its receptor in the microvessels from restless legs syndrome was significantly decreased compared with the controls but divalent metal protein 1, ferroportin, prohepcidin, mitochondrial ferritin and light-chain ferritin remained unchanged. The presence of an iron regulatory protein was demonstrated in the brain microvasculature and the activity of this protein is decreased in restless legs syndrome; a finding similar to our earlier report in neuromelanin cells from the substantia

  15. Leg movement tracking in automatic video-based one-leg stance evaluation.

    Science.gov (United States)

    Kawa, Jacek; Stępień, Paula; Kapko, Wojciech; Niedziela, Aleksandra; Derejczyk, Jarosław

    2018-04-01

    Falls are a major risk in elder population. Early diagnosis is therefore an important step towards increasing the safety of elders. One of the common diagnostic tests is the Berg Balance Scale (BBS), consisting of 14 exercises arranged from the easiest (sitting-to-standing) to the most demanding (one-leg stance). In this study a novel approach to the automatic assessment of the time in which the patient can remain in the one-leg stance position without loosing balance is introduced. The data is collected using a regular video camera. No markers, special garments, or system calibration are required. Two groups are examined. The first group consists of 16 students: healthy, young adults (12 female, 4 male, avg. 20yrs±1). The second group consists of 50 elders (39 female, 11 male, avg. 78.8yrs±5.9). Data (short, one minute recordings) are collected in a controlled environment using a digital video recorder (50fps, 1920×1080) fixed to a tripod. Data are processed off-line. First, the region of interest is determined. Next, the Kanade-Lucas-Tomasi tracking is performed. Best tracks are selected based on the registered vertical movement and two tracks are obtained corresponding to the left and right leg movements. Tracks are later subjected to the sparse signal baseline estimation, denoising and thresholding to detect the raised leg. Results are compared frame-wise to the ground truth reference obtained in the manual processing procedure. Both legs are evaluated in the elder group (in all cases several attempts featuring both legs were registered), resulting in 89.18%±11.27% DICE, 93.07%±5.43% sensitivity and 96.94%±6.11% specificity values for both legs. The signal of a single leg is evaluated in the student group (in all cases only one attempt was needed to perform the full examination) resulting in 98.96%±1.2% DICE, 98.78%±1.65% sensitivity and 98.73%±2.69% specificity values. This is the first step towards a video-based system enabling the automatic

  16. Relationship between Leg Mass, Leg Composition and Foot Velocity on Kicking Accuracy in Australian Football.

    Science.gov (United States)

    Hart, Nicolas H; Nimphius, Sophia; Spiteri, Tania; Cochrane, Jodie L; Newton, Robert U

    2016-06-01

    Kicking a ball accurately over a desired distance to an intended target is arguably the most important skill to acquire in Australian Football. Therefore, understanding the potential mechanisms which underpin kicking accuracy is warranted. The aim of this study was to examine the relationship between leg mass, leg composition and foot velocity on kicking accuracy in Australian Football. Thirty-one Australian Footballers (n = 31; age: 22.1 ± 2.8 years; height: 1.81 ± 0.07 m; weight: 85.1 ± 13.0 kg; BMI: 25.9 ± 3.2) each performed ten drop punt kicks over twenty metres to a player target. Athletes were separated into accurate (n = 15) and inaccurate (n = 16) kicking groups. Leg mass characteristics were assessed using whole body DXA scans. Foot velocity was determined using a ten-camera optoelectronic, three-dimensional motion capture system. Interactions between leg mass and foot velocity evident within accurate kickers only (r = -0.670 to -0.701). Relative lean mass was positively correlated with kicking accuracy (r = 0.631), while no relationship between foot velocity and kicking accuracy was evident in isolation (r = -0.047 to -0.083). Given the evident importance of lean mass, and its interaction with foot velocity for accurate kickers; future research should explore speed-accuracy, impulse-variability, limb co-ordination and foot-ball interaction constructs in kicking using controlled with-in subject studies to examine the effects of resistance training and skill acquisition programs on the development of kicking accuracy. Key pointsAccurate kickers expressed a very strong inverse relationship between leg mass and foot velocity. Inaccurate kickers were unable to replicate this, with greater volatility in their performance, indicating an ability of accurate kickers to mediate foot velocity to compensate for leg mass in order to deliver the ball over the required distance.Accurate kickers exhibited larger quantities of relative lean mass and lower quantities

  17. Robust and efficient walking with spring-like legs

    International Nuclear Information System (INIS)

    Rummel, J; Blum, Y; Seyfarth, A

    2010-01-01

    The development of bipedal walking robots is inspired by human walking. A way of implementing walking could be performed by mimicking human leg dynamics. A fundamental model, representing human leg dynamics during walking and running, is the bipedal spring-mass model which is the basis for this paper. The aim of this study is the identification of leg parameters leading to a compromise between robustness and energy efficiency in walking. It is found that, compared to asymmetric walking, symmetric walking with flatter angles of attack reveals such a compromise. With increasing leg stiffness, energy efficiency increases continuously. However, robustness is the maximum at moderate leg stiffness and decreases slightly with increasing stiffness. Hence, an adjustable leg compliance would be preferred, which is adaptable to the environment. If the ground is even, a high leg stiffness leads to energy efficient walking. However, if external perturbations are expected, e.g. when the robot walks on uneven terrain, the leg should be softer and the angle of attack flatter. In the case of underactuated robots with constant physical springs, the leg stiffness should be larger than k-tilde = 14 in order to use the most robust gait. Soft legs, however, lack in both robustness and efficiency.

  18. Loading and performance of the support leg in kicking.

    Science.gov (United States)

    Ball, Kevin

    2013-09-01

    The punt kick is important in many football codes and support leg kinematics and ground reaction forces have been implicated in injury and performance in kicking. To evaluate ground reaction forces and support leg kinematics in the punt kick. Cross sectional study. Seven elite Australian football players performed maximal kicks into a net using both the preferred and non-preferred legs. A force plate measured ground reaction forces and an optical motion capture system (200Hz) collected kinematic data during the stance phase of the kick. Preferred and non-preferred legs were compared and performance was evaluated by correlating parameters with foot speed at ball contact. Vertical forces were larger than running at a similar speed but did not reach levels that might be considered an injury risk. Braking forces were directed solely posteriorly, as for soccer kicks, but lateral force patterns varied with some players experiencing greater forces medially and others laterally. A more extended support leg, larger peak vertical and braking force during the stance phase and a shorter stance contact time was associated with larger kick leg foot speed at ball contact. No difference existed between the preferred and non-preferred legs for ground reaction forces or support leg mechanics. To punt kick longer, a straighter support leg, less time on the ground and stronger braking should be encouraged. Conditioning the support leg to provide stronger braking potential is recommended. Copyright © 2012 Sports Medicine Australia. Published by Elsevier Ltd. All rights reserved.

  19. Leg stiffness and sprint ability in amputee sprinters.

    Science.gov (United States)

    Hobara, Hiroaki; Tominaga, Shuichi; Umezawa, Shingo; Iwashita, Koudai; Okino, Atsuo; Saito, Taku; Usui, Fumio; Ogata, Toru

    2012-09-01

    Understanding leg stiffness (K (leg)) in amputee sprinters is important for the evaluation of their sprint ability and development of running-specific prostheses (RSP). To investigate K (leg) during hopping in amputee sprinters. Cross-sectional study. Seven transtibial (TT) and seven transfemoral (TF) amputee sprinters, as well as seven non-active able-bodied subjects, performed one-legged hopping matching metronome beats at 2.2 Hz. Amputees hopped on their sound limb whereas able-bodied (AB) subjects hopped on their dominant limb. Using a spring-mass model, K (leg) was calculated from the subjects' body mass, ground contact and flight times. Both TT and TF sprinters demonstrated significantly higher K (leg) than AB subjects. K (leg) during hopping on the sound leg significantly correlated with personal records attained in a 100-m sprint in both TT (r = -0.757) and TF sprinters (r = -0.855). The results of the present study suggest that amputee sprinters have a greater K (leg) during hopping than inactive non-amputees, and that their sprint ability can be predicted from the K (leg) during hopping at 2.2 Hz on the sound limb.

  20. Association between serum hepcidin level and restless legs syndrome.

    Science.gov (United States)

    Dauvilliers, Yves; Chenini, Sofiene; Vialaret, Jérôme; Delaby, Constance; Guiraud, Lily; Gabelle, Audrey; Lopez, Regis; Hirtz, Christophe; Jaussent, Isabelle; Lehmann, Sylvain

    2018-02-08

    To better understand the role of iron homeostasis dysregulation in restless legs syndrome, we compared serum hepcidin and ferritin levels in drug-free patients with primary restless legs syndrome and healthy controls and studied the relationship between hepcidin level and restless legs syndrome severity. One hundred and eight drug-free patients with primary restless legs syndrome (65 women; median age, 61.5 years) and 45 controls (28 women; median age, 53.9 years) were enrolled. Inclusion criteria were: normal ferritin level (>50 ng/mL) and absence of iron disorders, chronic renal or liver failure, and inflammatory or neurological diseases. Each subject underwent a thorough clinical examination and a polysomnography assessment. Serum hepcidin-25 was quantified using a validated mass spectrometry method. Restless legs syndrome severity was evaluated according to the International Restless Legs Syndrome Study Group. Despite no group difference between normal ferritin levels and demographic features, serum hepcidin level and hepcidin/ferritin ratio were higher in patients than in controls. Hepcidin level and hepcidin/ferritin ratio, but not ferritin level, were positively correlated with periodic leg movements during sleep and wakefulness in the whole sample. Hepcidin level seem to be associated with restless legs syndrome severity in a complex U-shaped relationship, without relationship with age at restless legs syndrome onset, positive family history, sleep and depressive symptoms, genetic background, and polysomnographic measurements. No relationship was found between ferritin level and restless legs syndrome severity. In drug-free patients with primary restless legs syndrome, hepcidin level is higher than in controls and may be associated with restless legs syndrome clinical severity. This result emphasizes the complex peripheral iron metabolism deregulation in restless legs syndrome, opening potential perspectives for a personalized approach with a hepcidin

  1. On the Necessity of Including Joint Passive Dynamics in the Impedance Control of Robotic Legs

    Directory of Open Access Journals (Sweden)

    Juan Carlos Arevalo

    2014-07-01

    Full Text Available Bioinspired quadruped robots are among the best robot designs for field missions over the complex terrain encountered in extraterrestrial landscapes and disaster scenarios caused by natural and human-made catastrophes, such as those caused by nuclear power plant accidents and radiological emergencies. For such applications, the performance characteristics of the robots should include high mobility, adaptability to the terrain, the ability to handle a large payload and good endurance. Nature can provide inspiration for quadruped designs that are well suited for traversing complex terrain. Horse legs are an example of a structure that has evolved to exhibit good performance characteristics. In this paper, a leg design exhibiting the key features of horse legs is briefly described. This leg is an underactuated mechanism because it has two actively driven degrees of freedom (DOFs and one passively driven DOF. In this work, two control laws intended to be use in the stan ce phase are described: a control law that considers passive mechanism dynamics and a second law that neglects these dynamics. The performance of the two control laws is experimentally evaluated and compared. The results indicate that the first control law better achieves the control goal; however, the use of the second is not completely unjustified.

  2. Sleep disturbances in restless legs syndrome

    Directory of Open Access Journals (Sweden)

    Jović Jasmina

    2018-01-01

    Full Text Available Background/Aim. Resteless legs syndrome (RLS is chronical neurological disorder characterized by urge to move legs that is usually accompanied by unpleasant sensations in the lower extremities. Sleep disturbance is one of the main accompanying symptoms of RLS which exists in approximatelly 90% of patients. Impairment of sleep is related to daily sleepiness, depressive and anxiety disorders. The aim of this study was to detect frequency and characterisitics of sleep-related symptoms in patients with RLS, and its impairrment to daily sleepiness, fatique, anxiety and depression. Methods. We have examinated 94 patients with RLS. The diagnose of RLS was based on questionnaire with 4 specific questions according to the International Restless Legs Syndrome Study Group (IRLSSG criteria updated in 2003. Severity of symptoms was astimated with IRLSSG Rating Scale, depression and anxiety with Hamilton Depression Rating Scale (HDRS and Hamilton Anxiety Rating Scale (HARS and sleepiness with Epworth Sleepiness scale (ESS. We astimated sleep characteristics and disturbances with specific questionnaire. Results. In our study 79.9% of patients had sleep-related symptoms. Average sleep duration was 6.50 ± 1.42 hours, with average frequency of awakening 2.34 ± 1.69 times per night. Average ESS score was 5.12 ± 4.08 (0–17. Patients with more severe symptoms had higher degree of sleepiness (p = 0.005. Patients with higher symptoms frequency, significantly more often had sleep disturbance (p = 0.016, tiredness and daily sleepiness (p = 0.001. Daily sleepiness (ESS also significantly correlates with depression (p < 0.05 and anxiety (p = 0.012. Conclusion. Our results confirm that sleep disturbances are one of the key accompanying symptoms of RLS which cause daily sleepiness, tiredness, depression and anxiety. Therefore, their early recognition and appropriate treatment must be a priority in RLS patients.

  3. [Bow legged adjectives in ancient literature].

    Science.gov (United States)

    Simon, Frantisek; Steger, Florian

    2011-01-01

    This article addresses the issue of capturing the medical entity called 'curved legs' in a terminologically exact way. In so doing, it refers to the long-lasting process of differentiation of exact nuances of meaning in Ancient Greek and Latin. In the chronological perusal of ancient Greek literature, it becomes evident that the various adjectives employed are often vague when looking at non-medical literature. By contrast, in the Hippocratic corpus these terms are for the first time annotated with explanations intended to lead to a more precise understanding of the described deformity. Further attempts of differentiation can be found in the writings of Galen, who not only distinguishes between outward and inward curvatures, but also between deformities of the thigh and lower leg as well as between pathological and natural curvatures. Latin literature also provides a series of adjectives that were initially often used in the meaning of 'curved' but it was not until Celsus that these were differentiated with respect to the type and direction of the curvature. When comparing Greek and Latin adjectives, it turns out that though the Latin term blaesus can be traced back etymologically to the Greek word beta lambda alpha iota sigma ó zeta, the meaning of beta lambda alpha iota sigma ó zeta does not fully correspond to that of the Latin word. It is not before the later common transliteration of Greek words that this adjective took on the meaning of beta lambda alpha iota sigma ó zeta; however, this was finally lost again. In summary, the article concludes that exact word meanings in ancient literature are often unclear and precise ascriptions of meanings are inconsistent. In the case of "curved legs," this has led to misunderstandings regarding the respective types and directions of the curvature.

  4. Leg ulcer in lepromatous leprosy - Case report*

    Science.gov (United States)

    Fernandes, Tania Rita Moreno de Oliveira; dos Santos, Talita Suzany Siqueira; Lopes, Ramon Rodrigues de Macedo

    2016-01-01

    In Brazil, leprosy is a widespread infectious and contagious disease. Clinicians and specialists view leprosy broadly as a systemic infection, since, in its manifestations, it mimics many conditions, such as rheumatic, vascular, ENT, neurological and dermatological diseases. There are few studies that characterize the factors associated with ulcers in leprosy. These injuries should be prevented and treated promptly to avoid serious problems like secondary infections, sepsis, carcinomatous degeneration and amputations. We describe a patient with ulcers on his legs, involving late diagnosis of lepromatous leprosy. PMID:27828650

  5. Painful legs and moving toes syndrome

    Directory of Open Access Journals (Sweden)

    Qiu-ying Ma

    2015-10-01

    Full Text Available Painful legs and moving toes syndrome (PLMT is a rare movement disorder with low diagnostic rate, which is characterized by lower limb pain with involuntary movements of feet or toes. Etiology and pathogenesis of this disease is still unclear. Patients have different clinical manifestations, so the diagnosis is difficult. Treatment methods for PLMT are numerous, but so far the treatment of this disease is still a major challenge for clinicians. Further research is still needed to guide clinical work. DOI: 10.3969/j.issn.1672-6731.2015.10.013

  6. A Fast-Processing Modulation Strategy for Three-Phase Four-Leg Neutral-Point-Clamped Inverter Based on the Circuit-Level Decoupling Concept

    DEFF Research Database (Denmark)

    Ghoreishy, Hoda; Zhang, Zhe; Thomsen, Ole Cornelius

    2012-01-01

    In this paper, a modulation strategy based on the circuit-level decoupling concept is proposed and investigated for the three-level four-leg neutral-point-clamped (NPC) inverter,with the aim of delivering power to all sorts of loads, linear/nonlinear and balanced/unbalanced. By applying...... the proposed modulation strategy, the four-leg NPC inverter can be decoupled into three three-level Buck converters in each defined operating section. This makes the controller design much simpler compared to the conventional four-leg NPC inverter controllers. Also, this technique can be implemented...

  7. Restless Legs Syndrome After Single Low Dose Quetiapine Administration.

    Science.gov (United States)

    Soyata, Ahmet Z; Celebi, Fahri; Yargc, Lutfi I

    2016-01-01

    Restless legs syndrome is an underdiagnosed sensori-motor disorder and psychotropic drugs are one of the main secondary causes of the illness. The most common psychotropic agents that cause restless legs syndrome are antidepressants; however, antipsychotics have also been reported to induce restless legs syndrome. The prevalence, vulnerability factors and the underlying mechanism of antipsychotic-induced restless legs syndrome are unclear. A possible explanation is that dopaminergic blockade is the main precipitator of the syndrome. Quetiapine-induced restless legs syndrome is another point of interest because of its low binding to D2 receptors. We herein report the case of a restless legs syndrome that emerged after a single low dose quetiapine administration.

  8. Immediate Effect of Positioning Devices on Infant Leg Movement Characteristics.

    Science.gov (United States)

    Jiang, Crystal; de Armendi, Joyce T; Smith, Beth A

    2016-01-01

    To determine the immediate effects of constraining or encouraging positioning devices on leg movement of infants with typical development (TD) and at-risk for developmental delay (AR). Twenty-six infants (13 TD, 13 AR) were placed in the supine position, a jungle gym, or a car seat. Movement sensors on infants' ankles measured acceleration and angular velocity. We calculated the number of leg movements, peak acceleration, and peak rotational rate of each leg movement. A 2 (group) × 3 (condition) analysis of variance with repeated measures on condition tested for a group effect, a condition effect, and a group by condition interaction for leg movement quantity, average peak acceleration, and average peak rotation. Leg movement quantity and average peak acceleration were significantly lower for the car seat condition compared with the supine position or the gym. Positioning device use has an immediate effect on infant leg movement characteristics. Long-term effects remain unknown.

  9. Nocturnal leg cramps in children: incidence and clinical characteristics.

    Science.gov (United States)

    Leung, A. K.; Wong, B. E.; Chan, P. Y.; Cho, H. Y.

    1999-01-01

    The records of 2527 healthy children seen in an ambulatory care clinic were evaluated for nocturnal leg cramps in the preceding 12 months, frequency and duration of the cramps, whether the cramps affected one leg or both legs at a time, whether there was associated muscle cramps in feet, whether the cramps occurred when the child was awake or asleep, and whether there was residual tenderness in the affected muscles. Nocturnal leg cramps were present in 185 children for an overall incidence of 7.3%. Leg cramps were noted only in children aged > or = 8 years. The incidence increased at 12 years and peaked at 16 to 18 years of age. A majority (81.6%) of the affected children had nocturnal leg cramps 1 to 4 times per year. The mean duration of episodes was 1.7 minutes. Leg cramps were unilateral in 98.9% of cases and the ipsilateral foot also was involved in 18.9% of cases. One hundred thirty-five (73%) children had leg cramps while asleep, and the remaining 23 (12.4%) children had leg cramps in either state. Fifty-seven (30.8%) children had residual tenderness in the affected muscles. The mean duration of residual tenderness was 33.2 minutes (range: 2 minutes-1 day). We conclude that nocturnal leg cramps are common in children aged > 12 years. A majority of the affected children have leg cramps 1 to 4 times per year. The cramps are usually unilateral and occur when the children are asleep. Normal duration of the leg cramp is < 2 minutes. Residual tenderness is present in approximately 30% of the affected children. Residual tenderness, if present, usually lasts for half an hour. PMID:10388258

  10. Six weeks' aerobic retraining after two weeks' immobilization restores leg lean mass and aerobic capacity but does not fully rehabilitate leg strenght in young and older men

    DEFF Research Database (Denmark)

    Vigelsø Hansen, Andreas; Gram, Martin; Wiuff, Caroline

    2015-01-01

    OBJECTIVE: To determine the effect of aerobic retraining as rehabilitation after short-term leg immobilization on leg strength, leg work capacity, leg lean mass, leg muscle fibre type composition and leg capillary supply, in young and older men. SUBJECTS AND DESIGN: Seventeen young (23 ± 1 years...... immobilization had marked effects on leg strength, and work capacity and 6 weeks' retraining was sufficient to increase, but not completely rehabilitate, muscle strength, and to rehabilitate aerobic work capacity and leg lean mass (in the young men)....

  11. Restless legs syndrome in hemodialysis patients

    Directory of Open Access Journals (Sweden)

    Shahram Rafie

    2016-01-01

    Full Text Available Restless legs syndrome (RLS is a neurological disorder characterized by uncomfortable sensation of paresthesia in legs that subsequently causes involuntary and continuous movement of the lower limbs, especially at rest. Its prevalence in hemodialysis is more than that in the general population. Different risk factors have been suggested for RLS. We studied the prevalence and risk factors of RLS in 137 hemodialysis patients followed up at our center. The patients completed at least three months on dialysis and fulfilled four criteria for the diagnosis of RLS. We compared the patients with and without RLS, and the odds ratios (ORs were estimated by the logistic regression models. The prevalence of RLS was 36.5% in the study patients. Among the variables, diabetes was the only predicting factor for the development of RLS. The diabetic patients may be afflicted with RLS 2.25 times more than the non-diabetics. Women developed severe RLS 5.23 times more than men. Neurodegeneration, decrease in dopamine level, higher total oxidant status, and neuropathy in diabetic patients may explain the RLS symptoms.

  12. Compression Stockings for Treating Venous Leg Ulcers

    Directory of Open Access Journals (Sweden)

    J. P. Benigni

    2013-01-01

    Full Text Available Background. In order to treat venous leg ulcers, it is recommended to use high pressure compression (30–40 mmHg at the ankle. Compression stockings which are not operator dependant could be the best option because of their pressure control. However 30–40 mmHg compression stockings are often hard to put on. Putting two lower pressure compression stockings over each other could be a good therapeutic alternative. Objectives. To compare the in vitro pressures given by the manufacturers of 2 antiulcer kits with the in vivo interface pressures measured in healthy subjects and to evaluate the stiffness and friction indices from those kits based on the interface pressure in order to assess their clinical properties. Material and Methods. Using a Kikuhime pressure device, interface pressure was measured in 12 healthy subjects at the reference point B1. One stiffness index (Static Stiffness Index (SSI and a friction index have been calculated. Results. Mediven Ulcer kit gets the recommended pressures whereas Jobst’s Ulcer Care kit does not for treating a venous leg ulcer. Jobst’s Ulcer Care transmits entirely the pressure in relation to a friction index close to 1. Conclusion. This antiulcer kit study underlines that in vivo and in vitro pressures can be different (Jobst’s Ulcer Care kit and Mediven Ulcer kit. In order not to lose pressure, it is important to take into account the friction index when superimposing two stockings.

  13. Leg Rejuvenation: A Combination Approach: A Review and Our Experience.

    Science.gov (United States)

    Weiss, Margaret; Mahoney, Anne M; Gold, Michael; Lawrence, Naomi

    2016-05-01

    Patients increasingly seek to enhance the appearance of their legs. Elimination of unwanted leg veins, reduction of epidermal photo-aging changes such as solar lentigines and keratoses, tightening of skin laxity and reduction of adipose tissue are among the most commonly requested goals. Many patients require a combination approach to address their concerns. It is important for dermatologists to be aware of the multitude of procedures that can be performed, often in combination, to rejuvenate the leg. The purpose of this review article was to discuss procedures for improving the appearance of the leg and to share the authors experience, especially in the combination approach to leg rejuvenation. A literature search was performed to investigate cosmetic procedures being performed on the leg, with an emphasis on controlled or randomized studies. In addition, the authors contributed their personal experience. Our discussion of the literature review highlights the treatments for leg veins, unwanted fat, cellulite, and photodamage of the legs that are most supported in peer-reviewed publications. A synergistic, combination approach to leg rejuvenation works best. This includes the use of injectable agents, energy-based devices, and more invasive surgical procedures.

  14. Oxygen uptake during Wingate tests for arms and legs in swimmers and water polo players

    Directory of Open Access Journals (Sweden)

    Colantonio Emilson

    2003-01-01

    Full Text Available OBJECTIVE: The aim of the present study is to compare the values of the maximal oxygen uptake (O2 max during two consecutive bouts in Wingate tests for arms and legs in swimmers (S and water polo players (WP. METHODS: Sample - seven national level athletes (4 S and 3 WP, age 17,90 ± 2,14 years, body mass 71,41 ± 6,84 kg, height 176,65 ± 7,02 cm, % body fat 13,23 ± 4,18. Two Wingate bouts with 30 sec each with 3 min interval between them, for arms and legs in alternated days. Oxygen uptake: breath-by-breath using the gas analysis system K4 b² Cosmed. Statistical analysis: Wilcoxon test for dependent variables and Kolmogorov-Smirnov test for independent variables. RESULTS: The mean values found at the O2 peak (PO2, mean power (MP and peak power (PP for each bout of the Wingate test, for arms and legs. For Arms: PO2 = 55.16 ± 5.72 ml.kg-1.min-1, MP = 5.28 ± 0.59 watts.kg-1 and PP = 6.71 ± 0.88 watts.kg-1 got in the first bout (1st Arms and PO2 = 60.12 ± 6.10 ml.kg-1.min-1, MP = 5.03 ± 0.40 watts.kg-1 and PP = 6.25 ± 0.51 watts.kg-1, got in the second bout (2nd Arms. For legs: PO2 = 55.66 ± 6.85 ml.kg-1.min-1, MP = 4.75 ± 1.79 watts.kg-1 and PP = 7.44 ± 1.96 watts.kg-1 got in the first bout (1st Legs and PO2 = 62.09 ± 5.99 ml.kg-1.min-1, MP = 4.28 ± 1.47 watts.kg-1 and PP = 6.68 ± 1.63 watts.kg-1 got in the second bout (2nd Legs. DISCUSSION AND CONCLUSION: All variables studied did not present significant difference among arms and legs, as much the first as the second bout for arms for PO2 (p < 0.05. There was no difference between the PM mean values of the first and the second bout. But the mean of the second bout of legs was significant smaller than the first bout (p < 0.05. For the PP variable there was no difference among the mean values to the first and second bout as much for arms as for legs. It looks like to exist larger magnitude to O2 adjustment for arms than legs, that could be associated to specific demands to which S

  15. Summertime blues? A re-examination of the seasonality of web searches for restless legs and leg cramps.

    Science.gov (United States)

    O'Keeffe, Shaun T

    2017-09-01

    Studies that examined Internet searches for restless legs and leg cramps have found a strong seasonal effect with peaks in summer and troughs in winter months. The present study used an econometric approach to examine the seasonality of such searches in greater detail. Monthly relative search volumes for 'restless legs' and 'leg cramps' from 2004 to March 2017 in the United Kingdom (UK) and Australia were obtained from Google Trends. Average percentage change from winter to summer months was examined. The TRAMO-SEATS procedure from the DEMETRA statistical software was used to decompose the data into trend, seasonal and noise components and to determine whether a combined seasonality test was positive. There were substantial percentage increases in Google Trends searches between winter and summer months regarding restless legs in the UK (median increase 46%) and Australia (33%) and regarding leg cramps in the UK (95%) and Australia (50%). However, the combined seasonality test was positive only for leg cramps and not for restless legs in both countries: although there was significant stable seasonality in restless legs searches, this was outweighed by substantial moving seasonality and noise components. Examination of average percentage increase in search volume from winter to summer exaggerates the degree of seasonality. Seasonal effects for restless legs searches are non-significant when the trend and noise components of the data are considered, although this does not exclude a clinical significance for the identified stable seasonality. Significant seasonality, with a summer peak, is present for leg cramps searches and suggests an increase in the incidence or severity of leg cramps in summer. Copyright © 2017 Elsevier B.V. All rights reserved.

  16. Evidence of homologous and heterologous effects after unilateral leg training in youth.

    Science.gov (United States)

    Ben Othman, Aymen; Behm, David G; Chaouachi, Anis

    2018-03-01

    The positive effects of unilateral training on contralateral muscles (cross education) has been demonstrated with adults for over a century. There is limited evidence for cross education of heterologous muscles. Cross education has not been demonstrated with children. It was the objective of this study to investigate cross-education training in children examining ipsilateral and contralateral homologous and heterologous muscles. Forty-eight male children (aged 10-13 years) were assessed for unilateral, ipsilateral and contralateral lower limb strength, power and endurance (1-repetition maximum (RM) leg press, knee extensors (KE) and flexors (KF) maximum voluntary isometric contractions (MVIC), countermovement jump, muscle endurance test (leg press repetitions with 60% 1RM)), and upper body unilateral MVIC elbow flexors (EF) and handgrip strength. An 8-week training program involved 2 unilateral leg press resistance-training groups (high load/low repetitions: 4-8 sets of 5RM, and low load/high repetitions: 1-2 sets of 20RM) and control (untrained) group. All muscles exhibited improvements of 6.1% to 89.1%. The trained limb exhibited greater adaptations than the untrained limb for leg press 1RM (40.3% vs. 25.2%; p = 0.005), and 60% 1RM leg press (104.1% vs. 73.4%; p = 0.0001). The high load/low repetition training induced (p cross-education effects with children and that the effects of unilateral training involve both contralateral homologous and heterologous muscles with the greatest strength-training responses from high-load/low-repetition training.

  17. Lower Leg Morphology and Stretch-Shortening Cycle Performance of Dancers.

    Science.gov (United States)

    Rice, Paige E; van Werkhoven, Herman; Merritt, Edward K; McBride, Jeffrey M

    2018-01-24

    Greater levels of bone ultimate fracture load, bone stress-strain index, muscle cross-sectional area, and maximal voluntary isometric plantarflexion strength of the lower leg may be adaptations from chronic exposure to stretch-shortening cycle (SSC) actions. Dancers, a population that habitually performs SSC movements primarily about the ankle-joint, may serve as a novel population to gain broader understanding of SSC function. Ten female collegiate dancers and ten untrained controls underwent peripheral quantitative computed tomography scans of both lower legs and performed maximal voluntary isometric plantarflexions, countermovement hops and drop hops at 20 cm, 30 cm and 40 cm on a custom-made inclined sled. Dancers had greater right and left ultimate fracture load values and significantly (p ≤ 0.05) greater left leg stress-strain index than controls. Dancers had significantly larger right and left muscle cross-sectional area and maximal voluntary isometric plantarflexion values and hopped significantly higher during all hopping conditions in comparison to controls. Average force- and power-time curves revealed significantly greater relative force and power measurements during the concentric phase for all hopping conditions in dancers when compared to controls. This investigation provides evidence that dance may be a stimulus for positive muscle and bone adaptations, strength levels and enhanced SSC capabilities.

  18. Gabapentin Enacarbil: Pharmacotherapy of Restless Legs Syndrome

    Directory of Open Access Journals (Sweden)

    Ruth Jones

    2010-01-01

    Full Text Available Restless Legs Syndrome (RLS is a prevalent sleep-associated movement disorder greatly affecting patients’ quality of life (QoL. Several drugs can be used to control this condition although the first-line dopamine agents often cause adverse effects. Non-dopaminergic drugs such as oral gabapentin (GBP have been more recently advocated. Despite ameliorating RLS symptoms, GBP's pharmacokinetic limitations restrict its overall effectiveness. A novel specifically designed prodrug, gabapentin enacarbil (GE, has demonstrated successful RLS alleviation with a superior pharmacokinetic profile. This review aims to examine the efficacy and tolerability of both GBP and GE as pharmacotherapy for RLS. Despite some heterogeneity and limitations across research methodologies, GE appears to be a potential RLS therapy superior to GBP and other dopaminergic agents.

  19. [Lipedema of the leg associated with dermatomyositis].

    Science.gov (United States)

    Ignjatović, M; Cerović, S

    1999-01-01

    Lipedema represents a form of lipodistrophy, which consists of abnormal accumulation of fat in subcutaneous tissue of the lower limbs with consecutive development of lymphostasis and lymphedema. The aim of this article was to review one clear case of lower limbs lipedema, of unusual occurrence and appearance, which was associated with dermatomyositis. A moderately manifested lipedema in 8 years old little girl was reported with its expressive segmental distribution to upper and lower legs, without significant increase in its size during last 10 years and without signs of lymphostasis. The hereditary influence was not confirmed. Histological examination of lipedematous tissue revealed significant presentation of immune component of the disease. According to the available literature, association between lipedema and dermatomyositis, lower limbs lipedema with segmental distribution as noticed above and its appearance as a consequence of corticosteroid therapy have not yet been published.

  20. [Pseudo-radicular referred leg pain].

    Science.gov (United States)

    von Heymann, W

    2015-12-01

    Pseudo-radicular leg pain as initially described by Bruegger more than 55 years ago was at that time a genius explanation for so many non-radicular pain syndromes that needed not any kind of surgical intervention but in first line a manual treatment or a treatment by therapeutic local anesthetics. Today we describe this pain as a "referred pain" originating from other anatomic structures that may occur during the development of chronic pain. Nevertheless this pain is found in many patients and it still seems to be a big problem for many physicians and surgeons. Imaging does not help either. The history and the clinical symptoms, the examinations, the chain reactions in the motor system as well as the treatment options from the point of view of manual medicine are described.

  1. Endovenous management of venous leg ulcers.

    Science.gov (United States)

    Raju, Seshadri; Kirk, Orla K; Jones, Tamekia L

    2013-04-01

    Compression is the current "standard" in the treatment of venous leg ulcers, and corrective surgery is ancillary. The emergence of safe and effective minimally invasive corrective techniques prompts a reappraisal of this paradigm. Among 192 consecutive limbs with venous leg ulcers, 189 were treated by (1) endovenous laser ablation (n = 30), (2) iliac vein stent placement (n = 89), or (3) both (n = 69). Residual deep reflux was not treated. No specialized wound care was used, and 38% of patients did not use stockings. Outcome measures were time to heal the ulcer and cumulative long-term healing. Sixty percent of the limbs were post-thrombotic. The median reflux segment score was 3 (range, 0-7). Thirty-seven percent had deep axial reflux. Median intravascular ultrasound-detected stenosis was 70% (range, 0%-100%) in stented patients. Sensitivity of venography to iliac vein obstruction was 52%. Postprocedural mortality was 0%, and 2% had deep venous thrombosis (ulcers approximately ≤1 inch in diameter had healed. Larger ulcers were slower in healing (P pressure). However, long-term ulcer healing was inferior in limbs with reflux segment score of ≥3 (P ulcers in this consecutive series achieved long-term healing with the described minimally invasive algorithm. Uncorrected residual reflux was not an impediment to ulcer healing. Ulcers sized ≤1 inch required no specialized or prolonged wound care. Compression was not necessary to achieve or maintain healing after interventional correction. Copyright © 2013 Society for Vascular Surgery. Published by Elsevier Inc. All rights reserved.

  2. Restless legs syndrome in patients on hemodialysis

    Directory of Open Access Journals (Sweden)

    Saleh Mohammad Yaser Salman

    2011-01-01

    Full Text Available Restless legs syndrome (RLS is common among dialysis patients, with a reported prevalence of 6-60%. The prevalence of RLS in Syrian patients on hemodialysis (HD is not known. The purpose of this study is to determine the prevalence of RLS in patients on regular HD, and to find the possible correlation between the presence of RLS and demographic, clinical, and biochemical factors. One hundred and twenty-three patients (male/female = 70/53, mean age = 41.95 ± 15.11 years on HD therapy at the Aleppo University Hospital were enrolled into the study. RLS was diagnosed based on criteria established by the International Restless Legs Syn-drome Study Group (IRLSSG. Data procured were compared between patients with and without RLS. Applying the IRLSSG criteria for the diagnosis, RLS was seen in 20.3% of the study pa-tients. No significant difference in age, gender, and intake of nicotine and caffeine was found between patients with and without the RLS. Similarly, there was no difference between the two groups in the duration of end-stage renal disease (ESRD, the period of dialysis dependence, dialysis adequacy, urea and creatinine levels, and the presence of anemia. The co-morbidities and the use of drugs also did not differ in the two groups. Our study suggests that the high prevalence of RLS among patients on HD requires careful attention and correct diagnosis can lead to better therapy and better quality of life. The pathogenesis of RLS is not clear and further studies are required to identify any possible cause as well as to discover the impact of this syndrome on sleep, quality of life, and possibly other complications such as cardiovasculare disease.

  3. On the development a pneumatic four-legged mechanism autonomous vertical wall climbing robot

    International Nuclear Information System (INIS)

    Mohamad Shukri Zainal Abidin; Shamsudin H.M. Amin . shukri@suria.fke.utm.my

    1999-01-01

    The paper describes the design of a prototype legged mechanism together with suction mechanism, the mechanical design, on-board controller and an initial performance test. The design is implemented in the form of a pneumatically powered multi-legged robot equipped with suction pads at the sole of the feet for wall climbing purpose. The whole mechanism and suction system is controlled by controller which is housed on-board the robot. The gait of the motion depended on the logic control patterns as dictated by the controller. The robot is equipped with sensors both at the front and rear ends that function as an obstacle avoidance facility. Once objects are detected, signals are sent to the controller to start an evasive action that is to move in the opposite direction. The mechanism has been tested and initial results have shown promising potential for an autonomous mobile. (Author)

  4. Biomimetic Spider Leg Joints: A Review from Biomechanical Research to Compliant Robotic Actuators

    Directory of Open Access Journals (Sweden)

    Stefan Landkammer

    2016-07-01

    Full Text Available Due to their inherent compliance, soft actuated joints are becoming increasingly important for robotic applications, especially when human-robot-interactions are expected. Several of these flexible actuators are inspired by biological models. One perfect showpiece for biomimetic robots is the spider leg, because it combines lightweight design and graceful movements with powerful and dynamic actuation. Building on this motivation, the review article focuses on compliant robotic joints inspired by the function principle of the spider leg. The mechanism is introduced by an overview of existing biological and biomechanical research. Thereupon a classification of robots that are bio-inspired by spider joints is presented. Based on this, the biomimetic robot applications referring to the spider principle are identified and discussed.

  5. ODYSSEUS autonomous walking robot: The leg/arm design

    Science.gov (United States)

    Bourbakis, N. G.; Maas, M.; Tascillo, A.; Vandewinckel, C.

    1994-01-01

    ODYSSEUS is an autonomous walking robot, which makes use of three wheels and three legs for its movement in the free navigation space. More specifically, it makes use of its autonomous wheels to move around in an environment where the surface is smooth and not uneven. However, in the case that there are small height obstacles, stairs, or small height unevenness in the navigation environment, the robot makes use of both wheels and legs to travel efficiently. In this paper we present the detailed hardware design and the simulated behavior of the extended leg/arm part of the robot, since it plays a very significant role in the robot actions (movements, selection of objects, etc.). In particular, the leg/arm consists of three major parts: The first part is a pipe attached to the robot base with a flexible 3-D joint. This pipe has a rotated bar as an extended part, which terminates in a 3-D flexible joint. The second part of the leg/arm is also a pipe similar to the first. The extended bar of the second part ends at a 2-D joint. The last part of the leg/arm is a clip-hand. It is used for selecting several small weight and size objects, and when it is in a 'closed' mode, it is used as a supporting part of the robot leg. The entire leg/arm part is controlled and synchronized by a microcontroller (68CH11) attached to the robot base.

  6. Impact of Restless Legs Syndrome on Cardiovascular Autonomic Control.

    Science.gov (United States)

    Bertisch, Suzanne M; Muresan, Cristen; Schoerning, Laura; Winkelman, John W; Taylor, J Andrew

    2016-03-01

    To examine whether patients with restless legs syndrome demonstrate specific alterations in cardiovascular autonomic control. Patients with moderate-severe restless legs syndrome (n = 20, 80% female) and controls (n = 20) matched for age, sex, body mass index, and free of hypertension and cardiovascular disease were enrolled. We assessed cardiovagal baroreflex gain via the modified Oxford technique, sympathetically mediated vascular responses to isometric exercise to fatigue, bradycardiac response to Valsalva maneuver, and respiratory sinus arrhythmia during paced breathing. Standard electrocardiography, beat-by-beat arterial pressure, respiration, and popliteal blood flow velocity were recorded continuously. Resting blood pressure and heart rate were similar between groups. However, baroreflex gain averaged 14.3 ± 1.4 msec/mm Hg in restless legs syndrome and was lower than in controls (22.6 ± 3.5 msec/mm Hg, P = 0.04). Hemodynamic responses to isometric exercise were similar between groups, though participants with restless legs syndrome had lower leg blood flow (P leg vascular resistance (P restless legs syndrome demonstrate compromised cardiovagal control, specific to the arterial baroreflex, with greater peripheral vascular resistance, potentially due to heightened sympathetic outflow. These autonomic alterations may directly relate to the higher prevalence of cardiovascular disease in restless legs syndrome. © 2016 Associated Professional Sleep Societies, LLC.

  7. Criteria in diagnosing nocturnal leg cramps : A systematic review

    NARCIS (Netherlands)

    Hallegraeff, Joannes; de Greef, Mathieu; Krijnen, Wim; van der Schans, Cees

    2017-01-01

    Background: Up to 33% of the general population over 50 years of age are affected by nocturnal leg cramps. Currently there are no generally accepted clinical characteristics, which identify nocturnal leg cramps. This study aims to identify these clinical characteristics and to differentiate between

  8. How Can I Relieve My Pregnancy Leg Cramps?

    Science.gov (United States)

    ... Español How Can I Relieve My Pregnancy Leg Cramps? KidsHealth / For Parents / How Can I Relieve My Pregnancy Leg Cramps? Print Now that I'm in my third trimester, I keep getting these painful cramps in my calves. Sometimes they even wake me ...

  9. Ubx regulates differential enlargement and diversification of insect hind legs.

    Directory of Open Access Journals (Sweden)

    Najmus Mahfooz

    2007-09-01

    Full Text Available Differential enlargement of hind (T3 legs represents one of the hallmarks of insect evolution. However, the actual mechanism(s responsible are yet to be determined. To address this issue, we have now studied the molecular basis of T3 leg enlargement in Oncopeltus fasciatus (milkweed bug and Acheta domesticus (house cricket. In Oncopeltus, the T3 tibia displays a moderate increase in size, whereas in Acheta, the T3 femur, tibia, and tarsus are all greatly enlarged. Here, we show that the hox gene Ultrabithorax (Ubx is expressed in the enlarged segments of hind legs. Furthermore, we demonstrate that depletion of Ubx during embryogenesis has a primary effect in T3 legs and causes shortening of leg segments that are enlarged in a wild type. This result shows that Ubx is regulating the differential growth and enlargement of T3 legs in both Oncopeltus and Acheta. The emerging view suggests that Ubx was co-opted for a novel role in regulating leg growth and that the transcriptional modification of its expression may be a universal mechanism for the evolutionary diversification of insect hind legs.

  10. Recurrent Metachronous Acute Compartment Syndrome in the Legs ...

    African Journals Online (AJOL)

    METHODS: A seven-year-old boy presented with four separate episodes of acute compartment syndrome of the legs within three years. The recurrent nature of the illness prompted detail review of the records of the child. RESULTS: There was involvement of each leg twice between the ages of three and seven years ...

  11. In-patient management of leg ulcers | Ohanaka | East African ...

    African Journals Online (AJOL)

    Objective: To review in-patient management of leg ulcers and to compare our experiences with those from other similar centres. Design: A retrospective study. Setting: University of Benin Teaching Hospital, Nigeria. Patients: Forty five patients hospitalisad with leg ulcers. Results: There were 27 male and 18 females (MF 3:2) ...

  12. Common Leg Aliment Of Poultry In Plateau State, Nigeria | Ogbe ...

    African Journals Online (AJOL)

    A study was carried out to investigate the occurrence and causes of leg ailment in poultrythrough questionnaire survey and farm visitation. Post mortem and laboratory examination were also conducted. The results showed that different species of poultry were affected with varous types of leg ailments; out of which local ...

  13. Leg length, sitting height and postmenopausal breast cancer risk

    DEFF Research Database (Denmark)

    Mellemkjær, L; Christensen, J; Frederiksen, K

    2012-01-01

    Tallness has consistently been associated with an increased risk of breast cancer. We investigated the association further by decomposing height into leg length and sitting height.......Tallness has consistently been associated with an increased risk of breast cancer. We investigated the association further by decomposing height into leg length and sitting height....

  14. Leg ulcers: a review of their impact on daily life.

    NARCIS (Netherlands)

    Persoon, A.; Heinen, M.M.; Vleuten, C.J.M. van der; Rooij, M.J.M. de; Kerkhof, P.C.M. van de; Achterberg, T. van

    2004-01-01

    BACKGROUND: Current nursing care for leg ulcer patients often focuses on wound care and providing compression therapy. Nurses perceive leg ulcer patients as 'under-served' with regard to problems patients experience in daily life. An overview of patient problems is a first and essential step in the

  15. The recalcitrant venous leg ulcer - A never ending story?

    NARCIS (Netherlands)

    S.W.I. Reeder (Suzan); M.B. Maessen-Visch (Birgitte); S.I. Langendoen; K.P. de Roos; H.A.M. Neumann (Martino)

    2013-01-01

    textabstractIntroduction: In general, four particular causes of recalcitrant venous leg ulcers may be distinguished. These are foot pump insufficiency, chronic venous compartment syndrome and non-re-canalized popliteal vein thrombosis. The fourth cause of recalcitrant venous leg ulcers is

  16. Vibration transmission characteristics of the legs of freely standing honeybees

    DEFF Research Database (Denmark)

    Rohrseitz, Kristin; Kilpinen, Ole

    1997-01-01

    The leg vibrations of honeybees standing on a vibrating substrate were measured with laser Doppler vibrometry, both in freely standing bees and in bees attached to a holder. In both cases, no resonances were found. In the fixed bee preparation, the legs moved with approximately the same amplitude...

  17. A Brief Survey Paper on Multi-Legged Robots

    Directory of Open Access Journals (Sweden)

    Mohammad Behmanesh

    2015-03-01

    Full Text Available This paper presents a brief survey on multi-legged robots and their applications in agriculture such as for harvesting. Multi-legged robots have the benefit of more flexibility and adapt to different rough terrain in a better way. They also have very important applications in fulfilling the dangerous tasks such as mine detecting.

  18. Ubx Regulates Differential Enlargement and Diversification of Insect Hind Legs

    Science.gov (United States)

    Mahfooz, Najmus; Turchyn, Nataliya; Mihajlovic, Michelle; Hrycaj, Steven; Popadić, Aleksandar

    2007-01-01

    Differential enlargement of hind (T3) legs represents one of the hallmarks of insect evolution. However, the actual mechanism(s) responsible are yet to be determined. To address this issue, we have now studied the molecular basis of T3 leg enlargement in Oncopeltus fasciatus (milkweed bug) and Acheta domesticus (house cricket). In Oncopeltus, the T3 tibia displays a moderate increase in size, whereas in Acheta, the T3 femur, tibia, and tarsus are all greatly enlarged. Here, we show that the hox gene Ultrabithorax (Ubx) is expressed in the enlarged segments of hind legs. Furthermore, we demonstrate that depletion of Ubx during embryogenesis has a primary effect in T3 legs and causes shortening of leg segments that are enlarged in a wild type. This result shows that Ubx is regulating the differential growth and enlargement of T3 legs in both Oncopeltus and Acheta. The emerging view suggests that Ubx was co-opted for a novel role in regulating leg growth and that the transcriptional modification of its expression may be a universal mechanism for the evolutionary diversification of insect hind legs. PMID:17848997

  19. Secondary hyperparathyroidism: Uncommon cause of a leg ulcer

    NARCIS (Netherlands)

    van Rijssen, L. B.; Brenninkmeijer, E. E. A.; Nieveen van Dijkum, E. J. M.

    2012-01-01

    Most leg ulcers are vascular based. Only if vascular therapy fails other causes are considered. We report the case of a female with incapacitating leg ulcers caused by a rare condition which was only diagnosed after failing treatment. PRESENTATION OF CASE: The female had an extensive previous

  20. Diurnal variations in lower leg subcutaneous blood flow rate in patients with chronic venous leg ulcers

    DEFF Research Database (Denmark)

    Sindrup, J H; Kastrup, J; Kristensen, J K

    1991-01-01

    The blood flow rate in subcutaneous adipose tissue was measured on the lower legs of 11 patients with chronic lower-leg venous insufficiency and ulceration and in eight age-matched control subjects for 12-20 h, under ambulatory conditions, using the 133Xe wash-out technique with portable Cadmium...... telluride (CdTe(Cl)) detectors. In both groups, the change from an upright to a supine position at the beginning of the night period elicited an instantaneous increment in the blood flow rate of 30-40% with a decrease in the central and local postural sympathetic vasoconstrictor activity. After...... approximately 1 h of sleep, a considerable increase in blood flow rate was seen in both patient and control groups which persisted for nearly 100 min. In the patient group, the mean increase was 137% compared to a mean increase of 68% in the control group (P less than 0.01). The blood flow then returned...

  1. Short-interval leg movements during sleep entail greater cardiac activation than periodic leg movements during sleep in restless legs syndrome patients.

    Science.gov (United States)

    Ferri, Raffaele; Rundo, Francesco; Silvani, Alessandro; Zucconi, Marco; Aricò, Debora; Bruni, Oliviero; Lanuzza, Bartolo; Ferini-Strambi, Luigi; Manconi, Mauro

    2017-10-01

    Periodic leg movements during sleep (PLMS) are sequences of ≥4 motor events with intermovement intervals (IMI) of 10-90 s. PLMS are a supportive diagnostic criterion for restless legs syndrome (RLS) and entail cardiac activation, particularly when associated with arousal. RLS patients also over-express short-interval leg movements during sleep (SILMS), which have IMI leg movements. We found that the duration of the R-R interval decrease with SILMS doublets was significantly longer than that with PLMS, whereas the maximal decrease in R-R interval was similar. Scoring SILMS in RLS patients may therefore be relevant from a cardiac autonomic perspective. © 2017 European Sleep Research Society.

  2. Laboratory on Legs: An Architecture for Adjustable Morphology with Legged Robots

    Science.gov (United States)

    2012-04-01

    evenly throughout the body, all mounted on the waterjet cut frame. Through the use of a USB bus as the common communication method within the robot...according to the overarching “spring assisted actuation” hypothesis just described. The body of Canid is similar to XRL, built from waterjet cut aluminum...on cheap, relatively fast turn-around water jet cut frame components and compliant leg and spine materials offers some useful lessons in effective

  3. Relationship between Leg Mass, Leg Composition and Foot Velocity on Kicking Accuracy in Australian Football

    Directory of Open Access Journals (Sweden)

    Nicolas H. Hart, Jodie L. Cochrane, Tania Spiteri, Sophia Nimphius, Robert U. Newton

    2016-06-01

    Full Text Available Kicking a ball accurately over a desired distance to an intended target is arguably the most important skill to acquire in Australian Football. Therefore, understanding the potential mechanisms which underpin kicking accuracy is warranted. The aim of this study was to examine the relationship between leg mass, leg composition and foot velocity on kicking accuracy in Australian Football. Thirty-one Australian Footballers (n = 31; age: 22.1 ± 2.8 years; height: 1.81 ± 0.07 m; weight: 85.1 ± 13.0 kg; BMI: 25.9 ± 3.2 each performed ten drop punt kicks over twenty metres to a player target. Athletes were separated into accurate (n = 15 and inaccurate (n = 16 kicking groups. Leg mass characteristics were assessed using whole body DXA scans. Foot velocity was determined using a ten-camera optoelectronic, three-dimensional motion capture system. Interactions between leg mass and foot velocity evident within accurate kickers only (r = -0.670 to -0.701. Relative lean mass was positively correlated with kicking accuracy (r = 0.631, while no relationship between foot velocity and kicking accuracy was evident in isolation (r = -0.047 to -0.083. Given the evident importance of lean mass, and its interaction with foot velocity for accurate kickers; future research should explore speed-accuracy, impulse-variability, limb co-ordination and foot-ball interaction constructs in kicking using controlled with-in subject studies to examine the effects of resistance training and skill acquisition programs on the development of kicking accuracy.

  4. Adaptive leg coordination with a biologically inspired neurocontroller

    Science.gov (United States)

    Braught, Grant; Thomopoulos, Stelios C.

    1996-10-01

    Natural selection is responsible for the creation of robust and adaptive control systems. Nature's control systems are created only from primitive building blocks. Using insect neurophysiology as a guide, a neural architecture for leg coordination in a hexapod robot has been developed. Reflex chains and sensory feedback mechanisms from various insects and crustacea form the basis of a pattern generator for intra-leg coordination. The pattern generator contains neural oscillators which learn from sensory feedback to produce stepping patterns. Using sensory feedback as the source of learning information allows the pattern generator to adapt to changes in the leg dynamics due to internal or external causes. A coupling between six of the single leg pattern generators is used to produce the inter-leg coordination necessary to establish stable gaits.

  5. A survey of bio-inspired compliant legged robot designs

    International Nuclear Information System (INIS)

    Zhou Xiaodong; Bi Shusheng

    2012-01-01

    The roles of biological springs in vertebrate animals and their implementations in compliant legged robots offer significant advantages over the rigid legged ones in certain types of scenarios. A large number of robotics institutes have been attempting to work in conjunction with biologists and incorporated these principles into the design of biologically inspired robots. The motivation of this review is to investigate the most published compliant legged robots and categorize them according to the types of compliant elements adopted in their mechanical structures. Based on the typical robots investigated, the trade-off between each category is summarized. In addition, the most significant performances of these robots are compared quantitatively, and multiple available solutions for the future compliant legged robot design are suggested. Finally, the design challenges for compliant legged robots are analysed. This review will provide useful guidance for robotic designers in creating new designs by inheriting the virtues of those successful robots according to the specific tasks. (topical review)

  6. Probabilitic analysis for fatigue failure of leg-supported liquid containers under random earthquake-type excitation

    International Nuclear Information System (INIS)

    Fujita, Takafumi

    1981-01-01

    Leg-supported cylindrical containers frequently used for nuclear power plants and chemical plants and leg-supported rectangular containers such as water and fuel tanks are the structures, of which the reliability is feared at the time of earthquakes. In this study, about such leg-supported liquid containers, the structural reliability of the system at the time of earthquakes was analyzed from the viewpoint of fatigue failure at the joints of tanks and supporting legs and the fixing parts of legs. The second order unsteady coupled probability density of response displacement and response velocity and the first and second order unsteady probability density of response displacement envelope were determined, then using the results, the expected value, variance and unsteady probability density of cumulative damage were obtained on the basis of Miner's law, thus the structural reliability of the system was analyzed. The result of analysis was verified with the results of vibration tests using many simulated earthquake waves, and the experiment of the fatigue failure of a model with sine wave vibration was carried out. The mechanical model for the analysis, the unsteady probability density described above, the analysis of structural reliability and the experiment are reported. (Kako, I.)

  7. Effects of gabapentin enacarbil on restless legs syndrome and leg pain in dementia with Lewy bodies.

    Science.gov (United States)

    Fujishiro, Hiroshige

    2014-06-01

    Restless legs syndrome (RLS) is a common neurological disorder. Dementia with Lewy bodies (DLB) is the second most common form of neurodegenerative dementia after Alzheimer's disease. Both RLS and DLB can be effectively treated by dopaminergic medications, suggesting the role of dopamine dysfunction in the pathogenesis of both diseases. Here, I report on a Japanese woman with probable DLB and RLS who was treated with gabapentin enacarbil, a non-dopaminergic agent. Because a dopamine agonist, a first-line therapy for moderate to severe RLS, caused the occurrence of metamorphopsia, an alternative treatment of gabapentin enacarbil was used; this treatment improved the patient's RLS without worsening her psychiatric symptoms. An alternative treatment is desirable for DLB patients with RLS because they often experience intolerable side-effects with a dopamine agonist, especially visual hallucinations. Administering gabapentin enacarbil also improved the continuous leg pain that occurred in conjunction with the development of RLS. Although the neurobiological mechanism in the development of pain remains unclear, a range of non-dopaminergic structures likely mediated pain processing in DLB in the present case based on neuropharmacological results. This is the first report reporting the effects of gabapentin enacarbil for RLS and leg pain in a DLB patient with psychiatric symptoms. © 2014 The Author. Psychogeriatrics © 2014 Japanese Psychogeriatric Society.

  8. LEGS AND TRUNK MUSCLE HYPERTROPHY FOLLOWING WALK TRAINING WITH RESTRICTED LEG MUSCLE BLOOD FLOW

    Directory of Open Access Journals (Sweden)

    Mikako Sakamaki

    2011-06-01

    Full Text Available We examined the effect of walk training combined with blood flow restriction (BFR on the size of blood flow-restricted distal muscles, as well as, on the size of non-restricted muscles in the proximal limb and trunk. Nine men performed walk training with BFR and 8 men performed walk training alone. Training was conducted two times a day, 6 days/wk, for 3 wk using five sets of 2-min bouts (treadmill speed at 50 m/min, with a 1-min rest between bouts. After walk training with BFR, MRI-measured upper (3.8%, P < 0.05 and lower leg (3.2%, P < 0. 05 muscle volume increased significantly, whereas the muscle volume of the gluteus maximus (-0.6% and iliopsoas (1.8% and the muscle CSA of the lumber L4-L5 (-1.0 did not change. There was no significant change in muscle volume in the walk training alone. Our results suggest that the combination of leg muscle blood flow restriction with slow walk training elicits hypertrophy only in the distal blood flow restricted leg muscles. Exercise intensity may be too low during BFR walk training to increase muscle mass in the non- blood flow restricted muscles (gluteus maximus and other trunk muscles.

  9. Protection against high intravascular pressure in giraffe legs.

    Science.gov (United States)

    Petersen, Karin K; Hørlyck, Arne; Ostergaard, Kristine H; Andresen, Joergen; Broegger, Torbjoern; Skovgaard, Nini; Telinius, Niklas; Laher, Ismael; Bertelsen, Mads F; Grøndahl, Carsten; Smerup, Morten; Secher, Niels H; Brøndum, Emil; Hasenkam, John M; Wang, Tobias; Baandrup, Ulrik; Aalkjaer, Christian

    2013-11-01

    The high blood pressure in giraffe leg arteries renders giraffes vulnerable to edema. We investigated in 11 giraffes whether large and small arteries in the legs and the tight fascia protect leg capillaries. Ultrasound imaging of foreleg arteries in anesthetized giraffes and ex vivo examination revealed abrupt thickening of the arterial wall and a reduction of its internal diameter just below the elbow. At and distal to this narrowing, the artery constricted spontaneously and in response to norepinephrine and intravascular pressure recordings revealed a dynamic, viscous pressure drop along the artery. Histology of the isolated median artery confirmed dense sympathetic innervation at the narrowing. Structure and contractility of small arteries from muscular beds in the leg and neck were compared. The arteries from the legs demonstrated an increased media thickness-to-lumen diameter ratio, increased media volume, and increased numbers of smooth muscle cells per segment length and furthermore, they contracted more strongly than arteries from the neck (500 ± 49 vs. 318 ± 43 mmHg; n = 6 legs and neck, respectively). Finally, the transient increase in interstitial fluid pressure following injection of saline was 5.5 ± 1.7 times larger (n = 8) in the leg than in the neck. We conclude that 1) tissue compliance in the legs is low; 2) large arteries of the legs function as resistance arteries; and 3) structural adaptation of small muscle arteries allows them to develop an extraordinary tension. All three findings can contribute to protection of the capillaries in giraffe legs from a high arterial pressure.

  10. Single-leg squats can predict leg alignment in dancers performing ballet movements in “turnout”

    Directory of Open Access Journals (Sweden)

    Hopper LS

    2016-11-01

    Full Text Available Luke S Hopper,1 Nahoko Sato,2 Andries L Weidemann1 1Western Australian Academy of Performing Arts, Edith Cowan University, Mt Lawley, WA, Australia; 2Department of Physical Therapy, Nagoya Gakuin University, Seto, Japan Abstract: The physical assessments used in dance injury surveillance programs are often adapted from the sports and exercise domain. Bespoke physical assessments may be required for dance, particularly when ballet movements involve “turning out” or external rotation of the legs beyond that typically used in sports. This study evaluated the ability of the traditional single-leg squat to predict the leg alignment of dancers performing ballet movements with turnout. Three-dimensional kinematic data of dancers performing the single-leg squat and five ballet movements were recorded and analyzed. Reduction of the three-dimensional data into a one-dimensional variable incorporating the ankle, knee, and hip joint center positions provided the strongest predictive model between the single-leg squat and the ballet movements. The single-leg squat can predict leg alignment in dancers performing ballet movements, even in “turned out” postures. Clinicians should pay careful attention to observational positioning and rating criteria when assessing dancers performing the single-leg squat. Keywords: injury, motion capture, clinical assessment

  11. Modeling trajectories of perceived leg exertion during maximal cycle ergometer exercise in children and adolescents.

    Science.gov (United States)

    Huebner, Marianne; Zhang, Zhen; Therneau, Terry; McGrath, Patrick; Pianosi, Paolo

    2014-01-09

    Borg developed scales for rating pain and perceived exertion in adults that have also been used in pediatric populations. Models describing functional relationships between perceived exertion and work capacity have not been studied in children. We compared different models and their fits to individual trajectories and assessed the variability in these trajectories. Ratings of perceived exertion (RPE) were collected from 79 children. Progressive cycle ergonometric testing was performed to maximal work capacity with test duration ranging from 6- 12 minutes. Ratings were obtained during each 1-minute increment. Work was normalized to individual maximal work capacity (Wmax). A delay was defined as the fraction of Wmax at which point an increase in ratings of leg fatigue occurred. Such a delay term allows the characterization of trajectories for children whose ratings were initially constant with increasing work. Two models were considered, a delay model and a power model that is commonly used to analyze Borg ratings. Individual model fit was assessed with root mean squared error (RMSE). Functional clustering algorithms were used to identify patterns. Leg tiredness developed quickly for some children while for others there was a delay before an in- creased ratings of leg exertion occurred with increasing work. Models for individual trajectories with the smallest RMSE included a delay and a quadratic term (quadratic-delay model), or a power function and a delay term (power-delay model) compared to a simple power function. The median delay was 40% Wmax (interquartile range (IQR): 26-49%) in a quadratic-delay model, while the median exponent was 1.03 (IQR: 0.83-1.78) in a power-delay model. Nine clusters were identified showing linear or quadratic patterns with or without a delay. Cluster membership did not depend on age, gender or diagnosis. Children and adolescents vary widely in their capacity to rate their perceptions and exhibit different functional relationships

  12. Balancing Control of AIT Leg Exoskeleton Using ZMP based FLC

    Directory of Open Access Journals (Sweden)

    Narong Aphiratsakun

    2009-12-01

    Full Text Available This paper is focused on the use of Zero Moment Point (ZMP concept for balancing control of the Asian Institute of Technology Leg EXoskeleton-I (ALEX-I. ALEX-I has been developed to assist patients who suffer from paraplegia or immobility due to the loss of power on lower limbs. The balanced posture set-points (joint trajectories under ZMP criterion are generated offline. The ZMP based set points are provided as the desired postures to ALEX-I. Fuzzy Logic Controller (FLC determines the modified set points based on postures balancing sensed by loadcells. Ground Contact Point (GCP is used to find the “ZMP-like in real time”. GCP data is obtained by placing 4 loadcells forming a force plate on each foot of ALEX-I. This GCP data is then compared with the reference ZMP. Uncertainties of the model parameters, backlash, and joint tolerance are considered as disturbance. The differences of ZMP and GCP on x-z plane are used as the inputs to the FLC. The 4 outputs from FLC are the compensated angles of left and right ankles joints in roll and pitch axes that make the actual ZMP locate in the convex hull of the supporting area.

  13. Artificial Leg Design and Control Research of a Biped Robot with Heterogeneous Legs Based on PID Control Algorithm

    Directory of Open Access Journals (Sweden)

    Hualong Xie

    2015-04-01

    Full Text Available A biped robot with heterogeneous legs (BRHL is proposed to provide an ideal test-bed for intelligent bionic legs (IBL. To make artificial leg gait better suited to a human, a four-bar mechanism is used as its knee joint, and a pneumatic artificial muscle (PAM is used as its driving source. The static mathematical model of PAM is established and the mechanical model of a single degree of freedom of a knee joint driven by PAM is analyzed. A control simulation of an artificial leg based on PID control algorithm is carried out and the simulation results indicate that the artificial leg can simulate precisely a normal human walking gait.

  14. Differential diagnosis of unpleasant sensations in the legs: prevalence of restless legs syndrome in a primary care population.

    Science.gov (United States)

    Möller, Caroline; Wetter, Thomas C; Köster, Jürgen; Stiasny-Kolster, Karin

    2010-02-01

    Restless legs syndrome (RLS) is a common neurological condition. We investigated the prevalence of RLS in patients suffering from unpleasant sensations in the legs. We included 16,543 patients consulting one of 312 primary care practices in Germany on November 8, 2007. All patients filled out a self-assessment questionnaire. Patients who reported suffering from unpleasant sensations in the legs were then assessed by the physician. Main outcome measures were the overall prevalence of unpleasant sensations in the legs and the prevalence of RLS; the most common differential diagnoses in the subpopulation suffered from unpleasant leg sensations. Out of all participating patients 7704 (46.6%) suffered from unpleasant sensations in the legs and 1758 (10.6%) were diagnosed with RLS according to the four essential clinical criteria. Among patients with unpleasant leg sensations, the prevalence of RLS was considerably higher (22.7%) than in the total population. The most common differential diagnoses were osteoarthritis (21.5%), disc lesion (19.2%), varicose veins (18.8%) and muscle cramps (14.6%). Of the patients with RLS 53.4% had already consulted their physician about their leg problems in the past. Still, only 20.1% of the RLS patients had received the correct diagnosis. Comorbidity rates were significantly increased in RLS patients compared to patients suffering from leg symptoms of other origin. This study showed a high prevalence of RLS in primary care patients with unpleasant sensations in the legs. Thus, in patients presenting with these symptoms the diagnosis of RLS should routinely be considered. 2009 Elsevier B.V. All rights reserved.

  15. Restless legs syndrome in patients on dialysis

    International Nuclear Information System (INIS)

    AlJahdali, Hamdan H; AlQadhi, Waleed A; Khogeer, Haithm A; AlHejaili, Fayez F; Al Sayyari, Abdullah A; AlGhamdi, Saeed M

    2009-01-01

    Restless legs syndrome (RLS) is an extremely distressing problem experienced by patients on dialysis; the prevalence appears to be greater than in the general population, with a wide variation from 6.6% to 80%. The diagnosis of RLS is a clinical one, and its definition has been clarified and standardized by internationally recognized diagnostic criteria, published in 1995 by the International Restless Legs Syndrome Study Group (IRLSSG). This study was designed to find out the prevalence of RLS in Saudi patients with end-stage renal disease (ESRD) on maintenance dialysis. This is a cross sectional study carried out between May and Sept 2007 at two centers, King Abdulaziz Medical City-King Fahad National Guard Hospital (KAMC-KFNGH), Riyadh and King Faisal Specialist Hospital and Research Centre (KFHRC), Jeddah, Saudi Arabia. Data were gathered on 227 Saudi patients on chronic maintenance hemodialysis or chronic peritoneal dialysis. The prevalence of RLS was measured using IRLSSG's RLS Questionnaire (RLSQ). Potential risk factors for RLS including other sleep disorders, underlying cause of chronic renal failure, duration on dialysis, dialysis shift, biochemical tests and demographic data were also evaluated. The overall prevalence of RLS was 50.22% including 53.7% males and 46.3% females. Their mean age was 55.7 + - 17.2 years and mean duration on dialysis 40.4 + - 37.8 months. Significant predictors of RLS were history of diabetes mellitus (DM), coffee intake, afternoon dialysis, gender and type of dialysis (P= 0.03, 0.01, < 0.001, 0.05 and 0.009 respectively). Patients with RLS were found to be at increased risk of having insomnia and excessive daytime sleepiness (EDS) (P= < 0.001 and 0.001, respectively). Our study suggests that RLS is a very common problem in dialysis population and was significantly associated with other sleep disorders, particularly insomnia, and EDS. Optimal care of dialysis patient should include particular attention to the diagnosis and

  16. Restless legs syndrome in patients on dialysis

    Directory of Open Access Journals (Sweden)

    Al-Jahdali Hamdan

    2009-01-01

    Full Text Available Restless legs syndrome (RLS is an extremely distressing problem experienced by patients on dialysis; the prevalence appears to be greater than in the general population, with a wide variation from 6.6% to 80%. The diagnosis of RLS is a clinical one, and its definition has been clarified and standardized by internationally recognized diagnostic criteria, published in 1995 by the International Restless Legs Syndrome Study Group (IRLSSG. This study was designed to find out the prevalence of RLS in Saudi patients with end-stage renal disease (ESRD on maintenance dialysis. This is a cross sectional study carried out between May and Sept 2007 at two centers, King Abdulaziz Medical City-King Fahad National Guard Hospital (KAMC-KFNGH, Riyadh and King Faisal Specialist Hospital and Research Centre (KFHRC, Jeddah, Saudi Arabia. Data were gathered on 227 Saudi patients on chronic maintenance hemodialysis or chronic peritoneal dialysis. The prevalence of RLS was measured using IRLSSG′s RLS Questionnaire (RLSQ. Potential risk factors for RLS including other sleep disorders, underlying cause of chronic renal failure, duration on dialysis, dialysis shift, biochemical tests and demographic data were also evaluated. The overall prevalence of RLS was 50.22% including 53.7% males and 46.3% females. Their mean age was 55.7 ± 17.2 years and mean duration on dialysis 40.4 ± 37.8 months. Significant predictors of RLS were history of diabetes mellitus (DM, coffee intake, afternoon dialysis, gender and type of dialysis (P= 0.03, 0.01, < 0.001, 0.05 and 0.009 respectively. Patients with RLS were found to be at increased risk of having insomnia and excessive daytime sleepiness (EDS (P= < 0.001 and 0.001, respectively. Our study suggests that RLS is a very common problem in dialysis population and was significantly associated with other sleep disorders, particularly insomnia, and EDS. Optimal care of dialysis patient should include particular attention to the diagnosis

  17. Nurses' knowledge about venous leg ulcer care: a literature review.

    Science.gov (United States)

    Ylönen, M; Stolt, M; Leino-Kilpi, H; Suhonen, R

    2014-06-01

    There is an increasing prevalence of venous leg ulcers coinciding with increasing older people populations. They are therefore important health problems, which restrict daily activities and incur high costs. Efficient and comprehensive nursing care for people with venous leg ulcers requires knowledge of causes, presentations and characteristics, the effects that venous leg ulcers have on individuals and nursing care with evidence-based treatment. To identify the gaps between nurses' demonstrated knowledge of venous leg ulcers and the related nursing care treatment with evidence-based nursing care. A computerized search using MEDLINE, CINAHL the COCHRANE LIBRARY was conducted. The initial search yielded 174 citations from which 16 relevant articles were included in this review. Four themes in venous leg ulcer nursing care emerged demonstrating nurses' knowledge gaps: assessment, physiology and the healing process, nursing care and dressings, and compression treatment. This review suggests that there is a lack of knowledge related to venous leg ulcer physiology, the healing process and how this influences care and treatment. Nurses may not be using the evidence base sufficiently well to support ulcer healing and patient well-being. There is a need for a positive work culture development and ongoing educational programmes aimed at improving nurses' knowledge of venous leg ulcer treatment and care, which address the themes within the results of this review. © 2014 International Council of Nurses.

  18. Comparison of Alternative Gaits for Multiped Robots with Severed Legs

    Directory of Open Access Journals (Sweden)

    Tse-Shuen Shih

    2012-10-01

    Full Text Available Multiped robots have become the focus of heated discussion lately, especially in applications involving rescue or military missions and underwater or extra-terrestrial explorations. The surroundings concerned are harsh and hazardous terrains, and predictably the malfunction rate is high. What if a leg is irreparably damaged? The original gait can no longer be used and an alternative gait must be taken for the robot to continue its mission. This paper studies and enumerates preferred alternative gaits for six- and eight-legged robots under a proposed severed leg scheme. A leg is assumed to be completely detachable when a failure occurs. Based on a new criterion called the progressive efficiency (PE, defined via the enhanced gait charts, along with other criteria like the stride length and the longitudinal stability, alternative gaits are evaluated. The tables of recommended gaits in this paper are useful for robots when a leg failure is foreseen. These tables not only provide a guideline as to what alternative gait to use, they also give insight into how important a certain leg is. A comparison between the severed leg scheme and the existing locked-joint strategy is also included.

  19. Laterality of the legs in young female soccer players

    Directory of Open Access Journals (Sweden)

    Antosiak-Cyrak Katarzyna Z.

    2015-12-01

    Full Text Available Purpose. The aim of the present study was assessment of laterality of the legs of young female soccer players and their non-training counterparts. Methods. The study sample comprised 9 female soccer players and 19 non-training girls. They underwent three measurement sessions, one every six months. The applied tests included kinesthetic differentiation, rate of local movements, static balance, single-leg hop, rate of global movements, strength and speed, and functional asymmetry of the legs tests. Results. The soccer players were better than the controls in their performance of the rate of local movements, rate of global movements, kinesthetic differentiation, single-leg 15m timed hop and static balance tests. Smaller differences between the results of the left and the right legs in soccer players, than in non-training girls, were noted in the rate of local movements, rate of global movements and kinesthetic differentiation tests. In the static balance test, the differences were greater in the group of soccer players. Conclusions. Lateralization of the lower limbs is a highly complex characteristic with a different variability in athletes than in nontraining individuals. The results of the present study also point to the specialization of soccer players’ left legs in body balance and single-leg hop tests.

  20. Single leg stance control in individuals with symptomatic gluteal tendinopathy.

    Science.gov (United States)

    Allison, Kim; Bennell, Kim L; Grimaldi, Alison; Vicenzino, Bill; Wrigley, Tim V; Hodges, Paul W

    2016-09-01

    Lateral hip pain during single leg loading, and hip abductor muscle weakness, are associated with gluteal tendinopathy, but it has not been shown how or whether kinematics in single leg stance differ in those with gluteal tendinopathy. To compare kinematics in preparation for, and during, single leg stance between individuals with and without gluteal tendinopathy, and the effect of hip abductor muscle strength on kinematics. Twenty individuals with gluteal tendinopathy and 20 age-matched pain-free controls underwent three-dimensional kinematic analysis of single leg stance and maximum isometric hip abductor strength testing. Maximum values of hip adduction, pelvic obliquity (contralateral pelvis rise/drop), lateral pelvic translation (ipsilateral/contralateral shift) and ipsilateral trunk lean during preparation for leg lift and average values in steady single leg stance, were compared between groups using an analysis of covariance, with and without anthropometric characteristics and strength as covariates. Individuals with gluteal tendinopathy demonstrated greater hip adduction (standardized mean difference (SMD)=0.70, P=0.04) and ipsilateral pelvic shift (SMD=1.1, P=0.002) in preparation for leg lift, and greater hip adduction (SMD=1.2, P=0.002) and less contralateral pelvic rise (SMD=0.86, P=0.02) in steady single leg stance than controls. When including strength as a covariate, only between-group differences in lateral pelvic shift persisted (SMD=1.7, P=0.01). Individuals with gluteal tendinopathy use different frontal plane kinematics of the hip and pelvis during single leg stance than pain-free controls. This finding is not influenced by pelvic dimension or the potentially modifiable factor of body mass index, but is by hip abductor muscle weakness. Copyright © 2016 Elsevier B.V. All rights reserved.

  1. Pramipexole alters thermoregulation in restless legs syndrome.

    Science.gov (United States)

    Salminen, Aaro V; Rimpilä, Ville; Polo, Olli

    2014-12-15

    Previous studies have associated restless legs syndrome (RLS) with peripheral hypoxia and impaired thermoregulation in the lower extremities. We performed long-term monitoring of skin temperatures in order to investigate whether these findings could be explained by reduced blood flow to the peripheral tissues. 96-hour continuous measurements of skin temperature were performed both in the distal and proximal parts of the body of 15 patients with RLS and 14 healthy controls. During the recording, the patients participated in suggested immobilization tests both with and without pramipexole medication. We found no baseline differences in distal or proximal skin temperature between patients and controls in daytime or during immobilization. However, pramipexole significantly increased distal skin temperature in the patient group during immobilization (31.1°C vs. 32.9°C, p thermoregulation and the previous studies might have been biased by medication. Dopaminergic medication is a major confounding factor when assessing peripheral phenomena in RLS and should be controlled for in the future studies. © 2014 American Academy of Sleep Medicine.

  2. Restless legs syndrome associated with major diseases

    Science.gov (United States)

    Allen, Richard; Högl, Birgit; Paulus, Walter

    2016-01-01

    Recent publications on both the genetics and environmental factors of restless legs syndrome (RLS) defined as a clinical disorder suggest that overlapping genetic risk factors may play a role in primary (idiopathic) and secondary (symptomatic) RLS. Following a systematic literature search of RLS associated with comorbidities, we identified an increased prevalence of RLS only in iron deficiency and kidney disease. In cardiovascular disease, arterial hypertension, diabetes, migraine, and Parkinson disease, the methodology of studies was poor, but an association might be possible. There is insufficient evidence for conditions such as anemia (without iron deficiency), chronic obstructive pulmonary disease, multiple sclerosis, headache, stroke, narcolepsy, and ataxias. Based on possible gene–microenvironmental interaction, the classifications primary and secondary RLS may suggest an inappropriate causal relation. We recognize that in some conditions, treatment of the underlying disease should be achieved as far as possible to reduce or eliminate RLS symptoms. RLS might be seen as a continuous spectrum with a major genetic contribution at one end and a major environmental or comorbid disease contribution at the other. PMID:26944272

  3. Restless legs syndrome and pregnancy: A review

    Science.gov (United States)

    Srivanitchapoom, Prachaya; Pandey, Sanjay; Hallett, Mark

    2014-01-01

    Restless legs syndrome (RLS) is a common sensorimotor neurological disorder that is diagnosed according to the revised criteria of the International RLS Study Group (IRLSSG). The pathophysiology of RLS is still unknown and its prevalence is influenced by ethnicity, age, and gender. RLS is divided into two types by etiology: primary or idiopathic and secondary. Primary RLS is strongly influenced by a genetic component while secondary RLS is caused by other associated conditions such as end-stage renal disease or peripheral neuropathy. Another common condition associated with RLS is pregnancy. The prevalence of RLS during pregnancy is two to three times higher than in the normal population and is influenced by the trimester and the number of parity. The main mechanisms that may contribute to the pathophysiology of RLS during pregnancy are hormonal changes and iron and folate status. Standard medications for treating RLS during pregnancy are not established. Most medications have been used according to the evidence from non-pregnant patients. Therefore, consideration of the medical treatment for treating RLS during pregnancy should be balanced between the benefit of relieving the symptoms and maternal and fetal risk. In general, the prognosis of RLS during pregnancy is good and symptoms are usually relieved after delivery. PMID:24768121

  4. Clinical correlates of the restless legs syndrome

    Directory of Open Access Journals (Sweden)

    Luis Fabiano Marin

    2012-07-01

    Full Text Available OBJECTIVE: To determine the clinical correlates of the restless legs syndrome (RLS in a Brazilian sleep disorders center. METHODS: We retrospectively studied 118 patients with RLS from January, 2004, to December, 2010. The analyzed variables were: age at disease onset, gender, race, years of school instruction, primary and secondary RLS, and treatment options. RESULTS: Among the studied patients, 83.9% were women with a female/male sex ratio of 5:1. Mean age of the patients at symptom onset ± standard deviation was 41.7±17.9 years-old. The primary RLS was found in 85% of patients. The other 15% remainders consisted of secondary forms, and they were associated with neuropathy, iron deficiency anemia, end-stage renal disease, or Parkinson's disease. Drug therapy for RLS was introduced in 67% of patients. CONCLUSIONS: Most patients presented primary RLS with an early disease onset. Further epidemiological studies are welcomed to provide better information on secondary RLS in Brazil.

  5. [Prophylaxis of Recurrent Venous Leg Ulcer].

    Science.gov (United States)

    Kroeger, K; Storck, M; Kujath, P; Rabe, E; Dissemond, J

    2017-06-01

    Venous leg ulcer (VLU) counts among the most common chronic wounds in Europe. Treatment is lengthy, cumbersome and costly, and there is a high rate of recurrence. This review shows the measures that should be offered to every patient with healed VLU to permanently prevent recurrence. To prevent VLU in case of varicose veins, the progression of chronic venous insufficiency (CVI) has to be stopped. There is convincing evidence that the effective treatment of varicose veins reduces the recurrence rate in patients with VLU. In patients with post-thrombotic syndrome (PTS), further thrombosis should be prevented through targeted prophylaxis of new thromboembolic events. The benefit of endovascular revascularization on the VLU recurrence rate in patients with post-thrombotic damage in the pelvic veins has not been proven in clinical studies. On the other hand, it has been clearly demonstrated in several studies that compression therapy is the basic procedure for the prevention of recurrent VLU in patients with varicose veins or PTS, regardless of whether other measures have been implemented or not. Good adherence in patients with compression therapy is more important than choosing the highest possible compression class. Future efforts for patients with VLU must aim to provide therapists with tools and treatment strategies to guide their patients and to increase patients' acceptance and understanding of the importance of self-management, in particular regarding compression therapy for the prevention of recurrent VLU. Georg Thieme Verlag KG Stuttgart · New York.

  6. Primary headaches in restless legs syndrome patients

    Directory of Open Access Journals (Sweden)

    Ravi Gupta

    2012-01-01

    Full Text Available Earlier studies conducted among migraineurs have shown an association between migraine and restless legs syndrome (RLS. We chose RLS patients and looked for migraine to exclude sample bias. Materials and Methods: 99 consecutive subjects of idiopathic RLS were recruited from the sleep clinic during four months period. Physician diagnosis of headache and depressive disorder was made with the help of ICHD-2 and DSM-IV-TR criteria, respectively. Sleep history was gathered. Severity of RLS and insomnia was measured using IRLS (Hindi version and insomnia severity index Hindi version, respectively. Chi-square test, one way ANOVA and t-test were applied to find out the significance. Results: Primary headache was seen in 51.5% cases of RLS. Migraine was reported by 44.4% subjects and other types of ′primary headaches′ were reported by 7.1% subjects. Subjects were divided into- RLS; RLS with migraine and RLS with other headache. Females outnumbered in migraine subgroup (χ2 =16.46, P<0.001. Prevalence of depression (χ2 =3.12, P=0.21 and family history of RLS (χ2 =2.65, P=0.26 were not different among groups. Severity of RLS (P=0.22 or insomnia (P=0.43 were also similar. Conclusion: Migraine is frequently found in RLS patients in clinic based samples. Females with RLS are prone to develop migraine. Depression and severity of RLS or insomnia do not affect development of headache.

  7. Peripheral Dopamine in Restless Legs Syndrome

    Directory of Open Access Journals (Sweden)

    Ulrike H. Mitchell

    2018-03-01

    Full Text Available Objective/BackgroundRestless Legs Syndrome (RLS is a dopamine-dependent disorder characterized by a strong urge to move. The objective of this study was to evalulate blood levels of dopamine and other catecholamines and blood D2-subtype dopamine receptors (D2Rs in RLS.Patients/MethodsDopamine levels in blood samples from age-matched unmedicated RLS subjects, medicated RLS subjects and Controls were evaluated with high performance liquid chromatography and dopamine D2R white blood cell (WBC expression levels were determined with fluorescence-activated cell sorting and immunocytochemistry.ResultsBlood plasma dopamine levels, but not norepinepherine or epinephrine levels, were significantly increased in medicated RLS subjects vs unmedicated RLS subjects and Controls. The percentage of lymphocytes and monocytes expressing D2Rs differed between Control, RLS medicated and RLS unmedicated subjects. Total D2R expression in lymphocytes, but not monocytes, differed between Control, RLS medicated and RLS unmedicated subjects. D2Rs in lymphocytes, but not monocytes, were sensitive to dopamine in Controls only.ConclusionDownregulation of WBCs D2Rs occurs in RLS. This downregulation is not reversed by medication, although commonly used RLS medications increase plasma dopamine levels. The insensitivity of monocytes to dopamine levels, but their downregulation in RLS, may reflect their utility as a biomarker for RLS and perhaps brain dopamine homeostasis.

  8. [Innovative therapy for leg ulcers: Electrostimulation].

    Science.gov (United States)

    Maillard, H

    2015-01-01

    Chronic wounds can take a long time to heal despite appropriate therapy based upon aetiology and use of suitable dressings. The success of electrostimulation is based upon the existence within the skin of the endogenous currents involved in the wound healing process. Where skin continuity is broken by a wound, these electrical potentials are short-circuited, resulting in leakage of electrical current. Woundel(®) therapy is the only such treatment currently available in France and is based on the use of continuous pulsed current that generates an electrical field near the endogenous electrical fields. It utilises a console to deliver the electrical impulses, a dressing electrode and a dispersion electrode. The electrode dressing is left on the wound for 3 days, and venous compression bandaging may be applied to the leg, taking care to leave the connector free. Negative polarity stimulates migration of fibroblasts, resulting in elimination of fibrin. Positive polarity causes keratinocyte migration, which in turn leads to epidermisation. Electrostimulation is of recognised utility in the healing of chronic wounds: it has been assigned a high-level recommendation in the European and American guidelines for the treatment of venous ulcers and bedsores with proof level of A. Further, the analgesic effect of electrostimulation has been demonstrated in several studies. Electrostimulation is already well developed in France among wound specialists, but prospective studies are planned so that it may be used at patients' homes. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

  9. Adjuvant Biological Therapies in Chronic Leg Ulcers

    Directory of Open Access Journals (Sweden)

    Natalia Burgos-Alonso

    2017-11-01

    Full Text Available Current biological treatments for non-healing wounds aim to address the common deviations in healing mechanisms, mainly inflammation, inadequate angiogenesis and reduced synthesis of extracellular matrix. In this context, regenerative medicine strategies, i.e., platelet rich plasmas and mesenchymal stromal cell products, may form part of adjuvant interventions in an integral patient management. We synthesized the clinical experience on ulcer management using these two categories of biological adjuvants. The results of ten controlled trials that are included in this systematic review favor the use of mesenchymal stromal cell based-adjuvants for impaired wound healing, but the number and quality of studies is moderate-low and are complicated by the diversity of biological products. Regarding platelet-derived products, 18 controlled studies investigated their efficacy in chronic wounds in the lower limb, but the heterogeneity of products and protocols hinders clinically meaningful quantitative synthesis. Most patients were diabetic, emphasizing an unmet medical need in this condition. Overall, there is not sufficient evidence to inform routine care, and further clinical research is necessary to realize the full potential of adjuvant regenerative medicine strategies in the management of chronic leg ulcers.

  10. Joint variable stiffness of musculoskeletal leg mechanism for quadruped robot

    OpenAIRE

    Lei, J; Zhu, J; Xie, P; Tokhi, MO

    2017-01-01

    © The Author(s) 2017. When the quadruped robot is in locomotion such as jumping and running with higher speed, there is non-continuous contact force between the foot and the environment inevitably. In order to achieve the flexible force interaction of the bionic legs with the environment, it is necessary to analyze the joint angular stiffness of the bionic leg. In this article, based on the designing principles of the bionics, light-weighted, and flexible, a kind of musculoskeletal bionic leg...

  11. Principal component structure and sport-specific differences in the running one-leg vertical jump.

    Science.gov (United States)

    Laffaye, G; Bardy, B G; Durey, A

    2007-05-01

    The aim of this study is to identify the kinetic principal components involved in one-leg running vertical jumps, as well as the potential differences between specialists from different sports. The sample was composed of 25 regional skilled athletes who play different jumping sports (volleyball players, handball players, basketball players, high jumpers and novices), who performed a running one-leg jump. A principal component analysis was performed on the data obtained from the 200 tested jumps in order to identify the principal components summarizing the six variables extracted from the force-time curve. Two principal components including six variables accounted for 78 % of the variance in jump height. Running one-leg vertical jump performance was predicted by a temporal component (that brings together impulse time, eccentric time and vertical displacement of the center of mass) and a force component (who brings together relative peak of force and power, and rate of force development). A comparison made among athletes revealed a temporal-prevailing profile for volleyball players, and a force-dominant profile for Fosbury high jumpers. Novices showed an ineffective utilization of the force component, while handball and basketball players showed heterogeneous and neutral component profiles. Participants will use a jumping strategy in which variables related to either the magnitude or timing of force production will be closely coupled; athletes from different sporting backgrounds will use a jumping strategy that reflects the inherent demands of their chosen sport.

  12. Dissociation of periodic leg movements from arousals in restless legs syndrome.

    Science.gov (United States)

    Manconi, Mauro; Ferri, Raffaele; Zucconi, Marco; Bassetti, Claudio L; Fulda, Stephany; Aricò, Debora; Ferini-Strambi, Luigi

    2012-06-01

    The purpose of this study was to characterize the nature of the relation between periodic leg movements during sleep (PLMS) and cortical arousals to contribute to the debate on the clinical significance and treatment of PLMS. A prospective, placebo-controlled, single-blind, parallel group study was carried out including 46 drug-naive patients with idiopathic restless legs syndrome (RLS). Each patient underwent 2 consecutive full-night polysomnographic studies. The first night was the baseline night. Prior to the second night, 1 group received a single oral dose of 0.25mg pramipexole, whereas a second group received a single oral dose of 0.5mg clonazepam, and the remaining patients received placebo. Sleep stages, cyclic alternating pattern (CAP), and leg movement activity were scored following standard criteria; symptoms of RLS were also assessed. Pramipexole suppressed PLMS without affecting electroencephalographic (EEG) instability (CAP) and arousals (corresponding to CAP A3 and, partially, A2 subtypes), whereas clonazepam did the opposite, reducing non-rapid eye movement sleep EEG instability without effects on PLMS. Both drugs were effective on sensory RLS symptoms. This study demonstrates that a selective pharmacological approach can disconnect PLMS from arousal events, suggesting an indirect relation between each other. These results might weaken the hypothesis of a direct pathological role of PLMS in sleep disruption and can be important for the discussion on the existence of a distinct entity called periodic limb movements disorder. Moreover, the study opens the doors to the possibility of a joint treatment for RLS targeting sensory and motor symptoms, as well as sleep instability. Copyright © 2012 American Neurological Association.

  13. Underwater nuclear power plant structure

    International Nuclear Information System (INIS)

    Severs, S.; Toll, H.V.

    1982-01-01

    A structure for an underwater nuclear power generating plant comprising a triangular platform formed of tubular leg and truss members upon which are attached one or more large spherical pressure vessels and one or more small cylindrical auxiliary pressure vessels. (author)

  14. Restless legs syndrome, periodic leg movements, and periodic limb movement disorder in children.

    Science.gov (United States)

    Durmer, Jeffrey S; Quraishi, Ghazala H

    2011-06-01

    The characteristic symptoms of restless legs syndrome (RLS) have been known for hundreds of years and were first reported in medicine in the 1600s. Clinicians must consider potential mimics, comorbid, and associated conditions when evaluating children with RLS symptoms. The traditional differentiation of RLS from periodic limb movement disorder (PLMD) is noted in children as well as adults. Because current pediatric RLS research is sparse, this article provides the most up-to-date evidence-based as well as consensus opinion-based information on the subject of childhood RLS and PLMD. Prevalence, pathophysiology, diagnosis, treatment, and clinical associations are discussed. Copyright © 2011 Elsevier Inc. All rights reserved.

  15. Dynamic Leg Exercise Improves Tolerance to Lower Body Negative Pressure

    Science.gov (United States)

    Watenpaugh, D. E.; Ballard, R. E.; Stout, M. S.; Murthy, G.; Whalen, R. T.; Hargens, A. R.

    1994-01-01

    These results clearly demonstrate that dynamic leg exercise against the footward force produced by LBNP substantially improves tolerance to LBNP, and that even cyclic ankle flexion without load bearing also increases tolerance. This exercise-induced increase of tolerance was actually an underestimate, because subjects who completed the tolerance test while exercising could have continued for longer periods. Exercise probably increases LBNP tolerance by multiple mechanisms. Tolerance was increased in part by skeletal muscle pumping venous blood from the legs. Rosenhamer and Linnarsson and Rosenhamer also deduced this for subjects cycling during centrifugation, although no measurements of leg volume were made in those studies: they found that male subjects cycling at 98 W could endure 3 Gz centrifugation longer than when they remained relaxed during centrifugation. Skeletal muscle pumping helps maintain cardiac filling pressure by opposing gravity-, centrifugation-, or LBNP-induced accumulation of blood and extravascular fluid in the legs.

  16. Leg and arm lactate and substrate kinetics during exercise

    DEFF Research Database (Denmark)

    Van Hall, Gerrit; Jensen-Urstad, M; Rosdahl, H

    2003-01-01

    To study the role of muscle mass and muscle activity on lactate and energy kinetics during exercise, whole body and limb lactate, glucose, and fatty acid fluxes were determined in six elite cross-country skiers during roller-skiing for 40 min with the diagonal stride (Continuous Arm + Leg) followed...... by 10 min of double poling and diagonal stride at 72-76% maximal O(2) uptake. A high lactate appearance rate (R(a), 184 +/- 17 micromol x kg(-1) x min(-1)) but a low arterial lactate concentration ( approximately 2.5 mmol/l) were observed during Continuous Arm + Leg despite a substantial net lactate...... release by the arm of approximately 2.1 mmol/min, which was balanced by a similar net lactate uptake by the leg. Whole body and limb lactate oxidation during Continuous Arm + Leg was approximately 45% at rest and approximately 95% of disappearance rate and limb lactate uptake, respectively. Limb lactate...

  17. Development and Physical Control Research on Prototype Artificial Leg

    Directory of Open Access Journals (Sweden)

    Fei Li

    2016-03-01

    Full Text Available To provide an ideal platform for research on intelligent bionic leg (IBL, this paper proposes a model of a biped robot with heterogeneous legs (BRHL. A prototype of an artificial leg is developed based on biological structure and motion principle analysis of human lower extremities. With regard to the driving sources, servomotors are chosen for the hip joint and ankle joint, while pneumatic muscle actuators (PMAs are chosen for the knee joint. The control system of the bionic artificial leg is designed and a physical experimental platform is established. The physical control experiments are done based on proportional-integral-derivative (PID control strategy. The experimental results show that such a system can realize the expected goals.

  18. Eyelash Transplantation Using Leg Hair by Follicular Unit Extraction

    Directory of Open Access Journals (Sweden)

    Sanusi Umar, MD

    2015-03-01

    Full Text Available Summary: Fine hairs of the head and nape areas have been used as donor sources in eyelash transplantation but are straight, coarse, and grow rapidly, requiring frequent eyelash maintenance. This is the first reported case of eyelash transplantation by follicular unit extraction using leg hair as a donor source; findings were compared with that of another patient who underwent a similar procedure with donor hairs from the nape area. Although both patients reported marked improvement in fullness of eyelashes within 3 months postsurgery, the transplanted leg hair eyelashes required less frequent trimming (every 5–6 weeks compared with nape hair eyelashes (every 2–3 weeks. Additionally, in leg hair eyelashes, the need for perming to sustain a natural looking eyelash curl was eliminated. Eyelash transplantation using leg donor hair in hirsute women may result in good cosmetic outcomes and require less maintenance compared with nape donor hair.

  19. Leg ulcers in sickle cell patients: management challenges

    Directory of Open Access Journals (Sweden)

    El Khatib AM

    2016-11-01

    Full Text Available Arij M El Khatib,1 Shady N Hayek2 1Division of Plastic and Reconstructive Surgery, Department of Surgery, American University of Beirut Medical Center (AUBMC, 2Private Practice, Cosmetic Surgery Center, Beirut, Lebanon Abstract: Sickle cell disease is an autosomal recessive hemoglobinopathy caused by an amino acid substitution from glutamic acid to valine in the beta hemoglobin chain. One of the common symptoms occurring in sickle cell patients are leg ulcers, which are notoriously painful, difficult to treat, and frequently recurrent. These ulcers pose a therapeutic challenge with multiple modalities proposed for treatment, but with scarce evidence of efficacy of any single modality. Ulcer prevention, rigorous wound care, pain control, and surgery are the current mainstays of sickle cell leg ulcer treatment. Keywords: sickle cell leg ulcer, leg wound, sickle cell disease 

  20. Hereditary Lymphedema of the Leg – A Case Report

    Directory of Open Access Journals (Sweden)

    Birgit Heinig

    2017-07-01

    Full Text Available Primary of hereditary lymphedema is a rare but progressive disease. It is yet not curable. We present a 48-year-old male patient with hereditary lymphedema of his left leg, that was realised by minor trauma (able twist when he was seven years old. He had never been treated for lymphedema but experienced multiple erysipelas during his life. After diagnostic procedures to exclude other causes of leg swelling, the diagnosis of hereditary lymphedema of the leg, stage III was confirmed. We initialized complex decongestive therapy. During two weeks of intensive treatment, the circumference of the left leg could be reduced by 10 cm. This case illustrates the "natural course" hereditary lymphedema. But it raises the hope that even after decades of ignorance, the patients benefits from complex decongestive treatment. Therapeutic nihilism is unnecessary and poses lymphedema patients to risks of infection and secondary malignancies like Stewart-Trewes syndrome.

  1. Emphysematous Pyelonephritis Presenting as Necrotizing Fasciitis of the Leg

    Directory of Open Access Journals (Sweden)

    Yu-Xiong Ye

    2009-03-01

    Full Text Available We report a 50-year-old man with poorly controlled diabetes mellitus who presented with a painful, swollen right leg. He had also experienced right flank pain for 1 week prior to admission. Physical examination was notable for tenderness over the right flank. The right leg was diffusely swollen and exquisitely tender to touch, with palpable crepitance. Laboratory tests revealed leukocytosis and pyuria. Computed tomography showed a right ureteral stone with hydronephrosis and characteristic findings of emphysematous pyelonephritis. Furthermore, a right perirenal gas-forming abscess with extension to the right leg was noted. The patient was successfully treated with antibiotic therapy, aggressive control of blood sugar, percutaneous drainage of the hydronephrosis and perirenal abscess, and aggressive debridement of the leg.

  2. Periodic Limb Movement Disorder (PLMD) and Restless Legs Syndrome (RLS)

    Science.gov (United States)

    ... the syndrome. Risk factors include the following: A sedentary lifestyle Smoking Obesity Many people with narcolepsy or rapid eye movement (REM) behavior disorder move their legs periodically during sleep. Both ...

  3. Quality of Life in People with Leg Ulcer, Integrative Review

    Directory of Open Access Journals (Sweden)

    Daniela Alves

    2016-04-01

    Full Text Available Objective: To identify the main changes in the daily life of people with leg ulcer and how that affects the person’s quality of life. Methodology: We used the methodology PI [C] OD and selected four research articles, taken from EBSCO, PubMed, and EWMA. Results: The main changes identified in the people’s daily live with leg ulcers are physical (pain, decreased mobility, presence of exudate, bad smell from the wound and change in the style of clothing, psychological (sleep disorders, depression, anxiety, feelings of rejection and low self-steem, social (isolation, restriction in leisure activities, inability to perform household chores. Conclusions: The literature about the person’s quality of life with leg ulcer reported a significant impact in the daily life. The care provided by nurses should be centered on the person, integrating all the kind of needs and the leg ulcer must not be the sole focus of care

  4. The pathophysiology of restless legs syndrome

    International Nuclear Information System (INIS)

    Miyamoto, Masayuki; Miyamoto, Tomoyuki; Iwanami, Masaoki; Suzuki, Keisuke; Hirata, Koichi

    2009-01-01

    Restless legs syndrome (RLS) is a sensorimotor disorder that is frequently associated with periodic leg movements (PLMS). RLS is generally considered to be a central nervous system (CNS)-related disorder although no specific lesion has been found to be associated with the syndrome. Reduced intracortical inhibition has been demonstrated in RLS by transcranial magnetic stimulation. Some MRI studies have revealed the presence of morphologic changes in the somatosensory cortex, motor cortex and thalamic gray matter. The results of single photon emission computed tomography (SPECT) and positron emission tomography (PET) studies showed that the limbic and opioid systems also play important roles in the pathophysiology of RLS. A functional MRI study revealed abnormal bilateral cerebellar and thalamic activation during the manifestation of sensory symptoms, with additional red nucleus and reticular formation activity during PLMS. PLMS is likely to occur in patients with spinal cord lesions, and some patients with sensory polyneuropathy may exhibit RLS symptoms. RLS symptoms seem to depend on abnormal spinal sensorimotor integration at the spinal cord level and abnormal central somatosensory processing. PLMS appears to depend on increased excitability of the spinal cord and a decreased supraspinal inhibitory mechanism from the A11 diencephalic dopaminergic system. RLS symptoms respond very dramatically to dopaminergic therapy. The results of analysis by PET and SPECT studies of striatal D2 receptor binding in humans are inconclusive. However, studies in animal models suggest that the participation of the A11 dopaminergic system and the D3 receptor in RLS symptoms. The symptoms of RLS are aggravated in those with iron deficiency, and iron treatment ameliorates the symptoms in some patients. Neuroimaging studies, analysis of the cerebrospinal fluid, and studies on postmortem tissue and use of animal models have indicated that low brain iron concentrations and dysfunction of

  5. Leg-adjustment strategies for stable running in three dimensions

    International Nuclear Information System (INIS)

    Peuker, Frank; Maufroy, Christophe; Seyfarth, André

    2012-01-01

    The dynamics of the center of mass (CoM) in the sagittal plane in humans and animals during running is well described by the spring-loaded inverted pendulum (SLIP). With appropriate parameters, SLIP running patterns are stable, and these models can recover from perturbations without the need for corrective strategies, such as the application of additional forces. Rather, it is sufficient to adjust the leg to a fixed angle relative to the ground. In this work, we consider the extension of the SLIP to three dimensions (3D SLIP) and investigate feed-forward strategies for leg adjustment during the flight phase. As in the SLIP model, the leg is placed at a fixed angle. We extend the scope of possible reference axes from only fixed horizontal and vertical axes to include the CoM velocity vector as a movement-related reference, resulting in six leg-adjustment strategies. Only leg-adjustment strategies that include the CoM velocity vector produced stable running and large parameter domains of stability. The ability of the model to recover from perturbations along the direction of motion (directional stability) depended on the strategy for lateral leg adjustment. Specifically, asymptotic and neutral directional stability was observed for strategies based on the global reference axis and the velocity vector, respectively. Additional features of velocity-based leg adjustment are running at arbitrary low speed (kinetic energy) and the emergence of large domains of stable 3D running that are smoothly transferred to 2D SLIP stability and even to 1D SLIP hopping. One of the additional leg-adjustment strategies represented a large convex region of parameters where stable and robust hopping and running patterns exist. Therefore, this strategy is a promising candidate for implementation into engineering applications, such as robots, for instance. In a preliminary comparison, the model predictions were in good agreement with the experimental data, suggesting that the 3D SLIP is an

  6. Pediatric restless legs syndrome diagnostic criteria: an update by the International Restless Legs Syndrome Study Group.

    Science.gov (United States)

    Picchietti, Daniel L; Bruni, Oliviero; de Weerd, Al; Durmer, Jeffrey S; Kotagal, Suresh; Owens, Judith A; Simakajornboon, Narong

    2013-12-01

    Specific diagnostic criteria for pediatric restless legs syndrome (RLS) were published in 2003 following a workshop at the National Institutes of Health. Due to substantial new research and revision of the adult RLS diagnostic criteria, a task force was chosen by the International Restless Legs Syndrome Study Group (IRLSSG) to consider updates to the pediatric diagnostic criteria. A committee of seven pediatric RLS experts developed a set of 15 consensus questions to review, conducted a comprehensive literature search, and extensively discussed potential revisions. The committee recommendations were approved by the IRLSSG executive committee and reviewed by the IRLSSG membership. The pediatric RLS diagnostic criteria were simplified and integrated with the newly revised adult RLS criteria. Specific recommendations were developed for pediatric application of the criteria, including consideration of typical words used by children to describe their symptoms. Pediatric aspects of differential diagnosis, comorbidity, and clinical significance were then defined. In addition, the research criteria for probable and possible pediatric RLS were updated and criteria for a related condition, periodic limb movement disorder (PLMD), were clarified. Revised diagnostic criteria for pediatric RLS have been developed, which are intended to improve clinical practice and promote further research. Copyright © 2013 The Authors. Published by Elsevier B.V. All rights reserved.

  7. The effect of spinal manipulation on imbalances in leg strength.

    Science.gov (United States)

    Chilibeck, Philip D; Cornish, Stephen M; Schulte, Al; Jantz, Nathan; Magnus, Charlene R A; Schwanbeck, Shane; Juurlink, Bernhard H J

    2011-09-01

    We hypothesized that spinal manipulation (SM) would reduce strength imbalances between legs. Using an un-blinded randomized design, 28 males and 21 females (54 ± 19y) with at least a 15% difference in isometric strength between legs for hip flexion, extension, abduction, or knee flexion were randomized to treatment or placebo (mock spinal manipulation). Strength of the stronger and weaker legs for hip flexion, extension, abduction, and/or knee flexion was assessed before and after the intervention. SM reduced the relative strength difference between legs for knee flexion (mean ± SD 57 ± 53 to 5 ± 14%) and hip flexion (24 ± 12 to 11 ± 15%) compared to placebo (34 ± 29 to 24 ± 36%, and 20 ± 18 to 22 ± 26%, respectively) (p = 0.05). SM also improved strength in the weak leg for hip abduction (104 ± 43 to 116 ± 43 Nm) compared to placebo (84 ± 24 to 85 ± 31 Nm) (p = 0.03). This study suggests that spinal manipulation may reduce imbalances in strength between legs for knee and hip flexion.

  8. Criteria in diagnosing nocturnal leg cramps: a systematic review.

    Science.gov (United States)

    Hallegraeff, Joannes; de Greef, Mathieu; Krijnen, Wim; van der Schans, Cees

    2017-02-28

    Up to 33% of the general population over 50 years of age are affected by nocturnal leg cramps. Currently there are no generally accepted clinical characteristics, which identify nocturnal leg cramps. This study aims to identify these clinical characteristics and to differentiate between them and the characteristics of restless leg syndrome and periodic limb disorder. A systematic literature study was executed from December 2015 to May 2016. This study comprised of a systematic literature review of randomized clinical trials, observational studies on nocturnal and rest cramps of legs and other muscles, and other systematic and narrative reviews. Two researchers independently extracted literature data and analyzed this using a standardized reviewing protocol. Modified versions of the Cochrane Collaboration tools assessed the risk of bias. A Delphi study was conducted to assess agreement on the characteristics of nocturnal leg cramps. After systematic and manual searches, eight randomized trials and ten observational studies were included. On the basis of these we identified seven diagnostic characteristics of nocturnal leg cramps: intense pain, period of duration from seconds to maximum 10 minutes, location in calf or foot, location seldom in thigh or hamstrings, persistent subsequent pain, sleep disruption and distress. The seven above characteristics will enhance recognition of the condition, and help clinicians make a clear distinction between NLC and other sleep-related musculoskeletal disorder among older adults.

  9. Modeling posture-dependent leg actuation in sagittal plane locomotion

    International Nuclear Information System (INIS)

    Schmitt, J; Clark, J

    2009-01-01

    The spring loaded inverted pendulum template has been shown to accurately model the steady locomotion dynamics of a variety of running animals, and has served as the inspiration for an entire class of dynamic running robots. While the template models the leg dynamics by an energy-conserving spring, insects and animals have structures that dissipate, store and produce energy during a stance phase. Recent investigations into the spring-like properties of limbs, as well as animal response to drop-step perturbations, suggest that animals use their legs to manage energy storage and dissipation, and that this management is important for gait stability. In this paper, we extend our previous analysis of control of the spring loaded inverted pendulum template via changes in the leg touch-down angle to include energy variations during the stance phase. Energy variations are incorporated through leg actuation that varies the force-free leg length during the stance phase, yet maintains qualitatively correct force and velocity profiles. In contrast to the partially asymptotically stable gaits identified in previous analyses, incorporating energy and leg angle variations in this manner produces complete asymptotic stability. Drop-step perturbation simulations reveal that the control strategy is rather robust, with gaits recovering from drops of up to 30% of the nominal hip height.

  10. Straight leg elevation to rule out pelvic injury.

    Science.gov (United States)

    Bolt, Caroline; O'Keeffe, Francis; Finnegan, Pete; Dickson, Kristofer; Smit, De Villiers; Fitzgerald, Mark C; Mitra, Biswadev

    2018-02-01

    Pelvic x-ray is frequently used as a screening tool during initial assessment of injured patients. However routine use in the awake and alert blunt trauma patient may be questioned due to low yield. We propose a clinical tool that may avoid unnecessary imaging by examining whether the ability to straight leg raise, without pain, can rule out pelvic injury. We conducted a prospective cohort study with the exposure variables of ability to straight leg raise and presence of pain on doing so, and presence of pelvic fracture on x-ray as the primary outcome variable. Of the 328 participants, 35 had pelvic fractures, and of these 32 were either unable to straight leg raise, or had pain on doing so, with a sensitivity of 91.43% (95% CI: 76.94-98.2%) and a negative predictive value of 98.57% (95% CI: 95.88-99.70%). The 3 participants with a pelvic fracture who could straight leg raise with no pain, all had a GCS of less than 15, and therefore, among the sub-group of patients with GCS15, a 100% sensitivity and 100% negative predictive value for straight leg raise with no pain to rule out pelvic fracture was demonstrated. Among awake, alert patients, painless straight leg raise can exclude pelvic fractures and be incorporated into initial examination during reception and resuscitation of injured patients. Crown Copyright © 2017. Published by Elsevier Ltd. All rights reserved.

  11. High resolution unenhanced computed tomography in patients with swollen legs.

    Science.gov (United States)

    Monnin-Delhom, E D; Gallix, B P; Achard, C; Bruel, J M; Janbon, C

    2002-09-01

    To evaluate the accuracy of computed tomography (CT) scan imaging in distinguishing lymphedema from deep venous thrombosis (DVT) and lipodystrophy (lipedema) in patients with swollen legs. CT scans of the lower limbs were performed in 55 patients with 76 swollen legs (44 lymphedemas, 12 DVT and 20 lipedemas). Thirty-four normal contralateral legs were also similarly evaluated. Primary lymphedema was verified by lymphography or lymphoscintigraphy, whereas secondary lymphedema was documented by a typical clinical history. DVT was established by ultrasound Doppler imaging. The diagnosis of lipedema was made with bilateral swollen legs where lymphoscintigraphy and Doppler examination were both unremarkable. Qualitative CT analysis was based on skin thickening, subcutaneous edema accumulation with a honeycombed pattern, and muscle compartment enlargement. Sensitivity and specificity of CT scan for the diagnosis of lymphedema was 93 and 100%, respectively; for lipedema it was 95 and 100%, respectively; andfor DVT it was 91 and 99%, respectively. Skin thickening was found in 42 lymphedemas (95%), in 9 DVT (75%), and in 2 lipedemas (16%). Subcutaneous edema accumulation was demonstrated in 42 legs (95%) with lymphedema and in 5 (42%) with DVT but in none with lipedema. A honeycombed pattern was present only in lymphedema (18 legs or 41%); muscle enlargement was present in all patients with DVT, in no patient with lipedema, and in 4 (9%) with lymphedema. Edema accumulation is readily demonstrated with plain CT scan and is not present in lipedema. Specific CT features of the subcutaneous fat and muscle compartments allow accurate differentiation between lymphedema and DVT.

  12. Treatment Failure and Leg Amputation Among Patients With Foot Osteomyelitis.

    Science.gov (United States)

    Barshes, Neal R; Mindru, Cezarina; Ashong, Chester; Rodriguez-Barradas, Maria; Trautner, Barbara W

    2016-12-01

    We sought to identify factors associated with treatment failure and leg amputations among those patients who presented with foot osteomyelitis. Characteristics, treatments, and outcomes for all patients treated for probable or definite foot osteomyelitis (per consensus definition) between January 2011 and March 2015 were reviewed. Multivariate Cox regression models were used to identify risk factors for treatment failure (unanticipated resection of additional bone or leg amputation) and of leg amputation alone. A total of 184 episodes of foot osteomyelitis met inclusion criteria. Treatment failure occurred in 53 (28.8%) and leg amputation in 21 (11.4%). Risk factors for treatment failure included severe/unaddressed peripheral artery disease, homelessness, Pseudomonas aeruginosa or Escherichia coli bone isolates, serum albumin <2.8 mg/dL, hallux involvement, insulin therapy, 60 or more pack-years smoking, and <7 days of directed antibiotic therapy for a positive bone margin. Delayed primary wound closure (ie, staged operations) had significantly lower treatment failure risk. Unanticipated resection of bone was not associated with leg amputation. Foot osteomyelitis treatment failure is common. Various factors can help identify those at risk for treatment failure and/or leg amputation, and further studies should focused whether initial management or follow-up should change when these factors are present.

  13. Modeling posture-dependent leg actuation in sagittal plane locomotion

    Energy Technology Data Exchange (ETDEWEB)

    Schmitt, J [Department of Mechanical Engineering, Oregon State University, Corvallis, OR 97331 (United States); Clark, J, E-mail: schmitjo@engr.orst.ed [Department of Mechanical Engineering, Florida State University, Tallahassee, FL 32310 (United States)

    2009-12-15

    The spring loaded inverted pendulum template has been shown to accurately model the steady locomotion dynamics of a variety of running animals, and has served as the inspiration for an entire class of dynamic running robots. While the template models the leg dynamics by an energy-conserving spring, insects and animals have structures that dissipate, store and produce energy during a stance phase. Recent investigations into the spring-like properties of limbs, as well as animal response to drop-step perturbations, suggest that animals use their legs to manage energy storage and dissipation, and that this management is important for gait stability. In this paper, we extend our previous analysis of control of the spring loaded inverted pendulum template via changes in the leg touch-down angle to include energy variations during the stance phase. Energy variations are incorporated through leg actuation that varies the force-free leg length during the stance phase, yet maintains qualitatively correct force and velocity profiles. In contrast to the partially asymptotically stable gaits identified in previous analyses, incorporating energy and leg angle variations in this manner produces complete asymptotic stability. Drop-step perturbation simulations reveal that the control strategy is rather robust, with gaits recovering from drops of up to 30% of the nominal hip height.

  14. Venous leg ulcer patients: a review of the literature on lifestyle and pain-related interventions.

    NARCIS (Netherlands)

    Heinen, M.M.; Achterberg, T. van; Reimer, W.S. op; Kerkhof, P.C.M. van de; Laat, H.E.W. de

    2004-01-01

    BACKGROUND: Having a leg ulcer has a major impact on daily life. Lifestyle is mentioned in most leg ulcer guidelines but mostly without much emphasis on the subject. AIMS AND OBJECTIVES: Evidence for the effect of nutrition, leg elevation and exercise on the healing of leg ulcers was reconsidered.

  15. A Behavioral Mechanism of How Increases in Leg Strength Improve Old Adults' Gait Speed

    NARCIS (Netherlands)

    Uematsu, Azusa; Tsuchiya, Kazushi; Kadono, Norio; Kobayashi, Hirofumi; Kaetsu, Takamasa; Hortobagyi, Tibor; Suzuki, Shuji

    2014-01-01

    We examined a behavioral mechanism of how increases in leg strength improve healthy old adults' gait speed. Leg press strength training improved maximal leg press load 40% (p = 0.001) and isometric strength in 5 group of leg muscles 32% (p = 0.001) in a randomly allocated intervention group of

  16. One-day low-intensity combined arm-leg (Cruiser) ergometer exercise intervention : cardiorespiratory strain and gross mechanical efficiency in one-legged and two-legged exercise

    NARCIS (Netherlands)

    Simmelink, Elisabeth K; Wervelman, Thijs; de Vries, Hendrik S; Geertzen, Jan H B; Dekker, Rienk; van der Woude, Lucas H V

    2017-01-01

    This study aims to research whether there is a difference in cardiorespiratory variables and gross mechanical efficiency (GE) in healthy individuals during low-intensity one-legged and two-legged exercise on the combined arm-leg (Cruiser) ergometer and whether motor learning occurs. The outcome of

  17. Are Giant Tornadoes the Legs of Solar Prominences?

    Science.gov (United States)

    Wedemeyer, Sven; Scullion, Eamon; Rouppe van der Voort, Luc; Bosnjak, Antonija; Antolin, Patrick

    2013-09-01

    Observations in the 171 Å channel of the Atmospheric Imaging Assembly of the space-borne Solar Dynamics Observatory show tornado-like features in the atmosphere of the Sun. These giant tornadoes appear as dark, elongated, and apparently rotating structures in front of a brighter background. This phenomenon is thought to be produced by rotating magnetic field structures that extend throughout the atmosphere. We characterize giant tornadoes through a statistical analysis of properties such as spatial distribution, lifetimes, and sizes. A total number of 201 giant tornadoes are detected in a period of 25 days, suggesting that, on average, about 30 events are present across the whole Sun at a time close to solar maximum. Most tornadoes appear in groups and seem to form the legs of prominences, thus serving as plasma sources/sinks. Additional Hα observations with the Swedish 1 m Solar Telescope imply that giant tornadoes rotate as a structure, although they clearly exhibit a thread-like structure. We observe tornado groups that grow prior to the eruption of the connected prominence. The rotation of the tornadoes may progressively twist the magnetic structure of the prominence until it becomes unstable and erupts. Finally, we investigate the potential relation of giant tornadoes to other phenomena, which may also be produced by rotating magnetic field structures. A comparison to cyclones, magnetic tornadoes, and spicules implies that such events are more abundant and short-lived the smaller they are. This comparison might help to construct a power law for the effective atmospheric heating contribution as a function of spatial scale.

  18. ARE GIANT TORNADOES THE LEGS OF SOLAR PROMINENCES?

    International Nuclear Information System (INIS)

    Wedemeyer, Sven; Scullion, Eamon; Rouppe van der Voort, Luc; Bosnjak, Antonija; Antolin, Patrick

    2013-01-01

    Observations in the 171 Å channel of the Atmospheric Imaging Assembly of the space-borne Solar Dynamics Observatory show tornado-like features in the atmosphere of the Sun. These giant tornadoes appear as dark, elongated, and apparently rotating structures in front of a brighter background. This phenomenon is thought to be produced by rotating magnetic field structures that extend throughout the atmosphere. We characterize giant tornadoes through a statistical analysis of properties such as spatial distribution, lifetimes, and sizes. A total number of 201 giant tornadoes are detected in a period of 25 days, suggesting that, on average, about 30 events are present across the whole Sun at a time close to solar maximum. Most tornadoes appear in groups and seem to form the legs of prominences, thus serving as plasma sources/sinks. Additional Hα observations with the Swedish 1 m Solar Telescope imply that giant tornadoes rotate as a structure, although they clearly exhibit a thread-like structure. We observe tornado groups that grow prior to the eruption of the connected prominence. The rotation of the tornadoes may progressively twist the magnetic structure of the prominence until it becomes unstable and erupts. Finally, we investigate the potential relation of giant tornadoes to other phenomena, which may also be produced by rotating magnetic field structures. A comparison to cyclones, magnetic tornadoes, and spicules implies that such events are more abundant and short-lived the smaller they are. This comparison might help to construct a power law for the effective atmospheric heating contribution as a function of spatial scale

  19. Determinants of the abilities to jump higher and shorten the contact time in a running 1-legged vertical jump in basketball.

    Science.gov (United States)

    Miura, Ken; Yamamoto, Masayoshi; Tamaki, Hiroyuki; Zushi, Koji

    2010-01-01

    This study was conducted to obtain useful information for developing training techniques for the running 1-legged vertical jump in basketball (lay-up shot jump). The ability to perform the lay-up shot jump and various basic jumps was measured by testing 19 male basketball players. The basic jumps consisted of the 1-legged repeated rebound jump, the 2-legged repeated rebound jump, and the countermovement jump. Jumping height, contact time, and jumping index (jumping height/contact time) were measured and calculated using a contact mat/computer system that recorded the contact and air times. The jumping index indicates power. No significant correlation existed between the jumping height and contact time of the lay-up shot jump, the 2 components of the lay-up shot jump index. As a result, jumping height and contact time were found to be mutually independent abilities. The relationships in contact time between the lay-up shot jump to the 1-legged repeated rebound jump and the 2-legged repeated rebound jump were correlated on the same significance levels (p jumping height existed between the 1-legged repeated rebound jump and the lay-up shot jump (p jumping height between the lay-up shot jump and both the 2-legged repeated rebound jump and countermovement jump. The lay-up shot index correlated more strongly to the 1-legged repeated rebound jump index (p jump index (p jump is effective in improving both contact time and jumping height in the lay-up shot jump.

  20. Isolated and soft-switched power converter

    Science.gov (United States)

    Peng, Fang Zheng; Adams, Donald Joe

    2002-01-01

    An isolated and soft-switched power converter is used for DC/DC and DC/DC/AC power conversion. The power converter includes two resonant tank circuits coupled back-to-back through an isolation transformer. Each resonant tank circuit includes a pair of resonant capacitors connected in series as a resonant leg, a pair of tank capacitors connected in series as a tank leg, and a pair of switching devices with anti-parallel clamping diodes coupled in series as resonant switches and clamping devices for the resonant leg. The power converter is well suited for DC/DC and DC/DC/AC power conversion applications in which high-voltage isolation, DC to DC voltage boost, bidirectional power flow, and a minimal number of conventional switching components are important design objectives. For example, the power converter is especially well suited to electric vehicle applications and load-side electric generation and storage systems, and other applications in which these objectives are important. The power converter may be used for many different applications, including electric vehicles, hybrid combustion/electric vehicles, fuel-cell powered vehicles with low-voltage starting, remote power sources utilizing low-voltage DC power sources, such as photovoltaics and others, electric power backup systems, and load-side electric storage and generation systems.

  1. The Association Between Knee Confidence and Muscle Power, Hop Performance, and Postural Orientation in People With Anterior Cruciate Ligament Injury

    DEFF Research Database (Denmark)

    Ageberg, Eva; Roos, Ewa M

    2016-01-01

    power, hop performance, and postural orientation (test for substitution patterns score) as independent variables (absolute value on the injured leg, and limb symmetry index [LSI; injured leg/uninjured leg × 100] or absolute difference between the injured and uninjured legs). Results Sixteen patients...... for substitution patterns scores. In the multivariable analysis, worse vertical jump LSI (P = .043) and worse side hop LSI (P = .012) significantly accounted for 25% of the variation in perceived knee confidence. Conclusion Between-leg differences during demanding tasks are associated with knee confidence...

  2. Effective force application in guided leg extensions

    NARCIS (Netherlands)

    Doorenbosch, C.A.M.; Veeger, H. E J; van Zandwijk, J. P.; van Ingen Schenau, G. J.

    1996-01-01

    In guided movements, limb kinematics is determined by the object on which a force is applied (as in cycling). Consequently, the force direction may deviate from the effective direction. It is examined how effective force application is related to maximal power output. A recent study, where subjects

  3. Analysis of Interrelationships among Voluntary and Prosthetic Leg Joint Parameters Using Cyclograms

    Directory of Open Access Journals (Sweden)

    Nur Azah Hamzaid

    2017-04-01

    Full Text Available The walking mechanism of a prosthetic leg user is a tightly coordinated movement of several joints and limb segments. The interaction among the voluntary and mechanical joints and segments requires particular biomechanical insight. This study aims to analyze the inter-relationship between amputees' voluntary and mechanical coupled leg joints variables using cyclograms. From this analysis, the critical gait parameters in each gait phase were determined and analyzed if they contribute to a better powered prosthetic knee control design. To develop the cyclogram model, 20 healthy able-bodied subjects and 25 prosthesis and orthosis users (10 transtibial amputees, 5 transfemoral amputees, and 10 different pathological profiles of orthosis users walked at their comfortable speed in a 3D motion analysis lab setting. The gait parameters (i.e., angle, moment and power for the ankle, knee and hip joints were coupled to form 36 cyclograms relationship. The model was validated by quantifying the gait disparities of all the pathological walking by analyzing each cyclograms pairs using feed-forward neural network with backpropagation. Subsequently, the cyclogram pairs that contributed to the highest gait disparity of each gait phase were manipulated by replacing it with normal values and re-analyzed. The manipulated cyclograms relationship that showed highest improvement in terms of gait disparity calculation suggested that they are the most dominant parameters in powered-knee control. In case of transfemoral amputee walking, it was identified using this approach that at each gait sub-phase, the knee variables most responsible for closest to normal walking were: knee power during loading response and mid-stance, knee moment and knee angle during terminal stance phase, knee angle and knee power during pre-swing, knee angle at initial swing, and knee power at terminal swing. No variable was dominant during mid-swing phase implying natural pendulum effect of the

  4. The Lively Legs self-management programme increased physical activity and reduced wound days in leg ulcer patients: Results from a randomized controlled trial.

    NARCIS (Netherlands)

    Heinen, M.M.; Borm, G.F.; Vleuten, C.J.M. van der; Evers, A.W.M.; Oostendorp, R.A.B.; Achterberg, T. van

    2012-01-01

    OBJECTIVE: Investigating the effectiveness of the Lively Legs program for promoting adherence with ambulant compression therapy and physical exercise as well as effects on leg ulcer recurrence. DESIGN: A randomized controlled trial. SETTING: Eleven outpatient clinics for dermatology in the

  5. Sleep apnea in patients reporting insomnia or restless legs symptoms.

    Science.gov (United States)

    Bianchi, M T; Goparaju, B; Moro, M

    2016-01-01

    Insomnia and restless legs syndrome (RLS) are defined by self-reported symptoms, and polysomnography (PSG) is not routinely indicated. Occult obstructive sleep apnea (OSA), common even in asymptomatic adults, may complicate management of patients presenting with insomnia or restless legs. To this end, we investigated objective sleep apnea metrics in a large retrospective cohort according to self-reported symptom profiles. We compared sleep apnea findings in patients referred to our center according to self-reported symptoms associated with insomnia, sleep apnea, and restless legs. The cohort included over 1900 adults who underwent diagnostic (n = 1418) or split-night (n = 504) PSGs and completed a symptom and medical history questionnaire. More than 30% of patients who did not endorse any OSA symptoms, but did endorse insomnia or restless legs symptoms, were found to have OSA based on apnea-hypopnea index (AHI) >5 during overnight laboratory testing. Regression models of the full cohort showed that the risk of OSA was related, as expected, to older age, male sex, elevated body mass index, and presence of OSA symptoms. The presence of insomnia symptoms did not alter the risk of OSA. The presence of restless legs symptoms showed a small odds ratio for lowered OSA risk. Objective evidence of OSA occurs similarly in those with insomnia or restless legs symptoms, even among those without self-reported OSA symptoms. Providers should be aware of the potential for occult OSA in populations with insomnia and restless legs, which may complicate their management in addition to presenting an independent medical risk itself. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  6. Leg kinematics and kinetics in landing from a single-leg hop for distance. A comparison between dominant and non-dominant leg

    NARCIS (Netherlands)

    van der Harst, J. J.; Gokeler, A.; Hof, A. L.

    Background. Anterior cruciate ligament (ACL) deficiency can be a major problem for athletes and subsequent reconstruction of the ACL may be indicated if a conservative regimen has failed. After ACL reconstruction signs of abnormality in the use of the leg remain for a long time. It is expected that

  7. Restless Leg Syndrome Across the Globe: Epidemiology of the Restless Legs Syndrome/Willis-Ekbom Disease.

    Science.gov (United States)

    Koo, Brian B

    2015-09-01

    There are more than 50 epidemiologic studies measuring the prevalence of restless legs syndrome/Willis-Ekbom disease (RLS/WED) across 5 of the 6 inhabited continents (not Australia), most conducted in North America and Europe. Sufficient studies have been conducted in Asia, North America, and Europe to make inferences on RLS/WED prevalence by region. RLS/WED prevalence is thought to be highest in North America and Europe and lower in Asia. These differences across regions may be explained by cultural, environmental, and genetic factors. Future investigation is needed to determine to what extent these factors affect expression of RLS/WED according to world region. Published by Elsevier Inc.

  8. The Comparing the Leg Muscles Electromyography during Single Leg Drop Landing in Pesplanus and Normal Men

    Directory of Open Access Journals (Sweden)

    mostafa bazvand

    2016-03-01

    Full Text Available Objective: pesplanus is one of the changes that brings about changes in muscle activation patterns. Being aware of muscles activity changes in various standing positions among pesplanus patients provides insights into preventing lower extremity injuries in this population. The aim of this study was to compare leg muscles electromyography during various standing positions in pesplanus and normal subjects. Methods: 60 healthy male university students, 30 subjects with pesplanus deformity (with average age 23/54±3/57 year, average height 175/34±7/62 cm, average weight 74/87±10/72 kg and 30 normal subjects (with average age 22/97±2/38 year, average height 176/6±5/59 cm, average weight 73/58±8/36 kg participated in this comparative study. Deformity of pesplanus was assessed with navicular drop test. Each subject performed single-leg landing dropping from 30cm height onto a force platform where muscles activity was recorded with EMG device. For data analysis, Matlab and Spss softwares were used and independent sample t-test was used to compare the dependent variables at a significance level of P &le 0/05. Results: Significant differences were observed between the two groups for the activities of the longus peroneus and anterior tibialis muscles ( p&le0/05 while no significant differences were observed in other muscles. Conclusion: The changes in the normal structure of the foot might affect muscle activities during standing, which can cause changes in the injury patterns. Therefore, it is proposed that focusing on corrective exercises and therapy plan can reduce these risks.

  9. Validity of leg-to-leg bioelectrical impedance analysis to estimate body fat in obesity.

    Science.gov (United States)

    Lloret Linares, Célia; Ciangura, Cécile; Bouillot, Jean-Luc; Coupaye, Muriel; Declèves, Xavier; Poitou, Christine; Basdevant, Arnaud; Oppert, Jean-Michel

    2011-07-01

    Bioelectrical impedance analysis (BIA) is a safe and easy method of assessing body composition. Its accuracy to predict fat mass (FM) in obesity and the change in FM following weight loss is questioned. Our objective was to compare leg-to-leg BIA to dual-energy X-ray absorptiometry (DXA) in the assessment of FM in a large population, the changes in FM after Roux-en-Y gastric bypass (RYGB) and to estimate between-method differences (bias) and limits of agreement. BIA (Tanita BC-420MA) and DXA (Hologic Discovery W) were used in 5,740 consecutive patients (mean BMI, 37.7 ± 8.2 kg/m(2)) examined in a clinical nutrition department and in 72 women undergoing RYGB (BMI, 47.2 ± 7.2 kg/m(2)). Analyses included correlations between methods and Bland Altman analysis. In the entire population, BIA significantly overestimated FM in comparison with DXA (1.1 ± 6.1 kg, 0.8 ± 5.6%). FM estimates by each method were significantly correlated in absolute value (kg; r(2) = 0.9 in the whole population), and in percentage (r(2) = 0.6). However, wide limits of agreement were observed. In surgery patients, BIA significantly overestimated FM both before and 12 months after bypass. BIA significantly overestimated changes in FM after RYGB at 3 months (2.9 ± 5.0 kg) and at 12 months (1.9 ± 3.9 kg) but not at 6 months (0.9 ± 5.0 kg; p = 0.08). Estimates of changes in FM by each method were significantly correlated (r (2) = 0.4, 0.6, and 0.9, respectively). According to the wide limits of agreement, BIA seems more interesting for epidemiological rather than individual use to evaluate body FM and FM changes in obese women undergoing RYGB.

  10. Muscle power is an important measure to detect deficits in muscle function in hip osteoarthritis

    DEFF Research Database (Denmark)

    Bieler, Theresa; Magnusson, Stig Peter; Christensen, Helle Elisabeth

    2017-01-01

    that exercise interventions focusing on improving leg extensor power of the symptomatic lower extremity and reducing asymmetry may be beneficial for patients with hip osteoarthritis. Implications for Rehabilitation Even in patients with mild symptoms not awaiting hip replacement a generalized muscle weakening...... functional performance and leg extensor power seems to be stronger, and more strongly related to power of the symptomatic lower extremity. Our results indicate that exercise interventions focusing on improving leg extensor power of the symptomatic lower extremity and reducing asymmetry may be beneficial...

  11. Association between restless leg syndrom and slow coronary flow.

    Science.gov (United States)

    Erden, İsmail; Çakcak Erden, Emine; Durmuş, Hacer; Tıbıllı, Hakan; Tabakçı, Mustafa; Kalkan, Mehmet Emin; Türker, Yasin; Akçakoyun, Mustafa

    2014-11-01

    Restless legs syndrome (RLS) is a common sleep disorder in which patients feel unpleasent leg sensations and urge to move the legs during rest, especially at night, and symptoms are improved by leg movement. Prior studies analyzing the associations between cardiovascular disease and restless legs syndrome has shown controversial results. The goal of the study was to estimate the relationship between restless legs syndrome and slow coronary flow (SCF). The present study was cross-sectional and observational and consists of 176 individuals who underwent coronary angiography and had angiographically normal coronary arteries of varying coronary flow rates. The study included 86 patients with isolated SCF and 90 control participants with normal coronary flow (NCF). RLS was assessed the day after the coronry flow was evaluated, using a self-administered questionnaire based on the International Restless Legs Study Group criteria. The following question was asked: "Do you have unpleasant leg sensations (like crawling, paraesthesia, or pain) combined with motor restlessness and an urge to move?" The possible responses were as follows: no, less than once/month, 2-4 times/month, 5-14 times/month, and 15 or more times per month. Those who answered that they had these feelings were asked the following two more questions: 1) "Do these symptoms occur only at rest and does moving improve them?" and 2) "Are these symptoms worsen in the evening/at night compared with the morning?" RLS is considered to be probable if the participant has answered "yes" for all three of the above questions, and has a frequency of ≥5 times/month. Student's t-test, Mann-Whitney U test, multiple logistic regression analysis were used for statistical analysis. The prevalence of restless legs syndrome was 48 (27%) and increased significantly with age. Patients with SCF have more likely had RLS than the control group (p<0.001). The age-adjusted prevalence odds of SCF were 3.11 times higher (95% CI: 1

  12. A Tabular Format for Computing Inverse Kinematic Equations for a 3DOF Robot Leg

    Directory of Open Access Journals (Sweden)

    F. Nickols

    2009-09-01

    Full Text Available A method is presented for accurately computing the three servomechanism angles that place the leg tip of a 3DOF robot leg in cylindrical coordinate space, R, θ, Z. The method is characterized by (i a multivariable integer power series for each degree of freedom that can be used to replace traditional trigonometrical functions, and, (ii only integer numbers are used. A technique is shown that derives the coefficients, Ci j k, of each of the terms in the series that represents a servomechanism angle, S. This power series method has the advantage of; (i satisfying accuracy requirements, (ii producing a unique solution, (iii high speed realtime computation, (iv low memory requirement and (v implementation into a generic algorithm or hardware such as a field programmable gate array. The series can represent many continuous kinematic systems just by changing the values of the coefficients. The coefficients are rapidly computed via a spreadsheet. The method can be extended to more than three degrees of freedom and also mapped into other coordinate frames such as a Cartesian or spherical.

  13. A Tabular Format for Computing Inverse Kinematic Equations for a 3DOF Robot Leg

    Directory of Open Access Journals (Sweden)

    F. Nickols

    2010-02-01

    Full Text Available A method is presented for accurately computing the three servomechanism angles that place the leg tip of a 3DOF robot leg in cylindrical coordinate space, R, ?, Z. The method is characterized by (i a multivariable integer power series for each degree of freedom that can be used to replace traditional trigonometrical functions, and, (ii only integer numbers are used. A technique is shown that derives the coefficients, Ci j k, of each of the terms in the series that represents a servomechanism angle, S. This power series method has the advantage of; (i satisfying accuracy requirements, (ii producing a unique solution, (iii high speed realtime computation, (iv low memory requirement and (v implementation into a generic algorithm or hardware such as a field programmable gate array. The series can represent many continuous kinematic systems just by changing the values of the coefficients. The coefficients are rapidly computed via a spreadsheet. The method can be extended to more than three degrees of freedom and also mapped into other coordinate frames such as a Cartesian or spherical.

  14. Relationship of functional leg-length discrepancy to abnormal pronation.

    Science.gov (United States)

    Rothbart, Brian A

    2006-01-01

    The objective of this study was to determine whether a correlation exists between abnormal pronation and functional leg-length discrepancies. Visual assessment and a pelvic thrust maneuver were used to identify the functionally short leg in 56 indigenous Mexicans (20 males and 36 females; mean age, 33 years; mean weight, 59 kg; and mean height, 1.60 m). The Foot Posture Index was used with a modified stance position to identify the more pronated foot. The posterosuperior iliac spines were used to identify the "relative" position of the innominate bones. The raw data obtained from this study were evaluated using the McNemar test for paired proportions. A significant positive correlation was found between abnormal pronation and hip position and between hip position and functional leg-length discrepancy. These results are consistent with a theoretical ascending dysfunctional pelvic model: Abnormal pronation pulls the innominate bones anteriorly (forward); anterior rotation of the innominate bones shifts the acetabula posteriorly and cephalad (backward and upward); and this shift in the acetabula hyperextends the knees and shortens the legs, with the shortest leg corresponding to the most pronated foot.

  15. Patterns of lower leg and foot eczema in south India

    Directory of Open Access Journals (Sweden)

    Chougule Abhijit

    2008-01-01

    Full Text Available Background: The pattern of eczema is altered by geography, habits of people and environmental factors and regional variation in skin structure and function. Aims: Our study was done to estimate frequency and patterns of lower leg and foot eczemas. Methods: A total of 200 patients with various types of lower leg and foot eczemas were recruited over a period of 2 years. Demographic and clinical characteristics were noted. Suspected cases of allergic contact dermatitis were patch tested. Results: The frequency of these eczemas was 2.5 per 1000 out patients. Mean age of patients was 40.49 years. Female to male ratio was 1.6:1. Sixty (30% patients were farmers, sixty (30% were housewives, forty (20% were students, nineteen (9.5% were daily laborers, nine had sedentary jobs and three were teachers. Most eczemas were bilateral (72%. Mean duration of eczema was 36.6 months. Most common type of eczema was lichen simplex chronicus (36% followed by discoid eczema (18.5%, allergic contact dermatitis (14.5% and stasis eczema (7.5%. Other eczemas noted were juvenile plantar dermatosis, cumulative irritant contact dermatitis, infected eczema, hyperkeratotic eczema, asteatotic eczema, pompholyx, infective eczema and unclassified endogenous eczema. Common sites of involvement were dorsa of feet (49.5%, followed by lateral aspect of lower leg (31%, medial aspect of lower leg (17.5% and ankle (12%. Conclusion : Our study highlights lichen simplex chronicus as the most common eczema affecting the lower legs and feet.

  16. Squamous cell carcinoma developed on chronic venous leg ulcer.

    Science.gov (United States)

    Sîrbi, Adelina Gabriela; Florea, Marius; Pătraşcu, Virgil; Rotaru, Maria; Mogoş, Dan Gabriel; Georgescu, Claudia Valentina; Mărgăritescu, Nicolae Dragoş

    2015-01-01

    Chronic venous leg ulcers (VLU), especially long-lasting non-healing ulcers, are among the risk factors for squamous cell carcinoma (SCC). Malignant transformation of a VLU is a rare finding and the relative risk of carcinomatous transformation is quite low (about 5.8). SCC arising in the context of a VLU has a particularly aggressive behavior. A 76-year-old male patient with no relevant medical familial history, with chronic venous insufficiency CEAP C6 for 10 years [recurrent leg ulcers with favorable outcome (healing) after specific local and systemic treatment], showing for about three years one ulcerated lesion located on the anterior upper third of the right calf non-responsive to specific treatment, which subsequently increased their size and merged. Biopsy sample was taken. Histopathology showed epidermal acanthosis, papillomatosis, intense parakeratosis, pseudoepitheliomatous hyperplasia, dysplasia and moderately differentiated squamous cell carcinoma with areas of acantholysis. Immunohistochemistry (Ki67, EMA, cytokeratin 34βE12 and p63) was performed and all types of immunostaining were moderately to intense positive. Above-knee leg amputation and specific oncologic treatment were proposed as possible curative solutions but the patient refused. Ten months after diagnosis and discharge form the Department of Dermatology, the patient died. Patients with chronic venous leg ulcers and clinically suspicious lesions should be evaluated for malignant transformation of the venous lesion. When diagnosed, malignancy complicating a chronic venous leg ulcer requires a resolute treatment as it may be fatal.

  17. Military boot attenuates axial loading to the lower leg.

    Science.gov (United States)

    Yoganandan, Narayan; Schlick, Michael; Arun, Mike W J; Pintar, Frank A

    2014-01-01

    Biomechanical tests to understand injury mechanisms and derive injury tolerance information using Post-Mortem Human Subjects (PMHS) have not used foot protection and they have primarily focused on civilian environments such as automotive and athletic- and sports-related events. As military personnel use boots, tests with the boot are required to understand their effect on attenuating lower leg loads. The purpose of this study was therefore, to determine the modulation of human lower leg kinematics with boot compressions and share of the force absorbed by the boot from underbody blast loading. Axial impacts were delivered to the Hybrid III dummy lower leg in the neutral position. The dummy leg was instrumented with its internal upper and lower tibia load cells, and in addition, a knee load cell was attached to the proximal end. Tests were conducted at 4.4 to 8.9 m/s, with and without boots, and repeat tests were done. Morphologies of the force-time responses were similar at the three load cell locations and for all input combinations and booted and unbooted conditions. However, booted tests resulted in considerably lower maximum forces (approximately two-third reduction) than unbooted tests. These results clearly show that boots can absorb a considerable share of the impact energy and decrease impact loads transmitted to the lower leg under vertical loading, thus necessitating the generation of tolerance data using PMHS for this environment.

  18. Why do arms extract less oxygen than legs during exercise?

    DEFF Research Database (Denmark)

    Calbet, J A L; Holmberg, H-C; Rosdahl, H

    2005-01-01

    To determine whether conditions for O2 utilization and O2 off-loading from the hemoglobin are different in exercising arms and legs, six cross-country skiers participated in this study. Femoral and subclavian vein blood flow and gases were determined during skiing on a treadmill at approximately 76...... exercise (diagonal stride), the corresponding mean values were 93 and 85% (n = 3; P hemoglobin to be 50% saturated (P50: r = 0.93, P ...Hg, respectively. Because conditions for O2 off-loading from the hemoglobin are similar in leg and arm muscles, the observed differences in maximal arm and leg O2 extraction should be attributed to other factors, such as a higher heterogeneity in blood flow distribution, shorter mean transit time, smaller...

  19. Radiation processing for the control of Salmonella in frog legs

    International Nuclear Information System (INIS)

    Nerkar, D.P.; Kumta, U.S.; Sreenivasan, A.

    1976-01-01

    Large consignments of frogs legs are exported annually from India. Failure to satisfy some of the strict microbiological standards, especially in relating to Salmonellae contamination, has resulted in the rejection of large quantities of the product in recent years. This has emphasised the need for better and more effective methods than those currently in use for the elimination of Salmonellae. With a view to developing an irradiation process for the control of this public health problem, commercial samples of frog legs have been screened to assess the incidence of Salmonella. The various serotypes have been identified and their radiation sensitivities determined. Based on these data, a radiation treatment of frozen frog legs for the elimination of Salmonella has been developed. (author)

  20. Injury of the right leg long term after thorotrast injection

    International Nuclear Information System (INIS)

    Ito, Yuzo; Taguma, Kiyohiko; Yatsuzuka, Mitsuo

    1978-01-01

    A patient (57-year-old man) had open fracture of the leg due to a bullet wound penetrating the right leg in 1941, and had arteriography from the right popliteal fossa at an army hospital in 1942. He complained of painful swelling ranging from the inward site of the right femur to the popliteal fossa in 1977. As a result of the examination using a scintillation counter, it was diagnosed as an injury of the right leg long term after thorotrast injection. There was no deposition of thorotrast in the liver, the spleen, or the epigastric lymph nodes. Histopathologically, there was no finding of malignancy but granuloma. The findings on the postoperative examination were restored to the normal, but long-time-course observation seemed to be necessary in future considering a possibility of its exacerbation. (Ichikawa, K.)

  1. Hybrid control and motion planning of dynamical legged locomotion

    CERN Document Server

    2012-01-01

    "This book provides a comprehensive presentation of issues and challenges faced by researchers and practicing engineers in motion planning and hybrid control of dynamical legged locomotion. The major features range from offline and online motion planning algorithms to generate desired feasible periodic walking and running motions and tow-level control schemes, including within-stride feedback laws, continuous time update laws and event-based update laws, to asymptotically stabilize the generated desired periodic orbits. This book describes the current state of the art and future directions across all domains of dynamical legged locomotion so that readers can extend proposed motion planning algorithms and control methodologies to other types of planar and 3D legged robots".

  2. Survey of the leg exocrine glands in termites(Isoptera

    Directory of Open Access Journals (Sweden)

    Helena Xavier Soares

    2002-01-01

    Full Text Available A survey of the leg exocrine glands in the termite workers of 16 species of the families Kalotermitidae and Termitidae was carried out through scanning electron microscope. Glandular openings were not found in the legs of Anoplotermes sp., Ruptitermes sp. (Apicotermitinae, Termitidae or Glyptotermes planus (Kalotermitidae, but they are present, spread over the ventral surface of the first, second and third tarsomeres of other Termitidae such as Armitermes euamignathus, Cornitermes cumulans, Nasutitermes coxipoensis, Rhynchotermes nasutissimus, Syntermes nanus, Embiratermes festivellus (Nasutitermitinae, Amitermes beaumonti, Hoplotermes amplus, Microcerotermes sp., Neocapritermes opacus, Orthognathotermes sp., Spinitermes brevicornutus and Termes sp. (Termitinae. The pores are usually isolated but they can also be grouped inside a round depression. The occurrence of leg exocrine glands in the family Termitidae is reported for the first time.

  3. Differential glucose uptake in quadriceps and other leg muscles during one-legged dynamic submaximal knee-extension exercise

    Directory of Open Access Journals (Sweden)

    Kari eKalliokoski

    2011-10-01

    Full Text Available One-legged dynamic knee-extension exercise (DKE is a widely used model to study the local cardiovascular and metabolic responses to exercise of the quadriceps muscles. In this study, we explored the extent to which different muscles of the quadriceps are activated during exercise using positron emission tomography (PET determined uptake of [18F]-fluoro-deoxy-glucose (GU during DKE. Five healthy male subjects performed DKE at 25 W for 35 min and both the contracting and contralateral resting leg were scanned with PET from mid-thigh and distally. On average, exercise GU was the highest in the vastus intermedius (VI and lowest in the vastus lateralis (VL (VI vs VL, p<0.05, whereas the coefficient of variation was highest in VL (VL vs VI, p<0.05. Coefficient of variation between the mean values of the four QF muscles in the exercising leg was 35±9%. Compared to mean GU in QF (=100%, GU was on average 73% in VL, 84% in rectus femoris, 115% in vastus medialis, and 142% in VI. Variable activation of hamstring muscles and muscles of the lower leg was also observed. These results show that GU of different muscles of quadriceps muscle group as well as between individuals vary greatly during DKE, and suggests that muscle activity is not equal between quadriceps muscles in this exercise model. Furthermore, posterior thigh muscles and lower leg muscles are more active than hitherto thought even during this moderate exercise intensity.

  4. The hyperaemic response to passive leg movement is dependent on nitric oxide

    DEFF Research Database (Denmark)

    Mortensen, Stefan Peter; Askew, Christopher D; Walker, Meegan

    2012-01-01

    interstitial space. Inhibition of NO synthesis lowered the vasodilatory response to passive leg movement by ~90%. The increase in leg blood flow was lower in elderly subjects compared to young subjects and leg blood flow did not increase when passive leg movement was performed by elderly with peripheral artery...... disease. The results suggest that the hyperaemia induced by passive leg movement is NO dependent. The hyperaemic response to passive leg movement and to ACh was also assessed in elderly subjects and patients with peripheral artery disease.......Key points Passive leg movement is associated with a ~3-fold increase in blood flow to the leg, but the underlying mechanisms remain unknown. Passive leg movement increased venous levels of metabolites of nitric oxide (NO) in young subjects, whereas they remained unaltered in the muscle...

  5. Willis-Ekbom Disease or Restless Legs Syndrome?

    Science.gov (United States)

    Carlos, K; Prado, L B F; Carvalho, L B C; Prado, G F

    2015-09-01

    Restless Legs Syndrome (RLS) or Willis-Ekbom Disease (WED) is highly prevalent, but patients and healthcare providers alike know little about it. Furthermore, controversy persists as to the best way of diagnosing this nosological entity. To verify whether the term used to refer to this disease entity (Restless Legs Syndrome or Willis-Ekbom Disease) affects the prevalence of self-diagnosed RLS/WED in a sample of newly graduated physicians. Newly graduated physicians were asked to self-evaluate for the presence of RLS/WED. Briefly, participants were allocated randomly across two groups. One was asked to self-assess for RLS, while the other was asked to self-assess for WED. The evaluation form given to one group asked 'Do you have Restless Legs Syndrome?' whereas the form given to participants in the other group asked 'Do you have Willis-Ekbom Disease?'. Both forms also contained the four criteria for diagnosing RLS proposed by the International Restless Legs Syndrome Study Group (IRLSSG) and instructions for self-diagnosis according to these criteria. The study sample comprised 1413 newly graduated physicians. Of the 708 participants who were given the form that used the term RLS, 87 (12.28%) diagnosed themselves with the condition. Conversely, of 705 physicians given the form with the term WED, 13 (1.84%) diagnosed themselves with the condition (p Restless Legs Syndrome than when presented with the term Willis-Ekbom Disease. This suggests that the term Restless Legs Syndrome may not be the most appropriate term to denote this nosological entity. Copyright © 2015 Elsevier B.V. All rights reserved.

  6. Leg orientation as a clinical sign for pusher syndrome

    Directory of Open Access Journals (Sweden)

    Johannsen Leif

    2006-08-01

    Full Text Available Abstract Background Effective control of (upright body posture requires a proper representation of body orientation. Stroke patients with pusher syndrome were shown to suffer from severely disturbed perception of own body orientation. They experience their body as oriented 'upright' when actually tilted by nearly 20° to the ipsilesional side. Thus, it can be expected that postural control mechanisms are impaired accordingly in these patients. Our aim was to investigate pusher patients' spontaneous postural responses of the non-paretic leg and of the head during passive body tilt. Methods A sideways tilting motion was applied to the trunk of the subject in the roll plane. Stroke patients with pusher syndrome were compared to stroke patients not showing pushing behaviour, patients with acute unilateral vestibular loss, and non brain damaged subjects. Results Compared to all groups without pushing behaviour, the non-paretic leg of the pusher patients showed a constant ipsiversive tilt across the whole tilt range for an amount which was observed in the non-pusher subjects when they were tilted for about 15° into the ipsiversive direction. Conclusion The observation that patients with acute unilateral vestibular loss showed no alterations of leg posture indicates that disturbed vestibular afferences alone are not responsible for the disordered leg responses seen in pusher patients. Our results may suggest that in pusher patients a representation of body orientation is disturbed that drives both conscious perception of body orientation and spontaneous postural adjustment of the non-paretic leg in the roll plane. The investigation of the pusher patients' leg-to-trunk orientation thus could serve as an additional bedside tool to detect pusher syndrome in acute stroke patients.

  7. Leg deformation during imaginal ecdysis in the downy emerald, Cordulia aenea (Odonata, Corduliidae).

    Science.gov (United States)

    Frantsevich, Leonid; Frantsevich, Ludmilla

    2018-04-01

    A dragonfly larva migrates from the water to the shore, perches on a plant stem and grasps it with strongly flexed legs. Adult legs inside the larval exoskeleton fit to the larval legs joint-to-joint. The adult emerges with stretched legs. During the molt, an imaginal leg must follow all the angles in exuvial joints. In turn, larval apodemes are withdrawn from imaginal legs. We visualized transient shapes of the imaginal legs by the instant fixation of insects at different moments of the molt, photographed isolated exuvial legs with the imaginal legs inside and then removed the exuvial sheath. Instant shapes of the imaginal tibia show sharp intrapodomere bends copying the angle in the larval femoro-tibial joint. The site of bending shifts distad during the molt. This is possible if the imaginal leg is pliable. The same problem of leg squeezing is also common in hemimetabolous insects as well as in other arthropods, whereas holometabolous insects overcome problems of a tight confinement either by using leg pliability in other ways but not squeezing (cyclorrhaphan flies, mosquitoes) or by pulling hardened legs out without change of their pupal zigzag configuration (moths, ants, honey bees). The pupal legs are not intended to grasp any external substrate. Copyright © 2018 Elsevier GmbH. All rights reserved.

  8. Myonecrosis in the leg caused by Salmonella enteritidis

    DEFF Research Database (Denmark)

    Jørring, S; Kolmos, H J; Klareskov, B

    1994-01-01

    Five weeks after an episode of gastroenteritis, a 65-year-old diabetic male developed an extensive myonecrosis, with gas production in the left leg caused by Salmonella enteritidis. The patient was treated with surgical revision and antibiotics. To our knowledge, this is the first case of myonecr......Five weeks after an episode of gastroenteritis, a 65-year-old diabetic male developed an extensive myonecrosis, with gas production in the left leg caused by Salmonella enteritidis. The patient was treated with surgical revision and antibiotics. To our knowledge, this is the first case...

  9. Anatomic and functional leg-length inequality: A review and recommendation for clinical decision-making. Part II, the functional or unloaded leg-length asymmetry

    Directory of Open Access Journals (Sweden)

    Knutson Gary A

    2005-07-01

    Full Text Available Abstract Background Part II of this review examines the functional "short leg" or unloaded leg length alignment asymmetry, including the relationship between an anatomic and functional leg-length inequality. Based on the reviewed evidence, an outline for clinical decision making regarding functional and anatomic leg-length inequality will be provided. Methods Online databases: Medline, CINAHL and Mantis. Plus library searches for the time frame of 1970–2005 were done using the term "leg-length inequality". Results and Discussion The evidence suggests that an unloaded leg-length asymmetry is a different phenomenon than an anatomic leg-length inequality, and may be due to suprapelvic muscle hypertonicity. Anatomic leg-length inequality and unloaded functional or leg-length alignment asymmetry may interact in a loaded (standing posture, but not in an unloaded (prone/supine posture. Conclusion The unloaded, functional leg-length alignment asymmetry is a likely phenomenon, although more research regarding reliability of the measurement procedure and validity relative to spinal dysfunction is needed. Functional leg-length alignment asymmetry should be eliminated before any necessary treatment of anatomic LLI.

  10. On voluntary rhythmic leg movement behaviour and control during pedalling.

    Science.gov (United States)

    Hansen, E A

    2015-06-01

    central pattern generators. The last part of the characterisation is largely based on, and supported by, work of other researchers in the field. Despite the robustness of the freely chosen pedalling frequency, it may be affected by some particular factors. As an example from the present work, freely chosen pedalling frequency during treadmill cycling increased by on average 15 to 17 rpm when power output was increased from a value corresponding to 86% and up to 165% of Wmax . This phenomenon is supported by other studies. As another example from the present work, freely chosen pedalling frequency decreased by on average 9 to 14 rpm following heavy strength training that involved both hip extension and hip flexion. Further, the present work suggested that the latter phenomenon occurred within the first week of training and was caused by in particular the hip extension strength training rather than the hip flexion strength training. The fast response to the strength training indicated that neural adaptations presumably caused the observed changes in movement behaviour. The internal organisation of the central pattern generator is by some other researchers in the field considered to be functionally separated into two components, in which, one is responsible for movement frequency and another is responsible for movement pattern. For the present dissertation, the freely chosen pedalling frequency was considered to reflect the rhythmic movement frequency of the voluntary rhythmic leg movement of pedalling. The tangential pedal force profile was considered to reflect the rhythmic movement pattern. The present work showed that fatiguing hip flexion exercise in healthy and recreationally active individuals modified the tangential pedal force profile during cycling at a pre-set target pedalling frequency in a way that the minimum tangential pedal force became more negative, the maximum tangential pedal force increased, and the phase with negative tangential pedal force increased

  11. Differential glucose uptake in quadriceps and other leg muscles during one-legged dynamic submaximal knee-extension exercise

    DEFF Research Database (Denmark)

    Kalliokoski, Kari K; Boushel, Robert; Langberg, Henning

    2011-01-01

    to mean GU in QF (=100%), GU was on average 73% in VL, 84% in rectus femoris, 115% in vastus medialis, and 142% in VI. Variable activation of hamstring muscles and muscles of the lower leg was also observed. These results show that GU of different muscles of quadriceps muscle group as well as between......One-legged dynamic knee-extension exercise (DKE) is a widely used model to study the local cardiovascular and metabolic responses to exercise of the quadriceps muscles. In this study, we explored the extent to which different muscles of the quadriceps are activated during exercise using positron...... in the vastus intermedius (VI) and lowest in the vastus lateralis (VL; VI vs VL, p muscles in the exercising leg was 35 ± 9%. Compared...

  12. Bio-Inspired Design and Kinematic Analysis of Dung Beetle-Like Legs

    DEFF Research Database (Denmark)

    Aditya, Sai Krishna Venkata; Ignasov, Jevgeni; Filonenko, Konstantin

    The African dung beetle Scarabaeus galenus can use its front legs to walk and manipulate or form a dung ball. The interesting multifunctional legs have not been fully investigated or even used as inspiration for robot leg design. Thus, in this paper, we present the development of real dung beetle......-like front legs based on biological investigation. As a result, each leg consists of three main segments which were built using 3D printing. The segments were combined with in total four active DOFs in order to mimic locomotion and object manipulation of the beetle. Kinematics analysis of the leg was also...

  13. Leg muscle activation patterns during walking and leg lean mass are different in children with and without developmental coordination disorder.

    Science.gov (United States)

    Yam, Timothy T T; Fong, Shirley S M

    2018-02-01

    Previous studies have shown that children with developmental coordination disorder (DCD) have a higher body fat and greater gait variability. Little research has investigated the gait muscle activity and lean mass measures in children with DCD. To compare the leg muscle activation patterns of the gait cycle and leg lean mass between children with and without DCD. Fifty-one children were in the DCD group (38 males and 13 females; 7.95 ± 1.04 years) and fifty-two in the control group (34 males and 18 females; 8.02 ± 1.00 years). Peak muscle activation patterns of treadmill walking in the right leg for the eight-gait phases were measured by means of surface electromyography, an electrogoniometer, and foot contact switches. Leg lean mass measures were evaluated using a whole-body dual energy X-ray absorptiometry scan. Children with DCD had a lower leg lean mass and appendicular lean mass index compared to the control group. Furthermore, they exhibited a less-pronounced peak muscle activation during the heel strike (gastrocnemius medialis), early swing (biceps femoris) and late swing phases (gastrocnemius medialis) of gait. Although lower limb total mass was similar between groups, the DCD group displayed lower lean mass measures than controls. Furthermore, children with DCD illustrated a lower leg peak muscle activation during the heel strike, early swing and late swing phases of gait when walking on a treadmill. Our results emphasize the need to incorporate lower limb phasic muscle strengthening components into gait rehabilitation programs for children with DCD. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. Effects of bodyweight-based exercise training on muscle functions of leg multi-joint movement in elderly individuals.

    Science.gov (United States)

    Yamauchi, Junichiro; Nakayama, Satoshi; Ishii, Naokata

    2009-09-01

    Because demands of functional exercise training with using own bodyweight for elderly individuals were increasing, the present study investigated the effects of bodyweight-based exercise training on muscle functions of leg multi-joint movements in elderly individuals. Twenty-seven untrained healthy elderly individuals (mean +/- standard deviation, 66.0 +/- 5.7 years) completed the training program for 10 months. The exercise program consisted mainly of exercises for large leg muscle groups without using external weight, performing 10-50 repetitions and 1-3 sets for each exercise. Before and after the training period, force-velocity relations of knee-hip extension movements were measured with a servo-controlled dynamometer and the maximum force (Fmax), velocity (Vmax) and power (Pmax) were determined. After the training, Fmax and Pmax increased and these increases represented 15% (P elderly individuals; however, the initial training status is important for progressive increases in muscle force.

  15. Verification results of methodology for determining the weighted mean coolant temperature in the primary circuit hot legs of WWER-1000 reactor plants

    Energy Technology Data Exchange (ETDEWEB)

    Saunin, Yuri V.; Dobrotvorski, Alexander N.; Semenikhin, Alexander V.; Korolev, Alexander S. [JSC ' ' Atomtechenergo' ' , Novovoronezh (Russian Federation). Novovoronezh Filial ' ' Novovoronezhatomtechenergo' ' ; Ryasny, Sergei I. [JSC ' ' Atomtechenergo' ' , Moscow (Russian Federation)

    2017-09-15

    The JSC ''Atomtechenergo'' experts have developed a new methodology for determining the weighted mean coolant temperature in the primary circuit hot legs of WWER-1000 reactor plants. The necessity for developing the new methodology was determined by the need to decrease the calculation error of the weighted mean coolant temperature in the hot legs because of the coolant temperature stratification. The methodology development was based on the findings of experimental and calculating research executed by the authors. The methodology verification was fulfilled through comparison of calculation results obtained with and without the methodology use in various operational states and modes of several WWER-1000 power units. The obtained verification results have confirmed that the use of the new methodology provides objective error decrease in determining the weighted mean coolant temperature in the primary circuit hot legs. The decrease value depends on the stratification character which is various for different objects and conditions.

  16. Control method of Three-phase Four-leg converter based on repetitive control

    Science.gov (United States)

    Hui, Wang

    2018-03-01

    The research chose the magnetic levitation force of wind power generation system as the object. In order to improve the power quality problem caused by unbalanced load in power supply system, we combined the characteristics and repetitive control principle of magnetic levitation wind power generation system, and then an independent control strategy for three-phase four-leg converter was proposed. In this paper, based on the symmetric component method, the second order generalized integrator was used to generate the positive and negative sequence of signals, and the decoupling control was carried out under the synchronous rotating reference frame, in which the positive and negative sequence voltage is PI double closed loop, and a PI regulator with repetitive control was introduced to eliminate the static error regarding the fundamental frequency fluctuation characteristic of zero sequence component. The simulation results based on Matlab/Simulink show that the proposed control project can effectively suppress the disturbance caused by unbalanced loads and maintain the load voltage balance. The project is easy to be achieved and remarkably improves the quality of the independent power supply system.

  17. Skipping on uneven ground: trailing leg adjustments simplify control and enhance robustness

    Science.gov (United States)

    2018-01-01

    It is known that humans intentionally choose skipping in special situations, e.g. when descending stairs or when moving in environments with lower gravity than on Earth. Although those situations involve uneven locomotion, the dynamics of human skipping on uneven ground have not yet been addressed. To find the reasons that may motivate this gait, we combined experimental data on humans with numerical simulations on a bipedal spring-loaded inverted pendulum model (BSLIP). To drive the model, the following parameters were estimated from nine subjects skipping across a single drop in ground level: leg lengths at touchdown, leg stiffness of both legs, aperture angle between legs, trailing leg angle at touchdown (leg landing first after flight phase), and trailing leg retraction speed. We found that leg adjustments in humans occur mostly in the trailing leg (low to moderate leg retraction during swing phase, reduced trailing leg stiffness, and flatter trailing leg angle at lowered touchdown). When transferring these leg adjustments to the BSLIP model, the capacity of the model to cope with sudden-drop perturbations increased. PMID:29410879

  18. Propeller Flap for Complex Distal Leg Reconstruction: A Versatile ...

    African Journals Online (AJOL)

    have been described in the axilla, periolecranon, forearm, lower extremity,[1] hand,[6] and trunk.[7] In spite of the versatility of perforator‑based flaps, literature search reveals ... Anatomy of distal leg perforators. Perforators are small diameter vessels that originate from a main pedicle and perforate the fascia or muscle to ...

  19. Does EMG activation differ among fatigue-resistant leg muscles ...

    African Journals Online (AJOL)

    The participants (N=32) were divided into two groups according to the Fatigue Index value [Group I: Less Fatigue Resistant (LFR), n=17; Group II: More Fatigue Resistant (MFR), n=15]. The repeated EMG activities of four leg muscles [rectus femoris, biceps femoris, vastus lateralis and vastus medialis] were analysed during ...

  20. Perforated diverticulitis presenting as necrotising fasciitis of the leg

    Directory of Open Access Journals (Sweden)

    Talbot Robert

    2008-02-01

    Full Text Available Abstract Diverticulosis of the colon is a common condition of increasing age. Complications of diverticulitis including stricture, perforation and fistula formation often require surgery. Perforated diverticulitis may rarely present with spreading superficial sepsis. We describe for the first time, to our knowledge, a case of retroperitoneal diverticula perforation presenting as necrotising fasciitis of the leg necessitating hind-quarter amputation.

  1. Standard Hip Ventrodorsal Leg Extended View In The Diagnosis Of ...

    African Journals Online (AJOL)

    Canine hip dysplasia (CHD) is hereditary developmental condition that involves a lack of conformity between the femoral head and acetabulum. It invariably leads to osteoarthritis. We hereby review the standard hip ventrodorsal leg extended view to be adopted by our Tanzanian veterinarians. Diagnostic radiography is the ...

  2. Restless legs syndrome in migraine patients : prevalence and severity

    NARCIS (Netherlands)

    van Oosterhout, W P J; van Someren, E J W; Louter, M A; Schoonman, G G; Lammers, G J; Rijsman, R M; Ferrari, M D; Terwindt, G M

    BACKGROUND AND PURPOSE: Our aim was to study not only the prevalence but more importantly the severity and the correlation between sleep quality and restless legs syndrome (RLS) in a large population of well-defined migraine patients as poor sleep presumably triggers migraine attacks. METHODS: In a

  3. European guidelines on management of restless legs syndrome

    DEFF Research Database (Denmark)

    Garcia-Borreguero, Diego; Ferini-Strambi, Luigi; Kohnen, Ralf

    2012-01-01

    Since the publication of the first European Federation of Neurological Societies (EFNS) guidelines in 2005 on the management of restless legs syndrome (RLS; also known as Willis-Ekbom disease), there have been major therapeutic advances in the field. Furthermore, the management of RLS is now a part...

  4. Well-leg compartment syndrome after gynecological laparoscopic surgery

    DEFF Research Database (Denmark)

    Boesgaard-Kjer, Diana H; Boesgaard-Kjer, Daniel; Kjer, Jens Jørgen

    2013-01-01

    Well-leg compartment syndrome in the lower extremities after surgery in the lithotomy position is a rare but severe complication requiring early diagnosis and intervention. Several circumstances predispose to this condition as a consequence of increased intra-compartmental pressure, such as posit...

  5. Cloacal impaction with cloacolith in a black-legged seriema ...

    African Journals Online (AJOL)

    Ibrahim Eldaghayes

    2017-12-07

    Dec 7, 2017 ... A 5-year-old intact female black-legged seriema (Chunga burmeisteri) was presented for behavioral changes and slight decrease in activity (minor ... panel did not reveal any abnormalities as compared to reference individuals from .... Cloacolith in a blue-fronted Amazon parrot. (Amazona aestiva). J. Avian ...

  6. X-Ray Exam: Lower Leg (Tibia and Fibula)

    Science.gov (United States)

    ... Staying Safe Videos for Educators Search English Español X-Ray Exam: Lower Leg (Tibia and Fibula) KidsHealth / For ... Muscles, and Joints Broken Bones Getting an X-ray (Video) X-Ray (Video) View more Partner Message About Us ...

  7. [Erosive pustular dermatosis of the leg: role of zinc deficiency?].

    Science.gov (United States)

    Salavert, M; Franck, F; Amarger, S; Mansard, S; Souteyrand, P; D'Incan, M

    2006-12-01

    Erosive pustular dermatosis of the legs is a rare and recently described condition seen in elderly subjects. It is characterised by symmetric erosions of the legs resulting from a confluence of sterile pustules, usually following minor trauma. Treatment with dermal corticosteroids is rapidly effective but is not codified and relapse is common. Three patients aged respectively 74, 84 and 92 years presented ulcers of the legs and ankles associated with peripheral pustules following minor injury. These pustules were sterile and exhibited a spongiform appearance on histological examination. None of these patients had a prior history of psoriasis. However, all presented zinc deficiency. Treatment with dermal corticosteroids combined with oral zinc gluconate resulted in complete resolution in two of the patients after several days of therapy and proved effective during relapse in the third patient. Erosive pustular dermatosis of the legs is a benign dermatosis that is probably under-reported that should be included in the category of inflammatory neutrophilic dermatoses. The cases we present suggest a triggering or enhancing role of zinc deficiency.

  8. Conservative management of distal leg necrosis in lung transplant recipients.

    Science.gov (United States)

    Aigner, F; Husmann, M; Huber, L C; Benden, C; Schuurmans, M M

    2017-05-01

    Critical limb ischemia (CLI) with distal leg necrosis in lung transplant recipients (LTR) is associated with a high risk for systemic infection and sepsis. Optimal management of CLI has not been defined so far in LTR. In immunocompetent individuals with leg necrosis, surgical amputation would be indicated and standard care. We report on the outcome of four conservatively managed LTR with distal leg necrosis due to peripheral arterial disease (PAD) with medial calcification of the distal limb vessels. Time interval from lung transplantation to CLI ranged from four years (n = 1) to more than a decade (n = 3). In all cases a multimodal therapy with heparin, acetylsalicylic acid, iloprost and antibiotic therapy was performed, in addition to a trial of catheter-based revascularization. Surgical amputation of necrosis was not undertaken due to fear of wound healing difficulties under long-term immunosuppression and impaired tissue perfusion. Intensive wound care and selective debridement were performed. Two patients developed progressive gangrene followed by auto-amputation during a follow-up of 43 and 49 months with continued ambulation and two patients died of unrelated causes 9 and 12 months after diagnosis of CLI. In conclusion, we report a conservative treatment strategy for distal leg necrosis in LTR without surgical amputation and recommend this approach based on our experience. Copyright © 2017 Tissue Viability Society. Published by Elsevier Ltd. All rights reserved.

  9. Metabolic profiles of exudates from chronic leg ulcerations.

    Science.gov (United States)

    Junka, Adam; Wojtowicz, Wojciech; Ząbek, Adam; Krasowski, Grzegorz; Smutnicka, Danuta; Bakalorz, Barbara; Boruta, Agnieszka; Dziadas, Mariusz; Młynarz, Piotr; Sedghizadeh, Parish Paymon; Bartoszewicz, Marzenna

    2017-04-15

    Chronic leg ulceration is a disease usually associated with other comorbidities, and significantly reduces patient quality of life. Infected leg ulcers can lead to limb-threatening sequelae or mortality. Leg ulcerations are colonized by a number of microbes that are able to cause life-threating infections in susceptible patients. Wound exudate is a body fluid that collects metabolites from patient eukaryotic cells and from prokaryotic bacterial communities inhabiting the wound. This study aimed at identification of metabolites in exudates collected from chronic leg ulcers, and correlation of this metabolome with patient comorbidities and microbiological status of the wound. By means of NMR spectroscopy we detected 42 metabolites of microbial or patient origin. The metabolites that were in abundance in exudates analyzed were lactate, lysine, and leucine. Metabolites were associated with the presence of neutrophils in wounds and destruction of high quantities of microbes, but also with hypoxia typical for venous insufficiency. The combination of nuclear magnetic resonance spectroscopy technique and partial least squares discriminant analysis allowed us to further discriminate groups of metabolites with regards to potential clinical meaning. For example, to discriminate between S.aureus versus all other isolated microbial species, or between patients suffering from type I or II diabetes versus patients without diabetes. Therefore, wound exudate seems to be highly applicable material for discriminant analysis performed with the use of NMR technique to provide for rapid metabolomics of chronic wound status. Copyright © 2017 Elsevier B.V. All rights reserved.

  10. Retrospective Assessment of Black Leg in Kafta Humera Woreda ...

    African Journals Online (AJOL)

    Retrospective study was conducted with the objective of assessing the vaccination coverage of Kafta Humera through observation of different woredas against black leg from records of the Humera veterinary clinic in Tigray region of Ethiopia, from 207/8-2012/13. The result revealed that there was vaccination program ...

  11. Whole-body vibration dosage alters leg blood flow

    NARCIS (Netherlands)

    Lythgo, Noel; Eser, Prisca; de Groot, Patricia; Galea, Mary

    The effect of whole-body vibration dosage on leg blood flow was investigated. Nine healthy young adult males completed a set of 14 random vibration and non-vibration exercise bouts whilst squatting on a Galileo 900 plate. Six vibration frequencies ranging from 5 to 30 Hz (5 Hz increments) were used

  12. Propeller Flap for Complex Distal Leg Reconstruction: A Versatile ...

    African Journals Online (AJOL)

    Reverse sural artery fasciocutaneous flap has become a workhorse for the reconstruction of distal leg soft tissue defects. When its use is not feasible, perforator‑based propeller flap offers a better, easier, faster, and cheaper alternative to free flap. We present our experience with two men both aged 34 years who sustained ...

  13. E-survey on venous leg ulcer among Dutch dermatologists

    NARCIS (Netherlands)

    S.W.I. Reeder (Suzan); K.P. de Roos; R.J.M. Vogels (R. J M); H.A.M. Neumann (Martino)

    2013-01-01

    textabstractAim: To get insight into the frequency of venous leg ulceration in the Dutch dermatologic practice, and into how this profession treats this disease. Design: Material and Methods: An e-survey was conducted. To all Dutch dermatologists and residents dermatology an email was sent with an

  14. [Compression therapy of chronic leg ulcers : Practical aspects].

    Science.gov (United States)

    Dissemond, J; Protz, K; Hug, J; Reich-Schupke, S; Kröger, K

    2017-02-16

    Compression therapy, together with modern moist wound treatment, is the basis for a successful conservative treatment of patients with chronic leg ulcers. In clinical practice, it is often the patients themselves who apply compression therapies. Many of the mostly elderly patients, however, are not able to reach their legs and feet due to movement restrictions, such as arthritis, arthrosis and even obesity. An adequate compression therapy also requires extensive experience and regular training. In practice only the minority of patients can perform bandaging well and therefore this should not be recommended. Self-management with do-it-yourself medical devices will become more and more important in the future. In addition to the psychological factors, cost aspects and demographic change, an expected lack of qualified nursing staff due to the number of elderly patients who are potentially in need of care means that self-management is becoming increasingly more important. For the essentially important compression therapy of patients with chronic leg ulcers, there already exist various therapy options. The needs, preferences and abilities of the patients concerned can be considered when selecting the appropriate system. Particularly for the self-management of compression therapy, adaptive compression bandages are suitable for patients with leg ulcers during the initial decompression phase and ulcer stocking systems in the subsequent maintenance phase.

  15. Venous thrombosis during pregnancy: leg and trimester of presentation

    NARCIS (Netherlands)

    Ginsberg, J. S.; Brill-Edwards, P.; Burrows, R. F.; Bona, R.; Prandoni, P.; Büller, H. R.; Lensing, A.

    1992-01-01

    In order to determine the relative frequencies of left and right leg venous thrombosis during pregnancy and the frequencies of venous thrombosis during the three trimesters, a cohort study of 60 consecutive patients with a first episode of venous thrombosis during pregnancy was performed.

  16. Short Communication Retrospective Assessment of Black Leg in ...

    African Journals Online (AJOL)

    Bheema

    ABSTRACT. Retrospective study was conducted with the objective of assessing the vaccination coverage of. Kafta Humera through observation of different woredas against black leg from records of the. Humera veterinary clinic in Tigray region of Ethiopia, from 207/8-2012/13. The result revealed that there was vaccination ...

  17. Muscle hernias of the lower leg: MRI findings

    Energy Technology Data Exchange (ETDEWEB)

    Mellado, J.M. [Radiology Department, Hospital Virgen de la Cinta, Tortosa, Tarragona (Spain)]|[IDI - Centre Tarragona, Ressonancia Magnetica, Hospital Joan XXIII, Tarragona (Spain); Perez del Palomar, L. [Radiology Department, Hospital Virgen de la Cinta, Tortosa, Tarragona (Spain)

    1999-08-01

    Muscle hernias of the lower leg involving the tibialis anterior, peroneus brevis, and lateral head of the gastrocnemius were found in three different patients. MRI findings allowed recognition of herniated muscle in all cases and identification of fascial defect in two of them. MR imaging findings and the value of dynamic MR imaging is emphasized. (orig.) With 3 figs., 10 refs.

  18. Proposing the LEGS framework to complement the WHO building ...

    African Journals Online (AJOL)

    This includes the health sector. The framework is based on the four pillars of leadership, ethics, governance and systems, hence called LEGS framework. It can complement the six World Health Organization building blocks that guide inputs to help a health system achieve the intended goals. Despite all the strengths of the ...

  19. urrent status and assessment of quantitative and qualitative one leg ...

    African Journals Online (AJOL)

    ... of only a quantitative assessment. These findings indicate that, when evaluating the one leg balance in children aged 3-6 years, a quantitative and qualitative assessment should be used in combination together to assure a more accurate assessment. (S. African J. for Research in Sport, Physical Ed. and Recreation: 2001 ...

  20. PWR hot leg natural circulation modeling with MELCOR code

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jae Hong; Lee, Jong In [Korea Institute of Nuclear Safety, Taejon (Korea, Republic of)

    1997-12-31

    Previous MELCOR and SCDAP/RELAP5 nodalizations for simulating the counter-current, natural circulation behavior of vapor flow within the RCS hot legs and SG U-tubes when core damage progress can not be applied to the steady state and water-filled conditions during the initial period of accident progression because of the artificially high loss coefficients in the hot legs and SG U-tubes which were chosen from results of COMMIX calculation and the Westinghouse natural circulation experiments in a 1/7-scale facility for simulating steam natural circulation behavior in the vessel and circulation modeling which can be used both for the liquid flow condition at steady state and for the vapor flow condition at the later period of in-vessel core damage. For this, the drag forces resulting from the momentum exchange effects between the two vapor streams in the hot leg was modeled as a pressure drop by pump model. This hot leg natural circulation modeling of MELCOR was able to reproduce similar mass flow rates with those predicted by previous models. 6 refs., 2 figs. (Author)

  1. Biomechanical analysis of the single-leg decline squat

    NARCIS (Netherlands)

    Zwerver, J.; Bredeweg, S. W.; Hof, A. L.

    Background: The single-leg squat on a 25 decline board has been described as a clinical assessment tool and as a rehabilitation exercise for patients with patellar tendinopathy. Several assumptions have been made about its working mechanism on patellar load and patellofemoral forces, but these are

  2. [A woman with painful ulcera on her lower leg].

    Science.gov (United States)

    Schreuder, Ramon-Michel; Horváth, Barbara; van Dullemen, Hendrik M

    2015-01-01

    A 49-year-old woman presented with painful ulcera on her right lower leg. She was known with Crohn's disease. Wound cultures were negative. Based on clinical findings she was diagnosed with pyoderma gangrenosum. After treatment with topical glucocorticoids and intravenous infliximab and ciclosporin, the ulcera gradually disappeared.

  3. Epidemiology, etiology, and treatment of chronic leg ulcer ...

    African Journals Online (AJOL)

    smoking, obesity, and diabetes. The treatment of venous ulcer is expensive, leading to large economic burden on health services in many countries. The aim of this communication is to determine the incidence, etiology, and presentation of chronic leg ulcer. It is also to evaluate the various modalities of treatment used in a ...

  4. A young woman with weakness of the legs

    African Journals Online (AJOL)

    A previously well 22-year-old woman presented with progressive weakness of her legs and urinary incontinence over 7 days. Clinically she was healthy, with no skin rashes. On neurological examination she had profound bilateral weakness of the lower limbs, hypertonia, hyperreflexia, a positive Babinski sign and a T6 ...

  5. Effects of wearing lower leg compression sleeves on locomotion economy.

    Science.gov (United States)

    Kurz, Eduard; Anders, Christoph

    2018-02-15

    The purpose of this investigation was to assess the effect of compression sleeves on muscle activation cost during locomotion. Twenty-two recreationally active men (age: 25 ± 3 years) ran on a treadmill at four different speeds (ordered sequence of 2.8, 3.3, 2.2, and 3.9 m/s). The tests were performed without (control situation, CON) and while wearing specially designed lower leg compression sleeves (SL). Myoelectric activity of five lower leg muscles (tibialis anterior, fibularis longus, lateral and medial head of gastrocnemius, and soleus) was captured using Surface EMG. To assess muscle activation cost, the cumulative muscle activity per distance travelled (CMAPD) of the CON and SL situations was determined. Repeated measures analyses of variance were performed separately for each muscle. The analyses revealed a reduced lower leg muscle activation cost with respect to test situation for SL for all muscles (p  0.18). The respective significant reductions of CMAPD values during SL ranged between 4% and 16% and were largest at 2.8 m/s. The findings presented point towards an improved muscle activation cost while wearing lower leg compression sleeves during locomotion that have potential to postpone muscle fatigue.

  6. Modelling of LEG tilting pad journal bearings with active lubrication

    DEFF Research Database (Denmark)

    Cerda Varela, Alejandro Javier; García, Asier Bengoechea; Santos, Ilmar

    2017-01-01

    This work constitutes the first step in a research effort aimed at studying the feasibility of introducing an active lubrication concept in tilting pad journal bearings (TPJBs) that feature the leading edge groove (LEG) lubrication system. The modification of the oil flow into each pad supply gro...

  7. Leg 201Tl-SPECT in chronic exertional compartment syndrome

    International Nuclear Information System (INIS)

    Elkadri, N.; Slim, I.; Blondet, C.; Choquet, Ph.; Constantinesco, A.; Lecocq, J.

    2004-01-01

    Leg 201 Tl-SPECT in chronic exertional compartment syndrome Background: The chronic exertional compartment syndrome is one of the most frequent origins regarding leg pain due to sport training. The diagnosis can be established by invasive compartment pressure measurement. The aim of this study is to evaluate the role that could have 201 Tl-SPECT for patients with suspicion of compartment syndrome. Patients and methods: 51 leg 201 Tl-SPECT exams were performed (exercise - and rest without reinjection) in 49 patients; 28 had compartment syndrome confirmed by pressure measurement. About 100 MBq of 201 Tl were injected during exercise, when pain appeared or at least after 25 minutes exercise. We studied mean percentages of level uptake for each compartment, referred to the maximal uptake of both legs. Results: 47 compartments were concerned by compartment syndrome and 361 compartments were not. Scintigraphic patterns in compartments are reversible ischaemia (45%), uptake stability (36%) or reverse redistribution (19%); these patterns are not linked to compartment syndrome. However, there is a significant difference of rest 201 Tl level uptake between compartments with and without compartment syndrome and a significant correlation between muscular pressure measurement and rest level uptake. Conclusion: 201 Tl-SPECT shows that only ischaemia does not explain compartment syndrome. Moreover, it allows to predict pressure variation during exercise but it does not offer any interest in order to select patients for muscular invasive pressure measurement. (author)

  8. Online adjustments of leg movements in healthy young and old

    NARCIS (Netherlands)

    Potocanac, Z.; Duysens, J.E.

    2017-01-01

    Online movement adjustments are crucial for daily life. This is especially true for leg movements in relation to gait, where failed adjustments can lead to falls, especially in elderly. However, most research has focused on reach adjustments following changes in target location. This arm research

  9. Presenting Symptoms in Pediatric Restless Legs Syndrome Patients

    NARCIS (Netherlands)

    de Weerd, Al; Arico, Irene; Silvestri, Rosalia

    2013-01-01

    Objective: The diagnosis restless legs syndrome (RLS) in children depends on the history told by the child and his parents. The description of symptoms given by the child him or herself is most important. Additional criteria are, among others, the results of polysomnography (PSG). Description of the

  10. Foothill yellow-legged frog conservation assessment in California

    Science.gov (United States)

    Marc P. Hayes; Clara A. Wheeler; Amy J. Lind; Gregory A. Green; Diane C. Macfarlane

    2016-01-01

    The foothill yellow-legged frog (Rana boylii) is a stream-breeding amphibian that has experienced significant population declines over a large portion of its historical range. This frog is nearing extirpation in much of the Sierra Nevada region where existing populations are sparse. Water development and diversions are likely to be the primary...

  11. Physiological responses to swimming fatigue of juvenile white-leg ...

    African Journals Online (AJOL)

    Swimming performance is one of the crucial factors determining the lifestyle and survival of Penaeid shrimps. This study examined under controlled laboratory conditions, the physiological responses to swimming fatigue of juvenile white-leg shrimp Litopenaeus vannamei (8.85 ± 0.05 cm TL) exposed to different current ...

  12. Epidemiology, etiology, and treatment of chronic leg ulcer ...

    African Journals Online (AJOL)

    age. It is thought that the incidence of ulceration is rising as a result of aging population and increased risk factors for atherosclerotic occlusion such as .... Complete healing at discharge from the hospital was. Table 2: Treatment for patients with chronic leg ulcer (n=60). Frequency Percent. Wound dressing only. 5. 8.3.

  13. Measuring Clearance Mechanics Based on Dynamic Leg Length

    Science.gov (United States)

    Khamis, Sam; Danino, Barry; Hayek, Shlomo; Carmeli, Eli

    2018-01-01

    The aim of this study was to quantify clearance mechanics during gait. Seventeen children diagnosed with hemiplegic cerebral palsy underwent a three-dimensional gait analysis evaluation. Dynamic leg lengths were measured from the hip joint center to the heel, to the ankle joint center and to the forefoot throughout the gait cycle. Significant…

  14. Muscle strategies for leg extensions on a "Reformer" apparatus.

    Science.gov (United States)

    Cantergi, Débora; Loss, Jefferson Fagundes; Jinha, Azim; Brodt, Guilherme Auler; Herzog, Walter

    2015-04-01

    Considering the kinematics of leg extensions performed on a Reformer apparatus, one would expect high activation of hip and knee extensor muscle groups. However, because of the bi-articular nature of some lower limb muscles, and the possibility to vary the direction of force application on the Reformer bar, muscles can be coordinated theoretically in a variety of ways and still achieve the desired outcome. Hence, the aim of this study was to determine the knee and hip moments during leg extensions performed on the Reformer apparatus and to estimate the forces in individual muscles crossing these joints using static optimization. Fifteen subjects performed leg extensions exercises on the Reformer apparatus using an individually chosen resistance. To our big surprise, we found that subjects performed the exercise using two conceptually different strategies (i) the first group used simultaneous hip and knee extension moments, (ii) while the second group used simultaneous hip flexion and knee extension moments to perform the exercise. These different strategies were achieved by changing the direction of the resultant force applied by the subject's feet on the Reformer bar. While leg extensions on the Reformer apparatus have been thought to strengthen the hip and knee extensors muscles, our results demonstrate that patients can perform the exercise in a different and unexpected way. In order to control the hip and knee moments and achieve the desired outcome of the exercise, the direction of force application on the Reformer bar must be controlled carefully. Copyright © 2014 Elsevier Ltd. All rights reserved.

  15. Analyzing the loss of coolant accident in PWR nuclear reactors with elevation change in cold leg by RELAP5/MOD3.2 system code

    International Nuclear Information System (INIS)

    Kheshtpaz, H.; Alison, C.

    2006-01-01

    As, the Russian designed VVER-1000 reactor of the Bushehr Nuclear Power Plant by taking into account the change from German technology to that of Russian technology, and with the design of elevation change in the cold legs has been developed; therefore safety assessment of these systems for loss of coolant accident in elevation change in the cold legs and comparison results for non change elevation in the cold legs for a typical reactor (normal design of nuclear reactors) is the main important factor to be considered for the safe operation. In this article, the main objective is the simulation of the loss of coolant accident scenario by the RELAP5/MOD3.2 code in two different cases; first, the elevation change in the cold legs, and the second, non change in it. After comparing and analyzing these two code calculations the results have been generalized for a new design feature of Bushehr reactor. The design and simulation of the elevation change in the cold legs process with RELAP5/MOD3.2 code for PWR reactor is performed for the first time in the country, where it is introducing several important results in this respect

  16. Differential catabolism of muscle protein in garden warblers (Sylvia borin): flight and leg muscle act as a protein source during long-distance migration.

    Science.gov (United States)

    Bauchinger, U; Biebach, H

    2001-05-01

    Samples of flight and leg muscle tissue were taken from migratory garden warblers at three different stages of migration: (1) pre-flight: when birds face an extended flight phase within the next few days, (2) post-flight: when they have just completed an extended flight phase, and (3) recovery: when they are at the end of a stop-over period following an extended flight phase. The changes in body mass are closely related to the changes in flight (Pflight. From pre- to post-flight, the flight and the leg muscle masses decrease by about 22%, but are restored to about 12% above the pre-flight masses during the recovery period. Biochemical analyses show that following flight a selective reduction occurred in the myofibrillar (contractile) component of the flight muscle (Pflight and leg muscle act as a protein source during long-distance migration. As a loss of leg muscle mass is additionally observed besides the loss in flight muscle mass, mass change seems not to be strictly associated with the mechanical power output requirements during flight. Whereas the specific content of sarcoplasmic proteins in the flight muscle is nearly twice as high as that in the leg muscle (Pflight muscle is one of the highest observed in muscles of a vertebrate.

  17. Restless Legs Syndrome in a Nigerian Elderly Population

    Science.gov (United States)

    Fawale, Michael B.; Ismaila, Isiaka Alani; Mustapha, Adekunle F.; Komolafe, Morenikeji A.; Adedeji, Tewogbade A.

    2016-01-01

    Study Objectives: The prevalence of restless legs syndrome (RLS) is highest in the elderly in Caucasian populations; the prevalence of RLS in elderly Africans is not known. This study aimed at determining the frequency and associations of RLS in a Nigerian elderly population. Methods: The study population comprised of 633 consecutive elderly individuals aged 65–105 years attending the general outpatient clinic of the State Hospital, Ilesa, for minor complaints and routine check-up. The diagnosis of RLS was made using the 2003 minimal criteria of the International Restless Legs Syndrome Study Group. Relevant sociodemographic and clinical data, including sleep duration, were also obtained. Results: Restless legs syndrome was found in 3.5% of the study population with a male-female ratio of 2:1. There was no significant age (p = 0.427) or gender (p = 0.178) influence on the prevalence of RLS except in the 75- to 84-year age group where there was significant male preponderance (p = 0.044). A strong independent association between RLS and sleep duration (OR, 3.229; 95% CI, 1.283–8.486; p = 0.013) and past history of head injury (OR, 4.691; 95% CI, 1.750–12.577; p = 0.002) was found. Conclusions: Our finding support previous reports of a possible lower prevalence of RLS in Africans. Restless legs syndrome independently increases the odds of habitual sleep curtailment in elderly individuals. Head injury may be a risk factor for future RLS; this requires further investigation as indirect evidence for a possible link between RLS and traumatic brain injury exists. Citation: Fawale MB, Ismaila IA, Mustapha AF, Komolafe MA, Adedeji TA. Restless legs syndrome in a Nigerian elderly population. J Clin Sleep Med 2016;12(7):965–972. PMID:27070251

  18. Restless legs syndrome: a rarity in the Nigerian pregnant population?

    Science.gov (United States)

    Fawale, Michael B; Ismaila, Isiaka A; Kullima, Abubakar A; Komolafe, Morenikeji A; Ijarotimi, Omotade A; Olowookere, Samuel Anu; Oluyombo, Rotimi; Adedeji, Tewogbade Adeoye

    2018-03-01

    The prevalence of RLS in pregnancy is higher when compared with the general population however it remains unknown among indigenous black Africans. Available data indicate that RLS is uncommon in sub-Saharan Africa. We embarked on this study to determine the prevalence and characteristics of RLS in an antenatal clinic sample of Nigerian pregnant women compared with a primary care sample of non-pregnant women. A total of 310 pregnant women and non-pregnant women filled out a questionnaire which incorporated the 2014 minimal criteria of the International Restless Legs Syndrome Study Group. Demographic and clinical data, including sleep duration and samples for blood hemoglobin concentration and urinalysis were obtained. The mean ages of the pregnant and non-pregnant women were 24.9 ± 5.6 years and 23.6 + 5.4 years, respectively (p = 0.003). There was no case of RLS found among pregnant women while five (1.6%) of the non-pregnant women fulfilled the criteria for RLS. Overall, the prevalence report of RLS symptoms was associated with lower mean habitual nocturnal sleep duration (p leg cramps (p leg cramps and proteinuria were independently associated with RLS. The prevalence of restless legs syndrome is low among women of child-bearing age in the Nigerian population and may be lower in pregnancy. Report of leg cramps and proteinuria are independently associated with RLS. Copyright © 2018 Elsevier B.V. All rights reserved.

  19. RSRM Nozzle-to-Case Joint J-leg Development

    Science.gov (United States)

    Albrechtsen, Kevin U.; Eddy, Norman F.; Ewing, Mark E.; McGuire, John R.

    2003-01-01

    Since the beginning of the Space Shuttle Reusable Solid Rocket Motor (RSRM) program, nozzle-to-case joint polysulfide adhesive gas paths have occurred on several flight motors. These gas paths have allowed hot motor gases to reach the wiper O-ring. Even though these motors continue to fly safely with this condition, a desire was to reduce such occurrences. The RSRM currently uses a J-leg joint configuration on case field joints and igniter inner and outer joints. The J-leg joint configuration has been successfully demonstrated on numerous RSRM flight and static test motors, eliminating hot gas intrusion to the critical O-ring seals on these joints. Using the proven technology demonstrated on the case field joints and igniter joints, a nozzle-to-case joint J-leg design was developed for implementation on RSRM flight motors. This configuration provides an interference fit with nozzle fixed housing phenolics at assembly, with a series of pressurization gaps incorporated outboard of the joint mating surface to aid in joint pressurization and to eliminate any circumferential flow in this region. The joint insulation is bonded to the nozzle phenolics using the same pressure sensitive adhesive used in the case field joints and igniter joints. An enhancement to the nozzle-to-case joint J-leg configuration is the implementation of a carbon rope thermal barrier. The thermal barrier is located downstream of the joint bondline and is positioned within the joint in a manner where any hot gas intrusion into the joint passes through the thermal barrier, reducing gas temperatures to a level that would not affect O-rings downstream of the thermal barrier. This paper discusses the processes used in reaching a final nozzle-to-case joint J-leg design, provides structural and thermal results in support of the design, and identifies fabrication techniques and demonstrations used in arriving at the final configuration.

  20. Evidence for varicose vein surgery in venous leg ulceration.

    Science.gov (United States)

    Kheirelseid, Elrasheid A H; Bashar, Khalid; Aherne, Thomas; Babiker, Thamir; Naughton, Peter; Moneley, Daragh; Walsh, Stewart R; Leahy, Austin L

    2016-08-01

    Venous leg ulcers affect 1-3% of adults with a significant economic impact, utilizing 1% of annual healthcare budgets in some western European countries. To determine the effects of intervention for incompetent superficial veins on ulcer healing and recurrence in patients with active or healed venous ulcers. In October 2014, we searched Medline, CINAHL, EMBASE, Scopus, the Cochrane library and Web of Science without date or language restriction for relevant randomized or observational studies. Bibliographies of included studies were also searched for additional studies. Observational studies or randomized controlled trials comparing intervention for varicose veins with compression therapy alone for venous leg ulcers were eligible. In addition, studies compared open to endovenous therapy for varicose veins in patients with leg ulcers and those compared treating saphenous and perforating veins to treating saphenous veins only were also included. Studies had to report at least one ulcer-related outcome (healing rate, recurrence or time to healing). Details of potentially eligible studies were extracted and summarized using a data extraction table. Data extraction and quality assessment were performed independently by two review authors, and any disagreements resolved by consensus or by arbitration of a third author. Intervention for superficial venous reflux improved ulcer healing (risk ratio = 1.11 [1.00, 1.22], 95% CI, p = 0.04) and reduced recurrence (risk ratio = 0.48 [0.32, 0.67], 95% CI, p venous leg ulcer is at beast weak. A well-structured RCT is required to investigate the role of endovenous ablation of incompetent superficial veins in improving venous leg ulcer outcomes. Copyright © 2016 Royal College of Surgeons of Edinburgh (Scottish charity number SC005317) and Royal College of Surgeons in Ireland. Published by Elsevier Ltd. All rights reserved.

  1. STRUCTURE OF PROMINENCE LEGS: PLASMA AND MAGNETIC FIELD

    Energy Technology Data Exchange (ETDEWEB)

    Levens, P. J.; Labrosse, N. [SUPA School of Physics and Astronomy, University of Glasgow, Glasgow, G12 8QQ (United Kingdom); Schmieder, B. [Observatoire de Paris, Meudon, F-92195 (France); Ariste, A. López, E-mail: p.levens.1@research.gla.ac.uk [Institut de Recherche en Astrophysique et Planétologie, Toulouse (France)

    2016-02-10

    We investigate the properties of a “solar tornado” observed on 2014 July 15, and aim to link the behavior of the plasma to the internal magnetic field structure of the associated prominence. We made multi-wavelength observations with high spatial resolution and high cadence using SDO/AIA, the Interface Region Imaging Spectrograph (IRIS) spectrograph, and the Hinode/Solar Optical Telescope (SOT) instrument. Along with spectropolarimetry provided by the Télescope Héliographique pour l’Etude du Magnétisme et des Instabilités Solaires telescope we have coverage of both optically thick emission lines and magnetic field information. AIA reveals that the two legs of the prominence are strongly absorbing structures which look like they are rotating, or oscillating in the plane of the sky. The two prominence legs, which are both very bright in Ca ii (SOT), are not visible in the IRIS Mg ii slit-jaw images. This is explained by the large optical thickness of the structures in Mg ii, which leads to reversed profiles, and hence to lower integrated intensities at these locations than in the surroundings. Using lines formed at temperatures lower than 1 MK, we measure relatively low Doppler shifts on the order of ±10 km s{sup −1} in the tornado-like structure. Between the two legs we see loops in Mg ii, with material flowing from one leg to the other, as well as counterstreaming. It is difficult to interpret our data as showing two rotating, vertical structures that are unrelated to the loops. This kind of “tornado” scenario does not fit with our observations. The magnetic field in the two legs of the prominence is found to be preferentially horizontal.

  2. Design and Evaluation of the AIRGAIT Exoskeleton: Leg Orthosis Control for Assistive Gait Rehabilitation

    Directory of Open Access Journals (Sweden)

    Mohd Azuwan Mat Dzahir

    2013-01-01

    Full Text Available This paper introduces the body weight support gait training system known as the AIRGAIT exoskeleton and delves into the design and evaluation of its leg orthosis control algorithm. The implementation of the mono- and biarticular pneumatic muscle actuators (PMAs as the actuation system was initiated to generate more power and precisely control the leg orthosis. This research proposes a simple paradigm for controlling the mono- and bi-articular actuator movements cocontractively by introducing a cocontraction model. Three tests were performed. The first test involved control of the orthosis with monoarticular actuators alone without a subject (WO/S; the second involved control of the orthosis with mono- and bi-articular actuators tested WO/S; and the third test involved control of the orthosis with mono- and bi-articular actuators tested with a subject (W/S. Full body weight support (BWS was implemented in this study during the test W/S as the load supported by the orthosis was at its maximum capacity. This assessment will optimize the control system strategy so that the system operates to its full capacity. The results revealed that the proposed control strategy was able to co-contractively actuate the mono- and bi-articular actuators simultaneously and increase stiffness at both hip and knee joints.

  3. Forced Use of the Paretic Leg Induced by a Constraint Force Applied to the Nonparetic Leg in Individuals Poststroke During Walking.

    Science.gov (United States)

    Hsu, Chao-Jung; Kim, Janis; Roth, Elliot J; Rymer, William Z; Wu, Ming

    2017-12-01

    Individuals with stroke usually show reduced muscle activities of the paretic leg and asymmetrical gait pattern during walking. To determine whether applying a resistance force to the nonparetic leg would enhance the muscle activities of the paretic leg and improve the symmetry of spatiotemporal gait parameters in individuals with poststroke hemiparesis. Fifteen individuals with chronic poststroke hemiparesis participated in this study. A controlled resistance force was applied to the nonparetic leg using a customized cable-driven robotic system while subjects walked on a treadmill. Subjects completed 2 test sections with the resistance force applied at different phases of gait (ie, early and late swing phases) and different magnitudes (10%, 20%, and 30% of maximum voluntary contraction [MVC] of nonparetic leg hip flexors). Electromyographic (EMG) activity of the muscles of the paretic leg and spatiotemporal gait parameters were collected. Significant increases in integrated EMG of medial gastrocnemius, medial hamstrings, vastus medialis, and tibialis anterior of the paretic leg were observed when the resistance was applied during the early swing phase of the nonparetic leg, compared with baseline. Additionally, resistance with 30% of MVC induced the greatest level of muscle activity than that with 10% or 20% of MVC. The symmetry index of gait parameters also improved with resistance applied during the early swing phase. Applying a controlled resistance force to the nonparetic leg during early swing phase may induce forced use on the paretic leg and improve the spatiotemporal symmetry of gait in individuals with poststroke hemiparesis.

  4. 78 FR 68909 - Agency Information Collection (Knee and Lower Leg Conditions Disability Benefits Questionnaire...

    Science.gov (United States)

    2013-11-15

    ... Lower Leg Conditions Disability Benefits Questionnaire) Under OMB Review AGENCY: Veterans Benefits... Questionnaire)'' in any correspondence. FOR FURTHER INFORMATION CONTACT: Crystal Rennie, Enterprise Records... Conditions Disability Benefits Questionnaire)''. SUPPLEMENTARY INFORMATION: Title: Knee and Lower Leg...

  5. Embodiment of Legged Robots Emerged in Evolutionary Design: Pseudo Passive Dynamic Walkers

    OpenAIRE

    Matsushita, Kojiro; Yokoi, Hiroshi

    2008-01-01

    An objective of this paper is to illustrate a physical representation of the embodiment on legged locomotion. Embodiment is here defined as physical features that reduce control complexity and energy consumption of legged robots. In this method, the embodiment of

  6. Gait Control for Redundant Legged Biped Robot at Constant Velocity and Constant Height of the Waist

    Science.gov (United States)

    Shima, Ryoichi; Haishi, Masahiko; Shibata, Masaaki

    In this paper, we propose a gait control method for redundant legged biped robot based on leg center of mass (COM) position control at constant velocity and constant height of the waist. The developed biped robot has redundant legs, which have 4 degree-of-freedoms (DOFs) on each in the saggital plane. The redundant DOF enables to move its leg tip position and its leg COM position independently. Therefore proposed robot has structural capability to control the leg COM position for keeping the projection of the total COM inside the support polygon without upper body motion. Such capability enables the stable static walk in the arbitrarily desired velocity and height of the waist motion. The validity of the proposed method for the static walk at constant velocity and constant height of the waist in the leg COM position control for redundant legged biped robot is confirmed by several results of simulation and experiment.

  7. Leg crossing with muscle tensing, a physical counter-manoeuvre to prevent syncope, enhances leg blood flow

    NARCIS (Netherlands)

    Groothuis, Jan T.; van Dijk, Nynke; ter Woerds, Walter; Wieling, Wouter; Hopman, Maria T. E.

    2007-01-01

    In patients with orthostatic intolerance, the mechanisms to maintain BP (blood pressure) fail. A physical counter-manoeuvre to postpone or even prevent orthostatic intolerance in these patients is leg crossing combined with muscle tensing. Although the central haemodynamic effects of physical

  8. Leg crossing with muscle tensing, a physical counter-manoeuvre to prevent syncope, enhances leg blood flow.

    NARCIS (Netherlands)

    Groothuis, J.T.; Dijk, N. van; Woerds, W. ter; Wieling, W.; Hopman, M.T.E.

    2007-01-01

    In patients with orthostatic intolerance, the mechanisms to maintain BP (blood pressure) fail. A physical counter-manoeuvre to postpone or even prevent orthostatic intolerance in these patients is leg crossing combined with muscle tensing. Although the central haemodynamic effects of physical

  9. The effect of Brazilian Propolis on leg health in broilers reared under heat stress

    Science.gov (United States)

    Exposing broiler chickens to heat stress increases leg abnormalities and Gait Score, also it reduced the time of Latency to Lie Test. This experiment was conducted to examine the effect of dietary supplemention with green Brazilian propolis on Latency to Lie Test for leg strength and leg abnormaliti...

  10. 33 CFR 147.809 - Mars Tension Leg Platform safety zone.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Mars Tension Leg Platform safety... SECURITY (CONTINUED) OUTER CONTINENTAL SHELF ACTIVITIES SAFETY ZONES § 147.809 Mars Tension Leg Platform safety zone. (a) Description. The Mars Tension Leg Platform (Mars TLP) is located at position 28°10′10.29...

  11. Bio-Inspired Design and Kinematic Analysis of Dung Beetle-Like Legs

    DEFF Research Database (Denmark)

    Aditya, Sai Krishna Venkata; Ignasov, Jevgeni; Filonenko, Konstantin

    2017-01-01

    The African dung beetle Scarabaeus galenus can use its front legs to walk and manipulate or form a dung ball. The interesting multifunctional legs have not been fully investigated or even used as inspiration for robot leg design. Thus, in this paper, we present the development of real dung beetle...

  12. 78 FR 42902 - Safety Zone; Olympus Tension Leg Platform, Mississippi Canyon Block 807, Outer Continental Shelf...

    Science.gov (United States)

    2013-07-18

    ... SECURITY Coast Guard 33 CFR Part 147 RIN 1625-AA00 Safety Zone; Olympus Tension Leg Platform, Mississippi... Olympus Tension Leg Platform, Mississippi Canyon Block 807 on the ] OCS. The purpose of the safety zone is... Tension Leg Platform facility. The request for the safety zone was made due to safety concerns for vessels...

  13. 33 CFR 147.811 - Ram-Powell Tension Leg Platform safety zone.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Ram-Powell Tension Leg Platform... SECURITY (CONTINUED) OUTER CONTINENTAL SHELF ACTIVITIES SAFETY ZONES § 147.811 Ram-Powell Tension Leg Platform safety zone. (a) Description. The Ram-Powell Tension Leg Platform (Ram-Powell TLP) is located at...

  14. Preserved alpha-adrenergic tone in the leg vascular bed of spinal cord-injured individuals.

    NARCIS (Netherlands)

    Kooijman, H.M.; Rongen, G.A.P.J.M.; Smits, P.; Hopman, M.T.E.

    2003-01-01

    BACKGROUND: Supraspinal sympathetic control of leg vascular tone is lost in spinal cord-injured individuals, but this does not result in a reduced leg vascular tone: Leg vascular resistance is even increased. The aim of this study was to assess the alpha-adrenergic contribution to the increased

  15. [Self-management programme for leg ulcer patients: increased physical activity and fewer wound days

    NARCIS (Netherlands)

    Heinen, M.M.; Borm, G.F.; Vleuten, C.J. van der; Evers, A.W.; Oostendorp, R.A.B.; Achterberg, T. van

    2012-01-01

    OBJECTIVE: To investigate the effectiveness of the Lively Legs programme on patient adherence to compression therapy, walking behaviour and leg exercising, as well as on leg ulcer recurrence. DESIGN: Randomized controlled trial (ClinicalTrials.gov identifier: NCT00184873). METHOD: A total of 184

  16. 33 CFR 147.817 - Sir Douglas Morpeth Tension Leg Platform safety zone.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Sir Douglas Morpeth Tension Leg... HOMELAND SECURITY (CONTINUED) OUTER CONTINENTAL SHELF ACTIVITIES SAFETY ZONES § 147.817 Sir Douglas Morpeth Tension Leg Platform safety zone. (a) Description. The Sir Douglas Morpeth Tension Leg Platform (Morpeth...

  17. Restless Legs Symptoms and Pregnancy and Neonatal Outcomes.

    Science.gov (United States)

    Oyieng'o, D Onentia; Kirwa, Kipruto; Tong, Iris; Martin, Susan; Antonio Rojas-Suarez, José; Bourjeily, Ghada

    2016-02-01

    Restless legs syndrome (RLS) is a commonly occurring neurologic disorder that affects up to one third of women during pregnancy. RLS has been associated with increased sympathetic tone in the nonpregnant population. We examined whether a RLS surrogate is associated with a higher prevalence of pregnancy and neonatal outcomes. Data were analyzed from a cross-sectional survey of 1000 women interviewed soon after delivery by using an RLS surrogate question. Women were asked how frequently (0 = none, 1 = rarely [leg movements" in the last 3 months of pregnancy. Clinical charts were reviewed to obtain relevant demographic and clinical data, including the presence of gestational hypertensive disorders and neonatal outcomes at birth. Subjects who "always" experienced RLS were compared with subjects experiencing symptoms less frequently or not at all with respect to prevalence of gestational hypertensive disorder. The mean ([SD]) age, prepregnancy body mass index (BMI), and BMI at delivery were 29.0 (6.1) years, 26.1 (6.2) kg/m(2), and 32.0 (6.3) kg/m(2), respectively. The overall prevalence of the RLS surrogate (jumpy or jerky leg movements) was 35.5% with the following distribution on a Likert scale: score 1 = 6.4%; score 2 = 10.2%; score 3 = 8.1%; and score 4 = 10.8%. Chronic hypertension was present in 2.1%, pregnancy-induced hypertension in 9.5%, and preeclampsia in 4.5% of respondents. Subjects who reported "always" having sensations of jumpy or jerky legs were more likely to have gestational hypertensive disorders compared with those who reported less frequent occurrence of the symptoms. Adjusted odds ratios were 3.74 (95% CI, 1.31-10.72; P = 0.014) for chronic hypertension; 1.26 (95% CI, 0.65-2.46; P = 0.487) for pregnancy-induced hypertension; and 2.15 (95% CI, 0.97-4.75; P = 0.060) for preeclampsia. There was a significant association between leg movement score and neonatal birth weight (coefficient, -149.5 g [95% CI, -276.9 to -22.5]; P = 0.005) and gestational

  18. The role of eccentric regime of leg muscle work in alpine skiing

    Directory of Open Access Journals (Sweden)

    Ropret Robert

    2017-01-01

    Full Text Available Alpine skiing is characterized by a great number of leg movements with muscle contractions in eccentric regime. The role of these movements is to absorb gravitation and inertial forces, manage skis more precisely and maintain balance. Recent studies have determined the volume, duration and intenisty of eccentric contractions as well as the basic characteristics of movement amplitudes and velocities. Based on the previous findings the experiments involving eccentric training using a bicycle ergometer confirmed a positive impact that this kind of training has on increasing maximum power, strength, endurance, coordination, injury prevention, metabolic work efficiency, more efficient work with longer muscle length and its role in miming skiers' movements. This paper is an review of the studies so far in the field of kinematics, skiing dynamics and the effect of eccentric training on the development of athletes' performances.

  19. Loss of legs: is it or not a handicap for an orb-weaving spider?

    Science.gov (United States)

    Pasquet, Alain; Anotaux, Mylène; Leborgne, Raymond

    2011-07-01

    Leg loss is a common phenomenon in spiders, and according to the species 5% to 40% of the adults can present at least one missing leg. There is no possibility of regeneration after adult moult and the animal must manage with its missing appendages until its death. With the loss of one or more legs, female orb-weaving spiders can be penalized twice: firstly, because the legs are necessary for web construction and secondly, the legs are essential for the control of the prey after its interception by the web. During development, spiders may be also penalized because regeneration has energetic costs that take away resources for survival, growth and reproduction. All these consequences should influence negatively the development of the spider and thus its fitness. We investigated the impact of leg loss in the orb-weaving spider, Zygiella x-notata by studying its frequency in a natural population and web building and prey capture behaviours in laboratory. In field populations, 9.5% to 13%, of the adult females presented the loss of one or more legs; the majority of individuals had lost only one leg (in 48% of cases, a first one). Leg loss seems to affect all the adult spiders, as there is no difference of mass between intact spiders and those with missing leg. Data obtained with laboratory-reared spiders, showed that the loss of legs due to the moult is rare (less than 1%). Considering changes in web design, spiders with missing legs decreased their silk investment, increased the distance between spiral turns but did not change the capture surface of the web. Under our laboratory experimental conditions, spiders with one or two lost legs did not present any difference in prey capture efficiency. In laboratory conditions, spiders with lost leg(s) did not show any difference in egg sac production or in longevity (adult lifespan) compared to intact spiders.

  20. PredyCLU: a prediction system for chronic leg ulcers based on fuzzy logic; part I - exploring the venous side.

    Science.gov (United States)

    de Franciscis, Stefano; Fregola, Salvatore; Gallo, Alessandro; Argirò, Giuseppe; Barbetta, Andrea; Buffone, Gianluca; Caliò, Francesco G; De Caridi, Giovanni; Amato, Bruno; Serra, Raffaele

    2016-12-01

    Chronic leg ulcers (CLUs) are a common occurrence in the western population and are associated with a negative impact on the quality of life of patients. They also cause a substantial burden on the health budget. The pathogenesis of leg ulceration is quite heterogeneous, and chronic venous ulceration (CVU) is the most common manifestation representing the main complication of chronic venous disease (CVD). Prevention strategies and early identification of the risk represent the best form of management. Fuzzy logic is a flexible mathematical system that has proved to be a powerful tool for decision-making systems and pattern classification systems in medicine. In this study, we have elaborated a computerised prediction system for chronic leg ulcers (PredyCLU) based on fuzzy logic, which was retrospectively applied on a multicentre population of 77 patients with CVD. This evaluation system produced reliable risk score patterns and served effectively as a stratification risk tool in patients with CVD who were at the risk of developing CVUs. © 2015 Medicalhelplines.com Inc and John Wiley & Sons Ltd.

  1. Restless legs syndrome responsive to rasagiline treatment: a case report.

    Science.gov (United States)

    Babacan-Yildiz, Gulsen; Gursoy, Esra; Kolukisa, Mehmet; Celebi, Arif

    2012-01-01

    We describe a patient with idiopathic restless legs syndrome (iRLS) who was responsive to rasagiline treatment. A 70-year-old woman presented with an 8-year history of iRLS symptoms and a 1-year history of resting tremor. The patient met the UK Parkinson's Disease Society Brain Bank Clinical Diagnostic Criteria (UK Parkinson Disease [PD] Brain Bank criteria) for the diagnosis of idiopathic PD and the criteria of the International Restless Legs Syndrome Study Group for the diagnosis of iRLS. One milligram of rasagiline once daily was started with the diagnosis of early PD as monotherapy. At week 8, the patient was almost iRLS symptoms free. Rasagiline has also been shown to mildly improve PD symptoms. Rasagiline was well tolerated during the follow-up. We suggest that rasagiline could represent a useful therapeutic option in the treatment of iRLS.

  2. Not only limbs in atypical restless legs syndrome.

    Science.gov (United States)

    Turrini, Alessandra; Raggi, Alberto; Calandra-Buonaura, Giovanna; Martinelli, Paolo; Ferri, Raffaele; Provini, Federica

    2018-04-01

    Restless legs syndrome (RLS) typically affects the limbs, but the involvement of other body parts has also been reported. In this essay, we critically review all literature reports of atypical RLS cases with unusual localizations. Applying the updated diagnostic criteria of the International restless legs syndrome study group (IRLSSG), which also consider symptoms localized outside of the lower limbs, a few of these atypical cases reported in the previous literature resulted in a definitive diagnosis of RLS. We also discuss the relationship between RLS and burning mouth syndrome (BMS) or restless genital syndrome (RGS). We conclude clinical sleep specialists should be aware of unusual RLS localizations because they respond to the usual treatment for RLS. All the IRLSSG diagnostic criteria should be applied in every suspected case, in order to establish a correct diagnosis of this disabling but treatable condition. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. Adaptive control strategies for interlimb coordination in legged robots

    DEFF Research Database (Denmark)

    Aoi, Shinya; Manoonpong, Poramate; Ambe, Yuichi

    2017-01-01

    for legged robots induced by various factors (locomotion speed, environmental situation, body properties, and task). In addition, we show characteristic properties of adaptive interlimb coordination, such as gait hysteresis and different time-scale adaptations. We also discuss the underlying mechanisms......Walking animals produce adaptive interlimb coordination during locomotion in accordance with their situation. Interlimb coordination is generated through the dynamic interactions of the neural system, the musculoskeletal system, and the environment, although the underlying mechanisms remain unclear....... Recently, investigations of the adaptationmechanisms of living beings have attracted attention, and bio-inspired control systems based on neurophysiological findings regarding sensorimotor interactions are being developed for legged robots. In this review, we introduce adaptive interlimb coordination...

  4. Quality of life of elderly patients with leg ulcers

    Directory of Open Access Journals (Sweden)

    Ana Paula Cardoso Tavares

    2017-10-01

    Full Text Available Abstract Objectives: To identify compromised domains of the 36-Item Short Form Survey (SF-36 for elderly individuals with leg ulcers and correlate their clinical and sociodemographic variables with the SF-36's components. Method: Exploratory and cross-sectional study conducted with 50 elderly individuals with leg ulcers. The instruments were the sociodemographic and clinical form and the SF-36. The Statistical Package for the Social Sciences was used to analyze data. Results: Most were married, retired, and received one times the minimum wage, were Caucasians or of mixed race, and had hypertension. In regard to the SF-36, the most compromised domain was physical limitations, while social aspects and general health status were the less compromised domains. The SF-36 domains were not correlated with age, income, duration or size of the lesion or pain. Conclusion: The ulcer-related biopsychosocial aspects need to be considered in order to devise more effective nursing interventions.

  5. VDLLA: A virtual daddy-long legs optimization

    Science.gov (United States)

    Yaakub, Abdul Razak; Ghathwan, Khalil I.

    2016-08-01

    Swarm intelligence is a strong optimization algorithm based on a biological behavior of insects or animals. The success of any optimization algorithm is depending on the balance between exploration and exploitation. In this paper, we present a new swarm intelligence algorithm, which is based on daddy long legs spider (VDLLA) as a new optimization algorithm with virtual behavior. In VDLLA, each agent (spider) has nine positions which represent the legs of spider and each position represent one solution. The proposed VDLLA is tested on four standard functions using average fitness, Medium fitness and standard deviation. The results of proposed VDLLA have been compared against Particle Swarm Optimization (PSO), Differential Evolution (DE) and Bat Inspired Algorithm (BA). Additionally, the T-Test has been conducted to show the significant deference between our proposed and other algorithms. VDLLA showed very promising results on benchmark test functions for unconstrained optimization problems and also significantly improved the original swarm algorithms.

  6. Hind wings in Basal birds and the evolution of leg feathers.

    Science.gov (United States)

    Zheng, Xiaoting; Zhou, Zhonghe; Wang, Xiaoli; Zhang, Fucheng; Zhang, Xiaomei; Wang, Yan; Wei, Guangjin; Wang, Shuo; Xu, Xing

    2013-03-15

    Recent discoveries of large leg feathers in some theropods have implications for our understanding of the evolution of integumentary features on the avialan leg, and particularly of their relevance for the origin of avialan flight. Here we report 11 basal avialan specimens that will greatly improve our knowledge of leg integumentary features among early birds. In particular, they provide solid evidence for the existence of enlarged leg feathers on a variety of basal birds, suggest that extensively scaled feet might have appeared secondarily at an early stage in ornithuromorph evolution, and demonstrate a distal-to-proximal reduction pattern for leg feathers in avialan evolution.

  7. Motion error compensation of multi-legged walking robots

    Science.gov (United States)

    Wang, Liangwen; Chen, Xuedong; Wang, Xinjie; Tang, Weigang; Sun, Yi; Pan, Chunmei

    2012-07-01

    Existing errors in the structure and kinematic parameters of multi-legged walking robots, the motion trajectory of robot will diverge from the ideal sports requirements in movement. Since the existing error compensation is usually used for control compensation of manipulator arm, the error compensation of multi-legged robots has seldom been explored. In order to reduce the kinematic error of robots, a motion error compensation method based on the feedforward for multi-legged mobile robots is proposed to improve motion precision of a mobile robot. The locus error of a robot body is measured, when robot moves along a given track. Error of driven joint variables is obtained by error calculation model in terms of the locus error of robot body. Error value is used to compensate driven joint variables and modify control model of robot, which can drive the robots following control model modified. The model of the relation between robot's locus errors and kinematic variables errors is set up to achieve the kinematic error compensation. On the basis of the inverse kinematics of a multi-legged walking robot, the relation between error of the motion trajectory and driven joint variables of robots is discussed. Moreover, the equation set is obtained, which expresses relation among error of driven joint variables, structure parameters and error of robot's locus. Take MiniQuad as an example, when the robot MiniQuad moves following beeline tread, motion error compensation is studied. The actual locus errors of the robot body are measured before and after compensation in the test. According to the test, variations of the actual coordinate value of the robot centroid in x-direction and z-direction are reduced more than one time. The kinematic errors of robot body are reduced effectively by the use of the motion error compensation method based on the feedforward.

  8. Crohn's Disease Is Associated With Restless Legs Syndrome

    OpenAIRE

    Weinstock, Leonard B.; Bosworth, Brian P.; Scherl, Ellen J.; Li, Ellen; Iroku, Ugonna; Munsell, Melissa A.; Mullen, Gerald E.; Walters, Arthur S.

    2010-01-01

    Extraintestinal manifestations of Crohn's disease (CD) have not previously included the central nervous system (CNS). Restless legs syndrome (RLS) is a CNS disorder that is either idiopathic or secondary to a number of diseases. The aim of this study was to determine if RLS was associated with CD because both are associated with iron deficiency, inflammation, and bacterial overgrowth. Consecutive CD outpatients (N=272) were prospectively surveyed at 4 centers for criteria for RLS. Incidence (...

  9. Genetic and Ethiopatogenetic Aspects of the Restless Legs Syndrome

    OpenAIRE

    Kemlink, David

    2006-01-01

    The restless legs syndrome (RLS) is a sensomotor disoder characterized by urge to move lower extremities and this urge is usualy associated with unpleasnat sensations. The symtoms of RLS are alleviated with movement and, on the contrary, worsen during rest. The urge presents circadian rhytmicity peaking in the evening and the first half of night. The diagnosis of RLS is set according to patients' history fulfilling the essential criteria. The prevalence of RLS is quite high in western countri...

  10. The biopsychosocial effects of restless legs syndrome (RLS)

    OpenAIRE

    Becker, Philip M

    2006-01-01

    The symptoms of restless legs syndrome (RLS) are associated with reductions in patients? quality of life (QoL) and mental heath. Sleep disturbance, which is often the most troublesome symptom of RLS, may have a negative impact on patients? daytime cognitive abilities. Research has established a relationship between the symptoms of RLS and mood symptoms, but causality is unclear. Some studies have indicated that the symptoms of RLS precede those of depression or anxiety, and others relate the ...

  11. Restless Legs Syndrome in a Nigerian Elderly Population.

    Science.gov (United States)

    Fawale, Michael B; Ismail, Ishaq Alani; Mustapha, Adekunle F; Komolafe, Morenikeji A; Adedeji, Tewogbade A

    2016-07-15

    The prevalence of restless legs syndrome (RLS) is highest in the elderly in Caucasian populations; the prevalence of RLS in elderly Africans is not known. This study aimed at determining the frequency and associations of RLS in a Nigerian elderly population. The study population comprised of 633 consecutive elderly individuals aged 65-105 years attending the general outpatient clinic of the State Hospital, Ilesa, for minor complaints and routine check-up. The diagnosis of RLS was made using the 2003 minimal criteria of the International Restless Legs Syndrome Study Group. Relevant sociodemographic and clinical data, including sleep duration, were also obtained. Restless legs syndrome was found in 3.5% of the study population with a male-female ratio of 2:1. There was no significant age (p = 0.427) or gender (p = 0.178) influence on the prevalence of RLS except in the 75- to 84-year age group where there was significant male preponderance (p = 0.044). A strong independent association between RLS and sleep duration (OR, 3.229; 95% CI, 1.283-8.486; p = 0.013) and past history of head injury (OR, 4.691; 95% CI, 1.750-12.577; p = 0.002) was found. Our finding support previous reports of a possible lower prevalence of RLS in Africans. Restless legs syndrome independently increases the odds of habitual sleep curtailment in elderly individuals. Head injury may be a risk factor for future RLS; this requires further investigation as indirect evidence for a possible link between RLS and traumatic brain injury exists. © 2016 American Academy of Sleep Medicine.

  12. Exercise-induced leg pain: sifting through a broad differential.

    Science.gov (United States)

    Korkola, M; Amendola, A

    2001-06-01

    The causes of exertional leg pain are not always easily determined but are often linked to repetitive stress. Medial tibial stress syndrome or periostitis, tibial stress fractures, deep posterior compartment syndrome, exertional compartment syndrome, fascial hernias, peripheral neuropathy, and blood vessel entrapments have characteristic signs and symptoms. A complete history and exam coupled with wise use of adjunctive investigations will lead to the correct diagnosis and treatment.

  13. Leg ulcers in sickle cell patients: management challenges

    OpenAIRE

    El Khatib,Arij; Hayek,Shady

    2016-01-01

    Arij M El Khatib,1 Shady N Hayek2 1Division of Plastic and Reconstructive Surgery, Department of Surgery, American University of Beirut Medical Center (AUBMC), 2Private Practice, Cosmetic Surgery Center, Beirut, Lebanon Abstract: Sickle cell disease is an autosomal recessive hemoglobinopathy caused by an amino acid substitution from glutamic acid to valine in the beta hemoglobin chain. One of the common symptoms occurring in sickle cell patients are leg ulcers, which are notoriously painful, ...

  14. Simvastatin-induced nocturnal leg pain disappears with pravastatin substitution

    Directory of Open Access Journals (Sweden)

    Stojaković Nataša

    2013-01-01

    Full Text Available Introduction. Statins have similar side effects that do not always occur at the same rate among the various statins. We present a case of simvastatin-induced muscle toxicity that disappeared when pravastatin was substituted for the original drug. Case Outline. A 74-year-old male, a nonsmoker, complained of severe nocturnal leg cramps. The patient also complained that similar painful cramping occurred when he walked rapidly or jogged. Because some components of his lipid panel exceeded the ‘desirable’ range, and as he had a history of myocardial infarction, his family physician prescribed simvastatin (40 mg/day. The patient had taken this medication for the past eight years. The painful nocturnal episodes started two years ago and affected either one or the other leg. Four months ago we discontinued his simvastatin and prescribed pravastatin (80 mg/day. At a follow-up visit six weeks later, the patient reported that his leg pains at night and the pain experienced after brisk walking had disappeared. Four months after the substitution of pravastatin for simvastatin, the patient reported that his complete lack of symptoms had continued. Conclusion. These painful muscle cramps were probably caused by an inadequate vascular supply to the calf and foot muscles. Perhaps a combination of advanced age and atherosclerotic changes created a predisposition for the simvastatin-induced leg cramps. Pravastatin differs from simvastatin in several ways. It is not metabolized by cytochrome P450 (CYP 3A4 oxidases, and thus is not influenced by CYP 3A4 inhibitors like simvastatin. Also, simvastatin is associated with single-nucleotide polymorphisms located within the SLCO1B1 gene on the chromosome 12 and established myopathy, while pravastatin lacks this association. These differences may contribute to increased tolerance to pravastatin in this particular case.

  15. Exercise Related Leg Pain (ERLP): a Review of The Literature

    OpenAIRE

    Reinking, Mark F.

    2007-01-01

    Exercise related leg pain (ERLP) is a regional pain syndrome described as pain between the knee and ankle which occurs with exercise. Indiscriminant use of terminology such as “shin splints” has resulted in ongoing confusion regarding the pathoanatomic entities associated with this pain syndrome. Each of the pathoanatomic entities – medial tibial stress syndrome, chronic exertional compartment syndrome, tibial and fibular stress fractures, tendinopathy, nerve entrapment, and vascular patholog...

  16. Restless legs syndrome: differential diagnosis and management with pramipexole

    Directory of Open Access Journals (Sweden)

    Francesca Brindani

    2009-06-01

    Full Text Available Francesca Brindani, Francesca Vitetta, Franco GemignaniDepartment of Neurosciences, University of Parma, ItalyAbstract: Restless legs syndrome (RLS is a condition characterized by discomfort at rest and urge to move focused on the legs. RLS may occur as an idiopathic, often hereditary condition (primary RLS, or in association with medical conditions (secondary RLS including iron deficiency, uremia, and polyneuropathy. Current understanding of the pathophysiology of RLS points to the involvement of three interrelated components: dopaminergic dysfunction, impaired iron homeostasis, and genetic mechanisms. The diagnosis of RLS is made according to the consensus criteria by a National Institutes of Health panel: 1 an urge to move the legs, usually accompanied by uncomfortable sensations; 2 beginning or worsening during rest; 3 relieved by movement; and 4 worse, or only occurring, in the evening or at night. The differential diagnosis of RLS aims to: 1 distinguish RLS from other disorders with RLS-like symptoms and 2 identify secondary forms, with investigation of underlying diseases. The treatment of RLS demands a clinical evaluation to rule out and cure causes of secondary RLS, including iron supplementation when deficient, and to eliminate the triggering factors. The presence of neuropathy should be especially investigated in nonhereditary, late-onset RLS, in view of a possible treatment of the underlying disease. The first line treatment for idiopathic RLS is represented by dopamine agonists, in particular nonergot-derived ropinirole and pramipexole, whereas ergot dopamine agonists (cabergoline and pergolide are no longer in first-line use given the risks of cardiac valvulopathy. Although no comparative trials have been published, a meta-analysis of pramipexole versus ropinirole suggests differences in efficacy and tolerability favoring pramipexole.Keywords: restless legs syndrome, pramipexole, dopamine, agonists, small fiber neuropathy

  17. Generalizing the Hop: Object-Level Programming for Legged Motion

    Science.gov (United States)

    1990-08-01

    1989. 4. J. Hodgins, J. Koechling, and M. H. Raibert, "Running experiments with a planar biped ," in The 3rd International Symposium on Robotics ...controlling a hopping robot . The approach focuses on the interaction between the hopper and its surroundings at points of con- tact. It is only through...locomotion of legged robots . Walking, running, and hopping are distinguished from most conventional robot tasks in several respects. A stationary robot

  18. Soft Legged Wheel-Based Robot with Terrestrial Locomotion Abilities

    Directory of Open Access Journals (Sweden)

    Ali Sadeghi

    2016-12-01

    Full Text Available In recent years robotics has been influenced by a new approach, soft-robotics, bringing the idea that safe interaction with user and more adaptation to the environment can be achieved by exploiting easily deformable materials and flexible components in the structure of robots. In 2016, the soft-robotics community has promoted a new robotics challenge, named RoboSoft Grand Challenge, with the aim of bringing together different opinions on the usefulness and applicability of softness and compliancy in robotics. In this paper we describe the design and implementation of a terrestrial robot based on two soft legged wheels. The tasks predefined by the challenge were set as targets in the robot design, which finally succeeded to accomplish all the tasks. The wheels of the robot can passively climb over stairs and adapt to slippery grounds using two soft legs embedded in their structure. The soft legs, fabricated by integration of soft and rigid materials and mounted on the circumference of a conventional wheel, succeed to enhance its functionality and easily adapt to unknown grounds. The robot has a semi stiff tail that helps in the stabilization and climbing of stairs. An active wheel is embedded at the extremity of the tail in order to increase the robot maneuverability in narrow environments. Moreover two parallelogram linkages let the robot to reconfigure and shrink its size allowing entering inside gates smaller than its initial dimensions.

  19. Frictional alopecia of the distal legs: case series and review.

    Science.gov (United States)

    Zhao, Johnny; Cohen, Philip R

    2016-08-15

    BackgroundAcquired alopecia of the lower legs may occur secondary to friction due to socks, footwear, or both on the lower extremities. There is scant literature that reports on this phenomenon.Methods and MaterialsWe describe 5 patients who presented with alopecia of their lower legs induced by socks, footwear, or both. We reviewed PubMed for the following terms: ankle alopecia, friction alopecia, frictional alopecia, lower extremity alopecia, non-scarring leg alopecia, and sock alopecia. We also reviewed papers containing these terms and their references.ResultsAcquired frictional alopecia of the lower extremities is often an asymptomatic condition found incidentally on physical examination. The condition can persist for many years despite removal of the source of friction.ConclusionThe incidence of acquired frictional alopecia of the lower extremities may be greater than reflected in previously published reports. It is a non-scarring subtype of alopecia that was noted as an incidental finding during the patient's dermatology appointment.

  20. Restless legs syndrome in migraine patients: prevalence and severity.

    Science.gov (United States)

    van Oosterhout, W P J; van Someren, E J W; Louter, M A; Schoonman, G G; Lammers, G J; Rijsman, R M; Ferrari, M D; Terwindt, G M

    2016-06-01

    Our aim was to study not only the prevalence but more importantly the severity and the correlation between sleep quality and restless legs syndrome (RLS) in a large population of well-defined migraine patients as poor sleep presumably triggers migraine attacks. In a large cross-sectional and observational study, data on migraine and RLS were collected from 2385 migraine patients (according to the International Classification of Headache Disorders ICHD-IIIb) and 332 non-headache controls. RLS severity (International RLS Study Group severity scale) and sleep quality (Pittsburgh Sleep Quality Index) were assessed. Risk factors for RLS and RLS severity were calculated using multivariable-adjusted regression models. Restless legs syndrome prevalence in migraine was higher than in controls (16.9% vs. 8.7%; multivariable-adjusted odds ratio 1.83; 95% confidence interval 1.18-2.86; P = 0.008) and more severe (adjusted severity score 14.5 ± 0.5 vs. 12.0 ± 1.1; P = 0.036). Poor sleepers were overrepresented amongst migraineurs (50.1% vs. 25.6%; P Restless legs syndrome is not only twice as prevalent but also more severe in migraine patients, and associated with decreased sleep quality. © 2016 EAN.

  1. ON THE MAGNETISM AND DYNAMICS OF PROMINENCE LEGS HOSTING TORNADOES

    Energy Technology Data Exchange (ETDEWEB)

    Martínez González, M. J.; Ramos, A. Asensio; Arregui, I.; Collados, M. [Instituto de Astrofísica de Canarias, Vía Láctea s/n, E-38205 La Laguna, Tenerife (Spain); Beck, C. [National Solar Observatory, Sacramento Peak P.O. Box 62, Sunspot, NM 88349 (United States); Rodríguez, J. de la Cruz [Institute for Solar Physics, Department of Astronomy, Stockholm University, Albanova University Center, SE-10691 Stockholm (Sweden)

    2016-07-10

    Solar tornadoes are dark vertical filamentary structures observed in the extreme ultraviolet associated with prominence legs and filament barbs. Their true nature and relationship to prominences requires an understanding of their magnetic structure and dynamic properties. Recently, a controversy has arisen: is the magnetic field organized forming vertical, helical structures or is it dominantly horizontal? And concerning their dynamics, are tornadoes really rotating or is it just a visual illusion? Here we analyze four consecutive spectro-polarimetric scans of a prominence hosting tornadoes on its legs, which helps us shed some light on their magnetic and dynamical properties. We show that the magnetic field is very smooth in all the prominence, which is probably an intrinsic property of the coronal field. The prominence legs have vertical helical fields that show slow temporal variation that is probably related to the motion of the fibrils. Concerning the dynamics, we argue that (1) if rotation exists, it is intermittent, lasting no more than one hour, and (2) the observed velocity pattern is also consistent with an oscillatory velocity pattern (waves).

  2. Leg ulcer in Werner syndrome (adult progeria): a case report.

    Science.gov (United States)

    Fumo, Giuseppe; Pau, Monica; Patta, Federico; Aste, Nicola; Atzori, Laura

    2013-03-15

    Werner syndrome (WS; MIM#277700) or adult progeria, is a rare disease, associated with mutations of a single gene (RECQL2 or WRN), located on chromosome 8 (8p12). It codes a DNA-helicase, whose defects cause genomic instability. The highest incidences are reported in Japan and Sardinia (Italy). On this major island of the Mediterranean Basin, the WS cases have been observed in the northern areas. The authors describe the apparently first case reported in southern Sardinia, a 51-year-old woman, who was born in and resides in the province of Cagliari. She presented with a 9-year history of an intractable leg ulcer and other characteristic symptoms, including "bird-like" face, high-pitched voice, premature greying, short stature, abdominal obesity in contrast with thin body type, scleroderma-like legs, decreased muscle mass, diabetes, atherosclerosis, and premature menopause. A specialized genetic Institute of Research (IRCCS-IDI, Rome) confirmed the clinical diagnosis. There is no cure or specific treatment and patients must be periodically screened for an increased risk of cardiovascular and cerebrovascular disease and malignancies. Among the many findings, leg ulcers significantly affect the patient's quality of life. This problem may send the patient to the dermatologist, who finally suspects the diagnosis. Poor response to medical treatment may require aggressive repeated surgery, with poor or temporary results.

  3. A legged anchoring mechanism for capsule endoscopes using micropatterned adhesives.

    Science.gov (United States)

    Glass, Paul; Cheung, Eugene; Sitti, Metin

    2008-12-01

    This paper presents a new concept for an anchoring mechanism to enhance existing capsule endoscopes. The mechanism consists of three actuated legs with compliant feet lined with micropillar adhesives to be pressed into the intestine wall to anchor the device at a fixed location. These adhesive systems are inspired by gecko and beetle foot hairs. Single-leg and full capsule mathematical models of the forces generated by the legs are analyzed to understand capsule performance. Empirical friction models for the interaction of the adhesives with an intestinal substrate were experimentally determined in vitro using dry and oil-coated elastomer micropillar arrays with 140 microm pillar diameter, 105 microm spacing between pillars, and an aspect ratio of 1:1 on fresh porcine small intestine specimens. Capsule prototypes were also tested in a simulated intestine environment and compared with predicted peristaltic loads to assess the viability of the proposed design. The experimental results showed that a deployed 10 gr capsule robot can withstand axial peristaltic loads and anchor reliably when actuation forces are greater than 0.27 N using dry micropillars. Required actuation forces may be reduced significantly by using micropillars coated with a thin silicone oil layer.

  4. Leg preference associated with protective stepping responses in older adults.

    Science.gov (United States)

    Young, Patricia M; Whitall, Jill; Bair, Woei-Nan; Rogers, Mark W

    2013-10-01

    Asymmetries in dynamic balance stability have been previously observed. The goal of this study was to determine whether leg preference influenced the stepping response to a waist-pull perturbation in older adult fallers and non-fallers. 39 healthy, community-dwelling, older adult (>65 years) volunteers participated. Participants were grouped into non-faller and faller cohorts based on fall history in the 12 months prior to the study. Participants received 60 lateral waist-pull perturbations of varying magnitude towards their preferred and non-preferred sides during quiet standing. Outcome measures included balance tolerance limit, number of recovery steps taken and type of recovery step taken for perturbations to each side. No significant differences in balance tolerance limit (P ≥ 0.102) or number of recovery steps taken (η(2)partial ≤ 0.027; P ≥ 0.442) were observed between perturbations towards the preferred and non-preferred legs. However, non-faller participants more frequently responded with a medial step when pulled towards their non-preferred side and cross-over steps when pulled towards their preferred side (P=0.015). Leg preference may influence the protective stepping response to standing balance perturbations in older adults at risk for falls, particularly with the type of recovery responses used. Such asymmetries in balance stability recovery may represent a contributing factor for falls among older individuals and should be considered for rehabilitation interventions aimed at improving balance stability and reducing fall risk. © 2013.

  5. Uterine Diverticulum With Fetal Leg Entrapment: A Case Report.

    Science.gov (United States)

    Chandrasekaran, Nirmala; Yudin, Mark H; Berger, Howard

    2017-10-01

    Uterine anomalies causing fetal complications are very rarely encountered in obstetric practice and thus pose a diagnostic dilemma. A multigravid patient attended the clinic for an ultrasound examination in the third trimester following a recent hospital admission for abdominal pain. Ultrasound imaging revealed a large uterine diverticulum in the right cornu of the uterus with evidence of fetal leg entrapment. Because of concerns of increased soft tissue edema in the entrapped leg, the patient was delivered at 35 weeks' gestation by elective CS. The CS was complicated by uterine rupture at the diverticular portion. The neonatal course was complicated by compartment syndrome of the leg, and the infant underwent surgery on post-delivery day one with good outcome. Uterine diverticula are rare anomalies, and once they are diagnosed, the possibility of entrapment of fetal parts or placenta in pregnancy should be considered. Copyright © 2017 The Society of Obstetricians and Gynaecologists of Canada/La Société des obstétriciens et gynécologues du Canada. Published by Elsevier Inc. All rights reserved.

  6. Restless legs syndrome and impact on work performance

    Directory of Open Access Journals (Sweden)

    Diana Samara

    2016-02-01

    Full Text Available Restless legs syndrome (RLS is a neurological sensorimotor disorder characterized by unpleasant sensations in the legs and an uncontrollable urge to move them for relief. The RSL prevalence in the general population is 0.1% - 11.5%, and increases with age, with the highest effect of producing a primary sleep disorder (70%-80%. Women appear to be at increased risk, as do individuals with certain chronic conditions, including renal failure and anemia. The pathophysiology of RLS is incompletely understood, but it probably results from derangements in dopamine and iron metabolism, and has a genetic component. RSL could be idiopathic or secondary (usually related with iron deficiency, terminal renal failure, pregnancy, and spinal cord lesions. RLS patients usually have sleep disorders, so the disease can cause difficulties and problems in occupational and social life. Subjects with RLS symptoms appear to experience significantly more daytime problems, including being late for work, making errors at work, or missing work because of sleepiness. The diagnosis of RLS is made by following the criteria of the International Restless Legs Syndrome Study Group (IRLSSG. Pharmacologic RLS therapy, in which dopaminergic drugs constitute the first line, is effective and may have a dramatic effect on symptoms and quality of life. Identifying and treating RLS may improve sleep quality, daytime function and work performance.

  7. Restless Leg Syndrome in Diabetics Compared with Normal Controls

    Directory of Open Access Journals (Sweden)

    Mehdi Zobeiri

    2014-01-01

    Full Text Available Introduction. Restless leg syndrome (RLS is a common sleep disorder which is characterized by urge to move the legs accompanied by disturbing and uncomfortable leg sensation during night and rest. This common condition affects 7–10% of general population and is frequently unrecognized, misdiagnosed, and poorly managed. Several clinical conditions like diabetes have been associated with secondary form of RLS. This study analyzed the frequency and possible risk factor for RLS development in diabetic patient. Material and Methods. This descriptive case-control study was done on 140 consecutive outpatient diabetics and age, sex, and body mass index matched control group. RLS was diagnosed by criteria of the International RLS Study Group. Results. Prevalence of RLS was 28.6% in diabetes and 7.1% in control group (P=0.001. Sex difference was not significant and with rising duration of diabetes prevalence of RLS was not increased. Discussion. With regarding significant association between RLS and diabetes and its negative impact on quality of life/health outcome/sleep/daytime activity/cognitive function/ and mental state of diabetic patient/higher awareness of RLS among physicians and related health worker suggested.

  8. On the Magnetism and Dynamics of Prominence Legs Hosting Tornadoes

    Science.gov (United States)

    Martínez González, M. J.; Asensio Ramos, A.; Arregui, I.; Collados, M.; Beck, C.; de la Cruz Rodríguez, J.

    2016-07-01

    Solar tornadoes are dark vertical filamentary structures observed in the extreme ultraviolet associated with prominence legs and filament barbs. Their true nature and relationship to prominences requires an understanding of their magnetic structure and dynamic properties. Recently, a controversy has arisen: is the magnetic field organized forming vertical, helical structures or is it dominantly horizontal? And concerning their dynamics, are tornadoes really rotating or is it just a visual illusion? Here we analyze four consecutive spectro-polarimetric scans of a prominence hosting tornadoes on its legs, which helps us shed some light on their magnetic and dynamical properties. We show that the magnetic field is very smooth in all the prominence, which is probably an intrinsic property of the coronal field. The prominence legs have vertical helical fields that show slow temporal variation that is probably related to the motion of the fibrils. Concerning the dynamics, we argue that (1) if rotation exists, it is intermittent, lasting no more than one hour, and (2) the observed velocity pattern is also consistent with an oscillatory velocity pattern (waves).

  9. Restless leg syndrome in diabetics compared with normal controls.

    Science.gov (United States)

    Zobeiri, Mehdi; Shokoohi, Azita

    2014-01-01

    Introduction. Restless leg syndrome (RLS) is a common sleep disorder which is characterized by urge to move the legs accompanied by disturbing and uncomfortable leg sensation during night and rest. This common condition affects 7-10% of general population and is frequently unrecognized, misdiagnosed, and poorly managed. Several clinical conditions like diabetes have been associated with secondary form of RLS. This study analyzed the frequency and possible risk factor for RLS development in diabetic patient. Material and Methods. This descriptive case-control study was done on 140 consecutive outpatient diabetics and age, sex, and body mass index matched control group. RLS was diagnosed by criteria of the International RLS Study Group. Results. Prevalence of RLS was 28.6% in diabetes and 7.1% in control group (P = 0.001). Sex difference was not significant and with rising duration of diabetes prevalence of RLS was not increased. Discussion. With regarding significant association between RLS and diabetes and its negative impact on quality of life/health outcome/sleep/daytime activity/cognitive function/ and mental state of diabetic patient/higher awareness of RLS among physicians and related health worker suggested.

  10. ON THE MAGNETISM AND DYNAMICS OF PROMINENCE LEGS HOSTING TORNADOES

    International Nuclear Information System (INIS)

    Martínez González, M. J.; Ramos, A. Asensio; Arregui, I.; Collados, M.; Beck, C.; Rodríguez, J. de la Cruz

    2016-01-01

    Solar tornadoes are dark vertical filamentary structures observed in the extreme ultraviolet associated with prominence legs and filament barbs. Their true nature and relationship to prominences requires an understanding of their magnetic structure and dynamic properties. Recently, a controversy has arisen: is the magnetic field organized forming vertical, helical structures or is it dominantly horizontal? And concerning their dynamics, are tornadoes really rotating or is it just a visual illusion? Here we analyze four consecutive spectro-polarimetric scans of a prominence hosting tornadoes on its legs, which helps us shed some light on their magnetic and dynamical properties. We show that the magnetic field is very smooth in all the prominence, which is probably an intrinsic property of the coronal field. The prominence legs have vertical helical fields that show slow temporal variation that is probably related to the motion of the fibrils. Concerning the dynamics, we argue that (1) if rotation exists, it is intermittent, lasting no more than one hour, and (2) the observed velocity pattern is also consistent with an oscillatory velocity pattern (waves).

  11. Is There an Association between Restless Legs Syndrome and Urticaria?

    Science.gov (United States)

    Tuna, Serpil; Alan, Sevil; Samancı, Nehir; Karakaş, Ayşe Akman

    2016-05-01

    Restless legs syndrome (RLS) is a disease characterized by the urge to move the legs and sleep disturbances. Similarly, chronic spontaneous urticaria (CSU) is a dermatological disease characterized by pruritus and sleep disorders. In this study, we aimed to determine the prevalence and severity of RLS in patients with chronic spontaneous urticaria (CSU) and to compare the quality of sleep of patients with and without RLS in the CSU group using the Pittsburgh Sleep Quality Index. A total of 130 patients with CSU and 100 healthy controls were included in this study. The frequency of RLS, frequency of sleep disturbances, and average score of RLS in patients with CSU were statistically significantly higher than control groups (respectively P = 0.008, P = 0.009, P = 0.004). Subjective sleep quality, sleep latency and habitual sleep efficiency scores in patients with RLS were statistically significantly higher than patients without RLS (respectively P = 0.016, P = 0.007, P = 0.035). We claimed that pruritus of urticaria may decrease the quality of sleep in patients with RLS and it may trigger and worsen the restless legs syndrome. Furthermore, RLS and CSU may share a common etiology.

  12. Gabapentin enacarbil – clinical efficacy in restless legs syndrome

    Directory of Open Access Journals (Sweden)

    Pinky Agarwal

    2010-04-01

    Full Text Available Pinky Agarwal1, Alida Griffith1, Henry R Costantino2, Narendra Vaish31Booth Gardner Parkinson’s Center, Kirkland, WA, USA; 2Costantino Consulting, Woodinville, WA, USA; 3Kirkland, WA, USAAbstract: Restless legs syndrome (RLS is a sleep-related movement disorder commonly involving an unpleasant urge to move the limbs, typically the legs. Dopaminergic agents represent the first-line therapy for RLS; however, long-term use of such drugs results in worsening symptoms due to “augmentation” or other adverse events. Gabapentin, an analog of the inhibitory neurotransmitter gamma-aminobutyric acid (GABA, is an anticonvulsant/analgesic agent. Gabapentin is only mildly effective in relieving RLS symptoms, perhaps a result of its poor absorption from the gastrointestinal (GI tract. Gabapentin enacarbil is a prodrug of gabapentin specifically designed to enhance absorption via the GI tract, and hence provide improved circulating levels of gabapentin on metabolism. Clinical trials to date have demonstrated favorable safety and (compared to traditional gabapentin improved pharmacokinetics and efficacy in treating RLS symptoms. Thus, gabapentin enacarbil may prove to be a useful drug in treating RLS. An application of gabapentin enacarbil for treatment of RLS is currently pending with FDA for approval.Keywords: restless legs syndrome, gabapentin enacarbil, movement disorder

  13. Restless legs syndrome and impact on work performance

    Directory of Open Access Journals (Sweden)

    Diana Samara

    2009-04-01

    Full Text Available Restless legs syndrome (RLS is a neurological sensorimotor disorder characterized by unpleasant sensations in the legs and an uncontrollable urge to move them for relief. The RSL prevalence in the general population is 0.1% - 11.5%, and increases with age, with the highest effect of producing a primary sleep disorder (70%-80%. Women appear to be at increased risk, as do individuals with certain chronic conditions, including renal failure and anemia. The pathophysiology of RLS is incompletely understood, but it probably results from derangements in dopamine and iron metabolism, and has a genetic component. RSL could be idiopathic or secondary (usually related with iron deficiency, terminal renal failure, pregnancy, and spinal cord lesions. RLS patients usually have sleep disorders, so the disease can cause difficulties and problems in occupational and social life. Subjects with RLS symptoms appear to experience significantly more daytime problems, including being late for work, making errors at work, or missing work because of sleepiness. The diagnosis of RLS is made by following the criteria of the International Restless Legs Syndrome Study Group (IRLSSG. Pharmacologic RLS therapy, in which dopaminergic drugs constitute the first line, is effective and may have a dramatic effect on symptoms and quality of life. Identifying and treating RLS may improve sleep quality, daytime function and work performance.

  14. Improved Ventilatory Efficiency with Locomotor Muscle Afferent Inhibition is Strongly Associated with Leg Composition in Heart Failure.

    Science.gov (United States)

    Keller-Ross, Manda L; Johnson, Bruce D; Carter, Rickey E; Joyner, Michael J; Eisenach, John H; Curry, Timothy B; Olson, Thomas P

    2016-01-01

    Skeletal muscle atrophy contributes to increased afferent feedback (group III and IV) and may influence ventilatory control (high VE/VCO2 slope) in heart failure (HF). This study examined the influence of muscle mass on the change in VE/VCO2 with afferent neural block during exercise in HF. 17 participants [9 HF (60±6 yrs) and 8 controls (CTL) (63±7 yrs, mean±SD)] completed 3 sessions. Session 1: dual energy x-ray absorptiometry and graded cycle exercise to volitional fatigue. Sessions 2 and 3: 5 min of constant-work cycle exercise (65% of peak power) randomized to lumbar intrathecal injection of fentanyl (afferent blockade) or placebo. Ventilation (VE) and gas exchange (oxygen consumption, VO2; carbon dioxide production, VCO2) were measured. Peak work and VO2 were lower in HF (pLeg fat was greater in HF (34.4±3.0 and 26.3±1.8%) and leg muscle mass was lower in HF (63.0±2.8 and 70.4±1.8%, respectively, pleg muscle mass (r2=0.58, pleg fat mass (r2=0.73, pleg muscle mass had the greatest improvement in VE/VCO2 with afferent blockade with leg fat mass being the only predictor for the improvement in VE/VCO2 slope. Both leg muscle mass and fat mass are important contributors to ventilatory abnormalities and strongly associated to improvements in VE/VCO2 slope with locomotor afferent inhibition in HF. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  15. Reconstruction of human swing leg motion with passive biarticular muscle models.

    Science.gov (United States)

    Ahmad Sharbafi, Maziar; Mohammadi Nejad Rashty, Aida; Rode, Christian; Seyfarth, Andre

    2017-04-01

    Template models, which are utilized to demonstrate general aspects in human locomotion, mostly investigate stance leg operation. The goal of this paper is presenting a new conceptual walking model benefiting from swing leg dynamics. Considering a double pendulum equipped with combinations of biarticular springs for the swing leg beside spring-mass (SLIP) model for the stance leg, a novel SLIP-based model, is proposed to explain human-like leg behavior in walking. The action of biarticular muscles in swing leg motion helps represent human walking features, like leg retraction, ground reaction force and generating symmetric walking patterns, in simulations. In order to stabilize the motion by the proposed passive structure, swing leg biarticular muscle parameters such as lever arm ratios, stiffnesses and rest lengths need to be properly adjusted. Comparison of simulation results with human experiments shows the ability of the proposed model in replicating kinematic and kinetic behavior of both stance and swing legs as well as biarticular thigh muscle force of the swing leg. This substantiates the important functional role of biarticular muscles in leg swing. Copyright © 2017 Elsevier B.V. All rights reserved.

  16. The effect of leg preference on postural stability in healthy athletes.

    Science.gov (United States)

    Huurnink, Arnold; Fransz, Duncan P; Kingma, Idsart; Hupperets, Maarten D W; van Dieën, Jaap H

    2014-01-03

    In research regarding postural stability, leg preference is often tested and controlled for. However, leg preference may vary between tasks. As athletes are a group of interest for postural stability testing, we evaluated the effect of five leg preference tasks categorization (step up, hop, ball kick, balance, pick up) on single-leg postural stability of 16 field hockey athletes. The 'center of pressure speed' was calculated as the primary outcome variable of single-leg postural stability. Secondary variables were 'mean length of the GRF vector in the horizontal plane', 'mean length of the ankle angular velocity vector', and 'mean length of the hip angular velocity vector', as well as the separate outcomes per degree of freedom. Results showed that leg preference was inconsistent between leg preference tasks. Moreover, the primary and secondary variables yielded no significant difference between the preferred and non-preferred legs, regardless of the applied leg preference task categorization (p>0.05). The present findings do not support the usability of leg preference tasks in controlling for bias of postural stability. In conclusion, none of the applied leg preference tasks revealed a significant effect on postural stability in healthy field hockey athletes. © 2013 Published by Elsevier Ltd.

  17. Comparison between Unilateral and Bilateral Plyometric Training on Single and Double Leg Jumping Performance and Strength.

    Science.gov (United States)

    Bogdanis, Gregory C; Tsoukos, Athanasios; Kaloheri, Olga; Terzis, Gerasimos; Veligekas, Panagiotis; Brown, Lee E

    2017-04-18

    This study compared the effects of unilateral and bilateral plyometric training on single and double-leg jumping performance, maximal strength and rate of force development (RFD). Fifteen moderately trained subjects were randomly assigned to either a unilateral (U, n=7) or bilateral group (B, n=8). Both groups performed maximal effort plyometric leg exercises two times per week for 6 weeks. The B group performed all exercises with both legs, while the U group performed half the repetitions with each leg, so that total exercise volume was the same. Jumping performance was assessed by countermovement jumps (CMJ) and drop jumps (DJ), while maximal isometric leg press strength and RFD were measured before and after training for each leg separately and both legs together. CMJ improvement with both legs was not significantly different between U (12.1±7.2%) and B (11.0±5.5%) groups. However, the sum of right and left leg CMJ only improved in the U group (19.0±7.1%, pplyometric training was more effective at increasing both single and double-leg jumping performance, isometric leg press maximal force and RFD when compared to bilateral training.

  18. Operation analysis of a Chebyshev-Pantograph leg mechanism for a single DOF biped robot

    Science.gov (United States)

    Liang, Conghui; Ceccarelli, Marco; Takeda, Yukio

    2012-12-01

    In this paper, operation analysis of a Chebyshev-Pantograph leg mechanism is presented for a single degree of freedom (DOF) biped robot. The proposed leg mechanism is composed of a Chebyshev four-bar linkage and a pantograph mechanism. In contrast to general fully actuated anthropomorphic leg mechanisms, the proposed leg mechanism has peculiar features like compactness, low-cost, and easy-operation. Kinematic equations of the proposed leg mechanism are formulated for a computer oriented simulation. Simulation results show the operation performance of the proposed leg mechanism with suitable characteristics. A parametric study has been carried out to evaluate the operation performance as function of design parameters. A prototype of a single DOF biped robot equipped with two proposed leg mechanisms has been built at LARM (Laboratory of Robotics and Mechatronics). Experimental test shows practical feasible walking ability of the prototype, as well as drawbacks are discussed for the mechanical design.

  19. Arm and leg substrate utilization and muscle adaptation after prolonged low-intensity training

    DEFF Research Database (Denmark)

    Helge, Jørn Wulff

    2010-01-01

    This review will focus on current data where substrate metabolism in arm and leg muscle is investigated and discuss the presence of higher carbohydrate oxidation and lactate release observed during arm compared with leg exercise. Furthermore, a basis for a possible difference in substrate...... partitioning between endogenous and exogenous substrate during arm and leg exercise will be debated. Moreover the review will probe if differences between arm and leg muscle are merely a result of different training status rather than a qualitative difference in limb substrate regulation. Along this line...... the review will address the available studies on low-intensity training performed separately with arm or legs or as whole-body training to evaluate if this leads to different adaptations in arm and leg muscle resulting in different substrate utilization patterns during separate arm or leg exercise...

  20. Exocrine glands in the legs of the social wasp Vespula vulgaris.

    Science.gov (United States)

    Nijs, Catherine; Billen, Johan

    2015-09-01

    This study brings a survey of the exocrine glands in the legs of Vespula vulgaris wasps. We studied workers, males, virgin queens as well as mated queens. A variety of 17 glands is found in the different leg segments. Among these, five glands are novel exocrine structures for social insects (trochanter-femur gland, ventrodistal tibial gland, distal tibial sac gland, ventral tibial gland, and ventral tarsomere gland). Most leg glands are present in the three leg pairs of all castes. This may indicate a mechanical function. This is likely for the numerous glands that occur near the articulation between the various leg segments, where lubricant production may be expected. Other possible functions include antenna cleaning, acting as a hydraulic system, or pheromonal. Further research including leg-related behavioural observations and chemical analyses may help to clarify the functions of these glandular structures in the legs. Copyright © 2015 Elsevier Ltd. All rights reserved.

  1. Postural stability during the transition from double-leg stance to single-leg stance in anterior cruciate ligament injured subjects.

    Science.gov (United States)

    Dingenen, Bart; Janssens, Luc; Luyckx, Thomas; Claes, Steven; Bellemans, Johan; Staes, Filip F

    2015-03-01

    An anterior cruciate ligament injury may lead to deteriorations in postural stability. The goal of this study was to evaluate postural stability during the transition from double-leg stance to single-leg stance of both legs in anterior cruciate ligament injured subjects and non-injured control subjects with a standardized methodology. Fifteen control subjects and 15 anterior cruciate ligament injured subjects (time after injury: mean (SD)=1.4 (0.7) months) participated in the study. Both groups were similar for age, gender, height, weight and body mass index. Spatiotemporal center of pressure outcomes of both legs of each subject were measured during the transition from double-leg stance to single-leg stance in eyes open and eyes closed conditions. Movement speed was standardized. The center of pressure displacement after a new stability point was reached during the single-leg stance phase was significantly increased in the anterior cruciate ligament injured group compared to the control group in the eyes closed condition (Plegs within both groups (P>.05). No significant differences were found during the transition itself (P>.05). The anterior cruciate ligament injured group showed postural stability deficits during the single-leg stance phase compared to the non-injured control group in the eyes closed condition. Using the non-injured leg as a normal reference when evaluating postural stability of the injured leg may lead to misinterpretations, as no significant differences were found between the injured and non-injured leg of the anterior cruciate ligament injured group. Copyright © 2015 Elsevier Ltd. All rights reserved.

  2. Mechatronics by Analogy and Application to Legged Locomotion

    Science.gov (United States)

    Ragusila, Victor

    A new design methodology for mechatronic systems, dubbed as Mechatronics by Analogy (MbA), is introduced and applied to designing a leg mechanism. The new methodology argues that by establishing a similarity relation between a complex system and a number of simpler models it is possible to design the former using the analysis and synthesis means developed for the latter. The methodology provides a framework for concurrent engineering of complex systems while maintaining the transparency of the system behaviour through making formal analogies between the system and those with more tractable dynamics. The application of the MbA methodology to the design of a monopod robot leg, called the Linkage Leg, is also studied. A series of simulations show that the dynamic behaviour of the Linkage Leg is similar to that of a combination of a double pendulum and a spring-loaded inverted pendulum, based on which the system kinematic, dynamic, and control parameters can be designed concurrently. The first stage of Mechatronics by Analogy is a method of extracting significant features of system dynamics through simpler models. The goal is to determine a set of simpler mechanisms with similar dynamic behaviour to that of the original system in various phases of its motion. A modular bond-graph representation of the system is determined, and subsequently simplified using two simplification algorithms. The first algorithm determines the relevant dynamic elements of the system for each phase of motion, and the second algorithm finds the simple mechanism described by the remaining dynamic elements. In addition to greatly simplifying the controller for the system, using simpler mechanisms with similar behaviour provides a greater insight into the dynamics of the system. This is seen in the second stage of the new methodology, which concurrently optimizes the simpler mechanisms together with a control system based on their dynamics. Once the optimal configuration of the simpler system is

  3. Muscle recruitment patterns during the prone leg extension

    Directory of Open Access Journals (Sweden)

    Rayfield Ben

    2004-02-01

    Full Text Available Abstract Background The prone leg extension (PLE is a clinical test used to evaluate the function of the lumbopelvis. It has been theorized that a normal and consistent pattern of muscle activation exists. Previous research has found two contradictory patterns of muscle activation during PLE in normal individuals. One study shows an almost simultaneous activation of the lower erector spinae and hamstring muscle group with a delayed activation of the gluteus maximus, while the second describes the order of activation being ipsilateral erector spinae (to the leg being extended, hamstrings, contralateral erector spinae and gluteus maximus. Due to the different conclusions from these two studies and the lack of quantified muscle onset times, expressed in absolute time this study attempted to quantify the muscle onset times (in milliseconds during the prone leg extension, while noting if a consistent order of activation exists and whether a timing relationship also exists between the gluteus maximus and contralateral latissimus dorsi. Methods 10 asymptomatic males (Average height: 175.2 cm (SD 6.5, Average Weight 75.9 kg (SD 6.5, Average Age: 27.1(SD 1.28 and 4 asymptomatic females (Average height 164.5 (SD 2.9, weight: 56.2 (SD 8.9, Average Age: 25 (SD 1 performed the prone leg extension task while the myoelectric signal was recorded from the bilateral lower erector spinae, gluteus maximus and hamstring muscle groups. Activation onsets were determined from the rectified EMG signal relative to the onset of the hamstrings muscle group. Results No consistent recruitment patterns were detected for prone leg extension among the hamstring muscle group and the erector spinae. However, a consistent delay in the Gluteus Maximus firing of approximately 370 ms after the first muscle activated was found. Five out of 14 asymptomatic subjects showed a delay in gluteus maximus firing exceeding the average delay found in previous research of subjects considered to

  4. Elevated C-reactive protein is associated with severe periodic leg movements of sleep in patients with restless legs syndrome.

    Science.gov (United States)

    Trotti, Lynn Marie; Rye, David B; De Staercke, Christine; Hooper, W Craig; Quyyumi, Arshed; Bliwise, Donald L

    2012-11-01

    Restless legs syndrome (RLS) is a common sleep disorder in which urges to move the legs are felt during rest, are felt at night, and are improved by leg movement. RLS has been implicated in the development of cardiovascular disease. Periodic leg movements (PLMs) may be a mediator of this relationship. We evaluated systemic inflammation and PLMs in RLS patients to further assess cardiovascular risk. 137 RLS patients had PLM measurements taken while unmedicated for RLS. Banked plasma was assayed for high sensitivity C-reactive protein (CRP), interleukin-6 (IL-6), and tumor necrosis factor alpha (TNF-alpha). Mean (SD) PLM index was 19.3 (22.0). PLMs were unrelated to TNF-a and IL-6, but were modestly correlated with logCRP (r(129)=0.19, p=0.03). Those patients with at least 45PLMs/h had an odds ratio of 3.56 (95% CI 1.26-10.03, p=0.02, df=1) for having elevated CRP compared to those with fewer than 45PLMs/h. After adjustment for age, race, gender, diabetes, hypertension, hyperlipidemia, inflammatory disorders, CRP-lowering medications, and body mass index, the OR for those with ≥ 45PLMs/h was 8.60 (95% CI 1.23 to 60.17, p=0.03, df=10). PLMs are associated with increased inflammation, such that those RLS patients with at least 45PLMs/h had more than triple the odds of elevated CRP than those with fewer PLMs. Further investigation into PLMs and inflammation is warranted. Copyright © 2012 Elsevier Inc. All rights reserved.

  5. Characterizing restless legs syndrome and leg motor restlessness in patients with Parkinson's disease: A multicenter case-controlled study.

    Science.gov (United States)

    Suzuki, Keisuke; Okuma, Yasuyuki; Uchiyama, Tomoyuki; Miyamoto, Masayuki; Sakakibara, Ryuji; Shimo, Yasushi; Hattori, Nobutaka; Kuwabara, Satoshi; Yamamoto, Toshimasa; Kaji, Yoshiaki; Hirano, Shigeki; Numao, Ayaka; Hirata, Koichi

    2017-11-01

    We investigated the prevalence and impact of restless legs syndrome (RLS) and leg motor restlessness (LMR) in patients with Parkinson's disease (PD) in a multicenter study. A total of 436 PD patients and 401 age- and sex-matched controls were included in this study. RLS was diagnosed based on four essential features. LMR was diagnosed when a participant exhibited the urge to move his or her legs but did not meet the four essential features of RLS. The RLS prevalence did not differ between PD patients and controls (3.4% vs. 2.7%), while LMR prevalence was significantly higher in PD patients than in controls (12.8% vs. 4.5%). PD patients with RLS or LMR had a higher prevalence of excessive daytime sleepiness (EDS) (50.7%, vs. 6.9%), probable REM sleep behavior disorder (38.0% vs. 3.4%) and PD-related sleep problems (49.3% vs. 20.7%) than controls with RLS or LMR. RLS/LMR preceding PD onset was related to an older age of PD onset. Our study revealed an increased prevalence of LMR but not RLS in PD patients. LMR could be an early manifestation of PD; however, whether LMR is within the range of RLS or whether LMR and RLS constitute different entities in PD requires further studies. Copyright © 2017 Elsevier Ltd. All rights reserved.

  6. The application of strength and power related field tests in older adults : criteria, current status and a future perspective

    NARCIS (Netherlands)

    Regterschot, G. Ruben H.; Morat, Tobias; Folkersma, Marjanne; Zijlstra, Wiebren

    2015-01-01

    Leg muscle strength (LMS) and leg muscle power (LMP) are determinants of aspects of functional status and important parameters for measuring intervention effects in older adults. Field tests are often used for the evaluation of LMS and LMP in older persons. However, criteria important for the

  7. Assessment of nutritional status in adult patients with cystic fibrosis: whole-body bioimpedance vs body mass index, skinfolds, and leg-to-leg bioimpedance

    NARCIS (Netherlands)

    Hollander, F.M.; Roos, de N.M.; Vries, de J.H.M.; Berkhout, van F.T.

    2005-01-01

    Objective: To investigate whether body mass index (BMI) or body fat percentage estimated from BMI, skinfolds, or leg-to-leg bioimpedance are good indicators of nutritional status in adult patients with cystic fibrosis. Body fat percentage measured by whole-body bioimpedance was used as the reference

  8. How does postural stability following a single leg drop jump landing task relate to postural stability during a single leg stance balance task?

    NARCIS (Netherlands)

    Fransz, Duncan P.; Huurnink, Arnold; Kingma, Idsart; van Dieën, Jaap H.

    2014-01-01

    We aimed to verify whether the static phase after a single leg drop jump (DJ) landing on a force plate may serve as a proxy for a single leg stance (SLS) balance task, as this would increase the application possibilities of landing tasks in the evaluation of sensorimotor function in relation to

  9. Lower extremity muscle activation onset times during the transition from double-leg stance to single-leg stance in anterior cruciate ligament reconstructed subjects.

    Science.gov (United States)

    Dingenen, Bart; Janssens, Luc; Claes, Steven; Bellemans, Johan; Staes, Filip F

    2016-06-01

    Previous studies mainly focused on muscles at the operated knee after anterior cruciate ligament reconstruction, less on muscles around other joints of the operated and non-operated leg. The aim of this study was to investigate muscle activation onset times during the transition from double-leg stance to single-leg stance in anterior cruciate ligament reconstructed subjects. Lower extremity muscle activation onset times of both legs of 20 fully returned to sport anterior cruciate ligament reconstructed subjects and 20 non-injured control subjects were measured during the transition from double-leg stance to single-leg stance in eyes open and eyes closed conditions. Analysis of covariance (ANCOVA) was used to evaluate differences between groups and differences between legs within both groups, while controlling for peak center of pressure velocity. Significantly delayed muscle activation onset times were found in the anterior cruciate ligament reconstructed group compared to the control group for gluteus maximus, gluteus medius, vastus medialis obliquus, medial hamstrings, lateral hamstrings and gastrocnemius in both eyes open and eyes closed conditions (Panterior cruciate ligament reconstructed group, no significant different muscle activation onset times were found between the operated and non-operated leg (P>.05). Despite completion of rehabilitation and full return to sport, the anterior cruciate ligament reconstructed group showed neuromuscular control deficits that were not limited to the operated knee joint. Clinicians should focus on relearning multi-segmental anticipatory neuromuscular control strategies after anterior cruciate ligament reconstruction. Copyright © 2016 Elsevier Ltd. All rights reserved.

  10. Effect of Exercise Intensity on Percent Body Fat Determined by Leg-to-Leg and Segmental Bioelectrical Impedance Analyses in Adults

    Science.gov (United States)

    Andreacci, Joseph L.; Nagle, Trisha; Fitzgerald, Elise; Rawson, Eric S.; Dixon, Curt B.

    2013-01-01

    Purpose: We examined the impact that cycle ergometry exercise had on percent body fat (%BF) estimates when assessed using either leg-to-leg or segmental bioelectrical impedance analysis (LBIA; SBIA) and whether the intensity of the exercise bout impacts the %BF magnitude of change. Method: Seventy-four college-aged adults participated in this…

  11. Organic trace minerals and 25-hydroxycholecalciferol affect performance characteristics, leg abnormalities, and biomechanical properties of leg bones of turkeys.

    Science.gov (United States)

    Ferket, P R; Oviedo-Rondón, E O; Mente, P L; Bohórquez, D V; Santos, A A; Grimes, J L; Richards, J D; Dibner, J J; Felts, V

    2009-01-01

    Leg problems and resulting mortality can exceed 1% per week in turkey toms starting at approximately 15 wk of age. Dietary supplementation of organic trace minerals (MIN) and 25-hydroxycholecalciferol (HyD) may improve performance, decrease incidence of leg abnormalities, and increase bone strength. Nicholas 85X700 toms were assigned to 4 treatments consisting of a factorial arrangement of 2 concentrations of MIN (0 and 0.1% of Mintrex P(Se), which adds 40, 40, 20, and 0.3 mg/kg of Zn, Mn, Cu, and Se, respectively) and 2 concentrations of HyD (0 and 92 microg/kg of HyD). Diets were formulated to be equal in nutrient content and fed ad libitum as 8 feed phases. Feed intake and BW were measured at 6, 12, 15, 17, and 20 wk of age. Valgus, varus, and shaky leg defects were determined at 12, 15, 17, and 20 wk of age. Tibia and femur biomechanical properties were evaluated by torsion and bending tests at 17 wk of age. There were no treatment effects on BW. Only MIN significantly improved feed conversion ratio through to 20 wk of age. Cumulative mortality at 3 wk of age was greater among the MIN birds, but it was lower by 20 wk (P = 0.085). The MIN decreased the incidence of varus defects at 17 wk of age; shaky leg at 12, 15, and 17 wk of age; and valgus defects at 15, 17, and 20 wk of age. There were no MIN x HyD interaction effects on individual gait problems. Maximum load and the bending stress required for tibias to break in a 4-point assay were increased with MIN supplementation, especially when HyD was also added. Maximum shear stress at failure of femoral bones in a torsion assay was increased by supplementation with both MIN and HyD together. Dietary supplementation of MIN and HyD may improve biomechanical properties of bones. Dietary MIN supplementation may improve feed conversion of turkeys, likely by decreasing leg problems.

  12. Characterizing rapid-onset vasodilation to single muscle contractions in the human leg

    Science.gov (United States)

    Credeur, Daniel P.; Holwerda, Seth W.; Restaino, Robert M.; King, Phillip M.; Crutcher, Kiera L.; Laughlin, M. Harold; Padilla, Jaume

    2014-01-01

    Rapid-onset vasodilation (ROV) following single muscle contractions has been examined in the forearm of humans, but has not yet been characterized in the leg. Given known vascular differences between the arm and leg, we sought to characterize ROV following single muscle contractions in the leg. Sixteen healthy men performed random ordered single contractions at 5, 10, 20, 40, and 60% of their maximum voluntary contraction (MVC) using isometric knee extension made with the leg above and below heart level, and these were compared with single isometric contractions of the forearm (handgrip). Single thigh cuff compressions (300 mmHg) were utilized to estimate the mechanical contribution to leg ROV. Continuous blood flow was determined by duplex-Doppler ultrasound and blood pressure via finger photoplethysmography (Finometer). Single isometric knee extensor contractions produced intensity-dependent increases in peak leg vascular conductance that were significantly greater than the forearm in both the above- and below-heart level positions (e.g., above heart level: leg 20% MVC, +138 ± 28% vs. arm 20% MVC, +89 ± 17%; P leg. Collectively, these data demonstrate the presence of a rapid and robust vasodilation to single muscle contractions in the leg that is largely independent of mechanical factors, thus establishing the leg as a viable model to study ROV in humans. PMID:25539935

  13. Effects of immobility on sensory and motor symptoms of restless legs syndrome.

    Science.gov (United States)

    Michaud, Martin; Lavigne, Gilles; Desautels, Alex; Poirier, Gaétan; Montplaisir, Jacques

    2002-01-01

    Restless legs syndrome (RLS) is defined by an irresistible need to move associated with leg paresthesia. Two additional features are essential for diagnosis: (1) worsening of symptoms at rest with temporary relief by activity, and (2) worsening of symptoms during the evening and/or during the night. The suggested immobilization test (SIT) has been developed to evaluate the presence of these criteria. This test quantifies leg movements and leg discomfort during a 1-hour period of immobility prior to bedtime. We used the SIT to evaluate the effects of immobility on leg discomfort and leg movements experienced by 19 patients with RLS and 19 control subjects. Results show that immobility significantly worsens both leg discomfort and periodic leg movements (PLM) in patients with RLS but not in controls. Patients with RLS showed a higher leg discomfort score (32.6 +/- 15.1 mm vs. 5.7 +/- 7.9 mm; P < 0.00001), a greater maximum leg discomfort value (63.4 +/- 27.4 mm vs. 13.7 +/- 23.0 mm; P < 0.00001) and a greater PLM index (88.4 +/- 62.6 vs. 10.4 +/- 20.6; P < 0.00004) than control subjects. These results further validate the use of the SIT as a diagnostic and research tool for RLS and confirm the contention of the International RLS study group that RLS symptoms worsen at rest. Copyright 2001 Movement Disorder Society.

  14. Theoretical and experimental study on a compliant flipper-leg during terrestrial locomotion.

    Science.gov (United States)

    Fang, Tao; Zhou, Youcheng; Li, Shikun; Xu, Min; Liang, Haiyi; Li, Weihua; Zhang, Shiwu

    2016-08-17

    An amphibious robot with straight compliant flipper-legs can conquer various amphibious environments. The robot can rotate its flipper-legs and utilize their large deflection to walk on rough terrain, and it can oscillate the straight flipper-legs to propel itself underwater. This paper focuses on the dynamics of the compliant straight flipper-legs during terrestrial locomotion by modeling its deformation dynamically with large deflection theory and simulating it to investigate the parameters of locomotion such as trajectory, velocity, and propulsion. To validate the theoretical model of dynamic locomotion, a single-leg experimental platform is used to explore the flipper-legs in motion with various structural and kinematic parameters. Furthermore, a robotic platform mounting with four compliant flipper-legs is also developed and used to experiment with locomotion. The trajectories of the rotating axle of the compliant flipper-leg during locomotion were approximately coincidental in simulation and in experiments. The speed of locomotion and cost of transport during locomotion were explored and analyzed. The performance of different types of compliant flipper-legs during locomotion shows that varying the degrees of stiffness will have a significant effect on their locomotion. The dynamic model and analysis of the compliant flipper-leg for terrestrial locomotion facilitates the ability of amphibious robots to conquer complex environments.

  15. The odd-skipped family of zinc finger genes promotes Drosophila leg segmentation.

    Science.gov (United States)

    Hao, Irene; Green, Ryan B; Dunaevsky, Olga; Lengyel, Judith A; Rauskolb, Cordelia

    2003-11-15

    Notch signaling controls formation of joints at leg segment borders and growth of the developing Drosophila leg. Here, we identify the odd-skipped gene family as a key group of genes that function downstream of the Notch receptor to promote morphological changes associated with joint formation during leg development. odd, sob, drm, and bowl are expressed in a segmental pattern in the developing leg, and their expression is regulated by Notch signaling. Ectopic expression of odd, sob, or drm can induce invaginations in the leg disc epithelium and morphological changes in the adult leg that are characteristic of endogenous invaginating joint cells. These effects are not due to an alteration in the expression of other genes of the developing joint. While odd or drm mutant clones do not affect leg segmentation, and thus appear to act redundantly, bowl mutant clones do perturb leg development. Specifically, bowl mutant clones result in a failure of joint formation from the distal tibia to tarsal segment 5, while more proximal clones cause melanotic protrusions from the leg cuticle. Together, these results indicate that the odd-skipped family of genes mediates Notch function during leg development by promoting a specific aspect of joint formation, an epithelial invagination. As the odd-skipped family genes are involved in regulating cellular morphogenesis during both embryonic segmentation and hindgut development, we suggest that they may be required in multiple developmental contexts to induce epithelial cellular changes.

  16. [The Activation of Interlimb Interactions Increase the Motor Output in Legs in Healthy Subjects under the Conditions of Arm and Leg Unloading].

    Science.gov (United States)

    Selionov, V A; Solopova, I A; Zhvansky, D S

    2016-01-01

    We studied the effect of arm movements and movements of separate arm joints on the electrophysiological and kinematic characteristics of voluntary and vibration-triggered stepping-like leg movements under the conditions of horizontal support of upper and lower limbs. The horizontal support of arms provided a significantly increase in the rate of activation of locomotor automatism by non-invasive impact on tonic sensory inputs. The addition of active arm movements during involuntary rhytmic stepping-like leg movements led to an increase in EMG activity of hip muscles and was accompanied by an increase in the amplitude of hip and shin movements. Passive arm movements had the same effect on induced leg movements. The movement of the shoulder joints led to an increase in the activity of hip muscles and an increase in the amplitude of movements of the knee and hip joints. At the same time, the movement of forearms. and wrists had similar facilitating effect on electrophysiological and kinematic characteristics of rhytmic stepping-like movements, but influenced the distal segments of legs to a greater extent. Under the conditions of sub-threshold vibration of leg muscles, voluntary arm movements led to the activation of involuntary rhytmic stepping movements. During voluntary leg movements, the addition of arm movements had a significantly smaller impact on the parameters of rhytmic stepping than during involuntary leg movements. Thus, the simultaneous movements of upper and lower limbs are an effective method of activation of neural networks connecting the rhythm generators of arms and legs. Under the conditions of arm and leg unloading, the interactions between the cervical and lumbosacral segments of the spinal cord seem to play the major role in the impact of arm movements on the patterns of leg movements. The described methods of activation of interlimb interactions can be used in the rehabilitation of post-stroke patients and patients with spinal cord injuries

  17. Restless Legs Syndrome and Cognitive Function: A Population-based Cross-sectional Study.

    Science.gov (United States)

    Rist, Pamela M; Elbaz, Alexis; Dufouil, Carole; Tzourio, Christophe; Kurth, Tobias

    2015-09-01

    Restless legs syndrome has been speculated to be linked to cognitive impairment through vascular risk factors or through its effect on sleep deprivation. Previous studies on the association between restless legs syndrome and cognitive function have been inconclusive. We performed a cross-sectional analysis of the association between restless legs syndrome and cognitive function using data from a large population-based study of elderly individuals residing in France. We used information from 2070 individuals from the Dijon, France center of the Three-City study who had available information on restless legs syndrome and cognitive functioning measures. Restless legs syndrome was assessed using the 4 minimal diagnostic criteria of the International Restless Legs Study Group. During the same wave in which restless legs syndrome status was assessed, cognitive functions also were assessed using 4 tests: Isaacs' test of verbal/category fluency, the Benton Visual Retention Test, the Trail Making Test B, and the Mini-Mental State Examination. We created a summary global cognitive score by summing the z scores for the 4 tests and used analysis of covariance to explore the association between restless legs syndrome and cognitive function. We did not observe any statistically significant differences in any cognitive z-score between those with restless legs syndrome and those without restless legs syndrome. The mean global z-score after multivariate adjustment was -0.003 (SE 0.173) for those with restless legs syndrome and -0.007 (SE 0.129) for those without restless legs syndrome (P-value = .98). Data from this large, population-based study do not suggest that restless legs syndrome is associated with prevalent cognitive deficits in elderly individuals. Copyright © 2015 Elsevier Inc. All rights reserved.

  18. Associations of Leg Fat Accumulation with Adiposity-Related Biological Factors and Risk of Metabolic Syndrome

    Science.gov (United States)

    Zhang, Xiaomin; Hu, Emily A.; Wu, Hongyu; Malik, Vasanti; Sun, Qi

    2012-01-01

    The association between regional fat mass distribution and cardiometabolic risk factors has been inconsistent in the literature, and data for ethnic minority groups, such as non-Hispanic blacks and Hispanics, are lacking. We aimed to examine this association among 8802 US residents who participated in the 1999-2004 US National Health and Nutrition Examination Survey (NHANES). Body composition was measured using dual-energy X-ray absorptiometry (DXA). Leg fat indices included leg fat mass (FM), leg fat mass percent (FM%), leg to whole body FM ratio (leg/whole) and leg to trunk FM ratio (leg/trunk). We evaluated the correlation between leg fat indices and adiposity-related risk factors, as well as the association of these indices with metabolic syndrome (MetS). After adjusting for covariates including age, gender, and trunk FM or trunk FM%, higher leg FM and leg FM% were, in general, correlated favorably with adiposity-related risk factors and associated with lower odds of MetS in all ethnicities, including non-Hispanic whites and blacks and Hispanic groups. In addition, in all multivariate-adjusted models, leg/whole and leg/trunk ratios were strongly associated with lower levels of most risk factors and decreased odds of MetS in these ethnicities (all odds ratios comparing extreme quintiles leg fat accumulation is inversely associated with adiposity-related biological factors and risk of MetS in both whites and ethnic groups, suggesting that regional fat distribution plays an important role in the etiology of adiposity-related diseases in these populations. PMID:23404933

  19. Daily Quantity of Infant Leg Movement: Wearable Sensor Algorithm and Relationship to Walking Onset.

    Science.gov (United States)

    Smith, Beth A; Trujillo-Priego, Ivan A; Lane, Christianne J; Finley, James M; Horak, Fay B

    2015-08-04

    Normative values are lacking for daily quantity of infant leg movements. This is critical for understanding the relationship between the quantity of leg movements and onset of independent walking, and will begin to inform early therapy intervention for infants at risk for developmental delay. We used wearable inertial movement sensors to record full-day leg movement activity from 12 infants with typical development, ages 1-12 months. Each infant was tested three times across 5 months, and followed until the onset of independent walking. We developed and validated an algorithm to identify infant-produced leg movements. Infants moved their legs tens of thousands of times per day. There was a significant effect of leg movement quantity on walking onset. Infants who moved their legs more walked later than infants who moved their legs less, even when adjusting for age, developmental level or percentile length. We will need a much larger sample to adequately capture and describe the effect of movement experience on developmental rate. Our algorithm defines a leg movement in a specific way (each pause or change in direction is counted as a new movement), and further assessment of movement characteristics are necessary before we can fully understand and interpret our finding that infants who moved their legs more walked later than infants who moved their legs less. We have shown that typically-developing infants produce thousands of leg movements in a typical day, and that this can be accurately captured in the home environment using wearable sensors. In our small sample we can identify there is an effect of leg movement quantity on walking onset, however we cannot fully explain it.

  20. Effect of elastic bandage wraps on leg edema in patients before and after liver transplant.

    Science.gov (United States)

    Mathews, Susan; James, Shantell; Anderson, Janet D; Merchant, Mehwish; Benenati, Sonia; Henry, Samantha; Comrie, Gem; Pirani, Shamsa; Zellinger, Mary

    2015-12-01

    Few studies have evaluated the benefits of short-term use of compression therapy to prevent or minimize edema and/or pain in the legs of acutely ill, hospitalized patients without venous leg ulcers. To determine if the use of elastic bandage wraps of the leg in patients before and after liver transplant decreases edema formation and pain in the leg. Study Population-A convenience sample of inpatients before and after liver transplant. Pretest, posttest, randomized controlled trial with each participant serving as his or her own control. Intervention-Elastic bandage wrap applied to leg for 8 hours. Edema and pain in leg. In 13 patients before and 11 patients after liver transplant, the mean (SD) change in leg circumference after a single 8-hour application of an elastic bandage wrap was -2.6 (2.2) cm at the ankle and -3.1 (2.9) cm at midcalf for wrapped legs, as opposed to -0.4 (1.6) cm at the ankle and 1.0 (2.8) cm at midcalf for unwrapped legs (PLeg pain, measured on a visual analog scale, was significantly lower for the wrapped (mean [SD], 10.3 [26.5] mm) versus the unwrapped (20.3 [33.5] mm) leg (P=.04). In inpatients before and after liver transplant, the application of elastic bandage wraps to 1 leg for an 8-hour period led to significantly less edema formation and pain compared with the unwrapped leg. These results support the use of elastic bandage wraps in liver transplant patients to reduce leg edema and improve comfort.

  1. Gain changes in sensorimotor pathways of the locust leg

    Science.gov (United States)

    BÜSchges; Wolf

    1996-01-01

    Feedback systems that control the leg joints of animals must be highly flexible in adapting to different behavioural tasks. One manifestation of such flexibility is changes in the gain of joint control networks. The femur­tibia (FT) control network of the locust leg is one of the feedback systems most thoroughly studied with regard to its neural circuitry. Despite excellent information concerning network topology, however, actual gain changes and their underlying mechanisms have not yet been examined because of the marked spontaneous variations in the action of the control network for this joint. We describe a behavioural situation and a preparation in which the locust (Locusta migratoria L.) FT control network exhibits reproducible changes in gain, allowing investigation of the neuronal basis of gain control. After ('fictive') flight motor activity, the gain of resistance reflexes in the FT joint of the locust middle leg is significantly decreased, with the flexor tibiae muscles being affected more strongly than the extensor muscles. Immediately after flight motor activity, the gain may be as low as 30 % of pre-flight levels. It returns to pre-flight values in under 150 s. The decrease in gain following flight motor activity is due to a decrease in motoneurone recruitment in the resistance reflex elicited by stimulation of the appropriate mechanoreceptor, the femoral chordotonal organ. Motoneurone recruitment is changed as a result of a drastic decline in the stimulus-related synaptic input to the motoneurones, which appears to be produced exclusively at the level of the pre-motor network. Two factors led to this conclusion: first, we found no indication of changes in membrane potential or membrane conductance of the tibia flexor and extensor motoneurones; second, recording from identified pre-motor nonspiking interneurones demonstrated that these may be involved in the observed gain changes. The putative behavioural relevance is discussed.

  2. Restless Legs Syndrome and Sleep-Wake Disturbances in Pregnancy

    Science.gov (United States)

    Dunietz, Galit Levi; Lisabeth, Lynda D.; Shedden, Kerby; Shamim-Uzzaman, Q. Afifa; Bullough, Alexandra S.; Chames, Mark C.; Bowden, Marc F.; O'Brien, Louise M.

    2017-01-01

    Study Objectives: To estimate the association of restless legs syndrome (RLS) and its frequency with sleep-wake disturbances in pregnancy. Methods: A cohort of 1,563 women in their third trimester of pregnancy were recruited from prenatal clinics between March 2007 and December 2010. Demographic, pregnancy, and delivery data were extracted from medical records and sleep information was collected with questionnaires. To diagnose RLS, we used standardized criteria of RLS symptoms and frequency that were developed by the International Restless Legs Study Group. Logistic regression models were constructed to investigate the association of RLS and its frequency with sleep-wake disturbances (poor sleep quality, daytime sleepiness, poor daytime function) and delivery outcomes. Results: Overall 36% of the pregnant women had RLS, and half had moderate to severe symptoms. Compared to women without RLS, those with RLS were more likely to have poor sleep quality (odds ratio [OR] 2.2, 95% confidence interval [CI] 1.7–2.9), poor daytime function (OR 1.9, 95% CI 1.4–2.4), and excessive daytime sleepiness (OR 1.6, 95% CI 1.3–2.0). A dose-response relationship also was evident between RLS frequency and each of the sleep-wake disturbances. There was no evidence for any association between RLS and delivery outcomes. Conclusions: RLS is a significant contributor to poor sleep quality, daytime sleepiness, and poor daytime function, all common and often debilitating conditions in pregnancy. Obstetric health care providers should be aware of these associations and screen women for RLS. Commentary: A commentary on this article appears in this issue on page 857. Citation: Dunietz GL, Lisabeth LD, Shedden K, Shamim-Uzzaman A, Bullough AS, Chames MC, Bowden MF, O'Brien LM. Restless legs syndrome and sleep-wake disturbances in pregnancy. J Clin Sleep Med. 2017;13(7):863–870. PMID:28633715

  3. [Diagnosis and symptom rating scale of restless legs syndrome].

    Science.gov (United States)

    Inoue, Yuichi

    2009-05-01

    Restless legs syndrome (RLS) is a sensorimotor disorder, characterized by an irresistible urge to move the legs and usually accompanied or caused by uncomfortable and unpleasant sensations. It begins or worsens during periods of rest or inactivity, is partially or totally relieved by movement and is exacerbated or occurs mainly in the evening or night. People suffering from RLS are estimated to represent 2-3% of the general Japanese population, which is relatively lower than the estimated prevalence in western countries. Supportive diagnostic critevia include family history, the presence of periodic-leg movements (PLM) when awake or asleep, and a positive response to dopaminergic treatment. RLS phenotypes include an early onset form that is usually idiopathic with frequent familial history and a late onset form that is usually secondary to other somatic conditions that are causative factors in RLS occurrence. In all patients presenting with complaints of insomnia or discomfort in the lower limbs, diagnosis of RLS should be considered. RLS should be differentiated from akathisia, which is an urge to move the whole body in the absence of uncomfortable sensations. Polysomnographic studies and the suggested immobilization test (SIT) can detect PLM in patients that are asleep or awake. RLS may cause severe sleep disturbances, poor quality of life, depressive and anxious symptoms, and may be a risk factor for cardiovascular disease. Secondary RLS may occur due to iron deficiency, end-stage renal disease, pregnancy, peripheral neuropathy and drug use including antipsychotics and antidepressants. Small fiber neuropathy can trigger RLS or mimic its symptoms. RLS is associated with many neurological disorders, including Parkinson disease and multiple system atrophy; althoughit does not predispose to these diseases. A symptom rating scale for RLS authorized by the International RLS Study Group (IRLS) would facilitate accurate diagnosis of this condition.

  4. Two-legged hopping in autism spectrum disorders

    Directory of Open Access Journals (Sweden)

    Matthew F. Moran

    2013-03-01

    Full Text Available Sensory processing deficits are common within autism spectrum disorders (ASD. Deficits have a heterogeneous dispersion across the spectrum and multimodal processing tasks are thought to magnify integration difficulties. Two-legged hopping in place in sync with an auditory cue (2.3, 3.0 Hz was studied in a group of six individuals with expressive language impaired ASD (ELI-ASD and an age-matched control group. Vertical ground reaction force data were collected and discrete Fourier transforms were utilized to determine dominant hopping cadence. Effective leg stiffness was computed through a mass-spring model representation. The ELI-ASD group were unsuccessful in matching their hopping cadence (2.21±0.30 hops•sec-1, 2.35±0.41 hops•sec-1 to either auditory cue with greater deviations at the 3.0 Hz cue. In contrast, the control group was able to match hopping cadence (2.35±0.06 hops•sec-1, 3.02±0.10 hops•sec-1 to either cue via an adjustment of effective leg stiffness. The ELI-ASD group demonstrated a varied response with an interquartile range (IQR in excess of 0.5 hops•sec-1 as compared to the control group with an IQR < 0.03 hops•sec-1. Several sensorimotor mechanisms could explain the inability of participants with ELI-ASD to modulate motor output to match an external auditory cue. These results suggest that a multimodal gross motor task can (1 discriminate performance among a group of individuals with severe autism, and (2 could be a useful quantitative tool for evaluating motor performance in individuals with ASD individuals.

  5. Merits of Using Tranquilizer Trap Devices on Leg-Hold Traps Used to Capture Gray Wolves (Canis lupus)

    OpenAIRE

    Sahr, Duane P.

    1997-01-01

    Gray wolves (Canis lupus) are frequently captured with leg-hold traps for reintroduction, relocation to reduce depredations on livestock, or as subjects for research projects. Wolves captured with leg-hold traps often sustain injuries to their feet, legs, and teeth during struggles to escape. Other studies have shown that the use of tranquilizer devices on leg-hold traps reduces such injuries to coyotes. This study (1) assessed whether use of tranquilizer trap devices (TTDs) on leg-hold traps...

  6. Reliability of a Novel High Intensity One Leg Dynamic Exercise Protocol to Measure Muscle Endurance.

    Directory of Open Access Journals (Sweden)

    Benjamin Pageaux

    Full Text Available We recently developed a high intensity one leg dynamic exercise (OLDE protocol to measure muscle endurance and investigate the central and peripheral mechanisms of muscle fatigue. The aims of the present study were to establish the reliability of this novel protocol and describe the isokinetic muscle fatigue induced by high intensity OLDE and its recovery. Eight subjects performed the OLDE protocol (time to exhaustion test of the right leg at 85% of peak power output three times over a week period. Isokinetic maximal voluntary contraction torque at 60 (MVC60, 100 (MVC100 and 140 (MVC140 deg/s was measured pre-exercise, shortly after exhaustion (13 ± 4 s, 20 s (P20 and 40 s (P40 post-exercise. Electromyographic (EMG signal was analyzed via the root mean square (RMS for all three superficial knee extensors. Mean time to exhaustion was 5.96 ± 1.40 min, coefficient of variation was 8.42 ± 6.24%, typical error of measurement was 0.30 min and intraclass correlation was 0.795. MVC torque decreased shortly after exhaustion for all angular velocities (all P < 0.001. MVC60 and MVC100 recovered between P20 (P < 0.05 and exhaustion and then plateaued. MVC140 recovered only at P40 (P < 0.05. High intensity OLDE did not alter maximal EMG RMS of the three superficial knee extensors during MVC. The results of this study demonstrate that this novel high intensity OLDE protocol could be reliably used to measure muscle endurance, and that muscle fatigue induced by high intensity OLDE should be examined within ~ 30 s following exhaustion.

  7. TF Inner Leg Space Allocation for Pilot Plant Design Studies

    Energy Technology Data Exchange (ETDEWEB)

    Peter H. Titus and Ali Zolfaghari

    2012-09-06

    A critical design feature of any tokamak is the space taken up by the inner leg of the toroidal field (TF) coil. The radial build needed for the TF inner leg, along with shield thickness , size of the central solenoid and plasma minor radius set the major radius of the machine. The cost of the tokamak core roughly scales with the cube of the major radius. Small reductions in the TF build can have a big impact on the overall cost of the reactor. The cross section of the TF inner leg must structurally support the centering force and that portion of the vertical separating force that is not supported by the outer structures. In this paper, the TF inner leg equatorial plane cross sections are considered. Out-of- Plane (OOP) forces must also be supported, but these are largest away from the equatorial plane, in the inner upper and lower corners and outboard sections of the TF coil. OOP forces are taken by structures that are not closely coupled with the radial build of the central column at the equatorial plane. The "Vertical Access AT Pilot Plant" currently under consideration at PPPL is used as a starting point for the structural, field and current requirements. Other TF structural concepts are considered. Most are drawn from existing designs such as ITER's circular conduits in radial plates bearing on a heavy nose section, and TPX's square conduits in a case, Each of these concepts can rely on full wedging, or partial wedging. Vaulted TF coils are considered as are those with some component of bucking against a central solenoid or bucking post. With the expectation that the pilot plant will be a steady state machine, a static stress criteria is used for all the concepts. The coils are assumed to be superconducting, with the superconductor not contributing to the structural strength. Limit analysis is employed to assess the degree of conservatism in the static criteria as it is applied to a linear elastic stress analysis. TF concepts, and in particular the PPPL AT

  8. Engineering Design of an Adaptive Leg Prosthesis Using Biological Principles

    DEFF Research Database (Denmark)

    Lenau, Torben Anker; Dentel, Andy; Invarsdottir, Thorunn

    2010-01-01

    The biomimetic design process is explored through a design case: An adaptive leg prosthesis. The aim is to investigate if the biomimetic design process can be carried out with a minimum of biological knowledge and without using advanced design methods. In the design case biomimetic design was suc...... was successfully carried out using library search resulting in 14 biological analogies for the design problem 'shape adaption'. It is proposed that search results are handled using special cards describing the biological phenomena and the functional principles....

  9. Delivery of Compression Therapy for Venous Leg Ulcers

    DEFF Research Database (Denmark)

    Zarchi, Kian; Jemec, Gregor B E

    2014-01-01

    IMPORTANCE: Despite the documented effect of compression therapy in clinical studies and its widespread prescription, treatment of venous leg ulcers is often prolonged and recurrence rates high. Data on provided compression therapy are limited. OBJECTIVE: To assess whether home care nurses achieve......; and a multilayer, 2-component bandage, as well as, association between achievement of optimal pressure and years in the profession, attendance at wound care educational programs, previous work experience, and confidence in bandaging ability. RESULTS: A substantial variation in the exerted pressure was found...

  10. Exercise Related Leg Pain (ERLP): a Review of The Literature.

    Science.gov (United States)

    Reinking, Mark F

    2007-08-01

    Exercise related leg pain (ERLP) is a regional pain syndrome described as pain between the knee and ankle which occurs with exercise. Indiscriminant use of terminology such as "shin splints" has resulted in ongoing confusion regarding the pathoanatomic entities associated with this pain syndrome. Each of the pathoanatomic entities - medial tibial stress syndrome, chronic exertional compartment syndrome, tibial and fibular stress fractures, tendinopathy, nerve entrapment, and vascular pathology - which manifest as ERLP are each described in terms of relevant anatomy, epidemiology, clinical presentation, associated pathomechanics, and intervention strategies. Evidence regarding risk factors for ERLP general and specific pathoanatomic entities are presented in the context of models of sports injury prevention.

  11. Walk-Startup of a Two-Legged Walking Mechanism

    Science.gov (United States)

    Babković, Kalman; Nagy, László; Krklješ, Damir; Borovac, Branislav

    There is a growing interest towards humanoid robots. One of their most important characteristic is the two-legged motion - walk. Starting and stopping of humanoid robots introduce substantial delays. In this paper, the goal is to explore the possibility of using a short unbalanced state of the biped robot to quickly gain speed and achieve the steady state velocity during a period shorter than half of the single support phase. The proposed method is verified by simulation. Maintainig a steady state, balanced gait is not considered in this paper.

  12. Dynamic stability of running: The effects of speed and leg amputations on the maximal Lyapunov exponent

    Energy Technology Data Exchange (ETDEWEB)

    Look, Nicole [Department of Applied Mathematics, University of Colorado Boulder, Boulder, Colorado 80309 (United States); Arellano, Christopher J.; Grabowski, Alena M.; Kram, Rodger [Department of Integrative Physiology, University of Colorado Boulder, Boulder, Colorado 80309 (United States); McDermott, William J. [The Orthopedic Specialty Hospital, Murray, Utah 84107 (United States); Bradley, Elizabeth [Department of Computer Science, University of Colorado Boulder, Boulder, Colorado 80309, USA and Santa Fe Institute, Santa Fe, New Mexico 87501 (United States)

    2013-12-15

    In this paper, we study dynamic stability during running, focusing on the effects of speed, and the use of a leg prosthesis. We compute and compare the maximal Lyapunov exponents of kinematic time-series data from subjects with and without unilateral transtibial amputations running at a wide range of speeds. We find that the dynamics of the affected leg with the running-specific prosthesis are less stable than the dynamics of the unaffected leg and also less stable than the biological legs of the non-amputee runners. Surprisingly, we find that the center-of-mass dynamics of runners with two intact biological legs are slightly less stable than those of runners with amputations. Our results suggest that while leg asymmetries may be associated with instability, runners may compensate for this effect by increased control of their center-of-mass dynamics.

  13. Dynamic stability of running: The effects of speed and leg amputations on the maximal Lyapunov exponent

    International Nuclear Information System (INIS)

    Look, Nicole; Arellano, Christopher J.; Grabowski, Alena M.; Kram, Rodger; McDermott, William J.; Bradley, Elizabeth

    2013-01-01

    In this paper, we study dynamic stability during running, focusing on the effects of speed, and the use of a leg prosthesis. We compute and compare the maximal Lyapunov exponents of kinematic time-series data from subjects with and without unilateral transtibial amputations running at a wide range of speeds. We find that the dynamics of the affected leg with the running-specific prosthesis are less stable than the dynamics of the unaffected leg and also less stable than the biological legs of the non-amputee runners. Surprisingly, we find that the center-of-mass dynamics of runners with two intact biological legs are slightly less stable than those of runners with amputations. Our results suggest that while leg asymmetries may be associated with instability, runners may compensate for this effect by increased control of their center-of-mass dynamics

  14. Sleep-Related Leg Cramps: A Review and Suggestions for Future Research.

    Science.gov (United States)

    Brown, Terry M

    2015-09-01

    Various medications and behavioral treatments for sleep-related leg cramps have been tried, but the quality of the evidence is low. Quinine seems to be effective, but dangerous. β-Agonists may be one of the more common causes of secondary leg cramps. Statins may not be implicated in leg cramps as much as has been believed. Potassium-sparing diuretics may have a higher incidence of sleep-related leg cramps than potassium-depleting diuretics. Plantar flexion of the feet may elicit most sleep-related leg cramps. More research into behavioral treatments is needed. A standardized sleep-related leg cramp questionnaire would be useful to expand research. Copyright © 2015 Elsevier Inc. All rights reserved.

  15. Management of symptoms of Restless Legs Syndrome with use of a traction straight leg raise: a preliminary case series.

    Science.gov (United States)

    Dinkins, Eric M; Stevens-Lapsley, Jennifer

    2013-08-01

    Restless Legs Syndrome (RLS) is estimated to affect 5-15 percent of the U.S. population. There are few studies investigating non-pharmacological treatments for RLS, such as physical therapy and/or peripheral neural mobilization. The traction straight leg raise (tSLR) technique is one such mobilization that may affect central and peripheral neural pathways and reduce RLS symptoms. The purpose of this study is to determine the effects of a tSLR on the symptoms associated with RLS. A cohort of fifteen people was enrolled. Thirteen subjects (11 female) between the ages of 32-64 completed the study. Subjects completed two questionnaires to quantify their severity of RLS before treatment was initiated and at the final session. These measures included: the Restless Legs Syndrome Rating Scale (RLSRS) 0-40, an RLS Ordinal Scale, and a Global Rating of Change (GROC) assessments (-7, 0, +7). Patients were treated with tSLR bilaterally for four total visits on days 1, 3, 8, and 15. Results indicated an RLSRS pre-treatment average of 24.8 (severe) and post-treatment average of 9.2 (mild), representing a 63% improvement from baseline (p < 0.05). Ten of 13 subjects reported a GROC of +4 or higher at the final session, indicating at least a moderate improvement in patient status from baseline. Our results indicate that following a series of tSLR treatments symptoms were reduced in individuals with idiopathic RLS. A prospective, randomized controlled trial is necessary to evaluate the potential for a tSLR to effectively manage idiopathic RLS symptoms. Copyright © 2012 Elsevier Ltd. All rights reserved.

  16. Postural stability deficits during the transition from double-leg stance to single-leg stance in anterior cruciate ligament reconstructed subjects.

    Science.gov (United States)

    Dingenen, Bart; Janssens, Luc; Claes, Steven; Bellemans, Johan; Staes, Filip F

    2015-06-01

    The goal of this study was to evaluate postural stability during the transition from double-leg stance (DLS) to single-leg stance (SLS) in anterior cruciate ligament reconstructed (ACLR) (n=20) and non-injured control subjects (n=20). All ACLR subjects had fully returned to their pre-injury sport participation. Both groups were similar for age, gender, height, weight, body mass index and activity level. Spatiotemporal center of pressure outcomes of both legs of each subject were measured during the transition from DLS to SLS in eyes open and eyes closed conditions. Movement speed was standardized. The center of pressure displacement after a new stability point was reached during the SLS phase was significantly increased in the ACLR group compared to the control group in the eyes closed condition (P=.001). No significant different postural stability outcomes were found between the operated and non-operated legs. In conclusion, the ACLR group showed postural stability deficits, indicating that these persons may have a decreased ability to stabilize their body after the internal postural perturbation created by the transition from DLS to SLS. The non-operated leg may not be the best reference when evaluating postural stability of the operated leg after ACLR, as no differences were found between legs. Copyright © 2015 Elsevier B.V. All rights reserved.

  17. Frequent periodic leg movement during sleep is an unrecognized risk factor for progression of atrial fibrillation.

    Directory of Open Access Journals (Sweden)

    Mahek Mirza

    Full Text Available Sleep apnea has been recognized as a factor predisposing to atrial fibrillation recurrence and progression. The effect of other sleep-disturbing conditions on atrial fibrillation progression is not known. We sought to determine whether frequent periodic leg movement during sleep is a risk factor for progression of atrial fibrillation. In this retrospective study, patients with atrial fibrillation and a clinical suspicion of restless legs syndrome who were referred for polysomnography were divided into two groups based on severity of periodic leg movement during sleep: frequent (periodic movement index >35/h and infrequent (≤35/h. Progression of atrial fibrillation to persistent or permanent forms between the two groups was compared using Wilcoxon rank-sum test, chi-square tests and logistic regression analysis. Of 373 patients with atrial fibrillation (77% paroxysmal, 23% persistent, 108 (29% progressed to persistent or permanent atrial fibrillation during follow-up (median, 33 months; interquartile range, 16-50. Compared to patients with infrequent periodic leg movement during sleep (n=168, patients with frequent periodic leg movement during sleep (n=205 had a higher rate of atrial fibrillation progression (23% vs. 34%; p=0.01. Patients with frequent periodic leg movement during sleep were older and predominantly male; however, there were no significant differences at baseline in clinical factors that promote atrial fibrillation progression between both groups. On multivariate analysis, independent predictors of atrial fibrillation progression were persistent atrial fibrillation at baseline, female gender, hypertension and frequent periodic leg movement during sleep. In patients with frequent periodic leg movement during sleep, dopaminergic therapy for control of leg movements in patients with restless legs syndrome reduced risk of atrial fibrillation progression. Frequent leg movement during sleep in patients with restless legs syndrome is

  18. Vascular risk factors, cardiovascular disease and restless legs syndrome in men

    Science.gov (United States)

    Winter, Anke C.; Berger, Klaus; Glynn, Robert J; Buring, Julie E.; Gaziano, J. Michael; Schürks, Markus; Kurth, Tobias

    2012-01-01

    Background Prevalences of vascular risk factors, cardiovascular disease and restless legs syndrome increase with age. Prior studies analyzing the associations between vascular risk factors, cardiovascular disease, and restless legs syndrome found controversial results. We therefore aim to evaluate the association between prevalent vascular risk factors, prevalent cardiovascular disease and restless legs syndrome. Methods We conducted a cross-sectional study among 22,786 participants of the US Physicians’ Health Studies I and II. Restless legs syndrome was classified according to the four minimal diagnostic criteria. Vascular risk factors and restless legs syndrome symptoms were self-reported. Prevalent cardiovascular disease events including major cardiovascular disease, stroke and myocardial infarction were confirmed by medical record review. Age- and multivariable-adjusted logistic regression models were used to evaluate the association between vascular risk factors, prevalent cardiovascular disease events and restless legs syndrome. Results The mean age of the cohort 67.8 years. Restless legs syndrome prevalence was 7.5% and increased significantly with age. Diabetes significantly increased the odds (OR: 1.41, 95%CI: 1.21–1.65), while frequent exercise (OR: 0.78, 95%CI: 0.67–0.91) and alcohol consumption of one or more drinks per day (OR: 0.80, 95%CI: 0.69–0.92) significantly reduced the odds of restless legs syndrome in multivariable-adjusted models. Prevalent stroke showed an increased multivariable-adjusted OR of 1.40 (1.05–1.86) while men with prevalent myocardial infarction had a decreased OR of 0.73 (0.55–0.97) for restless legs syndrome. Conclusions The restless legs syndrome prevalence among US male physicians is similar to men of the same age group in other western countries. A history of diabetes is the most consistent risk factor associated with restless legs syndrome. Prevalent stroke and myocardial infarction are related to restless legs

  19. Component level study of an actively lubricated LEG Tilting Pad Bearing: Theory and experiment

    DEFF Research Database (Denmark)

    Cerda Varela, Alejandro Javier; Santos, Ilmar Ferreira

    2018-01-01

    This article constitutes the second step in a research effort aiming at evaluating the feasibility of introducing active characteristics into standard leading edge groove (LEG) tilting pad journal bearings. The strategy proposed is to control the LEG inlet flow using a servovalve. This work...... bearing design, validate the available simulation tool and exemplify on a conceptual level the operational benefits from introducing this technology into standard LEG Tilting Pad Bearings....

  20. Transfer Relation between the Compression Test Rig and the Anthropomorphic Test Device (ATD) Lower Leg

    Science.gov (United States)

    2015-08-01

    Transfer Relation between the Compression Test Rig and the Anthropomorphic Test Device (ATD) Lower Leg by Masayuki Sakamoto ARL-SR-0330...1138 ARL-SR-0330 August 2015 Transfer Relation between the Compression Test Rig and the Anthropomorphic Test Device (ATD) Lower Leg ...Relation between the Compression Test Rig and the Anthropomorphic Test Device (ATD) Lower Leg 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM