WorldWideScience

Sample records for le mali est

  1. Le CRDI au Mali

    International Development Research Centre (IDRC) Digital Library (Canada)

    de ces technologies et tentent de déterminer si un régime de microcrédit pourrait encourager leur adoption. On cherche par cela à accroître la sécurité alimentaire de même que le rendement des cultures de dolique, de sorgho et de mil. □ Menaces pesant sur les moyens de subsistance. Financement octroyé pour le Mali :.

  2. Mali

    African Journals Online (AJOL)

    sulaiman.adebowale

    25 août 2006 ... communal de Baye a réclamé le transfert dudit droit, tel que ... arrondissement portant son nom, est aussi le chef-lieu de la commune de ...... Framework with South Asian and West African Cases»,Journal of Developing.

  3. Mali.

    Science.gov (United States)

    1989-12-01

    Mali has an area of 474,764 square miles, the capital is Bamako with a population of 800,000 and the terrain is desert and savanna. The climate ranges from semitropical to arid and the total population is 7.6 million with a growth rate of 2.7%. The ethnic groups are Mande 50%, Peul 17%, Songhai 6%, Yuareg and Moor 5%, and the religions are Islam 90%, indigenous 9%, and Christian 1%. The languages are French and Bambara and the life expectancy is 47 years, with an infant mortality rate of 173/1,000. The labor force is 72% agriculture, industry and commerce 12%, and services 16%. The government is a republic with a constitution, president, national assembly and a supreme court. Agricultural products include millet, sorghum, corn, rice, livestock, sugar, cotton, and peanuts. They export cotton and cotton product, animals, fish, tannery products, and peanuts. In 1958 Soudan and Senegal joined together to form the Mali Federation which collapsed in 1960. Soudan then proclaimed itself the republic of Mali, which lasted until 1967. A military coup took over in 1968 and civilian rule did not return until 1974 when the constitution was approved. Mali is 1 of the 10 poorest nations in the world because it has not developed its mineral resources and agriculture exports. Mali receives much foreign aid from nations around the world including China, US, and the Soviet Union.

  4. Le bonheur est dans les airs

    OpenAIRE

    Robène, Luc; Bodin, Dominique; Héas, Stéphane

    2010-01-01

    A partir des années 1880, en France, la dimension touristique des ascensions en ballon prend une importance croissante. En marge des pratiques strictement utilitaires de l'aérostation s’élabore un univers davantage tourné vers la communion et / ou vers le face-à-face de l'homme avec la nature en altitude. L'observation du milieu aérien, la confrontation avec la sauvagerie des éléments et le bien-être que l'environnement vierge des hauteurs est susceptible de procurer aux aéronautes constituen...

  5. Le salaire minimum n'est pas toujours le meilleur moyen d'accroître ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    4 mai 2016 ... De fait, cette intervention vigoureuse sur le marché du travail est une ... la mobilité des travailleurs entre le secteur structuré et le secteur non structuré, ... On peut certes se constituer rapidement du capital politique en faisant ...

  6. De quoi le genre est-il le nom ?

    OpenAIRE

    Andrieu, Bernard

    2013-01-01

    Cette note de lecture présente une courte évolution des travaux sur le genre sous l’angle du rapport au corps en démontrant comment la dénaturalisation du corps et du sexe biologique a conduit à une description culturaliste des fonctions individuelles et des rôles sociaux. Si le genre dénaturalise le corps c’est en refusant toute référence au sexe ou à la sexualité en tant qu’ils seraient des données naturelles. Depuis son apparition en 1947, sous la plume de John Money, psychologue chargé du...

  7. Heaven on Earth? The development of tourism in the Dogon Country and the Hombori Mountains (Mali Le Paradis sur Terre ? Le développement du tourisme au Pays Dogon et dans les Monts Hombori (Mali

    Directory of Open Access Journals (Sweden)

    Olivier Walther

    2008-10-01

    Full Text Available Cet article étudie le développement touristique inégal de deux destinations touristiques du Mali: le Pays Dogon, un must du marché touristique ouest-africain, et les Monts Hombori, considérés comme un « paradis sur Terre » en raison de leur exceptionnelle biodiversité. En s’appuyant sur les travaux de Butler (1980, nos travaux suggèrent que ces lieux touristiques se situent à des stades très différents de leur cycle de vie touristique. Au Pays Dogon, l’intérêt constant manifesté par les anthropologues depuis les années 1930 a conduit au classement du site au Patrimoine de l’Humanité. Rien de tel à Hombori, où les amateurs de tourisme de montagne contemporains peuvent être considérés comme les pionniers de cette destination.This paper studies the unequal development of two tourist destinations in Mali: Dogon Country, a well-established tourist market area, and the Hombori Mountains, considered as a kind of “heaven on earth” due to their preserved biological biodiversity. Building on Butler’s destination life cycle model (1980, our research suggests Dogon Country benefits from a considerable, long-term advantage in terms of image, which has led to its inclusion within UNESCO’s World Heritage List. The situation is totally different in the Hombori Mountains where current mountain tourists can be considered as the trailblazers for this particular destination.

  8. Recherche sur le paranormal et croyances irrationnelles: quel est le lien?

    Directory of Open Access Journals (Sweden)

    Marie-Catherine Mousseau

    2005-06-01

    Full Text Available A la fin du 19ième siècle, les phénomènes paranormaux étaient couramment étudiés et débattus par les scientifiques les plus renommés (l'astronome Camille Flammarion, les physiciens William Crook et Oliver Lodge, les prix Nobel Charles Richet, Pierre et Marie Curie, .... Les débats étaient intenses et de haut niveau. Leurs travaux étaient généralement publiés dans des journaux prestigieux. Ce champ d'étude était appelé 'métapsychique'. Aujourd'hui, les questions qu'ils avaient soulevées sont complètement ignorées par la communauté scientifique. Ses représentants prétendent que le débat est clos et le considèrent démodé et ridicule. C'est devenu une sorte de 'tabou', 'un des plus puissants interdits des temps modernes'.

  9. Accouchement gémellaire en milieu africain: une analyse de 10 ans dans le district de Bamako au Mali

    Science.gov (United States)

    Théra, Tiounkani; Mounkoro, Niani; Traore, Soumana Omar; Hamidou, Albachar; Traore, Mamadou; Doumbia, Saleck; Tall, Saoudatou; Kouma, Aminata

    2018-01-01

    Introduction Le but de cette étude était de déterminer les facteurs influençant le pronostic de l'accouchement du deuxième jumeau. Méthodes L'étude était rétrospective et a porté sur tous les cas d'accouchements gémellaires enregistrés à la maternité du Centre de Santé de Référence de la commune V du District de Bamako du 1erJanvier 2007 au 31 Décembre 2016 soit sur une période de dix ans. Résultats Nous avons enregistré 34.899 accouchements dont 1374 accouchements gémellaires soit une fréquence de 2,54%; près de 15% étaient des primipares; 39,16% étaient référées; 69,10% et 15,5% autres sans aucun suivi prénatal. Les facteurs influençant négativement pronostic du deuxième jumeau étaient: un délai ≥ 15minutes entre les jumeaux, le recours tardif à la césarienne, la non qualification de l'accoucheur, la grossesse monochoréale, le faible poids de naissance. Par contre la parité, la réalisation de manœuvres obstétricales n'avaient aucune influence sur le pronostic du deuxième jumeau. Conclusion Le pronostic du deuxième jumeau est fortement influencé par un délai de naissance de plus de 15 minutes entre les jumeaux, les autres facteurs agissant comme des cofacteurs. PMID:29662606

  10. Le big bang n'est pas une théorie comme les autres

    CERN Document Server

    Bonnet-Bidaud, Jean-Marc; Leglu, Dominique; Reinisch, Gilbert

    2009-01-01

    Le big bang n'est pas une théorie comme les autres. Ce n'est d'ailleurs pas une théorie physique au sens propre du terme, mais un scénario cosmologique issu des équations de la relativité générale. Il est le modèle qui s'ajuste le mieux aux observations actuelles, mais à quel prix ? Il nous livre un Univers composé à 96 % de matière et d'énergie noires inconnues. C'est donc un euphémisme que de dire que le big bang semble poser autant - sinon plus - de questions qu'il n'en résout. En ce sens, le big bang apparaît davantage comme une paramétrisation de notre ignorance plutôt que comme une modélisation d'un phénomène. Pourtant, le succès du big bang et l'adhésion qu'il suscite, tant dans la sphère scientifique que dans la sphère médiatique, ne se démentent pas. Surmédiatisé, son statut dépasse celui de modèle théorique, et la simple évocation de son nom suffit pour justifier des opérations de marketing scientifique ou rejeter des cosmologies alternatives. Pour éclaircir les pr...

  11. L’interface Habitat / Habitant : quand le lieu de vie est porteur de maladie - Le cas du radon en PACA

    Directory of Open Access Journals (Sweden)

    Cissé E.

    2012-10-01

    Full Text Available Les préoccupations sont croissantes pour étudier les liens entre des conditions environnementales spécifiques et la fréquence de certaines pathologies. Nous proposons d’analyser ici le lien présupposé entre une exposition au radon et le cancer du poumon. Le radon, est un gaz radioactif d’origine naturelle (issu de la désintégration naturelle de l’uranium présent dans la croûte terrestre et plus particulièrement dans certaines formations géologiques. A partir du sol et de l’eau, le radon se diffuse dans l’air (exhalation et se trouve, par effet de confinement, à des concentrations plus élevées à l’intérieur des bâtiments qu’à l’extérieur. Les descendants solides du radon sont alors inhalés avec l’air respiré et se déposent dans le poumon. Il est établi par diverses études scientifiques que le radon a un impact non négligeable sur certains cancers, notamment du poumon (augmentation de 16 % du risque de cancer du poumon par tranche de 100 Bq/m3, et des cancers digestifs via la consommation d’eau qui s’est chargée en radon au contact du socle. Le nombre annuel de décès par cancer du poumon attribuable à l’exposition domestique au radon en France métropolitaine varie entre 1 200 à 3 575 en fonction des relations exposition-réponse utilisées. Plusieurs régions en France se caractérisent par une problématique radon reconnue et étudiée depuis longtemps (Bretagne, Massif central, Corse. Or, si le radon ne recouvre pas l’ensemble de la région PACA, certaines zones géographiques sont particulièrement concernées et méritent d’être étudiées : le Massif des Maures dans le Var, du Mercantour dans les Alpes-Maritimes et du Briançonnais dans les Hautes-Alpes. La région PACA est une des régions de France et d’Europe les plus touchées par la pollution atmosphérique principalement due à l’augmentation du trafic routier et des contributions de régions industrialisées telles que

  12. Et le pouce, où est-il, qui montrera vers le ciel? (Sonnet XXXII

    Directory of Open Access Journals (Sweden)

    Miha Pintarič

    2012-12-01

    Full Text Available Lʼarticle soumet à une brève analyse les Sonnets romains dʼAndrej Capuder, homme de politique, diplomate, professeur dʼuniversité, écrivain, traducteur et poète. Le passé et le souvenir mélancolique de lʼamour de jeunesse, lʼavenir et la rencontre prochaine avec Dieu, entre lʼun et lʼautre, tant de choses si terrestres, tantôt jugées avec sévérité, tantôt tolérées et tantôt même rendues complices.

  13. Les arbres fruitiers sahéliens dans l'économie rurale; Cas du Burkina Faso et du Mali

    NARCIS (Netherlands)

    Kuhlman, J.W.; Coulibaly, K.; Yago, E.L.; Michels, R.; Berg, van den J.

    2010-01-01

    Ce document est le compte-rendu d’une enquête réalisée dans neuf villages au Mali et au Burkina Faso sur l’importance des fruits et d’autres produits provenant des arbres fruitiers indigènes. Ces arbres font partie du paysage agricole de la savane ouest-africaine. L’étude porte sur lele de ces

  14. Non est hic. Le cas exemplaire de la protection du fugitif

    Directory of Open Access Journals (Sweden)

    Jean-Pierre Cavaillé

    2007-06-01

    Full Text Available Le cas dont je voudrais ici esquisser l’histoire et montrer quelques uns des enjeux, est surtout, sinon exclusivement connu, aujourd’hui encore, dans la version proposée par Benjamin Constant pour mettre en évidence une conséquence nécessaire et selon lui inacceptable de la morale kantienne. Constant en effet écrit, dans ces Réactions politiques, publiées en 1797 : Le principe moral […] que dire la vérité est un devoir, s’il était pris d’une manière absolue et isolée, rendrait toute société i...

  15. Baisse de la transmission de la douve du foie dans le nord-est de la ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    mortelle de cancer du foie liée à l'O. viverrini. Dans cer- taines régions, près de 85 % de la population est porteuse du parasite. Les villages du nord-est de la Thaïlande, où l'on raffole du poisson cru, ont des taux d'infection parmi les plus élevés du pays. Les personnes infectées peuvent porter le parasite adulte pendant ...

  16. Le succès est relatif — Wara Alderete | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    26 janv. 2011 ... Les groupes de défense des droits de la personne estiment maintenant que jusqu'à 30 000 personnes – dont plus de 20 % étaient des étudiants – ont pu être torturées et tuées au cours de la « sale guerre ». « Ce furent des persécutions massives. Le chaos s'est installé, se rappelle Wara. Ma sécurité était ...

  17. Le criquet du Mato Grosso : l'agriculture est-elle responsable ?

    Directory of Open Access Journals (Sweden)

    Lecoq, M.

    1995-01-01

    Full Text Available Le criquet du Mato Grosso : l'agriculture est-elle responsable ?. Investigations through bibliographical references and among the local population provided a collection of documents and evidences showing without any doubt that Rhammatocerus schistocercoides (ReHN, 1906 [Orth. Acrididae Gomphocerinae] outbreaks in Mato Grosso (Brazil are not a new event neither by nature nor by magnitude. Therefore, the present conception on the origin of those outbreaks need to be drastically revised. The previous hypotheses, implying an overrated agricultural development of concerned areas since 1980, must then be rejected.

  18. Qu'est-ce que le boson de Higgs mange en hiver et autres détails essentiels

    CERN Document Server

    Gagnon, Pauline

    2015-01-01

    Juillet 2012 : le CERN, le Laboratoire européen de la physique des particules, annonçait en grande pompe la découverte du boson de Higgs. La nouvelle a fait le tour du monde. Mais combien de gens comprennent vraiment ce que c'est et pourquoi cette découverte fut suivie du prix Nobel de physique en 2013 pour les théoriciens François Englert et Peter Higgs qui en avaient prédit l'existence 48 ans auparavant ? Le boson de Higgs était le chaînon manquant du modèle théorique actuel qui décrit ce qui compose toute la matière qu'on voit autour de nous. Ce livre explique comment tout cela fonctionne et lele du boson de Higgs. Et le livre va beaucoup plus loin car cette théorie ne s'applique qu'à la matière visible, celle qu'on trouve sur Terre, dans les étoiles et les galaxies, mais qui ne compte que pour 5 % du contenu de l'Univers. Le reste, soit 95 % de l'Univers, consiste en « matière sombre » et en « énergie sombre », deux entités complètement inconnues. Quelle est donc cette mystér...

  19. Déchets nucléaires : où est le problème ?

    CERN Document Server

    Sorin, Francis

    2015-01-01

    Faut-il avoir peur des déchets nucléaires ? Sont-ils vraiment, comme le pense une partie du public, ce fardeau empoisonné ingérable faisant peser une menace fatale sur nous-mêmes et sur nos descendants ? Ou sont-ils au contraire, comme l'estime la grande majorité des scientifiques, des résidus que l'on sait fort bien conditionner et mettre hors d'état de nuire ? Entre le public inquiet et les ingénieurs rassurants, comment comprendre l'immense décalage des attitudes ? Et comment, face à ces déchets laissés en héritage, faire la part des choses entre ceux qui dénoncent "un crime contre les générations futures" et ceux qui jugent "la difficulté résolue" ? Bref, "Où est le problème ?" Sans craindre de bousculer bien des idées reçues mais sans méconnaître les risques encourus, Francis Sorin éclaire ici en quelques chapitres percutants les problèmes et les solutions liés à la gestion de ces déchets en France. II s'attache particulièrement au devenir des déchets de haute activité et...

  20. Le dessalement de l’eau de mer est-il une voie d’avenir?

    Directory of Open Access Journals (Sweden)

    Jean-Noël Salomon

    2012-06-01

    Full Text Available La pénurie en eau semble devenir une perspective inquiétante pour l’humanité. Aujourd’hui les pays en situation de stress hydrique sont de plus en plus nombreux tandis que les besoins ne cessent de grandir. Face à ce constat, nombre de solutions techniques ont été apportées dont celle du dessalement de l’eau de mer. Cette activité est en pleine expansion du fait d’une amélioration constante des techniques et d’un coût de plus en plus réduit. Déjà le dessalement représente la principale source d’eau potable pour un grand nombre de pays (îles, pays à climat désertique ou subdésertique, etc.. Mais, ce coût restant encore bien supérieur à celui des autres modes d’alimentation, cette technique reste réservée à des États ayant des ressources financières et énergétiques consistantes (Moyen Orient, pays développés, ce qui limite les possibilités. L’avenir du dessalement doit également prendre en compte ses effets sur l’environnement car de plus en plus d’études en montrent les effets pervers et …coûteux. Cet article entend faire le point et attirer l’attention sur l’ensemble de cette technique qui offre une alternative intéressante au spectre de la pénurie d’eau annoncée par bien des médias dans le contexte du réchauffement climatique.

  1. Croissance de Auchenoglanis occidentalis (Pisces, Claroteidae dans le Delta Central du Niger (Mali, Afrique de l'ouest

    Directory of Open Access Journals (Sweden)

    Niaré, T.

    2013-01-01

    Full Text Available Growth of Auchenoglanis occidentalis (Pisces, Claroteidae in the Central Delta of Niger River Flood Plain (Mali, West Africa. Growth biology of Auchenoglanis occidentalis (Valenciennes, 1840 is studied from individuals monthly sampled on two different annual cycles (1991 and 1997 in the fishing port of Mopti. Individual age of fishes was determined by squelettochronology. Chronological follow-up of relative margin diameter (dr of spine ray section was used for validation of the periodicity of annulus formation. Only one annulus is formed annually. Period of growth recovery shows an individual variability with an early starting up from the lowwater level, in May. The seasonal cycle of growth of this benthic fish, A. occidentalis, depends more on the availability of the trophic resources than of abiotic factors. However, the optimal period of growth always remains the high-water one in this river with flood plain. Fishes condition factor's varies between 1.97±0.27 à 2.57±0.41. Year x season interaction affects this parameter. Growth realized during the first year (189.17±4.57 and 261.25±12.19 mm as well as the later growths depend on hydrological conditions and are influenced by fishing pressure. Presence of 3+ age class fishes shows that demographic structure is not qualitatively modified despite changes arisen in the Delta.

  2. Voir tous les projets | Page 2 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Région(s): Guyana, West Indies, Saint Kitts and Nevis, Saint Lucia, Trinidad and Tobago. Financement total : CA$ 5,000,000.00. Agroforesterie et alimentation des moutons au Mali. Projet. L'élevage du mouton joue un rôle de premier plan pour ce qui est d'assurer la subsistance des ménages vivant en milieu rural au Mali ...

  3. Pourquoi le Grundgedanke (T. 4.0312 de Wittgenstein est si “Fondamental”?

    Directory of Open Access Journals (Sweden)

    André Leclerc

    1998-12-01

    Full Text Available La pensée fondamentale de Wittgenstein affirme que les constantes logiques ne représentent pas, ne fonctionnent pas sémantiquement comme des noms. En apparence triviale, cette pensée, nous le montrerons, à des ramifications étonnantes dans la philosophie du premier Wittgenstein, en particulier en ce qui concerne sa conception de la logique. Notre but est d'interpréter l'aphorisme en question (T. 4.0312 en montrant comment il se rapporte aux thèses et théories les plus importantes du Tractatus, et comment il permet de les faire tenir ensemble d'une façon cohérente, justifiant par là son caractère "fondamental". Nous tentons également d'apporter une réponse aux questions suivantes : les propositions complexes sont-elles encore - comme les propositions atomiques - des "images" de la réalité ? et quelle est cette "logique des faits" dont parle Wittgenstein dans l'aphorisme sous examen ?

  4. Le Prix mondial de l'alimentation est décerné à un ancien boursier ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    26 mai 2016 ... M. Hillel est chercheur principal au Center for Climate Systems Research, qui relève de l'Earth Institute de l'Université Columbia, et travaille avec le NASA Goddard Institute for Space Studies. Il a oeuvré par le passé avec de nombreux organismes de développement international et s'était vu octroyer une ...

  5. Le fascisme, c’est du théâtre. Macchina scenica e meccanica narrativa

    Directory of Open Access Journals (Sweden)

    Emanuele Canzaniello

    2015-11-01

    Full Text Available «Le fascisme, c’est du théâtre», sostiene Jean Genet, e come tale i suoi legami con la natura e la prassi della messa in scena sono essenziali alla specificità del fenomeno. La resa spettacolare della nazionalizzazione delle masse è stata senz’altro tra i temi fondamentali della ricerca sui totalitarismi. Il mio proposito è qui quello di intarsiare alcuni nuclei consolidati della ricerca storica con le rese squisitamente letterarie di quello che fu poco più che un  decennio di immensi tableaux vivants, visioni di un nuovo ordine di massa. Un’opera d’arte collettiva, basata su una premessa  fondamentale: dare “figurabilità” ai detriti e alle rovine (rimosse? di alcuni miti delle origini propri della cultura romantica, e  consapevolmente avviare e mettere in luce un enorme processo più generale di disgregazione del logos e di tutta la civiltà europea nella sua prospettiva diremo cartesiana, geometrica e razionalista. Il mio discorso si fonda, anche se in breve, su un testo solo: la Gerbe des forces (1937 di A. de Châteaubriant, uno dei più singolari resoconti di pellegrinaggio politico verso il miraggio totalitario che si sia dato tre le due guerre mondiali. Soccorsi non secondari sono il saggio di Sontag Under the sign of Saturn (1980 e quello di Tame La Mystique du Fascisme dans l’oeuvre de Robert Brasillach (1986. According to Jean Genet: «Le fascisme, c’est du théâtre», and as such its relationship with the nature and praxis of staging are essential to the specificity of the phenomenon. The magnificent representation of mass nationalisation is beyond doubt one of the fundamental issues when investigating totalitarianisms. My aim here is to link some wellestablished nuclei of historical research to the literary outputs of what was little more than a decade of immense tableaux vivants, visions of a new mass order. A collective work of art, based on a fundamental premise: to give ‘figurality’ to the rubble

  6. La guerre contre les drogues illicites : Est-ce qu’elle est perdue ? - Has the war against drugs been lost ? - La guerra contro le droghe è persa ?

    Directory of Open Access Journals (Sweden)

    Dominick M.

    2009-08-01

    Full Text Available Le système légal du Mexique est dans un état de ruine à cause des cartels de la drogue soutenus et subventionnés par les États-Unis d'Amerique. En effet, les États-Unis sont le marché principal de la marijuana, de la cocaine et, en moindre quantité, des drogues synthétiques provénantes du Mexique. L’article met en évidence que les régions frontalières du Mexique sont pris en otage entre d’une part, les principaux producteurs mondiaux de coca et d’autre part, les principaux consommateurs (de l’Amerique du Nord et de l’Europe. Pour cela, l’avis de l’autrice et de son collaborateur est que le Mexique ne peut résoudre seul les problèmes liés au narcotrafique. The Mexican legal system is in a state of ruin because of illegal drug cartels supported, sustained and subsidized by the United States of America. It is the U.S. which is the market for marijuana, cocaine and to a lesser extent synthetic drugs trafficked through Mexico. This article evidences that especially the frontier regions of Mexico have been taken hostage between, on the one hand, the principal world producers of cocaine and, on the other hand, the principal consumers (from North America and from Europe. Accordingly, it is the view of the author and her collaborator that Mexico cannot resolve in isolation the problems involved in narco-trafficking.Il sistema legale messicano versa in uno stato disastroso a causa dei cartelli della droga sostenuti e sovvenzionati dagli Stati Uniti d’America. Infatti, gli USA rappresentano il principale mercato della marijuana, della cocaina e delle droghe sintetiche (queste ultime in misura minore provenienti dal Messico. L’articolo mette in evidenza che le regioni frontaliere del Messico sono prese in ostaggio, da una parte, dai principali produttori modiali di cocaina e, dall’altra, dai principali consumatori (che si trovano nell’America del Nord ed in Europa. Pertanto, secondo l’autrice ed il suo collaboratore

  7. Association entre le travail par quarts et l’obésité chez les hommes dans le nord-est de l’Ontario

    Directory of Open Access Journals (Sweden)

    Anne Grundy

    2017-01-01

    Full Text Available Introduction : Même si certaines études suggèrent une association entre le travail par quarts et l’obésité, peu sont fondées sur la population ou tiennent compte de divers horaires de travail par quarts. L’obésité étant associée à plusieurs problèmes de santé chroniques, il est important de comprendre quelles formes de travail par quarts ont une incidence sur elle et d’effectuer des travaux permettant d’évaluer de façon plus détaillée l’exposition au travail par quarts. Méthodologie : Au moyen d’une régression logistique polytomique multivariée, nous avons étudié l’association entre le travail par quarts (de soir ou nuit, par quarts ou autre type de rotation et le surpoids et l’obésité, en fonction d’une mesure transversale de l’indice de masse corporelle chez 1 561 hommes. Ces hommes avaient déjà servi de témoins dans une étude cas-témoins sur le cancer de la prostate menée dans le nord-est de l’Ontario de 1995 à 1999. Nous avons obtenu l’information sur leurs antécédents de travail (notamment sur le travail par quarts, leur taille et leur poids à partir de données autodéclarées recueillies par questionnaire. Résultats : Nous avons observé une association entre le fait d’avoir déjà travaillé par quarts (par opposition au fait de n’avoir jamais travaillé par quarts et le surpoids (RC [rapport de cotes] = 1,34; IC [intervalle de confiance] à 95 % : 1,05 à 1,73 ainsi que l’obésité (RC = 1,57; IC à 95 % : 1,12 à 2,21. Nous avons également observé des associations statistiquement non significatives avec le fait d’avoir déjà travaillé (par opposition au fait de n’avoir jamais travaillé de façon permanente selon un quart de soir ou de nuit. Nous avons par ailleurs observé une tendance à la hausse statistiquement significative en ce qui concerne le risque de surpoids et d’obésité en fonction de la durée du travail par quarts. Conclusion : Tant l

  8. Is the cooling of coils of pulsed accelerators profitable?; Le refroidissement des bobines des accelerateurs pulses est-il avantageux?

    Energy Technology Data Exchange (ETDEWEB)

    Neyret, G.; Parain, J.; Schnuriger, J. C.

    1960-05-15

    In this report, the authors recall how metal resistivity decreases at low temperatures, and give some indications about the power and price of cryogenic installations. They report the study of the cooling of coils in accelerators displaying an alternate gradient with a 15 GeV energy, with or without a magnetic circuit in iron. They establish that cooling does not result in a decrease in the cost price for an hour of operation. They also state that it is not even sure that this cooling would result in a dimension reduction while increasing the maximum achievable induction [French] On rappelle comment la resistivite des metaux diminue aux basses temperatures, et on donne des indications sur la puissance et le prix des installations cryogeniques. On etudie le refroidissement des bobines d'accelerateurs a gradient alterne d'une energie de 15 GeV, avec ou sans circuit magnetique en fer; on trouve que le refroidissement ne permet pas de diminuer le prix de revient de l'heure de fonctionnement; il n'est meme pas sur qu'il puisse permettre de reduire les dimensions en elevant l'induction maximum realisable. L'idee de refroidir les bobines sans fer jusqu'a la temperature de l'air liquide est ancienne: Jean Perrin des 1907, puis Charly Fabry en 1910 l'avaient deja proposee. Recemment, cette idee est revenue a l'actualite: en 1958, R.F. Post a suggere de l'appliquer a la production de champs intenses en vue du confinement des plasmas thermonucleaires; en 1959, N.C. Christofilos a publie un projet d'accelerateur refroidi a 80 deg. K. Nous voulons examiner l'interet de refroidir les bobines d'un accelerateur, d'une part pour augmenter l'induction maximum (dans le cas de machines sans fer) et d'autre part pour diminuer l'importance de l'alimentation electrique. Cet examen est precede de generalites sur le refroidissement des bobines, generalites qui s'appliquent d'ailleurs a tous les champs magnetiques. Les trois metaux etudies sont ceux retenus comme les meilleurs par Post: le

  9. Le succès est relatif — Wara Alderete | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    26 janv. 2011 ... L'Argentine tarde à ratifier la Convention-cadre pour la lutte anti-tabac (CCLAT) de l'Organisation mondiale de la santé, qui impose aux gouvernements qui la ratifient de prendre de véritables mesures de lutte contre le tabagisme, dont de nouvelles lois et des mesures relatives aux prix, d'investir dans ...

  10. En Afrique, l'avenir est mobile | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    25 janv. 2011 ... Dans les pays industrialisés, les assistants numériques personnels (ANP) servent souvent à la gestion d'agenda, mais des chercheurs financés par le CRDI démontrent que les ANP sans fil peuvent contribuer à améliorer la prestation des soins en Afrique. « Commençons à considérer les ANP comme des ...

  11. Et le gagnant est... Brendan Baker en entrevue | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2 févr. 2011 ... lancé par le CRDI dans la période menant au troisième Forum urbain mondial. ... Après avoir obtenu mon diplôme universitaire, je me suis engagé pour une affectation de longue durée avec Ingénieurs sans frontières, qui m'a envoyé au Sénégal afin de participer à un projet de transformation des noix de ...

  12. Il est temps que le Canada rende la justice accessible à tous | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    école ou qu'on exclut une personne d'un hôpital, les médias ne perdent pas de temps à exposer l'injustice. La privation de soins de santé ou de scolarisation est impensable pour la plupart des Canadiens; pourtant, l'accès à ...

  13. Le boom du raffinage en Asie du Sud-Est Refinery Boom in Southeast Asia

    Directory of Open Access Journals (Sweden)

    Gruson J. F.

    2006-11-01

    Full Text Available Le marché pétrolier connaît en Asie un développement rapide, principalement dans la zone non OCDE, qui représente aujourd'hui plus de 15 % de la consommation pétrolière mondiale. La croissance économique attendue dans ces pays devrait porter cette part à plus de 25 % d'ici 2010, soit une hausse de la demande de 5,4% par an, principalement dans le secteur des transports. Les investissements qui en découlent pour l'industrie du raffinage régionale sont très élevés (des évaluations les chiffrent à près de 140 milliards de dollars, d'autant plus que la protection de l'environnement commence à prendre une importance significative. Dès lors, le défit majeur de ces pays sera d'assurer les financements nécessaires pour augmenter la capacité de raffinage (un quasi-doublement et l'adapter au poids croissant de l'essence et des distillats moyens dans la demande. La participation d'opérateurs privés apparaît essentielle, mais dépendra fortement du redressement des marges de raffinage et de la réalité de l'ouverture des marchés pétroliers nationaux annoncée par les pouvoirs publics. The Asia demand for oil is increasing dramatically, particularly in the non OECD countries, which represent, today more than 15% of the word oil market. The expected economic growth in these areas should contribute to a rise in oil demand by about 5. 4 per year and hence to a significant increase of this share to 25% in 2010; virtually a large part of this evolution will come from the transportation sector. The proceeding investments of the regional, refining industry are very high (some evaluations come to around 140 billions of dollars, all the more the protection of the environment takes an increasing significant place. Accordingly the most important challenge to be taken up by these countries will be to mobilize long term fundings to develop and adapt the capabilities of the refineries to meet the growth of gasoline and gasoil demand. The

  14. Le détritisme carbonate profond dans le Crétacé inférieur du Sud-Est français. Ses rapports avec l'eustatisme

    OpenAIRE

    Ferry , Serge

    1987-01-01

    Mémoire HS n° 13 - Géologie Alpine : Le détritisme dans le Sud-Est de la France - Colloque Association des Géologues du Sud-est - Grenoble 11-12 décembre 1986; 10 cycles eustatiques sont définis dans le Crétacé inférieur du Sud-Est français. Sur les plates-formes carbonatées, ils correspondent aux principales séquences "klupféliennes" de comblement, pour lesquelles le moteur tectonique (à-coups de subsidence) est mis en doute. Ces cycles ne sont repérables dans les séries de bassin que si l'a...

  15. RIEN N’EST FIXE: L’EXPÉRIENCE-NIETZSCHE ET LE QUOTIDIEN ÉDUCATIONNEL

    Directory of Open Access Journals (Sweden)

    Luciano Bedin da Costa

    2011-12-01

    Full Text Available Cet article est une lecture du quotidienne éducationnel par la philosophie de riedrich Nietzsche (1844-1900 avec des concepts tels quels : expérience, nihilisme, ressentiment, mauvaise conscience, force et de la volonté de puissance. La théorie de Nietzsche est utilisé comme un outil de réflexion sur les pratiques quotidiennes vécu dans l'éducation, de rompre avec l'inertie du discours des pleurs et nihiliste. Ce que nous appelons l'expérience de Nietzsche implique un autre regard, une grande santé et une éthique pour une évasion de la cristallisation et production des différences. MOTS-CLÉS : expérience; Nietzsche, nihilisme, formation, volonté de puissance

  16. L'Inde : où est le milieu ? | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    1 avr. 2011 ... Des entrepreneurs futés, favorisés par les réformes économiques opérées au début des années 1990, ont tiré parti des nouveaux débouchés sur les ... À long terme toutefois, M. Mazumdar est d'avis qu'il s'agit d'un encouragement manifeste à privilégier l'expansion horizontale plutôt que verticale. S'il était ...

  17. La redécouverte du droit : le trajet parcouru

    NARCIS (Netherlands)

    Hesseling, G.S.C.M.; Oomen, B.M.

    2005-01-01

    Au Mali, l'année 1991 marque la fin du régime autoritaire de la IIe République et le début d'une ère plus démocratique. En février 1993 est votée la loi-cadre sur la décentralisation. Au moment où, en 2001, les premiers juristes commencent leur aventure de recherche - qui aboutira à l'ouvrage

  18. Un proverbe comme 'conservatoire botanique' : le sésame en pays soninké (Sénégal, Mali, Mauritanie)

    OpenAIRE

    Chastanet, Monique

    2013-01-01

    A partir d'un proverbe soninké recueilli dans le haut Sénégal, j'ai reconstitué l'histoire d'une ancienne ressource, agricole et de cueillette. Il m'a fallu plusieurs années pour identifier la plante citée dans ce proverbe car elle n'était plus cultivée depuis le milieu du 20e siècle. J'ai pu le faire en croisant sources orales et sources écrites, notamment des archives du 18e et du 19e siècle. Une fois mise sur la piste du sésame, grâce à de nouvelles enquêtes et à différents travaux, j'ai c...

  19. Solar electricity for Mali

    Energy Technology Data Exchange (ETDEWEB)

    Naehr, Catrin [SMA Corporate Communication, Niestetal (Germany)

    2013-10-01

    Eight off-grid PV power plants that supply households, schools and smaller businesses in southern Mali villages with electricity not only boost the rural electrification but also the local economy in the crisis-ridden country. (orig.)

  20. LES VARIANTES LEXICALES POUR LE MOT ESPADRILLES AU PARANÁ ET DANS LA RÉGION NORD-EST DU BRÉSIL: UNE ETUDE ETHNOLINGUISTIQUE

    Directory of Open Access Journals (Sweden)

    Maranúbia Pereira Barbosa Doiron

    2014-03-01

    Full Text Available : Cette étude concerne les variantes lexicales pour le mot espadrilles dans l’Etat du Paraná et dans la région Nord-Est du Brésil, sous un regard ethnolinguistique. Le corpus est composé par les donnés obtenues à partir de la question numéro 276 du Questionnaire Semantique-Lexical de l’Atlas Linguistique du Paraná (ALPR, dont l’auteur est le professeur Vanderci de Andrade Aguilera (1994, de l’Université de l’Etat de Londrina, autant que les variantes lexicales pour le mot espadrilles trouvées dans deux ouvrages littéraires d’auteurs originaires du Nord-Est du Brésil – Fogo Morto, de José Lins do Rego (2009 et Vidas Secas, de Graciliano Ramos (1969. Dans ces livres, les espadrilles jouent un rôle fondamental, tout en reflétant son importance dans le vestiaire de cette région, du moins jusqu’à moitié du XXème siècle. On rechercha des éventuelles ressemblances ou différences existentes entre les variantes lexicales de la chaussure mentionnée par les informateurs “paranaenses” et le modèle cité dans les ouvrages des écrivains Rego et Ramos. Dans les deuxs sources – la linguistique et la littéraire – on privilégia l’analyse semantique des unités lexicales et le contexte dans lequel elles ont été enregistrées. L’étude démontra que l’unité lexicale espadrilles et ses variantes phonétiques similaires dans les deux corpora, aussi que les variantes lexicales populaires présentes dans l’Atlas Linguistique du Paraná (ALPR. En dépit des simitudes l’esthétique et la fonction des espadrilles ne sont pas les mêmes dans les localitées concernées.

  1. LES VARIANTES LEXICALES POUR LE MOT ESPADRILLES AU PARANÁ ET DANS LA RÉGION NORD-EST DU BRÉSIL: UNE ETUDE ETHNOLINGUISTIQUE

    Directory of Open Access Journals (Sweden)

    Vanderci de Andrade AGUILERA

    2013-12-01

    Full Text Available Cette étude concerne les variantes lexicales pour le mot espadrilles dans l’Etat du Paraná et dans la région Nord-Est du Brésil, sous un regard ethnolinguistique. Le corpus est composé par les donnés obtenues à partir de la question numéro 276 du Questionnaire Semantique-Lexical de l’Atlas Linguistique du Paraná (ALPR, dont l’auteur est le professeur Vanderci de Andrade Aguilera (1994, de l’Université de l’Etat de Londrina, autant que les variantes lexicales pour le mot espadrilles trouvées dans deux ouvrages littéraires d’auteurs originaires du Nord-Est du Brésil – Fogo Morto, de José Lins do Rego (2009 et Vidas Secas, de Graciliano Ramos (1969. Dans ces livres, les espadrilles jouent un rôle fondamental, tout en reflétant son importance dans le vestiaire de cette région, du moins jusqu’à moitié du XXème siècle. On rechercha des éventuelles ressemblances ou différences existentes entre les variantes lexicales de la chaussure mentionnée par les informateurs “paranaenses” et le modèle cité dans les ouvrages des écrivains Rego et Ramos. Dans les deuxs sources – la linguistique et la littéraire – on privilégia l’analyse semantique des unités lexicales et le contexte dans lequel elles ont été enregistrées. L’étude démontra que l’unité lexicale espadrilles et ses variantes phonétiques similaires dans les deux corpora, aussi que les variantes lexicales populaires présentes dans l’Atlas Linguistique du Paraná (ALPR. En dépit des simitudes l’esthétique et la fonction des espadrilles ne sont pas les mêmes dans les localitées concernées.

  2. Boom aurifère et dynamiques économiques entre Sénégal, Mali et Guinée

    Directory of Open Access Journals (Sweden)

    Faty B. Mbodj

    2009-03-01

    Full Text Available La conjoncture mondiale et les réformes minières entreprises par des pays comme la Guinée (1995, le Mali (1999 et le Sénégal (2003 ont créé les conditions favorables à l’investissement de multinationales de l’or dans un espace transfrontalier situé entre l’est du Sénégal, l’ouest du Mali et le nord-est de la Guinée. A travers les activités annexes et les investissements directs occasionnés, ces multinationales apparaissent comme un facteur d’intégration nationale et sous régionale de ces zones aurifères jusqu’ici en marge. Toutefois, l’insuffisance de leurs contributions financières, la gestion peu efficace de celles-ci, ainsi que la concurrence directe et indirecte que subissent les économies agricoles soulèvent des interrogations sur l’avenir économique des régions étudiées face aux activités extractives.The mining reforms undertaken by countries like Guinea (1995, Mali (1999 and Senegal (2003 have created favorable conditions for the investment of gold multinationals in a transborder area located between the east of Senegal, the west of Mali and the north-east of Guinea. Through the side activities and direct investments brought about, these firms appear as an opportunity to integrate these marginalized zones within the national and regional economies. However, their financial contributions are insufficient and they provoke direct and indirect competition on local agricultural economies, raising questions on the role of extractive activities for the economic future of the areas studied.

  3. Lele de la sphère publique en réseau pour ce qui est de favoriser ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Una Hakika : Porter à grande échelle les solutions numériques pour la gestion des conflits au Kenya et en Birmanie. L'information erronée, qu'elle soit le fruit de rumeurs ou d'une désinformation intentionnelle, peut alimenter le conflit et exercer de profondes répercussions sur la paix, la... Voir davantageUna Hakika : Porter ...

  4. Glasses for Mali

    CERN Multimedia

    PH Department

    2008-01-01

    We are collecting old pairs of glasses to take out to Mali, where they can be re-used by people there. The price for a pair of glasses can often exceed 3 months salary, so they are prohibitively expensive for many people. If you have any old spectacles you can donate, please put them in the special box in the ATLAS secretariat, Bldg.40-4-D01 before the Christmas closure on 19 December so we can take them with us when we leave for Africa at the end of the month. (more details in ATLAS e-news edition of 29 September 2008: http://atlas-service-enews.web.cern.ch/atlas-service-enews/news/news_mali.php) many thanks! Katharine Leney co-driver of the ATLAS car on the Charity Run to Mali

  5. le de la société civile pour ce qui est d'influencer les politiques de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    le de la société civile pour ce qui est d'influencer les politiques de santé publique en faveur des femmes autochtones du Mexique. Au Mexique, les iniquités relatives à l'accès aux services de santé et aux services connexes sont sensiblement plus marquées chez les populations autochtones, et en particulier chez les ...

  6. Stéréotyper le Féminin: entre le Doxique et l’Esthétique (Estereotipar o Feminino: entre o Dóxico e o Estético)

    OpenAIRE

    Maingueneau, Dominique; UNIVERSITÉ PARIS XII - VAL-DE-MARNE – PARIS/FRANCE

    2007-01-01

    RÉSUMÉ Cet article cherche à montrer que l’attitude masculine à l’égard des stéréotypes sur les femmes peut correspondre à deux manières de “gérer” l’énigme que représente pour l’homme la différence sexuelle: un régime doxique, celui de l’ “Homme Ordinaire”, et un régime esthétique, celui de “l’Artiste”. Le premier régime trouve à se manifester dans les proverbes, par exemple, dont la visée essentielle est de définir un ordre dans lequel le féminin se voit assigner “sa” place. Il est illustré...

  7. African Peacekeepers in Mali

    DEFF Research Database (Denmark)

    Haugegaard, Rikke

    Dette fælles DIIS-FAK forskningsprojekt undersøger de interne dynamikker i FN’s stabiliseringsmission i Mali (MINUSMA). Studiet af interoperabilitet i missionen vægtes med fokus på afrikanske styrkers opfattelser og motivation for deltagelse i MINUSMA. De afrikanske styrkers bidrag til FN er et u...

  8. IDRC in Mali

    International Development Research Centre (IDRC) Digital Library (Canada)

    Timbuktu. This telecentre allowed residents, particularly women and youth, to connect with the broader world. This project demonstrated the important role digital technology can play in rural development and served as a model for a series of multimedia centres that. UNESCO set up throughout Mali. C. U. R. T. C. A. R. N.

  9. Chimioprophylaxie du paludisme pendant la grossesse : évaluation de l'observance à Sikasso (Mali) par la méthode de Saker-Solomons

    OpenAIRE

    Arnold, Mireille

    2004-01-01

    Dans les régions endémiques, le paludisme contribue au développement d'une anémie sévère chez la femme enceinte et au faible poids de naissance de l'enfant. Dans ce contexte, une prophylaxie hebdomadaire de chloroquine est préconisée pour toutes les femmes enceintes au Mali. Une enquête transversale sur un échantillon représentatif de la population de femmes enceintes suivies aux consultations prénatales de Sikasso a permis d'évaluer l'observance de la chimioprophylaxie par questionnaire et r...

  10. Chimioprophylaxie du paludisme pendant la grossesse: évaluation de l'observance à Sikasso (Mali) par la méthode de Saker-Solomons

    OpenAIRE

    Arnold, Mireille; Rougemont, André

    2004-01-01

    Dans les régions endémiques, le paludisme contribue au développement d'une anémie sévère chez la femme enceinte et au faible poids de naissance de l'enfant. Dans ce contexte, une prophylaxie hebdomadaire de chloroquine est préconisée pour toutes les femmes enceintes au Mali. Une enquête transversale sur un échantillon représentatif de la population de femmes enceintes suivies aux consultations prénatales de Sikasso a permis d'évaluer l'observance de la chimioprophylaxie par questionnaire et r...

  11. Sorghum and rice: Mali

    International Nuclear Information System (INIS)

    2003-01-01

    Agriculture is the mainstay of the Malian economy and yet cereal imports absorb 6.5% of GDP. Food self-sufficiency is therefore a national priority. The Joint FAO/IAEA Division is supporting a programme to improve local varieties of sorghum and rice by using nuclear techniques to develop new cultivars that will produce higher yields under Mali's semi-arid climatic conditions. (IAEA)

  12. Pourquoi le « Disque Blanc » des Beatles est-il Blanc ?

    Directory of Open Access Journals (Sweden)

    Bernard Gensane

    2006-02-01

    Full Text Available Dans « Strawberry Fields Forever » (février 1967, John Lennon prévient, dans une perspective postmoderne, que la représentation artistique est impossible car « nothing is real ». Au même moment, Paul McCartney propose, avec « Penny Lane » (février 1967, une des plus troublantes définitions de ce qu’est la représentation artistique : « And though she feels as if she’s in a play / She is anyway ». Que se passe-t-il, en effet, lorsque l’art est sciemment accepté comme un faux-semblant à la foi...

  13. Quand (redire c’est (refaire : stratégies citationnelles dans le Paradis perdu

    Directory of Open Access Journals (Sweden)

    Gilles MATHIS

    2004-06-01

    Full Text Available “Non canimus surdis.” (Virgile : Eclogue X.8 : Je / Nous ne chantons pas pour les sourds.“Auditis? an me ludit amabilis / insania?” (Horace, Odes, III. iv. 5-6 : “L’entendez-vous ? ou suis-je le jouet d’un aimable délire ?”“Je ne dis les autres, sinon pour d’autant plus me dire” (Montaigne, Essais.I GénéralitésColloque, écriture, lecture, mêmes débats, mêmes ébats, mêmes combats. Dans tous les cas, il s’agit d’un banquet, d’un symposium, où la citation s’impose naturellement, en intruse ou...

  14. Le chantier médiéval dans le Sud-Est de la France: regard sur les techniques de construction et l’organisation du chantier à partir de quelques exemples (XIe-XIVe siècles

    Directory of Open Access Journals (Sweden)

    Esquieu, Yves

    2005-12-01

    Full Text Available The present article illustrates several aspects of the archaeological research on mediaeval construction in south-eastern France (11th-14th cent. by studies in building archaeology led by the authors in various architectural and scientific contexts. It focuses on questions such as the know-how and its transfer, changes in the architectural project, the organization of the building process and its techniques and strategies, by analyzing the masonry and structure of the edifice and, in the case of the pope’s palace in Avignon, by combined research on the architecture and the written sources.Le présent article illustre différents aspects de la recherche sur la construction du XIe au XIVe siècle dans le Sud-Est de la France à l’exemple d’études monumentales menées par ses deux auteurs dans différents contextes architecturaux et scientifiques. Il aborde les questions du savoir-faire et de sa transmission, des changements de projet, et l’organisation du chantier, à partir des indices de la lecture des élévations et, dans le cas de la construction du palais des papes d’Avignon, de l’étude conjointe des sources écrites.

  15. Agroforesterie et alimentation des moutons au Mali | CRDI - Centre ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Review of pasture and fodder production and productivity for small ruminants in the Sahel. 53216. Rapports. Accroître la sécurité alimentaire en associant étroitement élevage, arbres et cultures par la pratique de l'agroforesterie au Mali : rapport technique final (1er mars 2011 - 1er septembre 2014). Téléchargez le PDF.

  16. La bibliothèque du CERN | Pauline Gagnon présente : « Qu'est-ce que le boson de Higgs mange en hiver et autres détails essentiels » | 24 mars

    CERN Multimedia

    2015-01-01

    Mardi 24 mars 2015 à 16h00 à la bibliothèque du CERN (bât. 52-1-052) * Le café sera servi à partir de 15h30 *   Juillet 2012 : le CERN, le Laboratoire européen de la physique des particules, annonçait en grande pompe la découverte du boson de Higgs. La nouvelle a fait le tour du monde. Mais combien de gens comprennent vraiment ce que c'est et pourquoi cette découverte fut suivie du prix Nobel de physique en 2013 pour les théoriciens François Englert et Peter Higgs, qui en avaient prédit l'existence 48 ans auparavant ?  Le boson de Higgs était le chaînon manquant du modèle théorique actuel qui décrit ce qui compose toute la matière qu'on voit autour de nous. Ce livre explique comment tout cela fonctionne et lele du boson de Higgs. Et le livre va be...

  17. Le japonologue occidental est-il original ? Considérations sur la question et le cadre d’un travail concernant le Japon à partir de l’étude des lieux de cultes pour amoureux

    Directory of Open Access Journals (Sweden)

    Jean-Michel Butel

    2007-06-01

    Full Text Available Épais dictionnaires renseignant sur les mœurs et les coutumes japonaises, grandes compilations rassemblant sur plus d’une dizaine de volumes tout le savoir ethnologique accumulé depuis le début du siècle mais réorganisé selon une problématique au goût du jour, revues régulières relevant de grands musées, d’universités ou d’organismes régionaux, réseaux de groupes d’étude allant de la société savante locale à la puissante organisation nationale (Sieffert, 1952 : œuvres et institutions témoign...

  18. Il est beau le lavabo, il est laid le bidet

    DEFF Research Database (Denmark)

    Nølke, Henning

    1998-01-01

    Artiklen analyserer dislokering af subjektet på fransk. Der skelnes mellem tre hovedtyper: venstredislokering med og uden intonationsbrud og højre dislokering. I alle tilfælde indeholder sætningskernen principielt en pronominel kopi af subjektet. Det påvises, at de tre typer svarer til tre forske...

  19. Sécurité d'État et insécurité nationale au Mali : les logiques ...

    African Journals Online (AJOL)

    PhD, Socio économiste, Directeur, CERNES, Bamako, Mali. .... Au regard de la référence que constitue la définition sécuritaire régalienne de l'État et de son monopole .... Sur le plan économique, le cycle accumulation, rupture et reconstitution.

  20. Twitter a­-t­-il bousculé le droit parlementaire ? : Le jour où le #directAN s'est invité dans l'hémicycle

    OpenAIRE

    Chibois , Jonathan

    2014-01-01

    International audience; En février 2013, lors de l'examen à l'Assemblée nationale du projet de loi sur l'ouverture du mariage aux couples de même sexe, l'agitation est telle sur Twitter que, au quatrième jour de délibération, la séance publique dans l'hémicycle est levée pour quelques minutes. À plusieurs reprises ensuite, fréquentes sont les allusions à des échanges de tweets entre députés, jugés inappropriés, pour lesquels sera demandée, sans succès, une régulation du président de séance. L...

  1. Triatominae et Cactaceae : un risque pour la transmission de la Trypanosomose américaine dans le péridomicile (nord-est du Brésil

    Directory of Open Access Journals (Sweden)

    Emperaire L.

    2006-06-01

    Full Text Available Les observations de terrain réalisées dans le nord-est du Brésil ont montré la fréquente association, dans l’espace péridomiciliaire, entre un cactus, le Cereus jamacaru, la présence de nids dans ses branches et celle de Rhodnius neglectus et de Triatoma pseudomaculata, espèces vectrices du parasite Trypanosoma cruzi, agent de la maladie de Chagas. L’analyse des variables architecturales de cette Cactaceae montre que la présence de nids, et donc d’insectes, est inféodée aux pratiques traditionnelles de gestion de ce cactus. Cette étude souligne l’intérêt d’une approche intégrée de l’écologie des Triatominae pour l’identification des variables indicatrices de risque.

  2. Efficient transformation and expression of gfp gene in Valsa mali var. mali.

    Science.gov (United States)

    Chen, Liang; Sun, Gengwu; Wu, Shujing; Liu, Huixiang; Wang, Hongkai

    2015-01-01

    Valsa mali var. mali, the causal agent of valsa canker of apple, causes great loss of apple production in apple producing regions. The pathogenic mechanism of the pathogen has not been studied extensively, thus a suitable gene marker for pathogenic invasion analysis and a random insertion of T-DNA for mutants are desirable. In this paper, we reported the construction of a binary vector pKO1-HPH containing a positive selective gene hygromycin phosphotransferase (hph), a reporter gene gfp conferring green fluorescent protein, and an efficient protocol for V. mali var. mali transformation mediated by Agrobacterium tumefaciens. A transformation efficiency up to about 75 transformants per 10(5) conidia was achieved when co-cultivation of V. mali var. mali and A. tumefaciens for 48 h in A. tumefaciens inductive medium agar plates. The insertions of hph gene and gfp gene into V. mali var. mali genome verified by polymerase chain reaction and southern blot analysis showed that 10 randomly-selected transformants exhibited a single, unique hybridization pattern. This is the first report of A. tumefaciens-mediated transformation of V. mali var mali carrying a 'reporter' gfp gene that stably and efficiently expressed in the transformed V. mali var. mali species.

  3. Eesti tahab suurendada osalust Mali missioonil

    Index Scriptorium Estoniae

    2013-01-01

    Kaitseministeerium saatis valitsusele otsuse eelnõu, millega Eesti saadab Euroopa Liidu Mali väljaõppemissioonile kuni kümneliikmelise väljaõppemeeskonna staabiohvitseridest, kelle ülesanne on osaleda Mali üksuste väljaõppe planeermises ja nõustamises. Eelnõu annab kaitseväele võimaluse saata Malisse ka instruktorite grupp, kelel ülesanne on õpetada välja Mali valitsuse relvajõud

  4. The Sign Language Situation in Mali

    Science.gov (United States)

    Nyst, Victoria

    2015-01-01

    This article gives a first overview of the sign language situation in Mali and its capital, Bamako, located in the West African Sahel. Mali is a highly multilingual country with a significant incidence of deafness, for which meningitis appears to be the main cause, coupled with limited access to adequate health care. In comparison to neighboring…

  5. Le défi de l'hygiène dans les zones urbaines pauvres (Afrique de l'Est)

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'Organisation mondiale de la santé (OMS) estime que l'amélioration de ... Sustainable Technologies, Gender Integration and Supportive Policy Framework ... Le Conseil des gouverneurs félicite Jean Lebel pour son nouveau mandat au ...

  6. « Là est ma Grèce. » Le Quartier de Sagesse d’Henri Bosco Here is my Greece Allí está mi Grecia

    Directory of Open Access Journals (Sweden)

    Michèle Gorenc

    1997-05-01

    Full Text Available En juin 1927, sur la route de Naples à Lourmarin, Henri Bosco séjourne chez son ami, le peintre Pierre Deval, à La Valette-du-Var. Il n’a écrit jusque-là qu’un seul roman et souhaite maintenant trouver un style plus personnel. Sa sensibilité entre en résonance avec le beau domaine d’Orvès, propriété de son hôte. A ce contact s’élabore une écriture que l’écrivain déclinera dans ses romans ultérieurs.In June 1927, as be was travelling from Naples to Lourmarin, Henry Bosco stayed with his friend, Pierre Duval the painter, in La-Valette-du-Var. He had written only one novel so far and was now in search of a more personal style of writing. His sensitivity was struck by the beautiful Orvès property owned by his host. On the basis of this encounter, he started to elaborate a new medium which he was to exploit in his later novels.En junio de 1927, en el camino entre Nápoles y Lourmarin, Henri Bosco se hospeda en casa de su amigo, el pintor Pierre Deval, en La Valette-du-Var. Hasta entonces sólo ha escrito una novela, y desea ahora dar con un estilo más personal. Su sensibilidad se armoniza con la belle finca de Orvès, propiedad de su anfitrión. En ese contado se elabora una escritura que el escritor rechazará en sus novelas posteriores.

  7. Sédimentation et diagenèse des minéraux argileux du Jurassique supérieur-Crétacé dans le Jura méridional et le domaine subalpin (France, Sud-Est). Comparaison avec le domaine Atlantique Nord

    OpenAIRE

    Deconinck , Jean-François

    1984-01-01

    Le but de cette thèse est de décrire et d'expliquer l'évolution des assemblages argileux dans les Alpes occidentales depuis l'Oxfordien jusqu'au Crétacé supérieur, et de la comparer à celle connue dans l'Atlantique nord grâce aux forages DSDP. Etude géologique, sédimentologique et géochimique. Les assemblages argileux du Mésozolque supérieur (Malm - Crétacé) du domaine subalpin et du Jura mérldional sont étudiés par diffraction des rayons X, microscopie électronique à transmission et analyses...

  8. Effet du biotope sur la diversité floristique et le polymorphisme phénotypique des groupements à Tamarix africana Poir. dans les zones arides de la région de Khenchela (Est Algerien

    Directory of Open Access Journals (Sweden)

    Khabtane Abdelhamid

    2012-12-01

    Full Text Available RESUME Le genre Tamarix (Tamaricaceae regroupe plus de 80 espèces, parmi eux le Tamarix africana Poir. qui représente une très grande ubiquité en Algérie, soit du point de vue climatique (humidité et sécheresse, édaphique (sols salés et calcaires; où il représente l’espèce  à caractère typique des plantes thermo xérophytes. Pour contribuer à la connaissance de cette espèce et de son comportement nous avons essayé de suivre le comportement  phytosociologique ainsi que sa variabilité morphologique (l’hauteur, le recouvrement basale, nombre des ramifications à la base.. dans trois biotopes, extrêmement différents du point de vue climatique et édaphique,  dans les zones steppiques arides de la région de Khenchela (Est Algérien et qui sont  choisis  selon un transect Nord - Sud. Les résultats révèlent que les groupements à Tamarix africana Poir. représentent une richesse floristique importante, qui se diffère d’un site à l’autre, avec un polymorphisme phénotypique adaptée aux conditions spécifiques à chacun des trois sites et qui lui permet d’être l’espèce à forme arbustive  la plus adaptée pour la réhabilitation des écosystèmes dégradés dans les zones de transitions Désert-NordMots clés Tamarix africana P. - ubiquité- thermo xérophytes-  régions arides- halophytes- polymorphisme phénotypique

  9. Mali president kaotaks surmanuhtluse / Allan Espenberg

    Index Scriptorium Estoniae

    Espenberg, Allan

    2007-01-01

    Mali president Amadou Tourmani Toure pöördus riigi iseseisvuse väljakuulutamise 47. aastapäeva puhul rahva poole läkitusega, kus teatas surmanuhtluse likvideerimise seaduseelnõu parlamenti saatmisest. Presidendi säärane initsiatiiv pole aga meeltmööda Mali moslemivaimulikele. Praeguseks on Amnesty Internationali andmetel umbes pooled maailma riikidest surmanuhtluse tühistanud

  10. Eesti saadab Mali missioonile kaks staabiohvitseri

    Index Scriptorium Estoniae

    2013-01-01

    Välisminister Urmas Paet ütles eile, et valitsus andis oma toetuse missioonile Malis, kus on viimastel nädalatel ägenenud islamistlike mässuliste rünnakud. Missioon pole sõjaline, vaid selle eesmärgiks on treening ja õpetus Mali enda sõjaväele. Eesti saadab missioonile ilmselt ühe või kaks staabiohvitseri

  11. Nonhealing Ulcer: Acroangiodermatitis of Mali

    Directory of Open Access Journals (Sweden)

    Neeraj Varyani

    2011-01-01

    Full Text Available An 18-year-old male presented with a nonhealing wound on left lower limb, pain and swelling over multiple joints, weight loss, and yellowish discoloration of eyes and urine for the past 4 years. On examination, the patient had pallor, icterus, and generalized lymphadenopathy with a nonhealing unhealthy ulcer over left medial malleolus. He had deformed joints with hepatomegaly and splenomegaly. His laboratory investigations were positive for antinuclear antibody (ANA and anticardiolipin antibody (ACLA. Synovial fluid analysis showed inflammatory findings. Biopsy of margin of the ulcer showed findings consistent with Acroangiodermatitis of Mali. The patient was treated with disease-modifying antirheumatic drugs (DMARDs and aspirin for juvenile idiopathic arthritis and secondary antiphospholipid antibody syndrome (APS, respectively. The ulcer was managed conservatively with systemic antibiotics and topical steroids along with limb elevation and compression elastic stockings. The patient's symptoms improved significantly, and he is in our followup.

  12. « Le souvenir n’est qu’une maison que l’on porte dans la voix » (Alexandre Amprimoz, Bouquet de signes

    Directory of Open Access Journals (Sweden)

    Sante A. Viselli

    2015-12-01

    Full Text Available Depuis déjà plusieurs années, nous remarquons au Canada la présence d’une littérature unique en son genre, celle des auteurs italo-canadiens. En français, en anglais ou en italien, cette littérature s’est déjà frayé un chemin sûr vers une reconnaissance incontestée au niveau national aussi bien qu’international. Des auteurs tels que Fulvio Caccia, Antonio d’Alfonso, Marco Micone, Carole David-Fioramore, Bianca Zagolin et Alexandre Amprimoz, sont à considérer parmi les lauréats italo-canadiens, porte-parole d’une génération d’érudits cosmopolites et polyglottes. L’œuvre d’Alexandre Amprimoz est, à cet égard, un exemplum des plus marquants d’une littérature multiple et plurielle.

  13. Epilepsie et permis de conduire au Mali : connaissances, attitudes et ...

    African Journals Online (AJOL)

    English Title: Epilepsy and driving licence in Mali : knowledge, attitudes and ... study in collaboration with ANASER (National Agency for Road Safety in Mali) with ... this study emphasizes the importance of misconceptions about epilepsy, and ...

  14. Le laboratoire, le temple et le marché

    International Development Research Centre (IDRC) Digital Library (Canada)

    De manière générale, les auteurs insistent sur le fait que c'est leur foi qui leur a .... nettement que dans de nombreux cercles, le besoin était vivement ressenti de ... Le Dr Kapur présente tout d'abord une brève discussion sur sa vision du ...... pour les soins aux enfants orphelins et aux pauvres et pour la renaissance des ...

  15. The right to energy is a social, economical and environmental emergency; Le droit a l'energie est une urgence sociale, economique et environnementale

    Energy Technology Data Exchange (ETDEWEB)

    Coulon, Pierre-Jean

    2010-09-15

    2 billion people on the planet do not have access to energy. This energy deficiency has an impact on health, infant mortality, life expectancy, education, and women's emancipation and it slows development. Following the Copenhagen summit, in a financial crisis context that heavily impacted the world economies, energy issues demand real political commitment, because solutions exist. They include awareness-building, responsibility and commitment of society, because a better accessibility for the populations can't be achieve without the beneficiaries. [French] 2 milliards d'individus n'ont pas acces a l'energie sur la planete. Impact sur la sante, sur la mortalite infantile, sur l'esperance de vie, sur l'education, sur l'emancipation des femmes a cette situation de carence energetique est un frein au developpement. Au lendemain du Sommet de Copenhague, dans un contexte de crise financiere qui a impacte lourdement l'economie mondiale, les questions energetiques necessites une reelle volonte politique, car des solutions existent. Celles-ci passent notamment par la sensibilisation, la responsabilisation et l'implication de la societe civile, car permettre une meilleure accessibilite des populations ne peut pas se faire sans les beneficiaires eux-memes.

  16. The environment overlooked? L’environnement est-il négligé? Lele des préoccupations environnementales dans les discours sur l’alimentation bio

    Directory of Open Access Journals (Sweden)

    Jesper Lassen

    2009-09-01

    Full Text Available Cet article étudie la façon dont les gens ordinaires parlent de la nourriture et en particulier dans quelle mesure, et comment, ces discussions incluent des arguments sur l’environnement et les produits bios. Contrairement à de nombreuses études qui démontrent la préoccupation du public concernant les aliments et leur production, l’étude rapportée ici montre que, dans un cadre exploratoire où des danois étaient invités à discuter d’alimentation et de production alimentaire, les arguments environnementaux jouent un rôle insignifiant. Ceci peut être expliqué d’une part par l’émergence d’un nouveau discours sociétal qui minimise l’importance des problèmes environnementaux et, d’autre part, comme l’effet d’une tendance actuelle où les individus sont de plus en plus préoccupés par leur bien-être personnel.This paper addresses the way ordinary people talk about the food they eat and in particular to what extent, and how, such discussions include arguments about the environment and organic products. In contrast with the numerous studies demonstrating public concern over food and food production, the study reported here shows that in an exploratory set-up, where Danes were invited to discuss food and food production, environmental arguments played an insignificant role. This can be explained in part by the emergence of a new societal discourse that downsizes the importance of environmental problems, and in part as an effect of an ongoing trend in which individuals increasingly are concerned about their personal well-being.

  17. Contribution méthodologique pour la connaissance du rôle des acteurs locaux dans la réalisation d’un projet de territoire : le cas du projet de la réserve naturelle de Réghaia dans la zone côtière Est de l’Algérois

    Directory of Open Access Journals (Sweden)

    Mohamed Larid

    2010-12-01

    Full Text Available Dans le domaine de la gestion territoriale, on peut constater le manque et l’insuffisance des outils d’analyse des stratégies des acteurs. Ceci est encore plus ressenti dans les sociétés du monde en développement, où les mécanismes de gestion et d’administration du territoire sont souvent dysfonctionnels. Une meilleure connaissance des relations entre les intervenants dans l’application d’un projet territorial, permet des éclairages sur le contexte de sa réalisation et des orientations suceptibles d’avantager sa réussite. Les repères sur les logiques de comportement aident à cerner les enjeux et à poser les questions clés, pour atteindre les objectifs fixés et conforter l’accomplissement des actions arrêtées. Le présent article rend compte des résultats d’une expérience de terrain, réalisée dans une zone côtière humide de la région algéroise. Il propose une contribution, sur le plan méthodologique, pour la collecte d’informations pertinentes sur le comportement et les possibilités des acteurs dans la réalisation d’un projet local, orienté vers la valorisation et la protection d’un patrimoine naturel important.In the field of territorially management, we can see the insufficiency of analysis tools on the strategies of actors. This is even more crucial in case of the developing world, where the management and territorially administration are often dysfunctional. Better knowledge of the roles of stakeholders in the implementation of a territorial project, provides insights of the context of its implementation and guidance likely to favor its success. The logical behavior help to identify issues and key questions, to achieve the objectives and ensure the completion of actions agreed. This article reports the results of a field experiment conducted in a coastal wetland in the region of Algiers. It offers a contribution, on the methodology for collecting information on the behavior and capabilities of

  18. Gestion de l'eau en milieu aride : considérations physiques et sociales pour l'identification des territoires pertinents dans le Sud-Est tunisien

    Directory of Open Access Journals (Sweden)

    Bruno Romagny

    2006-02-01

    Full Text Available La situation actuelle des ressources en eau et de leurs usages dans le Sud-Est tunisien présente des enjeux qui sont communs à de nombreuses régions du bassin méditerranéen : des ressources limitées et déjà largement exploitées pour répondre à la croissance des besoins, le recours accru aux ressources dites non conventionnelles, une situation de concurrence entre usages sectoriels, une marchandisation croissante des ressources, et des conditions climatiques contraignantes qui viennent renforcer les tensions autour de l'eau. Dans le contexte des mutations en cours, face aux risques de déficits en eau et à la nécessité d'un développement économique et social équilibré, ces caractéristiques, parmi d'autres, font de la Jeffara tunisienne un cas d'étude exemplaire des difficultés que pose la gestion intégrée de l'eau. Celle-ci doit prendre en compte les différentes sources d'approvisionnement ainsi que les différents usages associés, et donc l'identification des territoires pertinents pour cette  gestion, compte tenu des relations amont-aval naturelles et artificielles d'une part, et des cohérences institutionnelles et sociales d'autre part.The current situation of the water resources and their uses in South-Eastern Tunisia presents stakes which are common to many areas of the Mediterranean basin : limited and already largely exploited resources to address the growth of the needs, the increasing use of so-called non conventional resources, a competition between sectoral uses of water, an increasing merchandising of the resources, and constraining climatic conditions which reinforce the tensions around water. In the context of the changes in progress, facing the hazard of water deficits and with the need for a balanced economic and social development, these characteristics, among others, make Tunisian Jeffara be an exemplary case of study of the difficulties raised by the integrated water resources management. This one

  19. Friction and Inequality among Peacekeepers in Mali

    DEFF Research Database (Denmark)

    Cold-Ravnkilde, Signe Marie; Albrecht, Peter; Haugegaard, Rikke

    2017-01-01

    The United Nations Multidimensional Integrated Stabilization Mission in Mali (MINUSMA) was established in 2013 to support Mali’s peace process. It represents an emerging practice of deploying UN peacekeeping missions in asymmetrical conflict environments where there is no peace to keep. While MIN...

  20. Securing the dangerous UN convoys in Mali

    DEFF Research Database (Denmark)

    Haugegaard, Rikke; Albrecht, Peter; Ravnkilde, Signe Cold

    2017-01-01

    It has proven particularly challenging for the UN stabilization mission in Mali (MINUSMA) to transport fuel, food and water to military camps in Sector North on the frontline of the mission. Convoy escorts drain the UN mission of resources and is one of its most dangerous tasks, mainly carried ou...

  1. Wind power in Mali 1979-1988

    International Nuclear Information System (INIS)

    Mamadou Adama Diallo.

    1990-08-01

    The purpose of this paper is to offer to the users maps of available wind power, the percentage of calm wind, the average speed of the wind and tables of wind frequencies in Mali, in order to provide possible solutions for the energy problems of the country. 11 tabs, 3 maps

  2. : tous les projets | Page 67 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Financement total : CA$ 543,005.00. Essais cliniques d'un vaccin expérimental contre le virus Ebola : une intervention canadienne dans la recherche. Projet. Cette initiative soutient les essais cliniques de phases II et III d'un vaccin expérimental contre le virus Ebola. Sujet: CANADA. Région: Guinea, Mali, Senegal, Canada.

  3. Publications | Page 196 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Gestion et valorisation des déchets d'équipements électroniques et informatiques en Afrique de l'Ouest (cas du Bénin, du Mali et du Sénégal) : rapport sur le cas du Bénin, 2007-2010 (restricted access) ...

  4. Le Sanskrit

    CERN Document Server

    Balbir, Nalini

    2013-01-01

    Cet ouvrage est destiné à tous ceux qui souhaitent se mettre ou se remettre à l'étude du sanskrit et ne peuvent y consacrer que quelques minutes par jour. En suivant le principe de la méthode quotidienne Assimil, vous acquerrez progressivement le vocabulaire et la grammaire de base qui sont nécessaires à la lecture des textes de la littérature sanskrite classique. Vous trouverez dans cette méthode une approche vivante de la langue et de la culture sanskrite classique à travers des textes d'abord adaptés pour le débutant puis authentiques. En quelques mois, vous manierez la langue sans efforts ni hésitation, de manière très naturelle. Les enregistrements reprennent l'intégralité des textes en sanskrit des leçons et des exercices de traduction du livre. Ils sont interprétés, à un rythme progressif, par des locuteurs natifs professionnels.

  5. Lele des chefs traditionnels au Ghana : un modèle inspirant ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    8 févr. 2011 ... Ray est également coordonnateur international du Traditional Authority ... Marketing social : le chef traditionnel acquiert une certaine expertise et ... Nadine Robitaille est rédactrice à la Division des communications du CRDI .

  6. A molecular map of CQR in Mali

    Science.gov (United States)

    Djimde, Abdoulaye A.; Barger, Breanna; Kone, Aminatou; Beavogui, Abdoul H.; Tekete, Mamadou; Fofana, Bakary; Dara, Antoine; Maiga, Hamma; Dembele, Demba; Toure, Sekou; Dama, Souleymane; Ouologuem, Dinkorma; Sangare, Cheick Papa Oumar; Dolo, Amagana; Sogoba, Nofomo; Nimaga, Karamoko; Kone, Yacouba; Doumbo, Ogobara K.

    2009-01-01

    Plasmodium falciparum CQR transporter point mutation (PfCRT76T) is known to be the key determinant of CQR. Molecular detection of PfCRT76T in field samples may be used for the surveillance of CQR in the malaria endemic countries. The genotype-resistance index (GRI) which is obtained as the ratio of the prevalence of PfCRT 76T to the incidence of CQR in a clinical trial was proposed as a simple andpractical molecular-based addition to the tools currently available for monitoring CQR in the field. In order to validate the GRI model across populations, time, and resistance patterns, we compiled data from the literature and generated new data from a dozen of sites across Mali. We found a mean PfCRT76T mutation prevalence of 84.5% (range 60.9%–95.1%) across all sites. CQR rates predicted from the GRI model was extrapolated onto a map of Mali to show the patterns of resistance throughout the participating regions. We present a comprehensive map of CQR in Mali, which strongly supports recent changes in drug policy away from chloroquine. PMID:20041947

  7. ’Itinéraires de la faim’ des migrants subsahariens expulsés d’Algérie au Mali Organizing survival among sub-Saharan migrants expelled from Algeria to Mali

    Directory of Open Access Journals (Sweden)

    Clara Lecadet

    2010-12-01

    Full Text Available En Algérie, l’expulsion des migrants d’origine subsaharienne vers la frontière Nord du Mali est devenue depuis le début des années 2000 un processus régulier. Rationnement alimentaire drastique dans les prisons algériennes, angoisse vitale dans les ghettos organisés en micro-communautés nationales aux abords de la frontière, leitmotiv de l’aide d’urgence : la faim constitue une caractéristique majeure de l’expérience vécue par les expulsés. Elle est à la fois une violence intime, une donnée politique, un motif d’intervention humanitaire. On parlera ainsi d’itinéraires de la faim pour appréhender le processus de l’expulsion et les parcours erratiques de l’après-expulsion : ils sont ici envisagés à la fois du point de vue du dispositif étatique algérien qui en porte la responsabilité et des contre-dispositifs précaires mis en œuvre par les expulsés pour survivre. Les expulsés auto-organisés, les associations d’expulsés, l’intervention ponctuelle des ONG, tentent en effet de faire face aux expulsions par des formes de regroupement, d’accueil et de restauration atypiques dans un contexte d’abandon et de dénuement radical.Since the beginning of the century the expulsion of sub-Saharan migrants from Algeria to the Northern Malian border has become a regular event. Hunger is the main aspect of expelled migrant life, caused by poor rations in Algerian jails, daily fear in the ghettos organized into national micro-communities on the border and the limited supply of emergency aid. Hunger is simultaneously a primal suffering, a political issue and an argument for humanitarian aid. We describe the process of expulsion and the erratic journey of migrants after deportation as itineraries of hunger. These itineraries are considered from two points of view; the state processes involved in these collective deportations and the precarious strategies invented by expelled migrants to survive. A combination

  8. Medicinal plants from Mali: Chemistry and biology.

    Science.gov (United States)

    Wangensteen, Helle; Diallo, Drissa; Paulsen, Berit Smestad

    2015-12-24

    Mali is one of the countries in West Africa where the health system rely the most on traditional medicine. The healers are mainly using medicinal plants for their treatments. The studies performed being the basis for this review is of importance as they will contribute to sustaining the traditional knowledge. They contribute to evaluate and improve locally produced herbal remedies, and the review gives also an overview of the plant preparations that will have the most potential to be evaluated for new Improved Traditional Medicines. The aim of this review is to give an overview of the studies performed related to medicinal plants from Mali in the period 1995-2015. These studies include ethnopharmacology, chemistry and biological studies of the plants that were chosen based on our interviews with the healers in different regions of Mali, and contribute to sustainable knowledge on the medicinal plants. The Department of Traditional Medicine, Bamako, Mali, is responsible for registering the knowledge of the traditional healers on their use of medicinal plants and also identifying compounds in the plants responsible for the bioactivities claimed. The studies reported aimed at getting information from the healers on the use of medicinal plants, and study the biology and chemistry of selected plants for the purpose of verifying the traditional use of the plants. These studies should form the basis for necessary knowledge for the development of registered Improved Traditional Medicines in Mali. The healers were the ethnopharmacological informants. Questions asked initially were related to wound healing. This was because the immune system is involved when wounds are healed, and additionally the immune system is involved in the majority of the illnesses common in Mali. Based on the results of the interviews the plant material for studies was selected. Studies were performed on the plant parts the healers were using when treating their patients. Conventional chromatographic

  9. Friction on the Frontline - African Soldiers in Mali

    DEFF Research Database (Denmark)

    Haugegaard, Rikke

    This conference abstract is a presentation of some of the findings from fieldwork conducted in Mali in june 2016, together with Signe Cold-Ravnkilde and Peter Albrecht from DIIS. The abstract highlights some of the frictions in the UN mission MINUSMA in Mali, especially perceptions, leadership...

  10. Cytology of infection of apple leaves by Diplocarpon mali

    Science.gov (United States)

    Diplocarpon mali, the causal agent of Marssonina leaf blotch of apple, causes severe defoliation during the growing season. Little information is available on the mode of infection and infection process. In this study, the infection strategies of D. mali in apple leaves were investigated using fluor...

  11. Cotton Production in Mali: Subsidies or Sustainable Development?

    Science.gov (United States)

    Moore, Lindsey

    2007-01-01

    Current trade rules concerning cotton subsidies are intricately linked with poverty and hunger in Mali. Over half of Mali's economy and over 30 million people depend directly on cotton. It is the main cash crop and the most important source of export revenue. Cotton also plays a key role in development policies and in the fight against poverty by…

  12. The European Union Training Mission in Mali: A case study

    Directory of Open Access Journals (Sweden)

    Dicke Rachel

    2014-10-01

    Full Text Available For several years, the European Union (EU has been increasing its international presence and moving into the role of a global security actor. To support the goal of greater crisis management capabilities, European security integration (ESI has been deepening. This article therefore examines an Ell operation - the European Union Training Mission in Mali (EUTM Mali - with the aim of gauging the success of the EU's efforts at ESI. To determine the success of EUTM Mali and thus of ESI, three propositions are examined: if EUTM Mali is a security operation showing successful security integration, there will be evidence of (i broad participation, (ii financial burden-sharing and (iii the successful incorporation of troops and equipment. The first and third propositions are supported whereas the second does not receive as much support. Overall, EUTM Mali shows considerable success and bodes well for further ESI.

  13. Le corps sportif1

    OpenAIRE

    Brulé, Pierre

    2015-01-01

    Le nu et le cuit Si, pas plus que l’Auvergne, le monde grec antique n’a été le théâtre d’un quelconque « miracle », il n’a pas manqué, toutefois, de « distinctions » diverses, d’exceptions même, qui le singularisent absolument. Une, c’est la pédérastie. Quelle culture l’a autant valorisée, autant instrumentalisée, l’a autant érigée en modèle ? Nous n’en avons pas encore mesuré toutes les conséquences. La place inhabituelle que prend là et alors cette polyvalence rare de la libido masculine de...

  14. Le développement durable est-il bienvenu dans les organisations ? Cas de l’implantation d’un Système de Management Environnemental en Tunisie

    Directory of Open Access Journals (Sweden)

    Moez Ben Yedder

    2009-02-01

    Full Text Available Les entreprises sociétalement responsables sont celles qui s’inscrivent dans une logique de développement durable. Leur engagement se matérialise, notamment, par le déploiement de systèmes de gestion respectueux de l’environnement tels que les systèmes de management environnemental (SME. En plus de leur portée écologique, ces derniers ont une visée sociale puisqu’ils permettent d’améliorer les conditions de travail des opérateurs. Toutefois, leur mise en place peut être gênée par ces derniers s’ils ne retrouvent pas leurs intérêts lors de l’instauration d’un tel système. L’objectif de ce texte est d’étayer cette idée à partir de l’étude de cas d’une entreprise tunisienne où l’instauration d’un SME n’a pu aboutir en partie à cause de la résistance du personnel. Dans ce sens, nous appuierons l’idée selon laquelle les pratiques du Développement Durable et de la Responsabilité Sociale de l’Entreprise ne se greffent pas ex abrupto sur une entreprise mais nécessitent certains préalables d’ordre organisationnel pour être mis en place.Socially responsible firms are the ones which act in accordance to sustainable development logic. Their engagement is materialised by deploying environment friendly practices such as environmental management system (EMS. Those systems have also a social purpose in the way that they allow enhancing work conditions of operators. However, their setting could be embarrassed by those ones because of the change of habits that it implies for them. The purpose of this study is to shore up this idea by resorting to a case study of a Tunisian firm in which the setting of the environmental management system turned failed in part because of the resistance of the personnel. We will defend the idea that practices of sustainable development and corporate social responsibilities couldn’t be correctly adopted by firms without taking into consideration to some organizational

  15. Family planning uses traditional theater in Mali.

    Science.gov (United States)

    Schubert, J

    1988-01-01

    Mali's branch of the International Planned Parenthood Federation has found a vehicle that effectively conveys the idea of family planning through the use of contraception, a method that blends the country's cultural heritage and modern technology. Despite becoming the first sub-Saharan francophone country to promote family planning, Mali only counted 1% of its population using a modern method of contraception. So with the aid of The Johns Hopkins University/Population COmmunication Services (JHU/PCS), the Association Malienne pour la Protection et la Promotion de la Famille (AMPPF) developed several programs to promote contraception, but none were more successful than the Koteba Project, which used Mali's traditional theater form to communicate the message. While comical, the Koteba generally deals with social issues -- it informs and entertains. This particular Koteba told the story of two government employees, one with two wives and many children, the other with one wife and few children. The first one sees nothing but family problems: fighting wives and delinquent children. The second one, who had used family planning, enjoys a peaceful home. Upon hearing of his friend's successes with family planning, the tormented government employee becomes convinced of its needs, and persuades his wives to accompany him to a family planning clinic. Developed at a cost of approximately US $3000 and televised nationwide, the Koteba proved effective. A survey of 500 people attending an AMPPF clinic revealed that 1/4 of them remembered the program. With the success of the Koteba, JHU/PCS and AMPPF are now exploring other traditional channels of communication.

  16. Activities Report 2007 PATTEC-Mali

    International Nuclear Information System (INIS)

    2007-01-01

    This annual report is a summary of main activities undertaken in 2007 under the Pan African Tsetse and Trypanosomiasis project. It results from the initiative of African governments in 2000 to eradicate tsetse flies and trypanosomiasis from infested areas in the African continent in order to mitigate poverty and improve food security in six countries (Ethiopia, Uganda, Kenya, Mali, Burkina, Ghana). . areas An integrated approach of combating tsetse is used, from simples techniques such as trapping nets impregnate with insecticides and skin treatment of animals for suppression, and sterile insect technique for eradicating of the residual population of glossina.Methods and basic socio-epidemiological conducted in the field are presented

  17. Le Mouvement Social

    OpenAIRE

    FRIDENSON, Patrick

    2003-01-01

    J'ai la faiblesse d'affirmer que parmi les revues françaises d'histoire Le Mouvement Social est la revue qui a publié le plus d'articles et de comptes rendus en matière d'histoire des femmes et du gender. Chacun peut le vérifier grâce à nos pages Web sur le site Internet du Dictionnaire créé par Jean Maitron. Elles comportent la table des matières complète de la revue depuis sa fondation en 1960. Notre rédaction est extrêmement fière de ce résultat. Mais elle reconnaît qu'il a été difficile à...

  18. Le Grand Inquisiteur : Âme et corpsQu’est-ce qu’une conversion sans adhésion de l’âme ?

    Directory of Open Access Journals (Sweden)

    Caroline Julliot

    2012-02-01

    Full Text Available Cet article vise à replacer dans le contexte philosophique et métaphysique général du romantisme la forme particulière de conversion figurée à travers le personnage du Grand Inquisiteur - en montrant en quoi elle se constitue en rupture totale avec la vérité historique.This article aims to replace in the general philosophical and metaphysical context of the romanticism the particular shape of conversion represented through the character of the Great inquisitor - by showing in what it is constituted in total break with the historical truth.

  19. GeneXpert MTB/RIF dans le dépistage de la tuberculose pulmonaire à l’Hôpital Provincial Général de Référence de Bukavu, à l’Est de la République Démocratique du Congo: quelles leçons tirées après 10 mois d’utilisation?

    Science.gov (United States)

    Lupande, David; Kaishusha, David; Mihigo, Carine; Itongwa, Moise; Yenga, Gustave; Katchunga, Philippe

    2017-01-01

    Introduction En Afrique subsaharienne, les méthodes de diagnostic de la tuberculose sont insuffisantes et reposent essentiellement sur la microscopie. Elles constituent un réel frein pour le contrôle de la tuberculose. La présente étude voudrait évaluer les performances du GeneXpert MTB/RIF vis à vis de la microscopie classique de Ziehl-Neelsen à l’Hôpital Provincial Général de Référence de Bukavu, à l’Est de la République Démocratique du Congo après 10 mois d’utilisation. Méthodes Les résultats de la coloration au Ziehl-Neelsen et de la biologie moléculaire sur GeneXpert MTB/RIF de 452 patients suspects de tuberculose ont été colligés. La validité d’un test par rapport à l’autre dans la détection de la tuberculose a été étudiée. Résultats Dans le groupe entier, la fréquence de la tuberculose pulmonaire était de 16.3%. La positivité était significativement plus élevée pour le GeneXpert MTB/RIF que pour le Ziehl-Neelsen dans le groupe entier (15.9% vs 9.3%, p= 0.03) et chez les séropositifs pour le VIH (52.0% vs 24.0%; p = 0.007). Cependant, la sensibilité de GeneXpert MTB/RIF comparé au Ziehl-Neelsen n’était pas maximale (95.2%). Enfin, GeneXpert MTB/RIF a détecté 20.8% de résistance à la rifampicine. Conclusion La présente étude confirme la supériorité de GeneXpert MTB/RIF sur la coloration de Ziehl-Neelsen dans la détection de la tuberculose et dans la prédiction de la multi résistance. Son utilisation systématique couplée au Ziehl-Neelsen permettrait de mieux contrôler la tuberculose en Afrique subSaharienne. PMID:29187929

  20. Risk factors for trachoma in Mali.

    Science.gov (United States)

    Schémann, J-F; Sacko, D; Malvy, D; Momo, G; Traore, L; Bore, O; Coulibaly, S; Banou, A

    2002-02-01

    Prior to commencing a campaign to eliminate blinding trachoma in Mali, a national disease prevalence survey was conducted from March 1996 to June 1997. The prevalence of trachoma was estimated and potential risk factors were studied. In each of Mali's seven regions (excluding the capital Bamako), a sample of 30 clusters was taken from the general population, in accordance with the principle of probability proportional to the size of the community. All children under 10 years of age were examined. The simplified clinical coding system proposed by the World Health Organization was used. The position of each village was established and subsequently related to the nearest meteorological station. Socioeconomic and environmental information was collected at both village and household level. The mother or caretaker of each child was questioned about availability and use of water for washing the child. At the time of examination, facial cleanliness and the presence of flies on the face were noted. A total of 15,187 children under 10 years of age were examined. The prevalence of active trachoma (follicular [TF] or intense trachoma [TI]) was 34.9% (95% CI : 32.3-37.6) and the prevalence of TI was 4.2% (95% CI : 3.5-5.0). Aridity/environmental dryness appears to be a risk factor influencing the current geographical distribution of trachoma. Small villages had considerably higher trachoma prevalence than their larger neighbours. The proximity of a medical centre and the existence of social organizations such as a women's association were associated with lower levels of trachoma. Crowded living conditions increased the risk. Using a monetary marker of wealth, we observed a linear inverse relation between wealth and trachoma prevalence. The presence of a dirty face was strongly associated with trachoma (odds ratio [OR] = 3.67) as was the presence of flies on the child's face (OR = 3.62). Trachoma prevalence increased with distance to a water source. Disease prevalence decreased

  1. The planning of Selingue in Mali

    International Nuclear Information System (INIS)

    Bangneres, Jacques

    2015-10-01

    After a brief recall of some geographic, demographic and economic characteristics of Mali, the author recalls the reasons for the construction of the Selingue dam on the Niger River. The objectives were mainly electric power supply, economic and local development, a more steady and usable waterway for trade and transport. He recalls the origin of the project, the different actors who intervened for its design, construction and financing. He comments some characteristics of the dam, of the reservoir, and of the hydroelectric plant. Based on data, he discusses the effect of Selingue on electricity production from 1982 (commissioning) to 2012. He evokes the problematic issue of maintenance, comments the effects on populations (displacement, deforestation, fishing and agriculture)

  2. Le FIVB annonce le financement de cinq autres projets | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    10 avr. 2018 ... En partenariat avec la Fondation Bill et Melinda Gates et Affaires mondiales Canada, le CRDI est heureux d'annoncer la prochaine série de projets soutenus par le Fonds d'innovation en matière de vaccins pour le bétail (FIVB). À ce jour, 11 projets ont obtenu un financement total de 13,6 millions de CAD ...

  3. Le financement de l'éducation dans les collectivités locales, quels ...

    African Journals Online (AJOL)

    Le financement de l'éducation dans les collectivités locales, quels défis ? Marie Elisabeth Dembélé. Abstract. This article aims to analyse the support provided by the state to local collectivities in Mali, to target the expenditure categories included in the funding and observe their appropriation by the beneficiaries of education ...

  4. Heinberg Richard, 2008, Pétrole: la fête est finie ! Avenir des sociétés industrielles après le pic pétrolier, Éditions Demi-Lune, [2003 pour la première édition en langue anglaise

    Directory of Open Access Journals (Sweden)

    Luc Semal

    2009-05-01

    Full Text Available Il a fallu attendre cinq ans pour que soit traduit ce best-seller de Richard Heinberg consacré au pic pétrolier et à ses conséquences sociales en tous genres ! Durant ces cinq années, les ouvrages scientifiques consacrés à ce thème ont continué à proliférer dans le monde anglo-saxon et ont même largement contribué à y faire naître le mouvement des transition towns (dont l’un des principaux objectifs est de préparer les communautés locales aux pénuries pétrolières. Mais en France, pendant la ...

  5. Un nouvel habitat du Bronze final IIIb dans le Val d’Orléans et ses traces de métallurgie du fer : Bonnée, Les Terres à l’Est du Bourg (Centre, Loiret A new settlement from late Bronze IIIb in the val d’Orléans: Bonnée, Les Terres à l’Est du Bourg (lands to the east of the town (Centre, Loiret

    Directory of Open Access Journals (Sweden)

    Stéphane Joly

    2011-12-01

    Full Text Available La multiplication récente des diagnostics archéologiques autour du petit bourg actuel de Bonnée a permis la détection d’une occupation du Bronze final IIIb (circa 900-750 av. n.-e. sur environ un hectare aux Terres à l’Est du Bourg. Les limites inhérentes à ce type d’intervention réduisent l’interprétation des structures et toute approche spatiale de ce probable habitat repéré. L’étude conjointe des différents mobiliers en particulier céramique et métallurgique, mais aussi le torchis et la faune, atteste de sa culture matérielle et de son intérêt. Ces scories pourraient être parmi les plus anciennes traces en région Centre d’activité métallurgique du fer. Des activités de post-réduction sont avérées et certaines opérations de forgeage sont supposées.La découverte de cet habitat dans ce secteur du lit majeur de la Loire, apporte de nouvelles données concernant l’occupation du sol et ses problématiques évolutives dans le Val d’Orléans sur ces périodes de transition avec le Hallstatt ancien.The recent increase in the archaeological evaluations around the village of Bonnée has enabled the discovery of a final Bronze Age IIIb settlement (circa 900-750 BP on about a hectare of the Terres à l’Est du Bourg. The limits inherent in this type of work restrict the interpretation of structures and all spatial approaches to this likely dwelling. The joint study of the different furnishings, in particular ceramics and metal, but also the cob and fauna, attests to its material culture and its interest. The slag could be amongst the oldest iron metallurgy remains from the Centre region. Some activities of post-forging are proven and certain operations are guessed at. The discovery of this settlement in this sector of the major bed of the Loire, has produced new data concerning the occupation of the land and its evolutionary problems in the valley of Orleans over these periods of transition in the early

  6. Pourquoi la Commission de la santé et de la sécurité du travail du Québec n’est pas le premier recours des enseignantes et des préposées à l’aide domestique ayant des lésions professionnelles

    Directory of Open Access Journals (Sweden)

    Nancy Guberman

    2005-05-01

    Full Text Available Cet article examine les motifs de deux groupes de travailleuses pour s’adresser ou pas à la Commission de la santé et de la sécurité du travail du Québec (CSST pour des lésions perçues comme étant liées au travail. Il est basé sur des entrevues qualitatives auprès de 16 enseignantes et de 16 préposées à l’aide domestique. Pour les deux groupes, les motifs de non-recours incluent la croyance que la CSST existe essentiellement pour les accidents et les retraits préventifs des femmes enceintes, l’image de la CSST comme un organisme qui accorde difficilement des indemnisations ainsi que la difficulté perçue de prouver le lien entre le travail et le problème de santé. Pour les préposées, le manque à gagner entre les prestations et le revenu d’emploi est aussi un facteur tandis que pour les enseignantes l’accès relativement facile à une assurance salaire joue contre le recours à la CSST. De plus, pour bien comprendre les choix des répondantes, il faut tenir compte de leur rapport à leur emploi et à leur santé et de la culture de leur milieu de travail.This article examines the motives behind the decisions of two groups of workers on whether or not to submit claims to the Workers’ Compensation Board (CSST for perceived work-related accidents or illnesses. It is based on qualitative interviews with 16 teachers and 16 cleaners. For both groups, motives for not making claims include the belief that the CSST is essentially for accidents and preventive work withdrawal for pregnant women, the view that compensation is difficult to obtain from the CSST, as well as a perceived difficulty of proving a relationship between their work and their health problem. For the cleaners, the difference between the compensation and employment income is also a factor, while for teachers, the fact that they have relatively easy access to wage-replacement insurance is one reason they do not submit claims to the CSST. To better

  7. Un oiseau "sabote" le CERN

    CERN Multimedia

    Colson, Sébastien

    2009-01-01

    Un oiseau, un simple oiseau, est parvenu à bloquer à lui tout seul l'accélérateur à particules à 3,7 milliards d'euros. UNe histoire quasiment bulresque qui a toutefois impacté le fonctionnement de la machine durant près de cinq jours, puisque c'est le système de refroidissement qui a été affecté. (1 page)

  8. Lutter contre le paludisme sans DDT

    International Development Research Centre (IDRC) Digital Library (Canada)

    Nancy Minogue

    La participation de la collectivité aux stratégies de contrôle, une surveillance ... Le contrôle de la maladie passe par une meilleure gestion de l'environnement. En vertu de ... de la santé humaine, ou écosanté, est un processus dynamique qui.

  9. Networking in the Desert - Operational and Analytical Challenges for MINUSMA in Mali

    DEFF Research Database (Denmark)

    Haugegaard, Rikke

    This paper will initiate a discussion of the operational and analytical challenges in understanding network dynamics in Mali, and how these dynamics can be seen as one source of conflict in Mali. The paper is based on a field visit to Mali in 2014....

  10. 48. Le pavillon Liliane de Stewart

    OpenAIRE

    Cameron, Christina; Déom, Claudine; Valois, Nicole

    2018-01-01

    Le pavillon Liliane de Stewart Le pavillon Liliane de Stewart est situé à l’arrière du pavillon Marguerite-d’Youville, qui lui est mitoyen. Il en constitue en quelque sorte un agrandissement, mais il s’en différencie par son plus petit volume (trois étages). Les deux pavillons partagent quelques caractéristiques architecturales, dont le plan angulaire et le revêtement de brique chamois. Le pavillon Liliane de Stewart se distingue cependant par sa fenestration, surtout celle de la façade avant...

  11. Toxins Produced by Valsa mali var. mali and Their Relationship with Pathogenicity

    Directory of Open Access Journals (Sweden)

    Caixia Wang

    2014-03-01

    Full Text Available Valsa mali var. mali (Vmm, the causal agent of apple tree canker disease, produces various toxic compounds, including protocatechuic acid, p-hydroxybenzoic acid, p-hydroxyacetophenone, 3-(p-hydroxyphenylpropanoic acid and phloroglucinol. Here, we examined the relationship between toxin production and the pathogenicity of Vmm strains and determined their bioactivities in several assays, for further elucidating the pathogenesis mechanisms of Vmm and for developing new procedures to control this disease. The toxins were quantified with the high performance liquid chromatography (HPLC method, and the results showed that the strain with attenuated virulence produced low levels of toxins with only three to four kinds of compounds being detectable. In contrast, higher amounts of toxins were produced by the more aggressive strain, and all five compounds were detected. This indicated a significant correlation between the pathogenicity of Vmm strains and their ability to produce toxins. However, this correlation only existed in planta, but not in vitro. During the infection of Vmm, protocatechuic acid was first detected at three days post inoculation (dpi, and the others at seven or 11 dpi. In addition, all compounds produced noticeable symptoms on host plants at concentrations of 2.5 to 40 mmol/L, with protocatechuic acid being the most effective compound, whereas 3-(p-hydroxyphenylpropanoic acid or p-hydroxybenzoic acid were the most active compounds on non-host plants.

  12. Peut-on voyager dans le temps ?

    CERN Multimedia

    CERN. Geneva

    2008-01-01

    La possibilité de voyager dans le temps est régulièrement évoquée par les magazines scientifiques (et parfois même par les scientifiques). Elle est également le sujet de nombreux romans de science-fiction. Nous discuterons d’abord du sens qu’on peut donner à l’expression « voyager dans le temps », puis nous expliciterons ce que la physique contemporaine dit à ce propos.

  13. Le beau et le vrai

    Directory of Open Access Journals (Sweden)

    Létitia Mouze

    2006-05-01

    Full Text Available La vie des abeilles de Maeterlinck est un ouvrage à la fois scientifique et littéraire, non pas parce qu’il appartiendrait à la science par son exactitude et à la littérature par son style, mais en ce qu’il invite à penser l’unité des deux domaines. Les aspects littéraires de l’ouvrage (beauté de l’écriture, usage des images, de l’analogie, etc. ne sont pas des accessoires, mais des outils indispensables à l’élaboration d’un authentique savoir sur les abeilles, c’est-à-dire un savoir qui reconnaît la part d’inconnu et le mystère qui subsistent en dépit de toutes les explications physiques et mécaniques que l’on peut par ailleurs donner des phénomènes observés. Etre scientifique, dans cette perspective, c’est-à-dire donner à connaître, c’est donc être littéraire. Cette conception de la science repose en dernière instance sur une conception philosophique de l’univers comme un tout où toutes choses sont reliées, unies, par des relations d’analogies, ce qui fonde et justifie l’emploi d’un style symboliste.The life of bees, one of Maeterlinck’s works, is together a scientific and literary book, not because of it scientific exactness and its literary style, but for the reason it suggests the unity of both these domains. Literay’s aspects of this work (writing’s beauty, use of images, analogy, etc. are not secondary but necessary to elaborate an authentic knowledge about bees, that means a knowledge which admit the unknown part and the mistery that subsist despite all the physical and mechanical explanations we can give moreover about the observed phenomenons. Be a scientist, in this sense, that is give something to know, therefore means be literary. Finally, this conception of science consist in a philosophiacl conception of Universe as a whole where everything links together, and is united by analogical relations, that base and justify the use of a symbolist style.

  14. French Military Intervention in Mali: Inevitable, Consensual yet Insufficient

    Directory of Open Access Journals (Sweden)

    Isaline Bergamaschi

    2013-06-01

    Full Text Available This practice note offers an account of France’s military intervention in Mali launched on 11 January 2013. Firstly, it provides an analysis of the events that led up to the dual crisis in the country’s northern and southern regions and to a new wave of armed conflict between government and rebel forces. Then, it is argued that although the French military intervention was framed as inevitable and based on a broad consensus, it will nevertheless be insufficient to address the root sociopolitical causes of Mali´s multidimensional crisis.

  15. Tabagisme et dysfonction erectile chez les personnes vivant avec le ...

    African Journals Online (AJOL)

    La dysfonction erectile (DE) est un probleme de sante publique qui altere la qualite de vie des patients. Chez les personnes infectees par le VIH, le tabagisme en association ii d'autres facteurs pourrait accroitre le risque de survenue de ce trouble. L'objectif de cette etude est de determiner la prevalence de laDE, les ...

  16. Initiative Think tank | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'ITT est le fruit d'un partenariat regroupant cinq bailleurs de fonds. Lancée en 2008, l'ITT est administrée par le Centre de Recherches pour le Développement International (CRDI), un organisme canadien.

  17. Le faussaire roman

    CERN Document Server

    D'Anna, Gianfranco

    2016-01-01

    À l'aube du XXIe siècle, le monde de la science est sur le point de vivre une révolution. Le jeune physicien allemand Albert Hendrick Thebell, des célèbres laboratoires de recherche B-Labs, à Summit, dans le New Jersey, publie, dans les plus grandes revues scientifiques internationales, une série d'articles dans lesquels il prétend avoir obtenu des résultats extraordinaires qui pourraient révolutionner les bases mêmes de la technologie. Rapidement, la communauté scientifique puis les médias saluent en lui un futur prix Nobel; on compare même son génie à celui d'Albert Einstein. Le progrès scientifique semble avoir franchi une étape décisive, susceptible d'amener un futur meilleur. Mais ces découvertes sont-elles authentiques ? Car pendant ce temps, dans les mêmeslaboratoires, des voix s'élèvent pour contester non seulement les théories de Thebell mais aussi la légitimité même de ses expériences ; certains le soupçonnent d'avoir combiné la plus grande fraude scientifique de tous l...

  18. Rapport financier trimestriel pour le trimestre qui a pris fin le 30

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sophie Comeau

    30 sept. 2011 ... politiques, de chercheurs et de collectivités de par le monde. ..... Financement : le CRDI est visé par l'Examen stratégique et ... Le Conseil des gouverneurs a amorcé la planification du recrutement du nouveau président.

  19. L'organisation territoriale en Colombie et les compétences des collectivités territoriales. Une action internationale est-elle possible depuis le contexte local?

    Directory of Open Access Journals (Sweden)

    Angel Tuirán Sarmiento

    2010-01-01

    Full Text Available Para entender con mayor claridad la forma como está construido el edificio de la organización territorial y las facultades de que gozan los entes territoriales en Colombia se hace necesario definir de antemano los conceptos de República unitaria, descentralización y autonomía. La autonomía otorgada por la descentralización a las colectividades territoriales ha traído consigo un aumento significativo en las competencias y facultades de los gobiernos locales, que están siendo confrontados a nuevas responsabilidades, viéndose en la necesidad de reforzar su capacidad de respuesta frente a las demandas y necesidades locales. Por tal motivo, las colectividades territoriales colombianas han trascendido sus fronteras en búsqueda de herramientas que posibiliten una mejor gestión de los asuntos locales; es así como las colectividades territoriales vienen interactuando en el escenario internacional con otros gobiernos locales, aprovechando la autonomía otorgada por el proceso de descentralización y las ventajas estratégicas que ofrece hoy día la globalización.

  20. AcEST(EST sequences of Adiantum capillus-veneris and their annotation) - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris

  1. L'internet nouveau est dans les "starting-blocks"

    CERN Multimedia

    Jennotte, A

    2001-01-01

    De nombreux chercheurs trouvent internet trop lent et limité. C'est pourquoi, ils travaillent sur un nouveau réseau : le Grid. Le Grid permettra de mieux partager les ressources informatiques en réseau (1 page).

  2. A grammar of Tadaksahak a northern Songhay language of Mali

    NARCIS (Netherlands)

    Christiansen-Bolli, Regula

    2010-01-01

    This dissertation is a descriptive grammar of the language Tadaksahak spoken by about 30,000 people living in the most eastern part of Mali. The four chapters of the book give 1. Information about the background of the group. 2. The phonological features of the language with the inventory of the

  3. Mali adolescents: early parenthood does not equal more choice.

    Science.gov (United States)

    1999-11-01

    This paper highlights the impact of laws and policies on reproductive rights in adolescents and young girls in Mali. The Center for Reproductive Law and the Association of Women Lawyers in the country uncovered several areas of concern on the adolescents in Mali. It was noted that 94% of the women in reproductive age have undergone female genital mutilation, also known as female circumcision. According to the report, 34% of the female adolescents have experienced pregnancy despite their knowledge that early pregnancies are critical risk factors in maternal and infant mortality. The adolescent pregnancy is attributed to their law, which permits girls to marry at an early age. Moreover, the low level of knowledge on contraceptives contributed to the increasing incidence of HIV/AIDS infection in the country. Also documented was the outlawing of abortion in Mali and is permitted only when the life of the woman is at risk. Because of this, adolescents flood to illegal abortions, putting themselves at risk of infection and complications. In response to this report, the UN recommended that Mali government should establish strategies against maternal mortality.

  4. Infant-Mother Attachment among the Dogon of Mali.

    Science.gov (United States)

    True, Mary McMahan; Pisani, Lelia; Oumar, Fadimata

    2001-01-01

    Examined infant-mother attachment in Mali's Dogon ethnic group. Found that distribution of Strange Situation classifications was 67 percent secure, 0 percent avoidant, 8 percent resistant, and 25 percent disorganized. Infant attachment security related to quality of mother-infant communication. Mothers of disorganized infants had significantly…

  5. Integrating agroforestry and sheep feed in Mali | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The challenge. Sheep herding plays a significant role in the livelihoods of rural households in Mali and other semi-arid countries of West Africa. Although sheep herding could improve the incomes of rural women, its potential is not being realized because a lack of feed reduces the meat production of sheep. Agroforestry ...

  6. Entre les violences conjugales et le harcèlement moral : le stalking .

    Directory of Open Access Journals (Sweden)

    Nicolas Desurmont

    2007-09-01

    Full Text Available Ce livre de la criminologue Murielle Anteo est le premier publié en langue française sur le stalking si l’on excepte les travaux encore inédits de Virginie Léon (2004. Comme le rappelle l’auteure, le terme est emprunté à l’anglais to stalk (hanter, rôder, et désigne un comportement menaçant, initié par un individu dont l’objectif conscient ou inconscient est l’objectivation de sa victime à des fins de domination. L’agression prend différentes formes : ...

  7. Lecture actentielle dans Trop c'est trop de Protais Asseng | IKANGA ...

    African Journals Online (AJOL)

    La naissance de cet enfant lui conférait le titre de "Papa national" Bakony symbolise la recherche de bonheur sur le dos d'un humain. C'est de l'exploitation de la femme par l'homme. Mais la multipare Bissabey, son épouse, n'est pas de son avis. Cette instrumentalisation est alors la pomme de discorde entre le couple et ...

  8. Enquête sur l’association entre les habitudes alimentaires, l’anthropométrie et le cancer colorectal: Etude cas-témoins dans une population de l’Est Algérien 2016-2017 [Survey on the association between eating habits, anthropometry and colorectal cancer: Case-control study in a population of eastern Algeria 2016-2017

    Directory of Open Access Journals (Sweden)

    Samira NEGRICHI

    2017-12-01

    Full Text Available Résumé Introduction. Des facteurs comme l’obésité et l’alimentation sont impliqués dans la carcinogenèse colique. Objectif. Une étude rétrospective cas-témoins est menée afin d’évaluer l’association de ces facteurs avec le cancer colorectal (CCR dans une population de l’Est Algérien. Matériel et méthodes. L’enquête a été réalisée entre avril 2016 et août 2017, au niveau de l'Etablissement Public Hospitalier de Bekaria à Tébessa et des Centres Anti-Cancer de Batna et d’Annaba. Soixante quatre patients atteints de CCR âgés de 51±12 et 64 témoins dont l’âge moyen était de 51±17 ans ont été recrutés. Le questionnaire utilisé a permis de collecter les informations concernant l’âge, le sexe, les mesures anthropométriques, les habitudes alimentaires et la fréquence de consommation de quelques aliments. Résultats. Une association significative est notée entre l’obésité et la prévalence du CCR (37,5 % des patients vs 20,31 % des témoins, p=0,048. L’indice de masse corporelle (IMC moyen des patients était plus élevé que celui des témoins. La prévalence du cancer atteint son maximum entre 50 et 59 ans. La consommation des céréales et des œufs est retenue comme facteur protecteur du CCR (p=0,046 et 0,028. Les témoins consomment plus de pâtes que les patients (P=0,054. Conclusion. Cette étude met en évidence l’association entre le cancer colorectal, l’obésité et la consommation de certains aliments chez les patients atteints de CCR. [Abstract Introduction. Factors such obesity and diet are involved in colon carcinogenesis. Objective. A retrospective case-control study was done to evaluate the association of these factors with colorectal cancer (CRC in eastern Algeria population. Material and methods. This study was conducted between April 2016 and August 2017, at the Bekaria public hospital in Tebessa, and the Anti-Cancer Centers of Batna and Annaba. Sixty four patients with

  9. (TEC) et ciblage des pauvres au Mali

    International Development Research Centre (IDRC) Digital Library (Canada)

    Comment est-ce que c'est vrai. La preuve par … □ Différentiel de ciblage entre P et NP. □ Part normalisée de consommation/achat des Pauvres. □ Part normalisée de la pression fiscale. (totale et de porte) sur les achats des P. □ Part normalisée des "exonérations" revenant aux Pauvres ...

  10. Le monde quantique

    CERN Document Server

    Aspect, A; Bensaude-Vincent, B; Castiel, A; Chevalley, C; Darrigol, O; Deligeorges, S; D'Espagnat, B; Laloë, F; Lévy-Leblond, J-M; Messiah, A; Paty, M; Vuillemin, J; Wheaton, B R

    1984-01-01

    Le monde quantique La physique quantique, après trois quarts de siècle, n'en finit pas d'être moderne. Elle est présente quotidiennement dans les laboratoires où les physiciens étudient atomes, noyaux et particules. Elle est entrée dans l'industrie où lasers, transistors et supraconducteurs lui doivent d'exister. Et elle continue à alimenter le débat philosophique sur la nature de la réalité dont elle montre la non-séparabilité fondamentale. Ses concepts de base, son développement, ses applications, ses controverses sont ici présentés par une pléiade de physiciens, d'historiens et de philosophes.

  11. Le vieillard et le chevalier

    Directory of Open Access Journals (Sweden)

    Mélanie JECKER

    2010-05-01

    Full Text Available La fin du Moyen Âge fascine. Deux facteurs principaux expliquent l’attraction qu’exerce cette période : elle apparaît d’une part comme un moment historique riche car double, phase de transition entre le Moyen Âge et la Renaissance, où se mêlent des cadres de représentation anciens et nouveaux. L’insinuation d’une pensée humaniste balbutiante s’y traduirait notamment par l’émergence de la notion d’individu, qui constitue l’un des objets de ce travail. Il faut invoquer, d’autre part, l’image macabre d’un bas Moyen Âge hanté par l’idée de la maladie et de la mort depuis l’épidémie de peste noire de 1348, obsédé par la brièveté de la vie humaine. Ces deux facettes de « l’automne du Moyen Âge » tel que l’évoque avec poésie Joan Huizinga sont-elles autre chose qu’une plaisante image d’Epinal? Cette étude cherche précisément à déterminer le degré de validité de ces deux topiques, à travers l’analyse de la représentation des âges de la vie dans un corpus bien défini, celui de la biographie chevaleresque castillane du XVe siècle. L’intérêt porté à l’individu, la conscience de la singularité impliquent en effet celle du caractère mouvant de la personne, or quel thème mieux que celui des âges permet de confirmer ou d’infirmer l’hypothèse du surgissement d’une nouvelle manière de concevoir l’homme, proprement « renaissante », en ce siècle de transition , La nature même du corpus retenu – des récits biographiques – suggère en effet une mutation dans l’appréhension de la personne, une attention prêtée à sa progressive transformation. L’étude de la représentation de la vieillesse, en particulier, révèle non seulement à quel point était alors réelle cette prétendue obsession de la déchéance physique et de la mortalité, mais aussi dans quelle mesure étaient soulignés et valorisés les changements individuels parallèles à l

  12. La Turquie face à la globalisation. Convergence d’intérêts entre les acteurs religieux particularistes : le cas du sud-est européen dans les années 1990 Turkey and Globalisation. Convergence of Interests between Particularists Religious Actors. The South-East Europe during the ’90s

    Directory of Open Access Journals (Sweden)

    Nikolaos Raptopoulos

    2011-03-01

    Full Text Available La globalisation, en favorisant l’interaction des idées et des hommes, est de ces facteurs qui sont capables de mettre en cause des systèmes sociopolitiques rigi­des. Cette contribution s’intéresse plus précisément au cas de figure du système kémaliste turc. L’islam turc, composante incontestée de l’identité nationale, est de plus en plus impliqué dans le système sociopolitique contemporain en tant qu’idéologie globalisante promue par certains acteurs. Cette situation, prévisi­ble pour la scène interne, se confirme aussi dans l’action et l’interaction des protagonistes au niveau international. En Turquie, l’islam, religion monothéiste, est devenu un véhicule d’interaction : d’une part entre l’État (laïc et nationa­liste et les acteurs sociaux islamiques ; d’autre part, entre ces mêmes acteurs et les communautés turques et musulmanes des régions de l’aire ottomane, no­tamment du sud-est de l’Europe.By fostering interaction globalization can question socio-political rigidity. This was the case with kemalist Turkey. Part and parcel of national identity, Turkish Islam is increasingly involved in the socio-political set up in the form of a global ideology. Recognizable locally, this process also carries international weight. Monotheistic Islam has acted in Turkey as a go-between : between the nationalistic, lay State and Islamic actors, between these latter and Islamic elements in regions of the former ottoman empire, notably in south-eastern Europe

  13. Le vernis des apparences

    Directory of Open Access Journals (Sweden)

    Grazia Nicosia

    2010-04-01

    Full Text Available Le but de cet article est de comprendre l’incidence sémiotique du nettoyage d’un tableau ainsi que la résultante cognitive induite sur l’observateur. Cette étude confronte l’analyse des phénomènes visuels engendrés par le jaunissement du vernis et son retrait, à des entretiens réalisés à dessein. Le retrait d’un vernis jauni change considérablement l’image. L’heure, le climat, la saison et l’activité même des personnages s’en trouvent ainsi modifié. La patine peut être perçue, soit comme un obstacle à l’exploration, soit pour ceux qui l’apprécient, comme le medium d’une relation plus intime entre l’œuvre et l’observateur.The purpose of this article is to understand the semiotic impact of the cleaning of a painting and the cognitive effects induced on the observer. This study analyses conjointly the visual phenomenon generated by yellowing varnish and its removal and controlled interviews of observers.The removal of yellowing varnish modifies considerably the perception of the picture. Daytime, climate, season and characters activities are modified. The patina may be perceived either as an obstacle to the painting exploration, or, for those who appreciate it, as a medium for a closer relationship between the painting and the observer.

  14. “La vida está fuera del tiempo”. León Tolstói entre la práctica vital y la predicación moral

    Directory of Open Access Journals (Sweden)

    Rabe, Ana María

    2010-10-01

    Full Text Available At the turn of the 20th century, Leo Tolstoy was considered an important ethical figure in Russia as well as in other cultural spheres. He was idolized as a moral example who preached life and work in the countryside in harmony with nature, charity, simplicity and denial of property; values that the aristocratic writer seemed to realize himself. At the same time, the public and ecclesiastic authorities of Russia feared the big influence emanating from the severe criticism and denunciations by which Tolstoy unveiled injustice, violence and hypocrisy of the Russian institutions. As the article shows, Tolstoyan ideas about love thas is realized here and now, denial of any recompense, nonviolent resistance, decease as a decline in everyday life and vital practice that is integrated in present played an important role in the intellectual circles of that time, e. g. in Bunin, Gorki, Heidegger, Gandhi, Nietzsche or Lukács. Tolstoy’s conception of life as pure present, as being “beyond” time and thus gaining felicity and eternity –an idea suggested by Saint Augustine–, impressed especially the young Wittgenstein. The article presents these ethical, religious and existential ideas as they appear in the Tolstoyan religio-theoretical writings and narrations while showing at the same time the contrary positions of Tolstoy’s thought and character on which they are built.

    A finales del XIX y principios del XX León Tolstói fue considerado un importante modelo ético dentro y fuera de Rusia. La gente del pueblo lo veneraba como ejemplo moral que predicaba la vida y el trabajo en el campo en concordancia con la naturaleza, el amor al prójimo, la sencillez y renuncia a la propiedad, valores que el escritor aristócrata parecía llevar él mismo a la práctica. A la vez, las autoridades estatales y eclesiásticas de Rusia temían la gran influencia que ejercían las severas críticas y acusaciones con las que el famoso novelista y

  15. [Reference values of neonatal erythrocyte and leukocyte count in Bamako, Mali].

    Science.gov (United States)

    Diallo, Dapa Aly; Diawara, Faoumata; Guindo, Aldiouma; Touré, Moustaph; Traoré, Mamadou; Fofana, Aïssata Traoré; Dembélé, Albdoul K; Guindo, Agnès; Diallo, Yacouba Lazare; Diallo, Oumahane; Baraika, Ag Mohamed; Dolo, Amadou Ingré

    2013-01-01

    Reference values for blood cell count are not established at birth in Mali. This study aimed to determine reference values for erythrocyte and leukocyte at birth in Bamako. Blood was collected from the umbilical cord immediately following its clamping and studied for complete blood cell count in 481 newborns with a birth weight > 2500g, Apgar score ≤ 7 at 5 or 10 minutes, without abnormal hemoglobin mutations and whose mothers were willing in Bamako, Mali. Other than the median and mean values, 2.5 and 97.5 percentiles were calculated. The findings suggest that the normal reference values following a timely clamping of the umbilical cord were (mean ± 1SD and range): RBC = 4,00 ± 0,46.1012/L (3,13 - 4,89), Hb = 14,12 ± 1,49 g/dL (11,20 - 17,00), Hct = 40,27 ± 4,71% (31,62 - 50,18), MCV = 101 ± 5 fl (91 - 112), MCHC = 35,37 ± 2,16 pg/cellule (30,70 - 39,59), MCH = 35,06 ± 0,93 g/dL (33,40 - 36,90), RDW = 17,79 ± 7,33% (15,50 - 20,39), Reticulocytes (109/L) = 133,081 ± 29,95 (66,62 - 200,86), GB (109/L) = 13,24 ± 7,23 (7,20 - 23,70), PMN (109/L) = 7,16 ± 4,70 (3,07 - 14,22), PME (109/L) = 0,28 ± 0,26 (0 - 0,98), PMB(109/L) = 0,05 ± 0,09 (0 - 0,31), Lymphocytes (109/L) = 4,49 ± 2,45 (1,96 - 9,42), Monocytes (10 9 /L) = 1,06 ± 0,73 (0,21 - 2,54), myelocytes = 1.43 ± 1.51%, erythroblasts = 4.52 ± 7.83%. It should be noted that male babies had a lower neutrophil count than female newborns. By taking into account these results when interpreting the blood cell count in Malian newborn infants, costly misdiagnoses should be considerably decreased in a population struggling with low incomes. Le comitée de rédaction se réserve le droit de revoyer aux auteurs avant toute soumission à l'avis des lecteurs les manuscrits qui ne seraient pas conformes à ces modalités de présentation. En outre il leur conseille de sonserver un examplaire du manuscrit, des figures et des tableaux.

  16. Analysis of the potential for sustainable, cassava-based bioethanol production in Mali

    DEFF Research Database (Denmark)

    Rasmussen, Kjeld; Bruun, Thilde Bech; Birch-Thomsen, Torben

    and solar resources in Mali 5) Screening of feasible applications of wind and solar energy in Mali: Assessment using the wind and solar maps for Mali The project is being carried out by a group of university departments, research institutions and consultants led by the UNEP Risø Centre (URC......The present project is covered in five main reports: 1) Analyses of the potential for sustainable, cassava-based bio-ethanol production in Mali 2) Agricultural residues for energy production in Mali 3) Pre-feasibility study for an electric power plant based on rice straw 4) Estimation of wind......) at the Technical University of Denmark (DTU) and conducted in cooperation with Direction Nationale de l’Energie (DNE) and Centre National de l’Energie Solaire et des Energies Renouvelables (CNESOLER) in Mali. The subcontracted institutions comprise Geographic Resource Analysis & Science A/S (GRAS), Department...

  17. Le Projet d’Ole Lando sur les Contrats

    DEFF Research Database (Denmark)

    Holle, Marie-Louise

    2017-01-01

    En 2016 le projet de recherche le plus important jusqu’à présent sur le droit nordique des contrats a pris fin et un livre, de presque 400 pages, en a marqué l’aboutissement. Le résultat du projet est un « restatement » tel qu’il existe aux États-Unis. Le Restatement porte sur les règles et les...

  18. Dans le tourbillon des particules

    CERN Document Server

    Zito, Marco

    2015-01-01

    Accélérateurs géants, détecteurs complexes, particules énigmatiques... La physique subatomique peut sembler bien intimidante pour le novice. Et pourtant, qui n a jamais entendu parler du boson de Higgs et du CERN, le laboratoire européen où il a été découvert en 2012 ? Nul besoin d être un spécialiste pour comprendre de quoi il s agit. Aujourd hui, une théorie extraordinairement élégante, le Modèle Standard, décrit tous les résultats des expériences dans le domaine. Trente-sept particules élémentaires et quatre forces fondamentales : c est tout ce dont nous avons besoin pour expliquer la matière et l Univers ! Ce livre, destiné à un large public, raconte sans équations le long parcours qui a abouti au Modèle Standard. Ce parcours, parfois sinueux, a été entamé lorsque les Grecs anciens, et peut-être d autres avant eux, ont imaginé que la matière est composée de petites « billes ». Il faudra attendre plusieurs siècles pour qu on réalise que la matière, à l échelle micros...

  19. Le LHC, un tunnel cosmique

    CERN Multimedia

    CERN. Geneva

    2009-01-01

    Et si la lumière au bout du tunnel du LHC était cosmique ? En d’autres termes, qu’est-ce que le LHC peut nous apporter dans la connaissance de l’Univers ? Car la montée en énergie des accélérateurs de particules nous permet de mieux appréhender l’univers primordial, chaud et dense. Mais dans quel sens dit-on que le LHC reproduit des conditions proches du Big bang ? Quelles informations nous apporte-t-il sur le contenu de l’Univers ? La matière noire est-elle détectable au LHC ? L’énergie noire ? Pourquoi l’antimatière accumulée au CERN est-elle si rare dans l’Univers ? Et si le CERN a bâti sa réputation sur l’exploration des forces faibles et fortes qui opèrent au sein des atomes et de leurs noyaux, est-ce que le LHC peut nous apporter des informations sur la force gravitationnelle qui gouverne l’évolution cosmique ? Depuis une trentaine d’années, notre compréhension de l’univers dans ses plus grandes dimensions et l’appréhension de son comportement aux plus peti...

  20. Le livre sur le livre traité de documentation

    CERN Document Server

    Otlet, Paul

    2015-01-01

    Paul Otlet est considéré comme le père des sciences de l'information. Ouvrage fondateur et fondamental, le Traité de documentation. Le livre sur le livre (1934) est l'aboutissement de son travail inlassable pour rassembler, classer et partager les connaissances. Otlet y propose une remarquable synthèse du savoir sur le livre et le document en même temps qu'il anticipe Internet et l'hypertexte. La réédition du Traité de documentation, 70 ans après la disparition de son auteur, coïncide avec la réouverture du Mundaneum à Mons, où le fabuleux héritage documentaire légué par Paul Otlet et Henri La Fontaine est conservé. « Ici, la table de travail n'est plus chargée d'aucun livre. À leur place se dresse un écran et à portée un téléphone. Là-bas, au loin, dans un édifice immense, sont tous les livres et tous les renseignements. De là, on fait apparaître sur l'écran la page à lire pour connaître la réponse aux questions posées par téléphone. » Préfaces de Benoît Peeters (éc...

  1. Technical support by Solthis for health-care workers in order to decentralise medical treatment for people living with HIV in the Ségou region of Mali

    Directory of Open Access Journals (Sweden)

    A. Akonde

    2009-01-01

    Full Text Available Medical treatment for people living with HIV/AIDS started in Mali as early as 1997 thanks to civil society. The national response was officialised by the adoption of the Malian Initiative for Access to Antiretroviral Therapy (Initiative Malienne d’Accès aux Antirétroviraux IMAARV. In 2004 ART, drugs against opportunistic infections and basic biological monitoring were made available free of charge by decree. In 2005, decentralisation of health-care to regions and circles became one of the main thrusts of the national strategy for the fight against the pandemic. Sub-Saharan African countries are making significant efforts to provide full geographical coverage of their national territory.It is in this “scaling-up” context that the Solthis NGO (Solidarité Thérapeutique et Initiatives contre le Sida began cooperating with Malian actors to extend access to quality treatment for patients living with HIV/AIDS in the city and region of Ségou. Based on a developmental approach, Solthis opted for continuing in situ technical support for national actors in the fight against AIDS. Thanks to the daily presence of a team “in the field” Solthis devotes a large part of its activities to capacity-building for health-care workers through an exchange of medical and scientific expertise. Efforts were also made to improve health-care workers’ working conditions and to make various tests and drugs accessible to patients infected with HIV. The initial aim was to encourage universal access to ART. Today, the Ségou programme supported by Solthis has developed over 1,500 new treatments in the region. In addition, every PMTCT centre in the region offers prevention and treatment services to mothers and children. Today, the Ségou region is an integral part of the IMAARV initiative as a decentralisation pilot project.Le traitement médical des malades atteints du VIH/SIDA a débuté au Mali dès 1997 grâce à la société civile. La r

  2. Development of the Falea Polymetallic Uranium Project, Mali

    International Nuclear Information System (INIS)

    Ring, Bob; Freeman, Paul

    2014-01-01

    Falea project basics: • Project now owned by Denison Mines; • ANSTO Minerals working with owner and their consultant, DRA; • Located in south western Mali, West Africa, near the intersection of the Senegal and Guinea borders; • Established mining region (mainly gold); • Location on plateau favourable for underground operation; • Significant uranium, silver and copper mineralisation - different to other U deposits; • Excellent metallurical outcomes to date

  3. [Hyperthyroidism in children. Experience in internal medicine in Mali].

    Science.gov (United States)

    Sidibé, A T; Dembélé, M; Diarra, A S; Bocoum, A I; Mousseni, E; Ag Aboubacrine, S; Traoré, H A; Ag Rhaly, A

    2007-06-01

    Thyroid pathology is frequent in Mali, which is an endemic zone for goiter. But this pathology rarely occurs in children. The purpose of our study was to characterize this illness among children in Mali. We report on patients aged less than 15-year old who presented with clinical signs and symptoms with hyperthyroidism at the medicine service at Hospital de Point G from January 1999 and December 2005 to determine the characteristics of hyperthyroidism. The frequency was 9.6 per thousand (38/3972), with an average age of 12.5+/-3.34-year. The sex ratio was 3 girls/1 boys. The most common symptoms were tachycardia (n=30, 78.9%), palpitations (n=15, 34.4%). 31 patients (81.5%) presented with exophthalmoses, 93.5% being bilateral. Weight loss was present in 31.5% (n=12). Goiter was present in 37 patients (97.4%). The goiter was diffuse in 27 patients (73%) and nodular in 10 (27.%). The presence of goiter caused signs of compression in the neck in half of the cases: dyspnea and dysphonia were the most common consequences. TSH less than 0.05 microUI/1 was used to confirm the diagnosis. Graves's disease was the most common cause (n=32, 84.2%), followed by toxic adenoma (n=4, 10.5%). Other causes included toxic multinodular goiter and thyroiditis. Etiologies were independent of sex and age: (p=0.95). All patients were started on medical therapy upon diagnosis. 7 patients (18.4%) were lost to follow-up during the 6 months of treatment. Remission was obtained in 26 patients (83.9%), and relapse occurred in 5 patients (16.1%). The frequency of hyperthyroidism in children in Mali is a problem in a goiter endemic zone like Mali. Poor general health in children and signs and symptoms of neck compression are markers of progressive disease.

  4. Estimation of wind and solar resources in Mali

    Energy Technology Data Exchange (ETDEWEB)

    Badger, J.; Kamissoko, F.; Olander Rasmussen, M.; Larsen, Soeren; Guidon, N.; Boye Hansen, L.; Dewilde, L.; Alhousseini, M.; Noergaard, P.; Nygaard, I.

    2012-11-15

    The wind resource has been estimated for all of Mali at 7.5 km resolution using the KAMM/WAsP numerical wind atlas methodology. Three domains were used to cover entire country and three sets of wind classes used to capture change in large scale forcing over country. The final output includes generalized climate statistics for any location in Mali, giving wind direction and wind speed distribution. The modelled generalized climate statistics can be used directly in the WAsP software. The preliminary results show a wind resource, which is relatively low, but which under certain conditions may be economically feasible, i.e. at favourably exposed sites, giving enhanced winds, and where practical utilization is possible, given consideration to grid connection or replacement or augmentation of diesel-based electricity systems. The solar energy resource for Mali was assessed for the period between July 2008 and June 2011 using a remote sensing based estimate of the down-welling surface shortwave flux. The remote sensing estimates were adjusted on a month-by-month basis to account for seasonal differences between the remote sensing estimates and in situ data. Calibration was found to improve the coefficient of determination as well as decreasing the mean error both for the calibration and validation data. Compared to the results presented in the ''Renewable energy resources in Mali - preliminary mapping''-report that showed a tendency for underestimation compared to data from the NASA PPOWER/SSE database, the presented results show a very good agreement with the in situ data (after calibration) with no significant bias. Unfortunately, the NASA-database only contains data up until 2005, so a similar comparison could not be done for the time period analyzed in this study, although the agreement with the historic NASA data is still useful as reference. (LN)

  5. Quantitative analysis of nickel in zirconium and zircaloy; Dosage du nickel dans le zirconium et dans le zircaloy

    Energy Technology Data Exchange (ETDEWEB)

    Rastoix, M [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1957-07-01

    A rapid spectrophotometric has been developed for determination of 10 to 1000 ppm of Ni in zirconium and zircaloy using dimethylglyoxime. Iron, copper, tin and chromium, do not interfere at the concentration usually present in zirconium and its alloys. (author) [French] On determine colorimetriquenent 10 a 1000 ppm de Ni dans le zirconium et le zircaloy par photo colorimetrie a 440 m{mu} de la dimethylglyoxime nickelique. Le dosage est rapide. Le fer, le cuivre, l'etain, le chrome ne genent pas aux concentrations habituellement rencontrees dans le zirconium et ses alliages. (auteur)

  6. Le language des masques burkinabè

    African Journals Online (AJOL)

    hond

    2 juil. 2007 ... un faire transformateur cognitif devient un esprit qui a des fonctions hautement spirituelles, religieuses et aussi souvent esthétiques. Le langage et le discours des masques. Les masques sont un langage et un discours. Un langage est un système de communi- cation et d'expression. L'unité de base de ...

  7. Hyperloop : le droit et le devoir de douter...

    OpenAIRE

    Crozet , Yves

    2016-01-01

    National audience; C’est comme si c’était fait ! Les journaux les plus sérieux (Les Echos) nous annoncent que le premier test du prototype Hyperloop dans le désert du Nevada est un succès. Le projet futuriste d’Elon Musk se concrétise. Un véhicule terrestre de transport collectif va bientôt se déplacer à plus de 1000 km/h entre San Francisco et Los Angeles. Comme pour donner du crédit à cette information, la SNCF, via sa filiale SYSTRA va devenir partenaire du projet. Déjà les journaux de Pro...

  8. [Mali: the offer of education disturbed by demographic variables].

    Science.gov (United States)

    Tounkara, B

    1990-12-01

    Although educational reforms in 1962 have played a positive role in the socioeconomic and cultural development of Mali, the most recent analyses of the educational system have shown it to be in crisis for reasons both endogenous and exogenous. Huge class sizes, lack of teaching materials, and insufficient training of teachers have affected the quality of education. 80% of Mali's population is illiterate but the rate of school attendance is under 30%. Financial resources devoted to education have not grown as fast as population. The situation is made worse by structural adjustment programs of the past few years that have encouraged the government share of educational expenses to decline and the role of parents and the private sector to increase. The 1987 Demographic and Health Survey showed that Mali's rate of population growth is 2.7%/year. 45% of the population is under 15, amounting to some 3.5 million children. Great efforts are needed just to provide schools and teachers and to maintain the rate of school attendance at its current level of 27%, 1 of the lowest in the world. To attain the goal of 50% school attendance by the year 2000, the number of students beginning primary school should increase by 11.3% per year. But currently the number of students aged 6-11 is actually shrinking by almost 1% per year. At the level of the family, the expenses of school attendance are an important factor in nonattendance. The high annual costs constitute an insurmountable barrier for parents of large families. The loss of children's labor in rural areas is an added cost of schooling. School attendance in Mali is becoming a source and means of social inequality. The seasonal or permanent migration of a large part of the population has also been an obstacle to school attendance. the unavailability of mothers who teach during their 3 months of maternity leave and 2 hours daily break for breast feeding, in addition to absenteeism when their children are sick, is another effect

  9. Characterizing the insecticide resistance of Anopheles gambiae in Mali.

    Science.gov (United States)

    Cisse, Moussa B M; Keita, Chitan; Dicko, Abdourhamane; Dengela, Dereje; Coleman, Jane; Lucas, Bradford; Mihigo, Jules; Sadou, Aboubacar; Belemvire, Allison; George, Kristen; Fornadel, Christen; Beach, Raymond

    2015-08-22

    The impact of indoor residual spraying (IRS) and long-lasting insecticide nets (LLINs), key components of the national malaria control strategy of Mali, is threatened by vector insecticide resistance. The objective of this study was to assess the level of insecticide resistance in Anopheles gambiae sensu lato populations from Mali against four classes of insecticide recommended for IRS: organochlorines (OCs), pyrethroids (PYs), carbamates (CAs) and organophosphates (OPs). Characterization of resistance was done in 13 sites across southern Mali and assessed presence and distribution of physiological mechanisms that included target-site modifications: knockdown resistance (kdr) and altered acetycholinesterase (AChE), and/or metabolic mechanisms: elevated esterases, glutathione S-transferases (GSTs), and monooxygenases. The World Health Organization (WHO) tube test was used to determine phenotypic resistance of An. gambiae s.l. to: dichlorodiphenyltrichloroethane (DDT) (OC), deltamethrin (PY), lambda-cyhalothrin (PY), bendiocarb (CA), and fenitrothion (OP). Identification of sibling species and presence of the ace-1 (R) and Leu-Phe kdr, resistance-associated mutations, were determined using polymerase chain reaction (PCR) technology. Biochemical assays were conducted to detect increased activity of GSTs, oxidases and esterases. Populations tested showed high levels of resistance to DDT in all 13 sites, as well as increased resistance to deltamethrin and lambda-cyhalothrin in 12 out of 13 sites. Resistance to fenitrothion and bendiocarb was detected in 1 and 4 out of 13 sites, respectively. Anopheles coluzzii, An. gambiae sensu stricto and Anopheles arabiensis were identified with high allelic frequencies of kdr in all sites where each of the species were found (13, 12 and 10 sites, respectively). Relatively low allelic frequencies of ace-1 (R) were detected in four sites where this assessment was conducted. Evidence of elevated insecticide metabolism, based on oxidase

  10. Le modèle spatial de la capitale allemande

    Directory of Open Access Journals (Sweden)

    Antoine Laporte

    2013-06-01

    Full Text Available En Allemagne, en 1999, le Chancelier fédéral et son gouvernement ont quitté Bonn pour Berlin. Ce transfert du pouvoir est accompagné de celui d’une grande partie de l’appareil d’État et de la haute administration, et des fonctions qui leur sont traditionnellement attribuées comme la presse, les lobbys ou encore la diplomatie. Le déplacement du statut de capitale effective de l’Allemagne de Bonn à Berlin est le résultat des évolutions géopolitiques d’un pays ayant recouvré son unité et sa pleine et entière souveraineté. Installer le pouvoir exécutif et législatif à Berlin était une démarche hautement symbolique, visant à normaliser la position de l’ancienne capitale de la RDA et du IIIe Reich comme véritable centre politique de l’Allemagne. Or le déplacement des institutions fédérales n’est pas qu’un acte symbolique. Il entraîne également à l’échelle intra-urbaine des dynamiques très concrètes sur le tissu urbain et participe à la mise en place de nouvelles centralités dans la ville. En effet, le statut de capitale d’État prédestine l’agglomération à la coprésence de nombreuses fonctions urbaines spécifiques plus ou moins directement liées à l’exercice ou à la symbolique du pouvoir.

  11. Le contrôle de gestion environnementale d'une entreprise

    OpenAIRE

    Marquet-Pondeville, Sophie

    2001-01-01

    Dans cette recherche, nous étudions comment s’opère le contrôle de gestion environnementale. Cette problématique est abordée dans une perspective contingente et nous proposons un modèle théorique qui met en évidence l’impact de certaines variables sur les systèmes de contrôle de la gestion environnementale. Certains liens présents dans ce modèle sont discutés à travers une étude de cas.

  12. Sexospécificités | Page 192 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    DOCUMENT D'INFORMATION. Le paludisme tue un enfant africain toutes les 30 secondes. Avec le VIH/sida et la tuberculose, le paludisme est l'un des principaux problèmes de santé publique menaçant le développement des pays les plus pauvres. – fiche d'information « Qu'est-ce que le paludisme ? » de l'OMS.

  13. EST! best practices

    Science.gov (United States)

    2000-10-05

    This booklet presents the eighteen winners in a competition for projects that promote environmentally sustainable transportation (EST). These range from car sharing to hydrogen fueled buses to public transit promotion campaign. Each project is presen...

  14. Est-ce 'la' ou 'le'? Un apprentissage difficile

    NARCIS (Netherlands)

    van der Linden, E.; Cuniţă, A.; Florea, F.; Păunescu, M.-O.

    2011-01-01

    A study of the acquisition of nominal gender in Germanic and Romance languages by monolingual and bilingual children on the one hand and second language learners on the other shows that gender is difficult to acquire in all languages for L2 learners. In the same time, it is shown that in Romance

  15. Profil lipidique des personnes vivant avec le VIH sous antirétroviral ...

    African Journals Online (AJOL)

    Au regard des connaissances actuelles, aucune étude n'est disponible au Bénin sur le profil lipidique des personnes vivant avec le VIH. L'objectif de la présente étude est de décrire le profil lipidique des personnes vivant avec le VIH sous antirétroviral suivies au CHU-O/P de Porto-Novo. Il s'est agi d'une étude ...

  16. Kenya | CRDI - Centre de recherches pour le développement ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le Kenya est depuis longtemps le centre économique de l'Afrique de l'Est. Cependant, malgré des progrès économiques considérables au cours de la dernière décennie, la pauvreté et des inégalités persistent. Le bureau du CRDI à Nairobi est le point central des efforts du Centre en Afrique subsaharienne et il supervise ...

  17. Le réseau GEOHealth d'Afrique orientale pour la prévention des ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ce projet est mis en oeuvre dans le cadre de l'initiative Global Environmental and Occupational Health, sous la direction du Fogarty International Center des National Institutes for Health des États-Unis, en collaboration avec le Centre de recherches pour le développement international. Le volet de recherche générale est ...

  18. L’Association du personnel, le TREF, le Comité des Finances et le Conseil du CERN

    CERN Multimedia

    Staff Association

    2016-01-01

    L’Association du personnel, forte de son approche participative et consensuelle, recherche toujours le meilleur accord possible pour l’Organisation et son personnel. Pour ce faire, discussions et concertation avec la Direction, travail d’explication et de persuasion au TREF et ailleurs auprès des délégués des États membres sont nos principaux atouts. TREF (Tripartite Employment Conditions Forum), un Forum d’échanges, de discussions « L’objectif du Forum est d’améliorer le processus de prise de décision  en donnant aux personnes concernées la possibilité et le temps de comprendre pleinement la position de tous les participants. » (CERN/RTG/8) Le Forum tripartite sur les conditions d’emploi (TREF), créé par le Conseil du CERN en juin 1994, est composé de r...

  19. Le vase de Pandore

    Directory of Open Access Journals (Sweden)

    Nicola Panichi

    2000-06-01

    Full Text Available Il s’agit ici de suivre les stratégies discursives par lesquelles Érasme situe sa Lingua sous le patronage symbolique de deux mythes des plus opératoires à la Renaissance : le vase de Pandore et la tour de Babel, tous deux verrouillant le texte, l’un en guise d’incipit, l’autre d’explicit, dans un dialogue où chacun use de l’autre pour renforcer les significations et instaurer le régime sémantique du texte, tant linguistique qu’éthique. Ce sont ces jeux complexes entre différents niveaux de discours dont dépend le sens ultime de l’œuvre que cet article s’attache à saisir.Se trata de seguir aquí las estrategias discursivas mediante las cuales Erasmo sitúa su Lingua bajo el dominio simbólico de dos de los mitos más funcionales del Renacimiento: el vaso de Pandora y la torre de Babel, los cuales limitan el texto, uno a modo de íncipit, otro de excipit, en un diálogo en el que se valen el uno del otro para reforzar los significados y establecer el régimen semántico del texto, tanto lingüístico como ético. Son esos juegos complejos entre diferentes niveles de discurso, de los que depende el sentido último de la obra, que este artículo intenta captar.

  20. Publications | Page 192 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L''objectif de cette étude est d''établir des relations entre les perceptions locales ... comme sujet d''une grande pertinence dans la recherche en sciences sociales. ... La recherche sur lele économique et social du secteur informel des TIC est ...

  1. Le commerce du Nord

    OpenAIRE

    Pourchasse, Pierrick; Bouëdec, Gérard Le

    2015-01-01

    Au XVIIIe siècle, la France s'approvisionne abondamment dans les pays du Nord : bois, chanvre et goudron de la Baltique, tonnellerie de Poméranie, pêche de rogue de Norvège, graines de lin de Courlande, barres de fer suédois… Sa balance commerciale est pourtant positive grâce aux sels, aux vins et surtout des nouvelles marchandises coloniales. Or, la plupart des transactions passent par l’incontournable intermédiaire hollandais. Les explications sur l’absence des Français dans le Nord sont re...

  2. Le plurilinguisme du perroquet

    Directory of Open Access Journals (Sweden)

    Manuel Mühlbacher

    2012-05-01

    Full Text Available La figure du perroquet occupe une position ambiguë face à la question de la traduction. Il est capable d’imiter des paroles en toutes les langues, mais il n’est capable d’en comprendre aucune — il ne peut que répéter des sons, c’est-à-dire des signifiants. Le traducteur semble faire le contraire quand il passe d’une langue à une autre en tâchant de transmettre une signification semblable par d’autres signes. L’article vise à discuter lele du traducteur et sa relation, éventuellement équivoque, au perroquet, en analysant la traduction allemande de Trois Contes par André Stoll et Cora van Kleffens. Un décalage au niveau sémantique peut éclairer l’interprétation du texte, par exemple en explicitant des allusions sous-jacentes, tandis que le transfert de la syntaxe française en allemand pose souvent des problèmes considérables. Comment le traducteur peut-il reproduire des structures syntaxiques qui n’existent pas en allemand, mais qui ne cessent de revenir dans le texte français ? Que faire si le texte se met à jouer au perroquet et finit par se singer lui-même ? André Stoll et Cora van Kleffens ont su trouver des stratégies pour affronter ces difficultés.The figure of the parrot holds an ambiguous position towards the question of translation. It is able to imitate all languages, but it will never understand any of them – its only skill is to mimic sounds, i.e. mere signifiers. On the contrary, the translator seems to be the antithesis of the parrot when he moves from one language to another. He endeavours to convey a similar meaning, but by different signs. The article aims at discussing the role of the translator and his or her eventually equivocal relation to the parrot by means of analysing the German translation of Trois Contes by André Stoll and Cora van Kleffens. Whereas a semantic divergence can result in a different tendency on the level of interpretation, as in the case of an underlying

  3. EST Vocabulary Instruction

    Directory of Open Access Journals (Sweden)

    Célia D.S. Bell

    2012-05-01

    Full Text Available This study aims at contributing to the investigation on the instruction of EST (English for Science and Technology vocabulary, in terms of receptive use of the language. It evaluates the effectiveness of two teaching approaches to the acquisition of vocabulary. The first approach consisted of teaching vocabulary through the use of dictionaries, where the words were merely translated into the learners’ L1 or defined in the target language thus promoting superficial level of word processing. The second approach employed activities promoting deep level of word processing. Data were analysed quantitatively. Results indicated that the two approaches seem to have some equipotentiality, as far as EST vocabulary is concerned.

  4. LE CARCINOME ONCOCYTAIRE DE LA PAROTIDE : A PROPOS D ...

    African Journals Online (AJOL)

    Après chirurgie, les récidives sont fréquentes. Lele de la radio- thérapie et de chimiothérapie est toujours controversé.Le pronostic est mauvais. Mots clés : Carcinome oncocytaire, parotide, chirurgie, radiothérapie. SUMMARY. Introduction : Oncocyticcarcinomais a rare salivary gland tumor. its management is not codified ...

  5. Une nouvelle ouverture sur le monde pour les femmes | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    'appellent ailleurs dans le dédale d'étals et d'allées serrés. En plus de son travail sur le marché, Jertrudes est également secrétaire de l'association des femmes qui vendent sur ce marché. Le groupe est un endroit où elles ...

  6. Publications | Page 10 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'obésité est un facteur de risque de plusieurs maladies non transmissibles, dont les cardiopathies, l'hypertension, le diabète et le cancer. Conflit et développement dans les collines de Guwahati. Dans la ville de Guwahati, dans le nord-est de l'Inde, la croissance rapide a alimenté une explosion de développement non ...

  7. La parole est à vous

    CERN Multimedia

    Staff Association

    2015-01-01

    Nous avons identifié, ci-dessous, 3 grands chapitres pour lesquelles bon nombre d’entre vous se posent des questions et ont fréquemment sollicités leurs délégués, qui n’ont pas toujours pu donner de réponses : La retraite et sa préparation. L’affiliation aux régimes sécurité sociale de nos états hôtes et ses conséquences au moment de la retraite. La fiscalité en général. Le service juridique, que nous avons interrogé récemment, n’est pas toujours informé de vos interrogations et de ce fait, il n’a pas encore pu investiguer sur ces questions auprès des services compétents. Il nous a suggéré de vous interroger afin de collecter vos questions, de les synthétiser, afin de les transmettre...

  8. 205 Le Role de la Litterature dans le Developpement de la Nation ...

    African Journals Online (AJOL)

    Ike Odimegwu

    du plaisir en même temps qu'il le moralise. Elle fait naître dans ses lecteurs ou dans son audience des .... développement de l'esprit>>(319)Par cette définition nous comprenons que le développement signale qu'il du progrès ... qu'elle est une œuvre de l'imagination qui aide l'homme à transcender le monde physique.

  9. Le « modèle germanique » Français

    OpenAIRE

    Lefebvre , Armelle

    2009-01-01

    Resume Le concept d?Allemagne permet de reveler, selon une approche , l?ampleur des desaccords ayant preside a la definition du concept d?Etat en France. De ce dernier, l?on aborde divers emplois qu?illustrent des modeles d?Etat. Le opere ainsi dans un debat qui est le creuset de la connaissance politique moderne, avec ses apories: celles de la souverainete externe, de l?ordre interetatique, de la confederation. L?article expose alo...

  10. Can the UN Stabilize Mali? Towards a UN Stabilization Doctrine?

    Directory of Open Access Journals (Sweden)

    Arthur Boutellis

    2015-06-01

    Full Text Available Almost two years after the deployment of the United Nations Multidimensional Integrated Stabilization Mission in Mali (MINUSMA in July 2013, the increasing number of asymmetric terrorist attacks targeting UN peacekeepers – in the context of a drawn-out peace process – has raised a number of questions in Mali, the sub-region, and in New York, over the relevance and adequacies of MINUSMA’s mandate and capabilities. It also raises a broader issue, of whether the consent-based UN peacekeeping tool is appropriate and can be effective in carrying out stabilization mandates in such a context and what doctrine such operations should be based on. The UN is indeed under increasing pressure from host countries and some African troop-contributing countries to go on the offensive. Member States have also increasingly recognized terrorism and organized crime as a strategic threat, and while opposed to the UN directly engaging in counterterrorism (CT operations, some may wish to see the UN playing a greater stabilization role following the January 2013 French military intervention in Mali. However, little guidance and means have been given so far to UN missions for dealing with such threats and implementing effective stabilization mandates. The High-Level Panel on Peace Operations, which recently released its report, noted that the usage of the term “stabilization” by the UN requires clarification. This article analyses the complex and evolving nature of threats in northern Mali and implications for MINUSMA and describes the military and political tools – including mediation – so far available within and outside the UN. The article concludes that the UN is bound to move towards stabilization when and if deployed in contexts such as Mali’s if it wants to remain relevant. However, such a move should be based on an overarching UN stabilization doctrine and context-specific UN-wide stabilization strategies which are first and foremost political

  11. La migration féminine au Mali

    OpenAIRE

    KEITA, Modibo

    2011-01-01

    Euro-Mediterranean Consortium for Applied Research on International Migration (CARIM) Les données et les recherches au sujet de la migration féminine au Mali sont rares. Cet article, qui privilégie une approche qualitative, suggère d’approfondir la question de la relation entre migration féminine et promotion de la femme, autrement dit la connaissance des conséquences de la migration féminine aux plans individuel, social, économique et culturel. Cette question renvoie, plus largement, à la...

  12. Plaidoyer pour le lavage de nez dans les pathologies naso ...

    African Journals Online (AJOL)

    Le lavage de nez permet l'humidification des muqueuses partant favorise le nettoyage mucociliaire en enlevant voire diminuant les croutes favorise leur élimination et ainsi la guérison en réduisant le recours aux antibiotiques [4-10]. Sans danger, le lavage de nez est bien tolérée tant chez les enfants que chez les adultes.

  13. Centre de recherches pour le développement international ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    André Lavoie

    Definitions. 5. Rôles et ... a) Le Centre de recherches pour le développement international (CRDI) est une société d'État canadienne à .... conduite éthique dans le cadre de ces activités afin que la confiance du public dans .... a) Les gouverneurs en déplacement pour le compte du CRDI ont droit à une indemnité de repas et ...

  14. Gestion du Centre | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le Comité de gestion du Centre (CGC) est composé des membres de la haute direction du CRDI, notamment les directeurs de nos quatre bureaux régionaux et de nos principaux secteurs de programme. Le CGC travaille en collaboration avec le président afin de soutenir la recherche pour le développement, lui fournissant ...

  15. Le grand inventaire

    Directory of Open Access Journals (Sweden)

    Michel Melot

    2012-05-01

    Full Text Available Depuis quarante ans qu’il existe, l’Inventaire général des monuments et des richesses artistiques de la France n’a pas seulement progressé, couvrant près de dix mille communes, documentant plus de vingt mille dans cinq millions de pages, trois millions de photographies, et cent mille dessins. Il est devenu ce que ses fondateurs désiraient qu’il fût. Il n’est pas une liste d’objets plus ou moins singuliers qu’on aurait oubliés, mais l’observation méthodique de l’émergence dans le monde de l’ar...

  16. Le paludisme, le tsunami silencieux d'Afrique | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    12 janv. 2011 ... Dans un élan de compassion fort justifié, le monde s'est porté au secours des victimes du tsunami qui a touché récemment la région de l'océan Indien. Mais il ignore qu'un « tsunami silencieux », le paludisme, s'abat sans cesse sur l'Afrique et y fait chaque année plus de 1,5 million de victimes, surtout de ...

  17. Les porphyres luganais entre le Lac de Lugano et la Valganna

    NARCIS (Netherlands)

    Sitter, de L.U.

    1925-01-01

    Le terrain exploré est limité au Nord par une ligne droite, qui va de Ghirla en passant par Marzio à Brusimpiano. La limite Est est formée par le lago di Lugano et par la vallée de Porto Ceresio jusqu’à Pogliana. La limite Sud est plus irrégulière; elle passe au Sud de Pogliana vers le sommet de la

  18. [Doctoral thesis: Demographic growth and economic and social development in Mali].

    Science.gov (United States)

    Dabo, K

    1999-12-01

    A doctoral thesis is described analyzing the relationships between demographic growth and economic and social development in Mali. The hypothesis is stated that demographic growth impedes economic development and any improvement in populations¿ standards of living. The hypothesis was verified using data for the period from 1960 to the present. Over that period, Mali conducted two general population censuses in 1976 and 1987, as well as several demographic research studies. The thesis is comprised of 4 parts, of which the first generally describes Mali. The second part analyzes the relationship between population growth and economic and social development in Mali. Study results are presented, followed by an analysis of the effects of economic and social development upon population growth in Mali through factors such as urbanization, education level, literacy, income, employment, occupation, gross domestic or gross national product by inhabitant, infant mortality rate, life expectancy at birth, contraceptive practice, fertility opinions and desires, women¿s status, and migration in Mali. Analysis indicates that Mali has not completely begun its demographic transition, but that traditional pronatalist behaviors are changing. Population policies and programs are explored in the third part of the thesis, followed by the fourth part which focuses upon methodological questions.

  19. L’introuvable capitale du Mali. La question de la capitale dans l’historiographie du royaume médiéval du Mali The capital that cannot be found: The question of the capital in the historiography of the medieval kingdom of Mali

    Directory of Open Access Journals (Sweden)

    Hadrien Collet

    2013-05-01

    Full Text Available Parmi les nombreuses hypothèses portant sur la capitale du Mali à son apogée (xiiie-début xve siècle, celle de Niani, apparue sous la plume des « historiens coloniaux », a connu la plus belle fortune. Construite par l’histoire coloniale, puis partiellement déconstruite à partir des années 1970, l’hypothèse de Niani, bien que porteuse d’une façon de faire de l’histoire aujourd’hui révolue, continue d’avoir ses partisans. Apparue en 1923, elle traverse l’époque coloniale et celle des indépendances des années 1960 avant de se retrouver confrontée à la méthode critique de l’histoire académique et de l’archéologie. Cette étude propose donc d’appréhender l’historiographie spécifique à Niani, qui reflète les évolutions de l’écriture de l’histoire ancienne du Soudan, et de faire le point sur l’état des recherches actuelles sur la question de la capitale du Mali.In the writings of “colonialist historians”, the hypothesis of Niani was certainly the main one formulated about the capital of medieval Mali at its height, from the 13th till the middle of the 15th century. This hypothesis, produced by colonial history in 1923 but partially deconstructed since the 1970s, still has strong support despite its outdated approach to writing history. It was advanced during the colonial era and the period of independence (the 1960s, before being subjected to a critique from academic history and archaeology. The historiography of Niani is presented as a reflection of trends in the writing of the history of the ancient Sudan, and current research on Mali’s capital is examined.

  20. Farm Equipment Manufacturing and Maintenance Services by Blacksmiths in Mali

    Directory of Open Access Journals (Sweden)

    O. Djiré

    2004-03-01

    Full Text Available The Office of Niger has largely contributed to the spread of animal traction technology. Draft animals being largely available, the major constraint has been the high price of imported equipment relative to the purchasing power of the farmers. From the 1980s, considerable quantities of animal traction implements have been introduced particularly by the Arpon project. These implements were assembled at a central workshop and distributed to farmers through a medium term credit facility, including purchase of oxen. Meanwhile support was given to the upgrading of the first blacksmiths’ workshops, providing them with basic equipment, on credit. In the Southern Mali cotton production zone as well as in the Segou River plains rice producing area, associations of blacksmiths have also been created. These networks have greatly contributed to the improvement of skills and turn over of their members. Blacksmiths have become the main producers of animal traction equipment in Mali. Also, farmers greatly appreciate after-sales services. Nevertheless, the sector is still handicapped by major constraints, which are the high price of imported steel, the poor distribution network for electricity and its high cost, as well as the actual absence of credit facilities for blacksmiths. Therefore, in 1997, the blacksmiths’ association of the Office of Niger zone, together with those of the two other zones have created the CMDT/ON/ORS Blacksmiths’ Federation. Its main purposes are the provision and distribution of raw materials (steel products, facilitation of workshop upgrading, organization of training and exchange sessions, and promotion of product marketing.

  1. [Plasma selenium and peripartum cardiomyopathy in Bamako, Mali].

    Science.gov (United States)

    Cénac, A; Touré, K; Diarra, M B; Sergeant, C; Jobic, Y; Sanogo, K; Dembele, M; Fayol, V; Simonoff, M

    2004-01-01

    Peripartum heart failure due to unexplained dilated cardiomyopathy is a common disorder as Savannak-Sahelian Africa. One of the many suspected risk factors identified is selenium deficiency. The purpose of this study was to measure plasma selenium levels in patients with peripartum heart failure due to cardiomyopathy in Bamako, Republic of Mali and compare data with healthy Sahalian women with the same obstetrical status. Plasma selenium was measured in a patient group consisting of 28 Malian women presenting peripartum heart failure and in a control group of 28 healthy breast-feeding Nigerien women of comparable age. The criteria for matching the two groups was parity (similar number of deliveries) since multiparity is a risk factor for peripartum cardiomyopathy. The Wilcoxon test (nonparametric) was used to compare the 2 groups considering up value < 0.05 as significant. Plasma selenium was significantly lower in patients from Mali than in controls from Niger (65 +/- 17 ng/ml vs. 78 +/- 17 ng/ml, p = 0.01). The results of this study showing lower plasma selenium in Bamako patients with peripartum cardiomyopathy than in a matching healthy control population confirms the previous data from the Niamey study.

  2. Le regard anachronique

    Directory of Open Access Journals (Sweden)

    Jean-Paul Aubert

    2011-01-01

    Full Text Available Cet article a pour objet l’anachronisme dans le film historique. Il s’appuie sur l’étude du long métrage Goya à Bordeaux, réalisé en 1999 par le cinéaste espagnol Carlos Saura. Cette biographie filmée du peintre Francisco de Goya fait mieux que composer avec l’anachronisme inhérent à toute reconstitution historique. Il l’assume et le revendique. La mise en cause de la chronologie et l’effacement de l’Histoire prennent sens dans la perspective d’une réflexion originale sur l’Histoire de l’art conçue comme un dialogue entre les œuvres et entre les époques.Este artículo está dedicado al problema del anacronismo en las películas históricas. Se basa en el estudio de Goya en Burdeos, un largo metraje rodado en 1999 por el director de cine español Carlos Saura. Esta biografía de Goya no sólo se acomoda con el anacronismo propio de la reconstitución histórica sino que lo asume y lo reivindica. El cuestionamiento de la cronología y el desinterés por la Historia cobran un nuevo sentido en el marco de una reflexión original sobre la Historia del arte concebida como un diálogo entre las obras y entre las épocas.

  3. Bruk av urtemedisiner blant gravide i Mali : Intervju av 72 healere i Bamako, Siby og Dioila

    OpenAIRE

    Al-Zayadi, Waled

    2012-01-01

    WHO’s rapport fra 2001 viser til at hele 75 % av Mali sin populasjon bruker tradisjonell medisin. Det er beregnet til å være 1 medisinmann pr 500 innbyggere. Hovedmålet med denne oppgaven var å undersøke tradisjonelle medisinmenns behandling av sykdom og plager i svangerskapet i Mali. Det er lite som vites om bruk av urtemedisiner blant gravide i Mali. Det er heller ingen studier gjort fra healerens side. Studien var med på å kartlegge hvilke urter som brukes til den enkelte plagen. I ette...

  4. Photovoltaic energy in Mali. Technical and organisational challenges of solar solutions deployment

    International Nuclear Information System (INIS)

    Lacroix, Olivier; Lesaffre, Dominique

    2011-01-01

    In 2008, electricity access rate in rural Mali was below 11%. In view of the challenges of electrification and development of rural areas in Mali, solar energy is seen as a strategic technology. The SIDI has asked ENEA to work on the technical and organisational terms ensuring sustainable access and spreading of photovoltaic systems in rural Mali. As such, in this report, ENEA improves the knowledge of the sector's private actors, suggests support architectures tackling the problematic, and highlights critical points by market segments

  5. Le travail … c’est la santé : la santé au travail … une pratique en question Work… is health : health at work … a practice in question La salud laboral… una práctica en cuestionamiento

    Directory of Open Access Journals (Sweden)

    Paul Frimat

    2010-02-01

    Full Text Available C’est en 1946 qu’est née cette institution originale qu’est la médecine du travail. Au départ, principalement basée sur une approche essentiellement individuelle, la notion d’aptitude y occupait une place centrale au sein du système de santé. Ce système a connu des évolutions où l’approche individuelle s’est peu à peu couplée à une dimension plus collective, laissant cependant encore un système largement perfectible. Dans ces évolutions, la décision d’aptitude s’est, quant à elle, complexifiée. De nombreux rapports ont d’ailleurs été écrits ces cinq dernières années afin de mettre en débat à la fois la légitimité de pérenniser un tel concept, mais également son efficacité en ce qui a trait à la prévention des pathologies liées au travail. Une loi sera sans doute prévue fin 2009, 2010… Mais qu’en sera-t-il de la pratique, quelle réalité perdurera ? Apte/inapte ? Comment peut-on aider à la compatibilité entre droit à la santé et droit au travail ? En quoi le système français de l’aptitude et de l’inaptitude a pu offrir des garanties pour l’employeur, le salarié, la société ? Tel sera l’objet de cette intervention.It was in 1946 that this new original institution, occupational medicine, was created in France. At the beginning, based mainly on an essentially individual approach, the concept of medical ability held a central place in the health system. This system has changed and the individual approach is now paired with a more collective vision, leaving the system still largely perfectible. Among these evolutions, the medical ability decision has become increasingly complex. Numerous reports have been written in the last five years to debate the legitimacy of maintaining such a concept, as well as its efficiency as far as the prevention of work-related pathologies is concerned. A law will certainly be expected at the end of 2009/beginning of 2010. But, what about

  6. « Suivre la route ».Mobilités et échanges entre Mali, Mauritanie et Sénégal

    Directory of Open Access Journals (Sweden)

    Armelle Choplin

    2010-12-01

    Full Text Available Cinquante ans après l’indépendance du Sénégal, du Mali et de la Mauritanie, la question de l’intégration régionale, de la fluidification des échanges et des mouvements de populations entre les trois Etats se pose avec acuité. Il s’agit de confronter les principes de la CEDEAO (libre circulation des biens et des hommes à la réalité des mobilités dans cette région. Reposant sur une enquête de terrain multi-située le long de la route, cet article rend compte des contradictions entre l’essor des réseaux de transports, l’intensification des échanges et les pratiques sociales transnationales entravées par de nombreux contrôles.Fifty years after the independence of Senegal, Mali and Mauritania, the issue of regional integration and political relations between the three states is at stake. The ECOWAS promotes the establishment of a common market and free movement of people. This article sheds light on the spreading of transports networks, increasing exchanges and people transborder practices. Based on a multi-sited fieldwork along the “route”, this paper highlights new form of popular transnationalism but also the contradiction between Ecowas theoretical principles and the growing controls, which hinder circulation.

  7. Le principe non bis in idem et le droit communautaire

    OpenAIRE

    Hedabou, Aziz

    2018-01-01

    Le principe non bis in idem est une garantie fondamentale qui interdit que les mêmes faits soit poursuivi et puni deux fois. Il est reconnu par tous les droits internes et “appartient aux droit universel des nations”. Dès lors, sa lettre et son esprit ne sont plus cantonnés au droit interne et ont tendance à s’internationaliser. En droit communautaire, l’étude du principe non bis in idem peut être envisagée sous trois angles différents. D’abord en droit pénal international unilatéral où chaqu...

  8. CitEST libraries

    Directory of Open Access Journals (Sweden)

    Maria Luísa P. Natividade Targon

    2007-01-01

    Full Text Available In order to obtain a better understanding of what is citrus, 33 cDNA libraries were constructed from different citrus species and genera. Total RNA was extracted from fruits, leaves, flowers, bark, seeds and roots, and subjected or not to different biotic and abiotic stresses (pathogens and drought and at several developmental stages. To identify putative promoter sequences, as well as molecular markers that could be useful for breeding programs, one shotgun library was prepared from sweet orange (Citrus sinensis var. Olimpia. In addition, EST libraries were also constructed for a citrus pathogen, the oomycete Phythophthora parasitica in either virulent or avirulent form. A total of 286,559 cDNA clones from citrus were sequenced from their 5’ end, generating 242,790 valid reads of citrus. A total of 9,504 sequences were produced in the shotgun library and the valid reads were assembled using CAP3. In this procedure, we obtained 1,131 contigs and 4,083 singletons. A total of 19,200 cDNA clones from P. parasitica were sequenced, resulting in 16,400 valid reads. The number of ESTs generated in this project is, to our knowledge, the largest citrus sequence database in the world.

  9. Alluvial diamond resource potential and production capacity assessment of Mali

    Science.gov (United States)

    Chirico, Peter G.; Barthelemy, Francis; Kone, Fatiaga

    2010-01-01

    In May of 2000, a meeting was convened in Kimberley, South Africa, and attended by representatives of the diamond industry and leaders of African governments to develop a certification process intended to assure that rough, exported diamonds were free of conflictual concerns. This meeting was supported later in 2000 by the United Nations in a resolution adopted by the General Assembly. By 2002, the Kimberley Process Certification Scheme (KPCS) was ratified and signed by diamond-producing and diamond-importing countries. Over 70 countries were included as members of the KPCS at the end of 2007. To prevent trade in "conflict diamonds" while protecting legitimate trade, the KPCS requires that each country set up an internal system of controls to prevent conflict diamonds from entering any imported or exported shipments of rough diamonds. Every diamond or diamond shipment must be accompanied by a Kimberley Process (KP) certificate and be contained in tamper-proof packaging. The objective of this study was (1) to assess the naturally occurring endowment of diamonds in Mali (potential resources) based on geological evidence, previous studies, and recent field data and (2) to assess the diamond-production capacity and measure the intensity of mining activity. Several possible methods can be used to estimate the potential diamond resource. However, because there is generally a lack of sufficient and consistent data recording all diamond mining in Mali and because time to conduct fieldwork and accessibility to the diamond mining areas are limited, four different methodologies were used: the cylindrical calculation of the primary kimberlitic deposits, the surface area methodology, the volume and grade approach, and the content per kilometer approach. Approximately 700,000 carats are estimated to be in the alluvial deposits of the Kenieba region, with 540,000 carats calculated to lie within the concentration grade deposits. Additionally, 580,000 carats are estimated to have

  10. Efficacy of the oral pentavalent rotavirus vaccine in Mali.

    Science.gov (United States)

    Sow, Samba O; Tapia, Milagritos; Haidara, Fadima C; Ciarlet, Max; Diallo, Fatoumata; Kodio, Mamoudou; Doumbia, Moussa; Dembélé, Rokiatou D; Traoré, Oumou; Onwuchekwa, Uma U; Lewis, Kristen D C; Victor, John C; Steele, A Duncan; Neuzil, Kathleen M; Kotloff, Karen L; Levine, Myron M

    2012-04-27

    The oral, pentavalent rotavirus vaccine (PRV), RotaTeq was assessed for prevention of severe rotavirus gastroenteritis (RVGE) in young children in two multi-site, randomized, placebo-controlled field trials; one in Asia (Vietnam and Bangladesh) and the other in sub-Saharan Africa (Ghana, Kenya and Mali). The efficacy results for the Mali site of the multi-country trial are presented here. We randomly assigned infants in a 1:1 ratio to receive 3 doses of PRV/placebo at approximately 6, 10, and 14 weeks of age. Gastroenteritis episodes were captured passively at the local health centers and by home visits. The primary study outcome was severe RVGE, as defined by a score of ≥ 11 using the Vesikari Clinical Scoring System occurring ≥ 14 days after the third dose until the end of the study. Other efficacy analyses included efficacy against severe RVGE through the first year and during the second years of life, as well as efficacy after receiving at least one dose of vaccine. In total, 1960 infants were enrolled in the trial at the Mali site and sera were collected on a subset of infants (approximately 150) for immunogenicity testing. In the first year of follow-up, largely due to cultural practices to visit traditional healers as the first point of care, the point estimate of efficacy was unreliable: the per protocol vaccine efficacy against severe RVGE was 1% (95% confidence interval [CI]: -431.7, 81.6); the intention-to-treat vaccine efficacy was 42.9% (95% CI: -125.7, 87.7). During the second year of follow-up, after the surveillance system was modified to adapt to local customs and health care seeking practices, the point estimate of per-protocol vaccine efficacy was 19.2% (95% CI: -23.1,47.3%). 82.5% of Malian infants (95% CI: 70.1,91.3%) who received PRV mounted a seroresponse (≥ 3-fold rise from baseline (prevaccination) to post-dose 3 vaccination) of anti-rotavirus immunoglobulin A antibody, with a post third-dose geometric mean titer (GMT) of 31.3 units

  11. Mass médias et figures du religieux islamique au Mali: entre ...

    African Journals Online (AJOL)

    Mass médias et figures du religieux islamique au Mali: entre négociation et appropriation de l'espace public. ... (development of means of transportation and communications technologies) and the extension of democratic rights and freedoms.

  12. Mali tõotab sõjalist tööpõldu aastateks / Evelyn Kaldoja

    Index Scriptorium Estoniae

    Kaldoja, Evelyn, 1980-

    2015-01-01

    Malis on praegu käimas kolm rahvusvahelist sõjalist missiooni, mis kestavad tõenäoliselt veel aastaid. Terroriorganisatsioonid, mis tegutsesid enamasti riigi põhjaosas, külvavad hirmu ka lõunas

  13. Le colonel Rol-Tanguy

    OpenAIRE

    Bourderon, Roger

    2009-01-01

    Ouvrier métallurgiste, syndicaliste et communiste, le futur colonel Rol-Tanguy, né en 1908, se passionne pour le métier des armes lors de son service militaire. Son expérience dans les Brigades internationales est décisive. Il l’enrichit dans les FTP puis comme chef régional FFI : il prépare et conduit l’insurrection parisienne avec un état-major comportant de nombreux cadres de l’armée. Compagnon de la Libération, il se distingue dans la campagne d’Allemagne et est intégré dans l’armée avec ...

  14. Le glaive de la parole

    Directory of Open Access Journals (Sweden)

    Luce Marchal-Albert

    2006-09-01

    Full Text Available Chacun sait, selon le mot de Pierre Viret, « en quelle confusion est la Chrestienté » au xvie siècle en Europe. C’est le deuxième quart du siècle qui nous intéressera ici, et en particulier l’année 1545, qui constitue une année charnière qui voit vaciller l’Église romaine, flamber et culminer la chasse aux hérétiques en même temps qu’elle voit la jeune Église réformée se renforcer et se positionner avec succès dans un champ religieux plus que chaotique. Les ouvrages polémiques réformés écrits...

  15. Le boson et le chapeau mexicain un nouveau grand récit de l'univers

    CERN Document Server

    Cohen-Tannoudji, Gilles

    2013-01-01

    Le boson ? C'est l'ultime particule élémentaire prédite par la théorie de l'infiniment petit, qui manquait encore et dont la découverte, grâce au grand collisionneur de hadrons du CERN, a été annoncée au monde entier le 4 juillet 2012. Postulée en 1964 par Robert Brout, François Englert et Peter Higgs, elle explique que le photon - particule qui transmet la force électromagnétique - n'a pas de masse, à l'encontre de celles véhiculant la force faible. Une telle dissymétrie était a priori incompatible avec la symétrie fondamentale, dite «de jauge», sur laquelle est fondé le modèle standard de la physique des particules. Le chapeau mexicain ? C'est le mécanisme grâce auquel le boson rend compte, en préservant les acquis du modèle standard, de l'origine des masses des particules élémentaires. Le boson et le chapeau mexicain se placent à la croisée - retracée par les deux auteurs en dialogue avec François Englert - des chemins de l'évolution des théories de l'astrophysique contemp...

  16. Leïomyosarcome de la prostate: Neoplasie rare

    Directory of Open Access Journals (Sweden)

    D. Basraoui

    2012-03-01

    La TDM et surtout l'IRM jouent un rôle primordial dans le bilan d'extension locale et à distance du léïomyosarcome prostatique et le seul moyen pour affirmer le diagnostic est l'histologie complétée par une étude immuno-histochimique. Leur prise en charge thérapeutique n'est pas codifiée à l'heure actuelle et leur pronostic reste très sombre.

  17. Administrateur à la paie (h/f) | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le titulaire est chargé de la saisie dans les délais prescrits de données exactes dans le SIGRHP (système intégré de gestion des ressources humaines et de la ... de ses tâches liées à la paie, le titulaire est chargé des mesures de contrôle ...

  18. Le CRDI au Costa Rica

    International Development Research Centre (IDRC) Digital Library (Canada)

    région ont-elles besoin du commerce, mais elles doivent en outre acquérir de nouvelles compétences afin de pouvoir prospérer dans l'économie du savoir. La capacité d'utiliser les technologies de l'information, entre autres, est désormais une nécessité. Le CRDI subventionne la Fundación. Omar Dengo afin qu'elle puisse ...

  19. Influence of culture media and environmental factors on mycelial growth and conidial production of Diplocarpon mali.

    Science.gov (United States)

    Zhao, H; Huang, L; Xiao, C L; Liu, J; Wei, J; Gao, X

    2010-06-01

    To identify media and environmental conditions suitable for rapid mycelial growth and sporulation of Diplocarpon mali. Liquid shake cultures were used to evaluate effects of media and environmental conditions on mycelial growth and conidial production of D. mali. Carrot sucrose broth (CSB), potato and carrot dextrose broth (PCDB) and potato and carrot sucrose broth (PCSB) were most favourable for rapid mycelial growth. PCDB, PCSB, PCB (potato and carrot broth) and carrot dextrose broth (CDB) were favourable for conidial production. All carbon sources tested and peptone favoured for mycelial growth. Carbon and nitrogen sources tested did not significantly stimulate conidial production. The optimum temperature for mycelial growth and conidial production was 25 degrees C. No mycelial growth occurred at 5 or 30 degrees C, but D. mali survived at these temperatures. Active mycelial growth occurred at pH 5-7, and pH 5-8 was favourable for sporulation. PCDB and PCSB incubated at 25 degrees C for 14 day are recommended for mycelial growth and conidial production of D. mali. The information generated in this study will facilitate mycological and pathological research on D. mali and Marssonina leaf blotch of apple caused by D. mali.

  20. Le CRDI au Brésil

    International Development Research Centre (IDRC) Digital Library (Canada)

    Les recherches subventionnées par le CRDI au Brésil ont permis d'éclairer les débats sur nombre de questions, dont la démocratie, la croissance économique, la santé, les services sociaux, l'innovation, la foresterie et l'eau. Pendant la dictature militaire, qui a pris fin en 1985, le CRDI s'est employé à assurer la survie de la ...

  1. la lutte contre le SIDA au Cameroun

    African Journals Online (AJOL)

    Chantel

    Pour lutter contre cette pandémie, le Cameroun s'est organisé en mettant en place, avec l'aide de ses partenaires bilatéraux et ... la dérision qui faisait du SIDA 'le syndrome inventé pour décourager les ... rapidement donner une réponse médicale à la maladie. ... histoire politique, à ses susceptibilités historiques et à.

  2. Increasing Access to Family Planning Choices Through Public-Sector Social Franchising: The Experience of Marie Stopes International in Mali

    OpenAIRE

    Gold, Judy; Burke, Eva; Ciss?, Boubacar; Mackay, Anna; Eva, Gillian; Hayes, Brendan

    2017-01-01

    Background: Mali has one of the world's lowest contraceptive use rates and a high rate of unmet need for family planning. In order to increase access to and choice of quality family planning services, Marie Stopes International (MSI) Mali introduced social franchising in public-sector community health centers (referred to as CSCOMs in Mali) in 3 regions under the MSI brand BlueStar. Program Description: Potential franchisees are generally identified from CSCOMs who have worked with MSI outrea...

  3. Gisèle HALIMI, La Kahina

    OpenAIRE

    ALLOUCHE-BENAYOUN, Joëlle

    2010-01-01

    Est-ce un ouvrage historique ? Est-ce un roman ? Un roman historique ? Le lecteur est désemparé dès qu’il plonge dans l’ouvrage que Gisèle Halimi a consacré à la grande héroïne judéo berbère. Si l’on comprend bien l’intérêt de l’avocate féministe – par ailleurs juive et née en Tunisie – pour cette figure féminine de résistance, la gêne s’installe au fur et à mesure de la lecture, face à l’impossibilité de l’auteur de choisir un genre littéraire et de s’y tenir. Alors que le destin légendaire ...

  4. En torno a una estética del deporte

    OpenAIRE

    Javier Olivera Betrán*

    2006-01-01

    Aunque el término estética tiene varios significados especiales, en el contexto de las ciencias sociales se emplea preferentemente para designar el conjunto de investigaciones que están relacionadas con las artes. Estética es el estudio del comportamiento y la experiencia del hombre al crear arte, al percibir y comprender el arte y al ser influido por el arte. El arte es el medio que promueve una fusión del individuo con el todo, el hombre para rebasar los límites que le impone la individuali...

  5. Effet du stress salin sur le comportement physiologique et ...

    African Journals Online (AJOL)

    SARAH

    30 juin 2013 ... rapidement dans les feuilles à partir de 25 mmol de NaCl. Le rapport de sélectivité K+/Na+ a été plus discriminant entre les variétés : Midass a présenté le rapport de sélectivité le plus élevé et Nabeul le rapport de sélectivité le plus faible. Conclusion et application : La variété Nabeul qui est de type piment ...

  6. Le patrimoine et ses outils de gestion

    CERN Document Server

    Garcin, J

    2001-01-01

    Les principale taches de gestion du Patrimoine immobilier du CERN sont la saisie des données, leur mise à jour, l'archivage et la mise à disposition des informations. Les outils de gestion actuels : Le Système de Gestion de Base de Données Relationnelles alphanumérique ORACLE permet de gérer toutes les informations du Patrimoine, sur le réseau du CERN. Le logiciel de dessin Graphique MICROSTATION (Bentley) a été installé dans la division ST depuis fin 1991. Les plans de situation des sites, des bâtiments et locaux, des espaces confinés ont été réalisés avec ce logiciel. Les outils de demain : La mise en place du SIG (Système d'Information Graphique) STAR a été réalisée en 1993. Le transfert des plans de locaux de MICROSTATION vers STAR est en cours depuis une année environ. Le dessin de la cartographie des réseaux de canalisations Eaux Usées et Eaux Pluviales est en cours de réalisation. Le Web est l'outil de consultation de l'information par les utilisateurs.

  7. Pays en transition : pour que les sociétés se transforment, il est ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Conscient du fait que les périodes de transformation risquent de provoquer le chaos, mais qu'elles sont également porteuses de rapides progrès sur le plan social et économique, le CRDI est intervenu dans quelque 25 pays ayant amorcé une transition de la guerre à la paix, de la dictature à la démocratie ou d'une ...

  8. Le déficit de filles

    International Development Research Centre (IDRC) Digital Library (Canada)

    de la population est une tendance plus récente. C. Le déficit de filles. Le déséquilibre du ratio hommes-femmes en Inde. D. R. O. I. T. S. D. E. S. F. E. M. M. E. S. E. T. P. A. R. T. IC. I. P. A. T. IO. N. C. I. T. O. Y. E. N. N. E. CENTRE DE. RECHERCHES. POUR LE. DÉVELOPPEMENT. INTERNATIONAL. CRDI : Jason Taylor ...

  9. Production of a magnetic field of 1 600 000 At/m in a non-magnetic region of volume 0.5 cubic decimeters by a coil cooled by liquid hydrogen (1963); Production d'un champ magnetique de l 600 000 At/m dans un milieu non magnetique dont le volume est 0,5 decimetre cube. Enroulement refroidi a l'hydrogene liquide (1963)

    Energy Technology Data Exchange (ETDEWEB)

    Garin, P [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1963-07-01

    The eventual application of the technique of cryogenic coils for the production of magnetic fields for liquid hydrogen bubble chambers has led us to the study and construction of two copper coils (cooled in a bath of liquid hydrogen). Part one treats certain generalities concerning the resistivity of several pure metals at very low temperatures, the gain in power, thermal isolation and the choice of conductor and power supply. Part two describes the experimental arrangement. The last part is devoted to a description of the two coils which were constructed, and to the results obtained. (author) [French] L'application eventuelle de la technique des ''bobines cryogeniques'' aux chambres a bulles a hydrogene liquide pour la production du champ magnetique nous a conduits a l'etude et a la construction de deux bobines en cuivre (refroidies dans un bain d'hydrogene liquide). La premiere partie traite de generalites concernant la resistivite de quelques metaux purs, a tres basse temperature, le gain de puissance, l'isolement thermique et le choix du conducteur et de l'alimentation electrique. Dans la seconde partie on decrit l'installation d'essais. La derniere partie est consacree a la description des deux bobines realisees et aux resultats obtenus. (auteur)

  10. Le Baratze (ou

    Directory of Open Access Journals (Sweden)

    Jacques Blot

    1998-01-01

    Full Text Available El círculo de piedras Mendizabal 7, de 8 metros de diámetro,   presenta una corona externa constituida de grandes bloques   hincados en la tierra, y otra interna y tangente, de elementos idénticos sólo puestos en el suelo. El cajón central está compuesto de cuatro losas y una tapa. No hay depósito de huesos ni de carbón de leña ; sólo se encuentran dos herraduras, entre las cuales una completa de tipo medieval, que podrían permitir de pensar en una construcción del círculo en el periodo histórico.

  11. Promotion de la recherche sur l'entrepreneuriat en Asie du Sud-Est ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... surtout en ce qui concerne les femmes, et de suivre leur évolution en Asie du Sud-Est. ... surveillera le déroulement du projet et veillera au contrôle de la qualité. ... including heat stress, water management, and climate-related migration.

  12. Le tournoi des ombres

    CERN Document Server

    Treille, Daniel

    2017-01-01

    Le lecteur, transporté avec le narrateur dans une région hors norme, est invité à partager sa fascination pour la beauté du lieu, à découvrir la chronique de son passé, rude et pittoresque. Il va côtoyer une galerie de personnages très attachants, mais aux destinées bousculées par l histoire, et assister à l agitation montante du présent dans un contexte d une actualité brûlante. Ce quatrième roman de Daniel Treille, mêlant hardiment les genres, du quotidien trivial au récit épique, de considérations géopolitiques à quelques avancées de la science moderne, confirme son talent à mener, d une écriture très aboutie, une histoire complexe, peuplée de héros singuliers

  13. Le Dominique Interactif

    Directory of Open Access Journals (Sweden)

    Valérie Ouellette

    2005-09-01

    Full Text Available Cet article présente le Dominique Interactif, une bande dessinée interactive et multimédia unique, servant à évaluer sept troubles de la santé mentale chez les jeunes. La version pour les six à onze ans est adaptée aux limites cognitives des enfants et comporte plusieurs avantages. Malgré quelques limites, cet instrument permet d’obtenir des informations fiables de la part de l’enfant sur sa santé mentale. La fidélité et la validité de cet outil sont meilleures que celles des autres instruments traditionnels servant à mesurer la santé mentale des enfants. En combinant les résultats de ce questionnaire avec les informations des parents, professionnels et enseignants, le Dominique Interactif permet aussi d’effectuer une évaluation complète de la santé mentale de l’enfant. Enfin, son utilisation simple et rapide facilite l’évaluation clinique des enfants par les professionnels, permet l’évaluation de programmes d’intervention et favorise l’intervention précoce (Valla et al., 2000.

  14. Le continu contre l'espace

    Science.gov (United States)

    Salanskis, Jean-Michel

    Disons pour conclure que, en tout état de cause, la façon de concevoir philosophiquement le conflit du continu et de l'espace que nous avons trouvée chez Hegel n'est pas homogène avec le style et les modalités de la pensée mathématique: 1) d'une part, le lien classique, le lien de référence entre continu et espace en mathématiques n'est pas que l'espace serait premier et privé de pensée, et le continu second, venant dissoudre l'espace en apportant la qualité, l'infini et la pensée, mais tout au contraire, il consiste en ce que l'espace est fondé sur l'abîme infinitaire du continu ; 2) d'autre part, l'éventuel divorce entre l'espace et le continu dans l'aire mathématique n'est pas celui d'une réflexivité purement conceptuelle du continu avec un positivisme géométrique, n'équivaut pas à une rupture disciplinaire ; il est plutôt le symptôme de la dérive d'une herméneutique à l'égard d'une autre, au sein d'un continent juridique commun définissant la discipline (la mathématique ensembliste), cette dérive pouvant, à la limite, induire une refonte de ce sol juridique, sans que jamais il soit question pour autant de nier l'unité des mathématiques, à comprendre ici comme l'unité ultime de responsabilité de la communauté mathématique à l'égard des trois questions Qu'est-ce que l'espace?”, “Qu'est-ce que le continu?” et “Qu'est-ce que l'infini?”.

  15. Prime note sulla tutela penale dei culti nei Paesi dell’Est Europa

    Directory of Open Access Journals (Sweden)

    Giovanni Cimbalo

    2011-05-01

    Full Text Available Testo della relazione tenuta al Convegno “La Carta e la Corte” (Ferrara, 27 ottobre 2007 destinata alla pubblicazione negli Atti. SOMMARIO: 1. Alcune considerazioni preliminari sullo status delle Confessioni religiose nei paesi dell’Est Europa - 2. I nuovi orientamenti del diritto penale nell’Est Europa - 3. Le norme statali in materia di tutela penale dei culti e del sentimento religioso. 3. Le norme penali relative ai culti e a al sentimento religioso prima del 1992 nei Paesi dell’Est Europa - 4. Tipologie e tecniche legislative di tutela penale dei culti dopo il 1992 nei Paesi dell’Est Europa - 5. Alcune sommarie considerazioni.

  16. Soutenir des politiques d'alimentation plus saine en Asie du Sud-Est ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Soutenir des politiques d'alimentation plus saine en Asie du Sud-Est. Près d'un quart des décès causés par des maladies non transmissibles dans le monde surviennent en Asie du Sud-Est. Ce projet tentera de résoudre le problème en menant des recherches sur la façon dont les politiques peuvent favoriser des ...

  17. Reformulation à l’oral et dans le forum Web

    Directory of Open Access Journals (Sweden)

    Eshkol-Taravella Iris

    2016-01-01

    Full Text Available Le cadre du travail réalisé entre dans le domaine de la linguistique de corpus et du Traitement Automatique des Langues (TAL. Les recherches sont fondées sur trois corpus : deux corpus oraux (ESLO1 et ESLO2 et un corpus composé de discussions collectées sur un forum de Doctissimo. Le travail vise à détecter, analyser et comparer la reformulation introduite par trois marqueurs (c’est-à-dire, je veux dire et disons dans le discours oral et le corpus écrit dialogique du Web. L’objectif est d’étudier la raison pour laquelle le locuteur décide de modifier un segment par un autre et de repérer un lien formel entre les deux segments reformulés aux différents niveaux linguistiques (morphologique, lexical, syntaxique, etc..

  18. La construction de la matière le modèle Standard

    CERN Document Server

    Léon, Jacques

    2016-01-01

    Qu'est-ce que la matière ? Voilà une question à laquelle il pourrait sembler facile de répondre car il n'est rien de plus concret que la matière. Et pourtant, la réponse qu'en donne la physique contemporaine est pour le moins déconcertante ! Le concept-même de particules, briques élémentaires de la matière, s'est volatilisé, dissout dans des objets mathématiques abstraits et abscons pour les non-initiés. Plus nos théories sont précises et plus l'image qu'elles nous renvoient est insaisissable. En un siècle, la représentation des particules s'est métamorphosée en nuages de probabilité portés par des champs quantiques régis par des symétries confinées dans des espaces abstraits. Mais dans un même temps, nous avons réussi le tour de force d'expliquer toute cette complexité avec seulement 16 particules… et une seule théorie, véritable construction de notre conception de la matière : le modèle standard. Ce livre tente de guider le lecteur dans le dédale de la physique des particu...

  19. Comprendre l'impunité : le droit à la vérité, à la justice et à des ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Comprendre l'impunité : le droit à la vérité, à la justice et à des réparations ... au nom de la souveraineté, de la sécurité, de l'ordre public et de la lutte contre le ... Le Centre de recherches pour le développement international est heureux ...

  20. Arid ways : cultural understandings of insecurity in Fulbe society, Central Mali = Leven met droogte : culturele expressie van onzekerheid bij de Fulbe in Centraal - Mali

    NARCIS (Netherlands)

    Bruijn, de M.; Dijk, van H.

    1995-01-01


    You can obtain a copy of this thesis through your local bookstore or directly from:
    Thela Thesis, Prinseneiland 305, 1013 LP Amsterdam.
    E-mail: office@thelathesis.nl

    Deze studie is het verslag van bijna twee jaar veldwerk bij de Fulbe van Centraal Mali, meer in het bijzonder de Fulbe

  1. Publications | Page 94 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, ... Le syndrome... Diamants de guerre — pour en finir. L'important accord international sur les diamants conclu cette année ne portera pas fruits s'il n'est pas ...

  2. Le pompage optique naturel dans le milieu astrophysique

    Science.gov (United States)

    Pecker, J.-C.

    The title of this lecture abstracts only a part of it : the importance in astrophysics of the study of non-LTE situations has become considerable, as well in the stellar atmospheres as, still more, in the study of fortuitous coincidences as a mechanism of formation of emission line nebular spectra, or of molecular interstellar « masers ». Another part of this talk underlines the role of Kastler in his time, and describes his warm personality through his public reactions in front of the nuclear armement, of the Viet-Nam and Algerian wars, of the problems of political refugees... Kastler was a great scientist ; he was also a courageous humanist. 1976 : Les accords nucléaires du Brésil : allocution d'ouverture (19 mars). Colloque sur le sujet ci-dessus. 1976 : La promotion de la culture dans le nouvel ordre économique international, allocution à l'occasion d'une table ronde sur ce thème par l'UNESCO (23-27 juin 1976) ; « Sciences et Techniques », octobre 1976. 1979 : La bête immonde (avec J.-C. Pecker), « Le Matin », 20 mars. 1979 : Appel à nos ministres (avec J.-C. Pecker), « Le Monde », 13 décembre. 1979 : Le flou, le ténébreux, l'irrationnel (avec J.-C. Pecker), « Le Monde », 14 septembre. 1980 : Education à la paix, Préface, in : Publ. UNESCO. 1981 : Le vrai danger, « Le Monde », 6 août 1981. 1982 : Nucléaire civil et militaire, « Le Monde », 1er juin 1982. 1982 : Les scientifiques face à la perspective d'holocauste nucléaire (texte inédit). Le titre de cette communication en résume seulement une partie : l'importance prise en astrophysique par l'analyse des situations hors ETL est devenue considérable, qu'il s'agisse des atmosphères stellaires, ou plus encore, des coïncidences fortuites de la formation des spectres d'émission nébulaires, ou des « masers » moléculaires interstellaires. Une autre partie de cet exposé souligne lele de Kastler dans son époque, et décrit sa personnalité généreuse à travers ses r

  3. La science, la littérature, le rituel: le vrai dire et le plus que mentir

    Directory of Open Access Journals (Sweden)

    Panagiotis Christias

    2005-03-01

    Full Text Available Le scientifique promet la vérité sans être en mesure d'accomplir sa promesse tandis que l'écrivain promet de mentir mais par son mensonge, il fait plus que mentir. Il ne dit certainement pas la vérité, car la vérité n'est pas sa préoccupation première. Voilà comment nous pouvons résumer les deux attitudes, condamnées à un antagonisme stérile par l'attitude positiviste moderne. Compte tenu donc de l'intention fondatrice de la science, de sa promesse donc originaire et fondatrice, la science doit dire la vérité et rien que la vérité. Ce qui, de l'aveu même de cette même science, est impossible. [...] La littérature se permet de reconstruire des mondes par-delà le vrai et le faux. [...] Un récit littéraire ne demande pas la consécration de la vérité, ne demande pas à être suivi parce que vrai, n'impose rien et n'attend rien. Sa vraie destinée est l'errance et sa vraie conscience est celle de sa dissémination. Celui qui renonce à la prétention de vérité renonce en même temps à la volonté de dominer. Dominer signifie créer un espace de vérité dans lequel celui qui énonce la vérité est le maître légitime de ceux qui sont dans le champ de la conception du monde dont cette vérité est la pierre angulaire.

  4. le pommier de cayor, espece emblematique du dallol bosso

    African Journals Online (AJOL)

    usage alimentaire le plus répandu est la consommation crue de la pulpe des fruits frais. Les amandes sont soit consommées crues, soit pilées et utilisées en sauce comme condiments, soit utilisées pour l'extraction traditionnelle d'huile. Le bois de ...

  5. La lutte contre le tabagisme en Afrique : Peuples, politique et ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    22 déc. 2011 ... Le tabagisme se répand rapidement en Afrique subsaharienne sous l'impulsion d'une forte croissance économique et des tactiques publicitaires agressives des multinationales du tabac ; bien que les interventions politiques y soient bien comprises, l'économie politique du contrôle du tabagisme ne l'est ...

  6. Tanzanie | Page 9 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Salaam, le ronflement des 50 machines à coudre est aussi tenace que le vrombissement d'insectes. Les ouvriers cousent des filets bleus, verts et blancs qui ont été tissés sur les métiers de la manufacture. Ces hommes et ces femmes font partie ...

  7. Utilisation des modules ATM pour le projet FP420

    CERN Document Server

    Renaglia, T

    2006-01-01

    Le but de cette note est de résumer les premières caractéristiques de l'intégration de 2 modules ATM pour le projet FP420 (voir note technique EDMS n° 743628) ainsi que la liste des problèmes découverts à ce jour sur l

  8. Livres | Page 18 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Qualitative Research for Tobacco Control : A How-to Introductory Manual for Researchers and Development Practitioners. Ce guide pratique est destiné à encourager les intervenants, où qu'ils se trouvent dans le monde, à s'engager dans la recherche contre le tabac en faisant appel à des méthodes et des outils qualita.

  9. Etude sur le Latin dus codex Bobiensis (k) des evangiles

    NARCIS (Netherlands)

    Hoogterp, Pieter Willem

    1930-01-01

    Le manuscrit dus texte, dont nous allons entreprendre l'étude, se trouve à la Biblioteca Nazionale de Turin (G VII 15). Il est universellement connu sous le nom de Codex Bobiensis (k d'après Tischendorf) et contient des parties de l'évangile selon S. Matthieu (I, 1-III, 10; IV, 2-XIV, 17; XV, 20-36)

  10. La grille, le World Wide Web du futur

    CERN Multimedia

    2001-01-01

    De nombreux chercheurs trouvent internet trop lent et limité. C'est pourquoi, ils travaillent sur un nouveau réseau : le Grid. Le Grid permettra de mieux partager les ressources informatiques en réseau (1 page).

  11. Publications | Page 175 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Qualitative Research for Tobacco Control : A How-to Introductory Manual for Researchers and Development Practitioners. Ce guide pratique est destiné à encourager les intervenants, où qu'ils se trouvent dans le monde, à s'engager dans la recherche contre le tabac en faisant appel à des méthodes et des outils qualitatifs.

  12. Georges et le big bang

    CERN Document Server

    Hawking, Lucy; Parsons, Gary

    2011-01-01

    Georges et Annie, sa meilleure amie, sont sur le point d'assister à l'une des plus importantes expériences scientifiques de tous les temps : explorer les premiers instants de l'Univers, le Big Bang ! Grâce à Cosmos, leur super ordinateur, et au Grand Collisionneur de hadrons créé par Éric, le père d'Annie, ils vont enfin pouvoir répondre à cette question essentielle : pourquoi existons nous ? Mais Georges et Annie découvrent qu'un complot diabolique se trame. Pire, c'est toute la recherche scientifique qui est en péril ! Entraîné dans d'incroyables aventures, Georges ira jusqu'aux confins de la galaxie pour sauver ses amis...Une plongée passionnante au coeur du Big Bang. Les toutes dernières théories de Stephen Hawking et des plus grands scientifiques actuels.

  13. EST2Prot: Mapping EST sequences to proteins

    Directory of Open Access Journals (Sweden)

    Lin David M

    2006-03-01

    Full Text Available Abstract Background EST libraries are used in various biological studies, from microarray experiments to proteomic and genetic screens. These libraries usually contain many uncharacterized ESTs that are typically ignored since they cannot be mapped to known genes. Consequently, new discoveries are possibly overlooked. Results We describe a system (EST2Prot that uses multiple elements to map EST sequences to their corresponding protein products. EST2Prot uses UniGene clusters, substring analysis, information about protein coding regions in existing DNA sequences and protein database searches to detect protein products related to a query EST sequence. Gene Ontology terms, Swiss-Prot keywords, and protein similarity data are used to map the ESTs to functional descriptors. Conclusion EST2Prot extends and significantly enriches the popular UniGene mapping by utilizing multiple relations between known biological entities. It produces a mapping between ESTs and proteins in real-time through a simple web-interface. The system is part of the Biozon database and is accessible at http://biozon.org/tools/est/.

  14. Un incidentalome surrenalien inhabituel: le ganglioneurome

    African Journals Online (AJOL)

    S. Attafi

    Résumé. Le ganglioneurome est une tumeur neurogène bénigne, rare, qui se développe à partir des cellules gan- glionnaires sympathiques. Elle se localise essentiellement dans la région rétropéritonéale. La localisation surrénalienne est rare. Nous rapportons un cas de ganglioneurome surrénalien chez une femme ...

  15. Optimal profit of the parasitation by Aphelinus mali in an IPM complementary strategy for the control of Eriosoma lanigerum.

    Science.gov (United States)

    Goossens, D; Bangels, E; Belien, T; Schoevaerts, C; De Maeyer, L

    2011-01-01

    During summer the parasitoid Aphelinus mali may certainly reduce the infestation of woolly apple aphid (Eriosoma lanigerum), but studies on the single interaction rarely indicate sufficient biological control in the period May-June. In this period chemical control by spirotetramat or pirimicarb remains indispensable in order to anticipate on dense migration waves and subsequent colonization of extension shoots by E. lanigerum. The limited parasitation by A. mali around flowering is linked with a delayed emergence from diapause and with a slower reproduction rate than its host. In 2010 and 2011 the first adult flights monitored on yellow sticky traps corresponded perfectly with the currently used prediction models for A. mali. Further accurate monitoring all along the season enabled also to determine a well defined endo-parasitic phase of A. mali occurring after the small peak observed around flowering. During this endo-parasitic phase A. mali larvae reside inside their mummified host. Compounds with higher acute toxicity on A. mali adults, like chloronicotinyl insecticides (CNI's), are preferably positioned here. Selectivity in the time can then be claimed. Respecting this principle, the further parasitation potential of A. mali in summer is not hampered. Preservation of the first peak of flights of A. mali in the pre-flowering period is essential for an exponential flight increase. This is essential for the parasitation of E. lanigerum in summer, which constitutes a valuable complement in the integrated control strategy.

  16. The Sahelian crisis and the poor : the role of Islam in social security among Fulbe pastoralists, Central Mali

    NARCIS (Netherlands)

    Bruijn, de M.E.

    1994-01-01

    This paper examines how poor members of Fulbe society, a group of agropastoralists in the Sahel, central Mali, are surviving after two decades of environmental disaster. The focus is on the Jalloube of the Hayre in central Mali. Social security relations and institutions based on Islam seem to be

  17. A quantitative synthesis of the medicinal ethnobotany of the Malinké of Mali and the Asháninka of Peru, with a new theoretical framework

    Science.gov (United States)

    Bletter, Nathaniel

    2007-01-01

    dans leur flore générale-est examinée par un re-échantillonnage des données de recherches effectuées parmi les Malinké au Mali et les Asháninka au Pérou, en particulier sur la malaria, la maladie africaine du sommeil, la maladie de Chagas, la leishmania, le diabète, l'eczéma, l'asthme et les fibromes utérins. Dans ces cas précis, la similitude de la flore médicinale s'avère sensiblement plus grande que la similitude de la flore générale, mais seulement quand les maladies en question sont regroupées ensemble comme maladies parasitaires et auto-immunitaires. Si cette hypothèse est prouvée, elle permettra la synthèse des informations recueillies sur les plantes médicinales du monde entier pour en sélectionner de façon plus précise celles qui sont les plus efficaces et qui méritent analyse plus approfondie au laboratoire. Asháninka abstract Aayiantyarori iròpero aavintane, ontzimatye ancovacovatero ayotero ovaqueraripaye incashi iyoyetziri ashaninka, ayotzityaro aajatzi iyotane viracocha paitachari "quimica" ancantero aaca oshintsinka inchashipaye. Atziri yotacotzirori cametsa, ishtoriajacotzirori iyotane ashaninkapaye te iroñàrantero maaroni ocaratzi yamenacotaqueri laboratorioki. Aaviantyarori cametsa, ayotacotero aavintarontsiyetatsiri osamani antzimaventero ishtoriatacotaro, aajatzi osheki opinata ampinaventero aparopaye inchashi, acoviriqui ayotacotero, osaretsikipaye. Tzimatsi ovaquerari quenquishiriantsitatsiri ero opinata osheki ashitoriatacotero aparopaye inchashi, asampiyetatyrey pashinipaye atziri saicatsiri intaina puitarika inchasshi yavintari, ajatzirica oshiyaro ayotzi aaca, quemetachari atziri saikatsiri nampitsiki malinke aajatzi ishiyari ashaninka saicatsiri peruki, tzimatsi inchashi aajatzi yaavintari osheki okamètsatzi aririka anteri mantsiyarentsi icantaitziri ompetarentsi catsirentsi, pochokirentsi, patsarontsi(matatsi) ashipetate maaroni, ampochavathate, ancainikentsite, oncatsithakite tsinani. Aririka añaker aajatzi

  18. A quantitative synthesis of the medicinal ethnobotany of the Malinké of Mali and the Asháninka of Peru, with a new theoretical framework

    Directory of Open Access Journals (Sweden)

    Bletter Nathaniel

    2007-12-01

    deux cultures éloignées que dans leur flore générale-est examinée par un re-échantillonnage des données de recherches effectuées parmi les Malinké au Mali et les Asháninka au Pérou, en particulier sur la malaria, la maladie africaine du sommeil, la maladie de Chagas, la leishmania, le diabète, l'eczéma, l'asthme et les fibromes utérins. Dans ces cas précis, la similitude de la flore médicinale s'avère sensiblement plus grande que la similitude de la flore générale, mais seulement quand les maladies en question sont regroupées ensemble comme maladies parasitaires et auto-immunitaires. Si cette hypothèse est prouvée, elle permettra la synthèse des informations recueillies sur les plantes médicinales du monde entier pour en sélectionner de façon plus précise celles qui sont les plus efficaces et qui méritent analyse plus approfondie au laboratoire. Asháninka abstract Aayiantyarori iròpero aavintane, ontzimatye ancovacovatero ayotero ovaqueraripaye incashi iyoyetziri ashaninka, ayotzityaro aajatzi iyotane viracocha paitachari "quimica" ancantero aaca oshintsinka inchashipaye. Atziri yotacotzirori cametsa, ishtoriajacotzirori iyotane ashaninkapaye te iroñàrantero maaroni ocaratzi yamenacotaqueri laboratorioki. Aaviantyarori cametsa, ayotacotero aavintarontsiyetatsiri osamani antzimaventero ishtoriatacotaro, aajatzi osheki opinata ampinaventero aparopaye inchashi, acoviriqui ayotacotero, osaretsikipaye. Tzimatsi ovaquerari quenquishiriantsitatsiri ero opinata osheki ashitoriatacotero aparopaye inchashi, asampiyetatyrey pashinipaye atziri saicatsiri intaina puitarika inchasshi yavintari, ajatzirica oshiyaro ayotzi aaca, quemetachari atziri saikatsiri nampitsiki malinke aajatzi ishiyari ashaninka saicatsiri peruki, tzimatsi inchashi aajatzi yaavintari osheki okamètsatzi aririka anteri mantsiyarentsi icantaitziri ompetarentsi catsirentsi, pochokirentsi, patsarontsi(matatsi ashipetate maaroni, ampochavathate, ancainikentsite, oncatsithakite

  19. Adoption d'innovations agricoles par le truchement de services ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'agriculture est le fer de lance de nombreuses économies en développement, mais la capacité des petits agriculteurs privés de ressources à adopter des innovations agricoles est freinée par le manque d'accès à des services financiers adéquats. Des experts internationaux estiment qu'il existe un manque à gagner ...

  20. Vers une plus grande collaboration régionale — le CRDI appuie le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    26 janv. 2011 ... Richard Fuchs croit que les gens qui veulent comprendre comment le monde évolue devraient jeter un coup d'oeil à la vague de transformations qui déferle sur ... Bien qu'ils aient souvent de la difficulté à se démarquer face à la véritable dynamo économique qu'est la Chine, des pays tels que le Laos, ...

  1. Lele de l'énergie dans le développement rural | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    21 oct. 2010 ... L'énergie est sans aucun doute l'un des principaux moteurs du ... de ses recherches sur l'énergie, l'environnement et le développement rural. ... Durban, Mumbai et Rio illustrent la croissance rapide et la transformation qui a ...

  2. Le modèle judiciaire libéral mis à l’épreuve : la surveillance des juges sous le Directoire

    OpenAIRE

    Berger, Emmanuel

    2007-01-01

    La justice du Directoire est principalement identifiée aux différentes violations infligées par le gouvernement afin de contrôler le pouvoir judiciaire et durcir la répression criminelle. Cette représentation est, en réalité, partiale. L’auteur tente de le prouver à travers l’analyse d’un aspect essentiel du système judiciaire directorial : la surveillance des juges. L’étude des normes et des pratiques montre que le mode de surveillance établi par le code des délits et des peines respecte la ...

  3. Hepatitis B virus and primary liver carcinoma in Mali

    International Nuclear Information System (INIS)

    Sidibe, S.; Sacko, B.Y.; Traore, I.; Traore, H.A.

    2004-01-01

    Full text: The purpose of this study was to evaluate the relation between hepatitis B virus surface antigen (HBs antigen) and serum alpha fetoprotein (AFP) levels in patients with liver cirrhosis and primary liver cancer (PLC) in Mali. Between September 1994 to December 1999 a prospective case control study was carried out in Hopital du Point 'G', in 104 patients (27 females, 77 males). Of these 104 patients, 57 were of cirrhosis and 47 of PLC. Age and sex matched 104 healthy controls were also included in the study. HBs antigen, antiHBs antibody and AFP were systematically measured by radioimmunoassay method. HBs antigen was found in 75% of patients as compared to 15.4% in healthy controls (p < 0.01). There was no difference in the frequency of HBs antigen in patients with cirrhosis and PLC. HBs antigen presence was found to be well correlated to AFP level. In fact, 81.5% of our patients with a serum AFP level greater than the normal value were HBs antigen positive. Of the 63% patients having AFP serum concentration greater than 8 times of our laboratory standardizes normal value, only 4 patients (6.3%) were negative for HBs antigen. AFP serum concentration greater than 16 times of the normal value was found only in HBs antigen patients. In our opinion, this data gives a new element to the role of Hbs antigen in the pathogenesis of liver cirrhosis and PLC. (author)

  4. LE LIEN ENTRE FINANCE ET ECONOMIE ISLAMIQUES VIA LE MODELE PRINCIPIEL "ZR"

    OpenAIRE

    BELABES, ABDERRAZAK

    2010-01-01

    A l'heure où certains évoquent l'intégration de la finance islamique à la finance globale, et d'autres rattachent la finance islamique à des thèmes en vogue telles que la finance éthique, la finance participative ou la finance socialement responsable, le présent papier explore le lien entre finance et économie islamiques à partir du modèle principiel "ZR", c’est-à-dire "Zakât" et "Ribâ". Ce modèle montre que les principes invariants de Zakât et Ribâ jouent un rôle central dans l’établissement...

  5. Lele du pharmacien dans la fécondation in vitro

    OpenAIRE

    Hannoun , Odélia

    2017-01-01

    La procréation médicalement assistée regroupe plusieurs techniques venant en aide aux couples ayant des difficultés à concevoir. Environ 15% des couples en age de procréer consultent pour une difficulté à concevoir. Ce véritable problème de société nous incite à réfléchir sur le role que tient le pharmacien en tant que professionnel de santé dans le parcours de fécondation in vitro. Le pharmacien développe une relation étroite avec les patients au comptoir. Il est la pour expliquer le traitem...

  6. La spermiation chez le brochet.

    Directory of Open Access Journals (Sweden)

    DE MONTALEMBERT G.

    1980-01-01

    Full Text Available L'évolution quantitative et qualitative de la production de sperme au cours de la période de spermiation a été étudiée chez des brochets maintenus en captivité dans un étang de 400 m2. Le sperme est prélevé toutes les semaines à partir du début de février, et pendant près de 2 mois. La quantité de sperme recueillie est très faible et présente de fortes variations individuelles ; elle augmente progressivement jusqu'à la 5me semaine et décroit ensuite. La quantité moyenne de sperme récoltée par mâle est de l'ordre de 0,7 ml/semaine et varie considérablement d'un mâle à l'autre (0.07 à 1,5 ml. La concentration du sperme en spermatozoïdes varie entre 18 et 25 milliards par ml ( X = 21,5 109 + 2,11. La quantité de spermatozoïdes récoltée par semaine est de 28,5 106 + 26,4/kg de poids corporel. La qualité du sperme appréciée par l'intensité et la durée de motilité suit une évolution similaire à celle de la quantité de sperme récoltée avec des valeurs maximales à 4 semaines et minimales en début et fin de période de prélèvement. Les premières ovulations détectées sur des femelles stockées dans les mêmes conditions que les mâles ont été observées à la 6me semaine de prélèvements alors que les performances de spermiation avaient déjà fortement déclinées. Il est vraisemblable que les conditions expérimentales particulièrement traumatisantes pour les mâles ont affecté prématurément la spermiation, amplifiant ainsi le décalage fréquemment observé entre les périodes de spermiation et d'ovulation.

  7. Quand la musique donne le ton

    DEFF Research Database (Denmark)

    Reeh, Henrik

    2017-01-01

    Le lycée Sainte-Anne de Copenhague est un établissement réputé pour les résultats de ses élèves et pour être le foyer d’une intense tradition chorale et musicologique. L’article interroge les parcours de 32 élèves d’une même classe, tous reçus au baccalauréat 2014 avec une option musique et mathé...... de comprendre cette coexistence entre musique et éducation, la relation entre « individu » et « communauté » est examinée et la notion de « culture » désigne le point d’articulation qui peut rendre compte de la dynamique pédagogique en question....

  8. Le Peer to Peer: Vers un Nouveau Modèle de Civilization

    Directory of Open Access Journals (Sweden)

    Michel Bauwens

    2006-06-01

    Full Text Available Le « peer to peer » est la dynamique intersubjective caractéristique des réseaux distribués. Le but de cet essai est de montrer qu'il s'agit d'une véritable nouvelle forme d’organisation sociale, apte à produire et échanger des biens, à créer de la valeur. Celle-ci est la conséquence d'un nouvel imaginaire social, et possède le potentiel de devenir le pilier d'un nouveau mode d'économie politique, voire d'un nouveau type de civilisation. Pour cela, nous allons d'abord définir le P2P, décrire en bref ces manifestations, et le différencier d'autres modalités d'échange intersubjectif tel que le marché, la hiérarchie, l'économie du don.Comme principale modalité P2P nous distinguons: Les processus de production P2P, comme troisième mode de production, qui n'est ni géré par un mode hiérarchique ou par l'état, ni répondant à des impératifs de profit ou qui sont modulés par le biais des prix. Les processus de gouvernance P2P, qui gouverne ces processus de production. Les formes de propriété P2P, qui sont destine a empecher l’appropriation prive de cette production pour le commun.Afin d’examiner les characteristiques de cette nouvelle dynamique sociale, nous utilisons la typologie intersubjective de l’anthropologue Alan Page Fisque, qui distingue: 1. l'échange égalitaire (Equality Matching, c..a.d l’economie du don. 2. La relation d’autorité (Authority Ranking tel qu’elle s’exprime dans le mode hierarchique. 3. le marché (Market Pricing. 4. la participation commune (Communal Shareholding.En conclusion, nous examinons les possibilites d’expansion de ce nouveau mode sociale et son insertion dans l’economie capitaliste, en nous nous posons la question: le P2P peut-il etre concu comme alternative sociale et economique aux modeles existants.

  9. Con la testa fra le nuvole

    Directory of Open Access Journals (Sweden)

    André Greboge

    2015-06-01

    Full Text Available Partitura de Con la testa fra le nuvole, composta em 2015 para piano e harpa de pedais. Este memorial apresenta as notas sobre a obra e a organização do processo composicional, baseada em um insight composicional a partir da ideia de complexidade apresentada por James Tenney em Meta Meta-hodos (1988.

  10. AcEST: DK960831 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |P40798|STC_DROME Protein shuttle craft OS=Drosophila melanoga... 33 1.0 sp|O68988|CSMI_CHLTE Chlorosome pro...++ M LE Sbjct: 101 EAIEDFLCNFLIKMGMTRTLDCFQAEWYELIQKKGSDFKGLGNVPDVYSQVMLLE 155 >sp|P40798|STC_DROME Protein shuttle craft

  11. AcEST: DK947961 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ABVR Minor nucleoprotein VP30 OS=Lake Victoria m... 30 9.1 sp|A1AYS1|SELA_PARDP L...E 586 G H+ +G L +P M++ Sbjct: 498 GEVHHC-KGELARALPMMQQ 516 >sp|Q1PDC6|VP30_MABVR Minor nucleoprotein VP30 OS=Lake Victoria

  12. AcEST: DK949890 [AcEST

    Lifescience Database Archive (English)

    Full Text Available _GOSHI Catalase isozyme 1 OS=Gossypium hirsutum G... 401 e-111 sp|O24339|CATA_SOLAP Catalase OS=Soldanella a...8 EGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCT 414 >sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina PE=2 SV=1 Le

  13. Phyllactinia mali and Podosphaera tridactyla var. tridactyla – new hosts of Ampelomyces quisqualis

    Directory of Open Access Journals (Sweden)

    Beata Czerniawska

    2014-08-01

    Full Text Available In 2002, the occurrence of fungi of the order Erysiphales on plants of the Słowiański Park located in Goorzów Wielkopolski was investigated. Plant samples were collected once a month, from August to November. The samples examined were above ground plant parts colonized by powdery mildew fungi. A total of 78 samples were collected. Apart from 14 species of the order Erysiphales, Ampelomyces quisqualis parasitizing on Erysiphe cichoracearum var. cichoracearum, Phyllactinia mali and Podosphaera tridactyl var. tridactyla was found. Ampelomyces quisqualis affected hyphae, oidia, and young cleistothecia of P. mali. In contrast, in E. cichoracearum var. cichoracearum, Po. tridactyle var. tridactyla, this hyperparasite colonized only hyphae and oidia. This paper for the first trime informs of A. quisqualis parasitizing on P. mali and Po. tridactyla var. tridactyla.

  14. Savoir gérer le mal

    Directory of Open Access Journals (Sweden)

    Michel Maffesoli

    2015-09-01

    Full Text Available Le sens commun, conservatoire immémorial de la sagesse humaine « sait », de savoir incorporé, que le mal, l’ombre, la mort, la douleur sont des caractéristiques essentielles de l’existence en son entièreté. Dès lors les créatures quelles qu’elles soient, sont des manifestations de la vie et, dès lors, méritent une attitude « compassionnelle », fraternelle, parce qu’ensemble elles constituent le flux vital. C’est ainsi que l’on peut comprendre l’utilité sociale de ces divers « mondes intermédiaires » que sont les croyances, religieuses ou philosophiques, au « double », au « daimon », aux esprits et autres figures tutélaires ou effrayantes. Elles aident à vivre, au jour le jour, la souffrance en la communalisant.

  15. galaxieEST: addressing EST identity through automated phylogenetic analysis.

    Science.gov (United States)

    Nilsson, R Henrik; Rajashekar, Balaji; Larsson, Karl-Henrik; Ursing, Björn M

    2004-07-05

    Research involving expressed sequence tags (ESTs) is intricately coupled to the existence of large, well-annotated sequence repositories. Comparatively complete and satisfactory annotated public sequence libraries are, however, available only for a limited range of organisms, rendering the absence of sequences and gene structure information a tangible problem for those working with taxa lacking an EST or genome sequencing project. Paralogous genes belonging to the same gene family but distinguished by derived characteristics are particularly prone to misidentification and erroneous annotation; high but incomplete levels of sequence similarity are typically difficult to interpret and have formed the basis of many unsubstantiated assumptions of orthology. In these cases, a phylogenetic study of the query sequence together with the most similar sequences in the database may be of great value to the identification process. In order to facilitate this laborious procedure, a project to employ automated phylogenetic analysis in the identification of ESTs was initiated. galaxieEST is an open source Perl-CGI script package designed to complement traditional similarity-based identification of EST sequences through employment of automated phylogenetic analysis. It uses a series of BLAST runs as a sieve to retrieve nucleotide and protein sequences for inclusion in neighbour joining and parsimony analyses; the output includes the BLAST output, the results of the phylogenetic analyses, and the corresponding multiple alignments. galaxieEST is available as an on-line web service for identification of fungal ESTs and for download / local installation for use with any organism group at http://galaxie.cgb.ki.se/galaxieEST.html. By addressing sequence relatedness in addition to similarity, galaxieEST provides an integrative view on EST origin and identity, which may prove particularly useful in cases where similarity searches return one or more pertinent, but not full, matches and

  16. Le tourisme alpin

    Directory of Open Access Journals (Sweden)

    Andrea Macchiavelli

    2009-06-01

    Full Text Available La forte croissance qu’ont connue les pays alpins dans les dernières décennies a surtout été fondée sur l’offre des activités du ski, avec comme conséquence, un massif développement immobilier, la multiplication d’infrastructures et l’extension des domaines. Aujourd’hui, le marché du ski semble arriver à saturation, la Convention alpine a mis un frein à la poursuite du développement des domaines skiables et on observe donc avec intérêt la diversification de l’offre soutenue par l’innovation. Après avoir rappelé les facteurs de changement en cours les plus significatifs dans le tourisme montagnard, l’article présente une grille interprétative de l’évolution des destinations touristiques alpines, identifiant les phases qui ont caractérisé son développement. Puis il propose une réflexion sur certaines conditions qui peuvent favoriser l’innovation dans le tourisme alpin, ainsi que sur les contradictions qui les accompagnent souvent. Dans la plupart des cas l’innovation est le résultat d’un processus qui a été lancé et qui s’est développé au sein de la communauté alpine, souvent favorisé et soutenu par des institutions nationales et internationales, et grâce auquel les difficultés structurelles qui ont déjà été abordées précédemment ont pu être surmontées avec succès.The spectacular increase in tourism in the Alps in recent decades has been founded mainly on the boom in skiing, resulting in both strong real estate development and an increasing array of infrastructures and ski runs. Today the ski market seems to have virtually reached saturation point and the winter sports sector needs to diversify its offer through innovation. After a review of the main factors of change in mountain tourism, the paper presents a grid for interpreting the life cycle of alpine destinations, identifying the phases that characterize their evolution. The conditions that may favour innovation in alpine

  17. : tous les projets | Page 112 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le programme de recherche Croissance de l'économie et débouchés économiques des femmes (CEDEF) est une initiative de collaboration entre le CRDI, le Department for International Development du Royaume-Uni et la Fondation William et Flora Hewlett. Région: South Asia, North of Sahara, South of Sahara, United ...

  18. Le modèle fédéral dans le sport français, un principe fondateur dépassé ?

    Directory of Open Access Journals (Sweden)

    Béatrice Barbusse

    2009-06-01

    Full Text Available Dans le sport français, le fédéralisme s’est installé comme une évidence institutionnelle dès la fin du 19e siècle et le début du 20e siècle dans un pays qui pourtant ne se pense pas fédéral. En outre, si son apparition est liée à l’émergence du sport comme nouvelle pratique sociale à côté d’autres pratiques physiques plus traditionnelles, il s’est rapidement imposé comme la pierre angulaire de l’ordre sportif français. Près d’un siècle plus tard, son monopole institutionnel est bousculé voire «concurrencé». Ces constats d’ensemble nous amènent à nous interroger sur les raisons pour lesquelles le sport a épousé le modèle fédéral dans un pays non fédéral, mais aussi sur ses limites actuelles. Est-il encore le modèle approprié aux circonstances contemporaines ? A-t-il toujours sa place dans le système de gouvernance du sport ? Ou bien, a contrario, reste-t-il le dernier rempart légitime face aux excès du sport contemporain (dopage, violence, corruptions, déficits… ? À partir d’une approche socio-historique, il s’est agi dans cet article de reconstruire le fil de la généalogie du fédéralisme sportif tout en s’interrogeant sur ses perspectives. Au delà de la question du fédéralisme, c’est bien celle de la gouvernance du sport contemporain qui est posée.

  19. Le survivant sans le syndrome Schreber

    Directory of Open Access Journals (Sweden)

    Richard Figuier

    2006-09-01

    Full Text Available On a pensé la catastrophe, mais a-t-on suffisamment pensé la survivance et la figure du survivant ? Ce n'est pas un hasard si celle-ci est au centre de Masse et puissance, oeuvre dans laquelle Canetti interroge la « mauvaise » survivance responsable de la poursuite de la logique de guerre. Mais où trouver la « bonne » ? Revenir de la catastrophe ne suffit pas pour être un « survivant authentique », selon l'expression de Kafka. Il faut avoir dépassé, avec Primo Levi et Robert Antelme, l'opposition de la vie comme croissance continue et de la mort comme son horrible contraire, par le don, dans la pauvreté solidaire, de cette vie retrouvée.Hemos reflexionado acerca de la catástrofe, pero ¿hemos meditado lo suficiente sobre la supervivencia y el superviviente? No es una coincidencia si el superviviente es el tema principal de Masse et puissance, obra en la cual Canetti analiza la «mala» supervivencia responsable de la persistencia de la lógica de guerra ¿Dónde sin embargo podemos encontrar la «buena» supervivencia? Superar la catástrofe no es suficiente para ser un «auténtico superviviente», según Kafka. Es fundamental ir más allá, con Primo Levi y Robert Antelme, de la oposición entre la vida, como crecimiento continuo, y la muerte, como su espantoso contrario, mediante la donación de forma solidaria de esta vida reencontrada.Disaster is the theme of many studies, but what about survival and of the figure of the survivor? This issue is central in Mass and power, work in which Canetti questions the “bad” survival, responsible for the continuation of the logic of war. But is there any “good” survival? Coming back from the catastrophe is not enough to be an “authentic survivor”, according to Kafka’s expression. To achieve this, it is necessary to have exceeded, with PrimoLevi and Robert Antelme, the opposition of life as a continuous growth and of death as its horrible opposite, by the gift, in a

  20. Le tennis dans le monde: état et prospective

    Directory of Open Access Journals (Sweden)

    Pierre DUMOLARD

    1989-06-01

    Full Text Available Le tennis est peu ou prou pratiqué dans tous les pays du monde, mais avec de considérables variations d'intensité. Actuellement, ses points d'ancrage se situent dans les pays développés occidentaux et dans l'ancienne sphère d'influence britannique. En tenant compte de l'évolution démographique et économique possible des nations, des projections de pénétration de ce sport sont établies pour l'horizon 2000.

  1. La lipogenèse chez le lapin. Importance pour le contrôle de la teneur en lipides de la viande

    OpenAIRE

    Gondret, Florence

    1999-01-01

    La teneur en lipides d’un tissu est la résultante de plusieurs flux métaboliques (dépôt, synthèse, utilisation). Cet article présente les principales caractéristiques de la synthèse des lipides chez le lapin, dans le muscle comparativement aux tissus adipeux visibles et au foie. Le potentiel de synthèse de novo exprimé par le muscle augmente avec l’âge de l’animal, en parallèle à l’accumulation des triglycérides dans les adipocytes intramusculaires. L’activité des enzymes qui fournissent le N...

  2. Comparative morphological analysis of apple blister mite, Eriophyes mali Nal., a new pest in Serbia

    Directory of Open Access Journals (Sweden)

    Biljana Vidović

    2014-06-01

    Full Text Available The apple blister mite, Eriophyes mali Nalepa, 1926 (Acari: Prostigmata: Eriophyoidea, has been recently found in Serbia as a new pest of apple. The history of its research, the results of a morphological analysis and degree of infestation are presented. A comparison of the main morphological features of mites from different populations of remote geographical origin has shown that the apple blister mite from Serbia is most similar to another European population (Bulgarian [or Austrian?] while it differs from E. mali originating from the USA and New Zealand. The percentage of infestation varied from 1.6% to 87.6%, with an average of 22.4%.

  3. Rutebeuf entre le temps de l'église et le temps du marchand

    Directory of Open Access Journals (Sweden)

    Miha Pintarič

    1994-12-01

    Full Text Available La poésie de Rutebeuf, comme l' observe M. Zink, est une poésie religieuse, vu que l préoccupation du salut y est omnipresénte. Elle est religieuse à une époque qui donne de nouveaux contenus aux anciennes valeurs, ouvrant de nouvelles voies qui peuvent mener au salut spirituel qui reste le but suprême de la vie humaine. Une idée des plus importantes, en ce qui concerne ce changement, c'est l'idée de travail.

  4. 149 Résumé Notre article se propose d'analyser le travail des ...

    African Journals Online (AJOL)

    8 juil. 2008 ... ... la dynamique de l'économie informelle, c'est le rapport à la loi qui est décisif… » ... qui très souvent, pour ne pas dire systématiquement, attire le con- sensus chez ceux qui .... des secteurs modernes…» (A.Invernizzi.

  5. Le limus rédempteur de Andrej Tarkovski

    Directory of Open Access Journals (Sweden)

    Paolo Mottana

    2015-04-01

    Full Text Available Le cinéma de Tarkovski est riche de présences symboliques. L'essai rend, à travers le contact prolongé et fidèle aux différentes oeuvres du metteur en scène russe, la constellation de ses éléments archetipiques et de ses figures les plus significatives. Le dialogue terre-eau, le travail du feu, la récurrence de l'arbre, du bois, de l'enfance, le flux lent du temps, la phenomenologie poétique de la maison. Dans le cinéma de Tarkovski on se perd, son oeuvre, un vrai opus magnus alchimique, est un voyage dans la survivance d'un halètement mystique profondément incarné dans la matière terrestre. Son parcours circulaire, de l'arbre brûlé d'Ivan à ce qui renaît à la fin du Sacrifice miraculeusement, c'est une cheville fondamentale pour pouvoir expérimenter la puissance de l'imagination créatrice quand encore elle est l' expression d'une sensibilité inspirée à l'âme du monde".

  6. Le vide univers du tout et du rien

    CERN Document Server

    Diner, Simon

    1997-01-01

    Pourquoi l'Univers plutôt que le vide ? Le temps et l'espace existent-ils en l'absence de l'Univers ? Que reste-t-il quand tout est enlevé ? Pourquoi quelque chose plutôt que rien ? Depuis des siècles, ces interrogations mobilisent philosophes et physiciens. Mais aujourd'hui, le vide n'est pas le rien. Il serait même l'acteur central de l'histoire de la matière et de l'Univers, le partenaire privilégié de la physique. Vide et matière ne sont plus deux manifestations séparées de la nature, mais deux aspects d'une même réalité. Le vide est l'état de base dont la matière émerge, sans couper son cordon ombilical Le vide comme Univers du rien cède la place au vide comme Univers du tout. Que le vide puisse être conçu par les physiciens comme réservoir potentiel d'univers, voici qui ne devrait laisser personne indifférent. Ce livre ouvre un débat et nous convie à une réflexion surprenante.

  7. Lactase persistence genotypes and malaria susceptibility in Fulani of Mali

    Directory of Open Access Journals (Sweden)

    Dolo Amagana

    2011-01-01

    Full Text Available Abstract Background Fulani are a widely spread African ethnic group characterized by lower susceptibility to Plasmodium falciparum, clinical malaria morbidity and higher rate of lactase persistence compared to sympatric tribes. Lactase non-persistence, often called lactose intolerance, is the normal condition where lactase activity in the intestinal wall declines after weaning. Lactase persistence, common in Europe, and in certain African people with traditions of raising cattle, is caused by polymorphisms in the enhancer region approximately 14 kb upstream of the lactase gene. Methods To evaluate the relationship between malaria and lactase persistence genotypes, a 400 bp region surrounding the main European C/T-13910 polymorphism upstream of the lactase gene was sequenced. DNA samples used in the study originated from 162 Fulani and 79 Dogon individuals from Mali. Results Among 79 Dogon only one heterozygote of the lactase enhancer polymorphism was detected, whereas all others were homozygous for the ancestral C allele. Among the Fulani, the main European polymorphism at locus C/T-13910 was by far the most common polymorphism, with an allele frequency of 37%. Three other single-nucleotide polymorphisms were found with allele frequencies of 3.7%, 1.9% and 0.6% each. The novel DNA polymorphism T/C-13906 was seen in six heterozygous Fulani. Among the Fulani with lactase non-persistence CC genotypes at the C/T-13910 locus, 24% had malaria parasites detectable by microscopy compared to 18% for lactase persistent genotypes (P = 0.29. Pooling the lactase enhancer polymorphisms to a common presumptive genotype gave 28% microscopy positives for non-persistent and 17% for others (P = 0.11. Conclusions Plasmodium falciparum parasitaemia in asymptomatic Fulani is more common in individuals with lactase non-persistence genotypes, but this difference is not statistically significant. The potential immunoprotective properties of dietary cow milk as a reason

  8. Le voyageur et le touriste

    Directory of Open Access Journals (Sweden)

    André Rauch

    2011-06-01

    Full Text Available Les guides qui paraissent dans la première moitié du XIXe siècle, en langue allemande, anglaise et française, ont introduit des usages. Ils ont défini une manière de voyager, arrêté les itinéraires et indiqué les sites ou les lieux qu’il convenait de visiter. Lorsque paraissent les guides pour automobilistes au début du XXe siècle, la route permet d’autres formes de vagabondage, dont la gastronomie est un exemple illustratif. Dans les années soixante-dix, les nouveaux guides ont suscité d’autres curiosités, ils ont aussi indiqué au touriste les budgets qui leur permettraient de s’orienter dans la consommation touristique.Guides published during the first half of 19th century, in German, English and French languages have introduced some customs. They have defined a way of travelling, made up the routes and indicated the places and settings one has to visit. When guides for motorists are published at the beginning of the 20th century, the road allows other forms of wandering, among which gastronomy is an illustrative example. During the seventies, the new guides aroused other curiosities, they also indicated to the tourists the budgets that would allow them to find their way inside tourist consuming.

  9. AcEST: BP915632 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ... 31 2.6 sp|P03186|TEGU_EBV Large tegument protein OS=Epstein-Barr virus ... 30 3.3 sp|Q9E7N7|VP4A_LNYV Phosphoprotein OS=Lettuce...E7N7|VP4A_LNYV Phosphoprotein OS=Lettuce necrotic yellows virus GN=P PE=2 SV=1 Le

  10. AcEST: DK962367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla ... 57 2e-06 tr|O81529|O81529_MESCR Metallothion...DPCNC 66 >tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla filiculoides GN=AzMT2 PE=4 SV=1 Le

  11. AcEST: DK950504 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9|NETR_PONPY Neurotrypsin OS=Pongo pygmaeus GN=PRSS12 PE... 25 3.5 sp|A1VRP1|T23O_POLNA Tryptophan 2,3-dioxy...in OS=Pongo pygmaeus GN=PRSS12 PE=3 SV=1 Length = 877 Score = 25.4 bits (54), Expect(2) = 3.5 Identities = 1...+LE+ +R+ Sbjct: 444 DQNLSQCKDEAHLSANNLEDAHRK 467 >sp|Q5G269|NETR_PONPY Neurotryps

  12. AcEST: DK956784 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tolB OS=Rhizobium leguminosarum bv.... 38 0.042 sp|A8F168|TOLB_RICM5 Protein tolB OS=Rickettsia massiliae (s...PDGARVSFES 309 >sp|A8F168|TOLB_RICM5 Protein tolB OS=Rickettsia massiliae (strain Mtu5) GN=tolB PE=3 SV=1 Le

  13. Économie | Page 23 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Colour. #2C81B5. Le G8 (Allemagne, Angleterre, Canada, États-Unis, France, Italie, Japon, Russie et Union européenne) est aujourd'hui le principal vecteur politique de la mondialisation. Il est également la force politique qui soutient le plus fermement les institutions multilatérales façonnant la gouvernance économique ...

  14. Les enjeux du modèle standard

    CERN Document Server

    CERN. Geneva

    2008-01-01

    Toute la matière visible dans l'Univers est décrite par le « Modèle Standard ». Selon cette théorie, la matière est constituée d'atomes, qui contiennent des électrons orbitant autour de noyaux, dont les composants fondamentaux sont les quarks. Quatre forces fondamentales agissent entre ces particules élémentaires : les forces électromagnétique est gravitationnelle, et les interactions nucléaires forte et faible. La description fournie par le Modèle Standard de ces particules et de leurs interactions est en parfait accord avec les expériences. Néanmoins, des questions fondamentales restent sans réponse jusqu'à maintenant : d'où vient la masse des particules ? Pourquoi y a-t-il tant de types de particules ? Existe-t-il une théorie unifiée de toutes les interactions ? Quelle est la nature de la matière cachée prédite par les astrophysiciens ? Le LHC au CERN donnera des éléments de réponse à ces questions au-delà du Modèle Standard.

  15. Le CRDI en Colombie

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI appuie la recherche en Colombie dans des domaines tels ... Le CRDI a soutenu des activités de longue haleine qui ont eu pour ... Des travaux subventionnés par le CRDI ont aidé une fondation à intégrer Internet à son programme ...

  16. Le fictif et le réel dans L’Empereur et l’assassin de Chen Kaige

    OpenAIRE

    Giafferri, Xiaomin

    2008-01-01

    Comme tout texte historique littéraire refait l’Histoire en la manipulant, le récit filmique est doublement mensongère du fait de sa double représentation : le décor et les acteurs représentent une situation qui est la fiction, et le film lui-même représente sous forme d’images juxtaposées cette première représentation. Sans vouloir faire la part du réel et de l’imaginaire, le présent travail tente de montrer comment, dans le film L’empereur et l’assassin de Chen Kaige, l’illusion de l’authen...

  17. Processus de construction de la confiance et configuration de contrôle de gestion

    OpenAIRE

    Wafa Khlif

    2000-01-01

    International audience; L'enrichissement de la compréhension du contrôle de gestion par une dimension plus “humaine” a conduit naturellement à l'émergence de concepts “qualitatifs”. La confiance fait partie de ces concepts ignorés dans un contexte instrumental. L'objectif de cette recherche est d'analyser le processus de construction de la confiance relativement aux éléments de contrôle de gestion. En premier lieu, ce travail discute le lien entre le contrôle de gestion et la confiance dans l...

  18. Construire les stratégies avec le Balanced Scorecard:vers une approche interactive du modèle de Kaplan et Norton

    OpenAIRE

    Gérald Naro; Denis Travaillé

    2010-01-01

    (VF)L’objectif de cet article est de confronter le Balanced Scorecard avec le modèle des leviers de contrôle de Simons (1995) et de discuter de son rôle dans les différentes phases du processus stratégique. Nous privilégions une représentation du BSC comme outil de contrôle interactif. Notre recherche est fondée sur une méthodologie longitudinale de type recherche action à partir de l’étude de deux cas. Les résultats montrent que le BSC crée un processus de construction collective favorisant ...

  19. Lele des associations  dans la médiation en archéologie

    OpenAIRE

    Sence, Christophe

    2014-01-01

    Le milieu associatif est connu en France pour son dynamisme et sa réactivité. Il en va de même en archéologie, notamment dans le domaine de la médiation. Si le public ignore bien souvent qu’une association se cache derrière le lieu qu’il vient de visiter, nombreux sont les sites archéologiques, toutes périodes confondues, dont la mise en valeur est entièrement assumée par une telle structure. Dans ce cadre, tout est envisageable, de la simple ouverture pendant les Journées européennes du patr...

  20. Le theatre d'Afrique noire francophone: un art tourne vers le ...

    African Journals Online (AJOL)

    Cette étude a pour objectif de porter un regard analytique sur le théâtre d'Afrique noire francophone, depuis les années d'indépendances jusqu'à nos jours, afin de mettre en relief sa contribution au développement du continent. Il est à remarquer, en effet, que ce théâtre, dans son cheminement, est essentiellement un ...

  1. Clinical manifestations of Waardenburg syndrome in a male adolescent in Mali, West Africa.

    Science.gov (United States)

    Imperato, Pascal James; Imperato, Gavin H

    2015-02-01

    Waardenburg syndrome (WS) is a genetic disorder of which there are four distinct types. These four types are differentiated by the physical defects which they produce. Presented here is the case of a 13-year-old boy with WS Type I who was observed and physically assessed in Mali, West Africa in 1969. His physical findings included a bright blue coloring to the irises of the eyes, profound sensorineural deafness, mutism, dystopia canthorum (lateral displacement of the inner canthi of the eyes), broad nasal root, bushy eyebrows, and scaphoid deformities of the supraorbital portions of the frontal bone. Because family members were not available for interviews or physical examinations, it was not possible to determine if this patient was suffering from a congenital form of the disorder or from a spontaneous mutation. Given the patient's then location in a remote rural area of Mali where electricity was absent, it was not possible to perform additional diagnostic tests. The patient described here is the first with WS in Mali, West Africa to have been medically observed and evaluated and later documented in the medical literature. A second case of the syndrome in Mali was described in the medical literature in 2011 in an 18-month-old infant who did not have sensorineural hearing loss, but who did have a bilateral cleft lip. An historical overview of WS is presented along with details concerning the characteristics of the four types of the disorder.

  2. Inequality in MINUSMA: African Soldiers are in the Firing Line in Mali

    DEFF Research Database (Denmark)

    Albrecht, Peter; Cold-Ravnkilde, Signe Marie; Haugegaard, Rikke

    2016-01-01

    African and European soldiers in the United Nations peacekeeping mission in Mali (MINUSMA) work under very different conditions regarding levels of training, equipment, general support from their governments and the fact that African troops are deployed in the most dangerous areas. The UN should ...

  3. Communicating war in Mali, 2012 : On-offline networked political agency in times of conflict

    NARCIS (Netherlands)

    Bruijn, de M.E.; Pelckmans, L.; Sangare, B.

    2015-01-01

    The Arab Spring raised high expectations for political freedom, especially for situations in which the rapid development of ICT intersects with political oppression and rebellion, as was the case in Mali, West Africa. In 2012 the country’s northern part fell into the hands of ‘rebels’ and jihadists

  4. Effects of climate variability and climate change on crop production in southern Mali

    NARCIS (Netherlands)

    Traore, B.; Corbeels, M.; Wijk, van M.T.; Rufino, M.C.; Giller, K.E.

    2013-01-01

    In West Africa predictions of future changes in climate and especially rainfall are highly uncertain, and up to now no long-term analyses are available of the effects of climate on crop production. This study analyses long-term trends in climate variability at N'Tarla and Sikasso in southern Mali

  5. The True Lion King of Africa: The Epic History of Sundiata, King of Old Mali.

    Science.gov (United States)

    Paterno, Domenica R.

    David Wisniewski's 1992 picture book version of the African epic of "Sundiata, Lion King of Mali" and the actual historical account of the 13th century Lion King, Sundiata, are both badly served by Disney's "The Lion King." Disney has been praised for using African animals as story characters; for using the African landscape as…

  6. Disputed desert : decolonisation, competing nationalisms and Tuareg rebellions in Northern Mali

    NARCIS (Netherlands)

    Lecocq, B.

    2010-01-01

    This book deals with political changes and internal debates about political changes within Tamasheq (Tuareg) society in Mali from the late 1940s to the present. These debates focus on political structures introduced to Tamasheq society from outside and their impact on and incorporation into local

  7. Validating operational food insecurity indicators against a dynamic benchmark : evidence from Mali

    OpenAIRE

    Christiaensen, Luc J.; Boisvert, Richard N.; Hoddinott, John

    2000-01-01

    The authors develop an explicitly forward-looking indicator of food insecurity that takes into account both current dietary inadequacy and vulnerability to dietary inadequacy in the future. Application of this measure to data from northern Mali shows that neglecting the future dimension of food insecurity causes serious underestimation of food insecurity in this area. The authors evaluate ...

  8. Policy Review on Adult Learning: The Adult Non-Formal Education Policy of Mali, West Africa

    Science.gov (United States)

    Gadio, Moussa

    2011-01-01

    This article focuses on the issue of policy development for adult learning in Mali, West Africa. On January 2007, the Malian government adopted the "Adult Non-formal Education Policy Document," which was intended to regulate the adult learning sector and federate the actions of policy makers, adult education providers, and adult…

  9. Structuring of Milk Production Basins: Comparison between Brazilian Amazonia and Mali

    Directory of Open Access Journals (Sweden)

    R. Poccard Chapuis

    2007-01-01

    Full Text Available In Brazilian Amazonia, structuring of dairy basins is progressing fast. In Mali, these processes are not engaged, although the activity of cattle keeping is ancient and currently thriving. This difference covers essential stakes: fight against poverty, food production in the face of the demographic challenge, current debates on the theories of the development. The comparative analysis is based on a diachronic model of the successive phases of structuring of the Amazonian dairy basins. This model is then applied to dairy dynamics in Mali to identify blockages in the structuring of basins. Six phases are highlighted in the Amazonian model, from subsistence consumption of raw milk to basin specialization and establishment of an industrial monopoly. The application in Mali shows that the initial situations are similar (territory constraints. But two essential mechanisms are not working: transportation of finished products to distant markets, and fresh milk collection extended beyond the boundaries of the direct sale to urban consumers. These two aspects, essential to ensure the flow upstream and downstream of the products, address the question of dairy unit location as well as the distribution organization in Bamako. In spite of the limits of the comparative analysis, the model shows that the keys to a positive evolution in Mali are more to be found at the industry and distribution levels than at the production level. Public actions (State and collectivities could focus on these two points, notably through training activities and credit policies.

  10. The phenology of malaria mosquitos in irrigated rice fields in Mali

    NARCIS (Netherlands)

    Klinkenberg, E.; Takken, W.; Huibers, F.P.; Touré, Y.T.

    2003-01-01

    A field study was carried out in the large-scale rice irrigation scheme of the Office du Niger in Mali to investigate the relation between anopheline mosquito larval development and small-scale differences in irrigation practices, such as water level, irrigation application and irrigation frequency.

  11. Consumption of, and beliefs about fonio (digitaria exilis) in urban area in Mali

    NARCIS (Netherlands)

    Fanou, N.; Koreissi, Y.; Dossa, R.A.M.; Brouwer, I.D.

    2009-01-01

    The study sought to determine beliefs and practices about neglected crops in West Africa, using fonio (Digitaria exilis) as a model to understand how obstacles impede the consumption of this cereal in Bamako, the capital city of Mali. This was a crosssectional study on food ethnography in three

  12. Co-learning cycles to support the design of innovative farm systems in southern Mali

    NARCIS (Netherlands)

    Falconnier, Gatien N.; Descheemaeker, Katrien; Mourik, Van Thomas A.; Adam, Myriam; Sogoba, Bougouna; Giller, Ken E.

    2017-01-01

    Farm systems were re-designed together with farmers during three years (2013–2015) in Southern Mali with the aim to improve income without compromising food self-sufficiency. A cyclical learning model with three steps was used: Step 1 was the co-design of a set of crop/livestock technical

  13. Understanding farm trajectories and development pathways: Two decades of change in southern Mali

    NARCIS (Netherlands)

    Falconnier, G.N.; Descheemaeker, K.K.E.; Mourik, van T.A.; Sanogo, O.; Giller, K.E.

    2015-01-01

    Institutional support for smallholders has been the motor for the expanding cotton production sector in southern Mali since the 1970s. Smallholder farms exhibit diverse resource endowments and little is known on how they benefit from and cope with changes in this institutional support. In this paper

  14. The pre- and protohistoric togué of the Niger alluvial plain, Mali

    NARCIS (Netherlands)

    Schmidt, Annette Margaretha

    2009-01-01

    The Inland Niger Delta in Mali is scattered with thousands of tell-like dwelling mounds that testify to the rich archaeological heritage of this attractive occupation area. Little is known about the structure and evolution of this considerable settlement system. The general aim of the present

  15. The hearthhold in pastoral Fulbe society, central Mali : social relations, milk and drought

    NARCIS (Netherlands)

    Bruijn, de M.E.

    1997-01-01

    In pastoral Fulbe society in central Mali women had, and to some degree still have, an important social and economic role, concentrated on a 'milk economy' organized through a female-headed, women-centred unit, called 'fayannde' or 'hearthhold'. In a society of seminomadic pastoralists who live most

  16. The match between motivation and performance management of health sector workers in Mali

    NARCIS (Netherlands)

    Dieleman, Marjolein; Toonen, Jurrien; Touré, Hamadassalia; Martineau, Tim

    2006-01-01

    UNLABELLED: Human resources for health (HRH) play a central role in improving accessibility to services and quality of care. Their motivation influences this. In Mali, operational research was conducted to identify the match between motivation and the range and use of performance management

  17. How project approach influences adoption of SWC by farmers, examples from southern Mali

    NARCIS (Netherlands)

    Bodnar, F.; Schrader, T.; Campen, Van W.

    2006-01-01

    Choices in project approach affect the continuation of soil and water conservation (SWC) after project withdrawal, and thus the sustainability and cost effectiveness of the project. A SWC project was carried out in southern Mali between 1986 and 1998. Its features were the promotion of cheap and

  18. Factors influencing adoption of soil and water conservation measures in southern Mali

    NARCIS (Netherlands)

    Bodnar, F.; Graaff, de J.

    2003-01-01

    A soil and water conservation (SWC) extension programme, promoting erosion control measures and soil fertility measures, has been going on in southern Mali since 1986. Five factors that influence farmer adoption of SWC measures were analysed: land pressure, cotton-growing area, possession of

  19. Mali - Public Expenditure Management and Financial Accountability Review : Public Financial Management Performance Report

    OpenAIRE

    World Bank

    2010-01-01

    The public financial management (PFM) performance assessment in Mali covered all central government revenues and expenditures and the institutions responsible for their management. This means that the assessment covered central government ministries and institutions, along with their de concentrated units in the regions (governors' staff); and autonomous government agencies, of which there...

  20. Le citoyen rieur

    Directory of Open Access Journals (Sweden)

    Anna Rycman

    2009-11-01

    Full Text Available Dans la Pologne d’aujourd’hui, l’évolution des modèles d’engagement civique et politique s’opère plus particulièrement auprès des jeunes générations. Parmi les expériences nouvelles de participation politique, les nouvelles technologies de l’information et de la communication offrent des opportunités radicales de reconfigurer l’espace public. La jeunesse polonaise investit en masse le Web. Dans le flux de paroles affranchies circulant et dialoguant dans le cyberespace, nous nous intéressons ici au développement d’un discours qui emprunte au registre de la dérision et de la satire politiques. Une multitude de sites critiques, de nature apparemment contestataire, des sites d’opposition fondés sur le genre satirique, ont émergé comme réponse apportée à la situation politique. Cet espace public électronique représente une forme moderne de « folklore politique », contribuant au processus de socialisation des jeunes citoyens polonais.The laughing citizen. A modern form of civic commitment in democratic Poland?In present day Poland, the evolution of civic and political commitment models is above all the affaire of the younger generations. Among the current opportunities for political participation, the new information and communication technologies offer radical opportunities to reconfigure the public arena. Polish youth are flocking to the Web. Amongst the flux of frank points of views circulating and dialoguing in cyberspace, our interest here is the development of a discourse inspired by political and satirical derision. A multitude of critical, apparently anti-establishment, sites and general opposition sites using the satirical style have emerged as a response to the political situation. This public electronic space represents a modern form of « political folklore », contributing to the socialising processes of young polish citizens.El ciudadano que rie. ¿Nueva forma del compromiso cívico en la

  1. Le devenir actif du corps affectif

    Directory of Open Access Journals (Sweden)

    Pascal Séverac

    2005-09-01

    Full Text Available Le but de cet article est de saisir ce que signifie, pour le corps, être actif. À partir de la proposition 49 de la partie IV de l’Éthique, on propose de distinguer deux manières d’appréhender le corps – soit comme corps organique, soit comme corps affectif -, et l’on montre que la question éthique du devenir actif s’adresse à la dimension affective du corps. Il faut penser le devenir actif du corps affectif comme augmentation de son aptitude non seulement à affecter, mais aussi à être affecté. En effet, être affecté pour le corps n’est pas identique à pâtir : au contraire, plus est grande l’ouverture sensible d’un corps aux autres corps, plus est grande son activité éthique.The aim of this paper is to understand how the body can be active. With the proposition 49 of the fourth part of Ethics, two ways of conceiving of the body are distinguished : like an organic body or like an affective body. The ethics question of becoming active is about the affective body. This becoming active must be understood as increasing of the ability to affect, as well as to be affected. To be affected is different from to be passive. On the contrary, the more the body is able to be affected, the more he becomes active.

  2. Mesure GPS sur le circuit du LIER à Lyon

    OpenAIRE

    GIRARD, PL; MARAIS, J

    2006-01-01

    Depuis quelques années le guidage immatériel pour les autobus est à l'ordre du jour et la localisation est une des contraintes à son développement. Pour subvenir à ces besoins la solution GPS est envisagée. Cette technologie en devenir comporte énormément d'avantage notamment en terme coût et de maintenance. L'expérimentation faite à Lyon met en évidence les performances maximales pouvant être obtenu en utilisant le GPS. RAPPORT DE CONTRAT

  3. Le cosmos et le lotus confessions d'un astrophysicien

    CERN Document Server

    Trinh, Xuan Thuan

    2011-01-01

    Que nous dit vraiment la science sur la nature de l'univers, sur son origine et son avenir ? Par quel mystère le langage mathématique, pure création de l'esprit humain, se révèle-t-il aussi performant pour nous décrire les phénomènes physiques, de l'infiniment petit à l'infiniment grand ? S'il existe un ordre du monde, ce que nous en disent la physique quantique et la théorie de la relativité est-il compatible avec ce qu'enseigne le bouddhisme ? Et que peut-on en conclure concernant notre propre vie ? A ces questions passionnantes et à beaucoup d'autres, le célèbre astrophysicien Trinh Xuan Thuan répond ici d'une façon personnelle, en s'appuyant sur son expérience. Son itinéraire l'a placé d'emblée à la confluence de trois cultures : issu d'une famille de lettrés vietnamiens imprégnée de traditions bouddhiste et confucéenne, il a reçu une éducation à la française puis une formation scientifique à l'américaine. Une telle richesse de points de vue lui permet d'apporter, non pas de...

  4. Charabias et magiciens dans le théâtre des xiie-xiiie siècles

    OpenAIRE

    Revol, Thierry

    2014-01-01

    S’intéressant à l’imaginaire médiéval, Jacques Le Goff a mis en valeur trois domaines dans lesquels se manifeste le merveilleux. Le mirabilis correspond au merveilleux pré-chrétien, le magicus au surnaturel maléfique et satanique, et enfin le miraculosus au surnaturel chrétien. Dans la logique chrétienne, le dernier tend à repousser les deux autres dans le domaine de la superstition, ce qui, paradoxalement, légitime leur existence, puisque celle-ci n’est pas niée. Miraculosus et magicus appar...

  5. Le modèle standard de la physique des particules de l'électron au boson de Higgs

    CERN Document Server

    Samueli, Jean-Jacques

    2013-01-01

    Le modèle standard de la physique des particules est une théorie qui décrit les constituants élémentaires de la matière et les interactions qui existent entre eux. Le présent ouvrage est un exposé du développement historique de ce modèle qui suppose que toute la matière est composée de quarks et de leptons, particules ponctuelles de spin 1?2. On dénombre trois générations de quarks et autant de leptons. Les interactions faible, forte et électromagnétique sont, pour leur part, décrites par des théories de jauge dont la médiation est effectuée par des quanta de jauge de spin 1. Ces médiateurs sont les ? , W + , W ? , Z ainsi que huit gluons. La gravitation est par ailleurs analysée dans l'ouvrage dans sa formulation classique et relativiste. Enfin le mécanisme dit de Englert-Brout-Higgs prévoit des particules de spin zéro, correspondant à un champ scalaire qui est supposé donner une masse aux quarks, leptons et aux bosons vecteurs intermédiaires W + , W ? , Z . Nous décrivons ce m�...

  6. A Cross-Sectional Study to Assess HPV Knowledge and HPV Vaccine Acceptability in Mali

    Science.gov (United States)

    Poole, Danielle N.; Tracy, J. Kathleen; Levitz, Lauren; Rochas, Mali; Sangare, Kotou; Yekta, Shahla; Tounkara, Karamoko; Aboubacar, Ben; Koita, Ousmane; Lurie, Mark; De Groot, Anne S.

    2013-01-01

    Despite a high prevalence of oncogenic human papilloma virus (HPV) infection and cervical cancer mortality, HPV vaccination is not currently available in Mali. Knowledge of HPV and cervical cancer in Mali, and thereby vaccine readiness, may be limited. Research staff visited homes in a radial pattern from a central location to recruit adolescent females and males aged 12–17 years and men and women aged ≥18 years (N = 51) in a peri-urban village of Bamako, Mali. Participants took part in structured interviews assessing knowledge, attitudes, and practices related to HPV, cervical cancer, and HPV vaccination. We found low levels of HPV and cervical cancer knowledge. While only 2.0% of respondents knew that HPV is a sexually transmitted infection (STI), 100% said they would be willing to receive HPV vaccination and would like the HPV vaccine to be available in Mali. Moreover, 74.5% said they would vaccinate their child(ren) against HPV. Men were found to have significantly greater autonomy in the decision to vaccinate themselves than women and adolescents (p = 0.005), a potential barrier to be addressed by immunization campaigns. HPV vaccination would be highly acceptable if the vaccine became widely available in Bamako, Mali. This study demonstrates the need for a significant investment in health education if truly informed consent is to be obtained for HPV vaccination. Potential HPV vaccination campaigns should provide more information about HPV and the vaccine. Barriers to vaccination, including the significantly lower ability of the majority of the target population to autonomously decide to get vaccinated, must also be addressed in future HPV vaccine campaigns. PMID:23431375

  7. A cross-sectional study to assess HPV knowledge and HPV vaccine acceptability in Mali.

    Directory of Open Access Journals (Sweden)

    Danielle N Poole

    Full Text Available Despite a high prevalence of oncogenic human papilloma virus (HPV infection and cervical cancer mortality, HPV vaccination is not currently available in Mali. Knowledge of HPV and cervical cancer in Mali, and thereby vaccine readiness, may be limited. Research staff visited homes in a radial pattern from a central location to recruit adolescent females and males aged 12-17 years and men and women aged ≥ 18 years (N = 51 in a peri-urban village of Bamako, Mali. Participants took part in structured interviews assessing knowledge, attitudes, and practices related to HPV, cervical cancer, and HPV vaccination. We found low levels of HPV and cervical cancer knowledge. While only 2.0% of respondents knew that HPV is a sexually transmitted infection (STI, 100% said they would be willing to receive HPV vaccination and would like the HPV vaccine to be available in Mali. Moreover, 74.5% said they would vaccinate their child(ren against HPV. Men were found to have significantly greater autonomy in the decision to vaccinate themselves than women and adolescents (p = 0.005, a potential barrier to be addressed by immunization campaigns. HPV vaccination would be highly acceptable if the vaccine became widely available in Bamako, Mali. This study demonstrates the need for a significant investment in health education if truly informed consent is to be obtained for HPV vaccination. Potential HPV vaccination campaigns should provide more information about HPV and the vaccine. Barriers to vaccination, including the significantly lower ability of the majority of the target population to autonomously decide to get vaccinated, must also be addressed in future HPV vaccine campaigns.

  8. Le don gratuit. Le cas d'un établissement public

    OpenAIRE

    Barel , Yvan; Frémeaux , Sandrine

    2008-01-01

    Disponible en ligne : http://www.annales.org/gc/2008/gc94/barel.pdf; La logique de la réciprocité est le cadre d'analyse dominant de la relation de travail. La logique du don/contredon s'inscrit dans ce même cadre de référence, en postulant qu'aucune relation d'échange ne peut survivre à une situation d'asymétrie trop forte (MAUSS, 1924). Mais elle ajoute une idée nouvelle en mettant en exergue le " tabou du calcul " (BOURDIEU, 1980) : le désir de contredon n'est pas toujours manifesté, ni mê...

  9. AcEST: BP920221 [AcEST

    Lifescience Database Archive (English)

    Full Text Available nition sp|Q9Y4A5|TRRAP_HUMAN Transformation/transcription domain-associated protein OS=Homo sapiens Align le...ficant alignments: (bits) Value sp|Q9Y4A5|TRRAP_HUMAN Transformation/transcription domain-associ... 42 5e-05..... 29 6.3 sp|Q91820|STK6_XENLA Serine/threonine-protein kinase 6 OS=Xenopu... 29 8.2 >sp|Q9Y4A5|TRRAP_HUMAN Transformation

  10. Le combat contre le tabagisme à l'échelle mondiale | CRDI - Centre ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    12 janv. 2011 ... ... en effet d'adopter la toute première convention mondiale à porter sur un enjeu de la santé. ... Elle a désormais force de loi dans plus de 40 pays, dont le Canada. ... ce taux est passé de 1 % il y a dix ans à 5 % aujourd'hui.

  11. Le corpus lexicographique dans les langues à tradition orale: le cas ...

    African Journals Online (AJOL)

    rbr

    langues à tradition orale: les informateurs et la représentativité du corpus. Cette dernière, qui doit ..... les techniques, les instruments, la pêche par les hommes, la pêche par .... cet outil indispensable qu'est le dictionnaire. Je pense que ces ...

  12. Luther contre le protocole de Kyoto ou le retour des « indulgences ».

    Directory of Open Access Journals (Sweden)

    Bernard Jouve

    2005-05-01

    Full Text Available Le 16 février 2005 a marqué la mise en œuvre du Protocole de Kyoto. En fait, depuis l’annonce par la Russie, le 25 octobre 2004, de sa décision de ratifier ce protocole, l’affaire était entendue. Menacé depuis le refus des États-Unis, l’un des plus grands pollueurs de la planète, de ne pas le ratifier pour des raisons purement économiques alors que ce pays produit à lui seul 40 % des gaz à effet de serre ( ges , l’accord survenu à Kyoto en 1997 est enfin entériné et ...

  13. Intelligence artificielle et agents collectifs : le modèle EUROSIM

    Directory of Open Access Journals (Sweden)

    Denise Pumain

    2007-07-01

    Full Text Available EUROSIM est un modèle multi-agents conçu pour simuler l’évolution à moyen terme du système des villes européennes. Les agents sont des entités collectives, les grandes villes caractérisées par leur taille et leur fonction dans le système des villes, et dont les interactions (échanges modulés par des relations de proximité ou de réseau déterminent la dynamique relative, tandis que la croissance d’ensemble dépend de l’innovation. Des outils d’analyse multiscalaire ont été développés afin d’interpréter les sorties du modèle et faciliter le calibrage.

  14. Le corps dans l’espace architectural. Le Corbusier, Claude Parent et Henri Gaudin

    Directory of Open Access Journals (Sweden)

    Julie Cattant

    2016-12-01

    Full Text Available Le premier geste de l’espace architectural est d’accueillir nos corps humains. En leur offrant un espacement à habiter, il leur permet de s’abriter, de se mouvoir et de se rencontrer. L’homme et l’architecture s’affectent l’un l’autre. Nombreux sont les architectes qui interrogent cette coexistence car, renouveler la pensée de l’espace nécessite de reconsidérer le corps humain. L’étude des relations entre le corps et l’espace chez trois architectes français sera l’occasion d’évoquer les écarts et les convergences entre l’homme et l’architecture. L’œuvre de Le Corbusier, protagoniste du mouvement moderne, maintient ainsi une distance entre un corps machinisé et un espace idéal. Marquée par un mode de pensée dualiste, l’architecture de Le Corbusier annonce toutefois son propre dépassement, dépassement que Claude Parent et Henri Gaudin opèreront par la suite à leur manière, le premier en introduisant l’oblique et la déstabilisation du corps, le second en transgressant la limite de l’espace et du corps pour envisager leur porosité réciproque. Finalement, c’est la manière dont l’homme appréhende l’espace avec son corps qui est questionnée par ces trois architectes, de la prégnance du visuel à son évincement.

  15. Le surpoids, l'obésité et le contrôle glycémique chez les diabétiques ...

    African Journals Online (AJOL)

    utilisation et du stockage des sucres apportés par l'alimentation, sa prise en charge est ... l'organisation mondiale de santé (OMS), Le contrôle glycémique a été effectué par l'analyse sanguine de l'Hémoglobine glycosylée et de la Glycémie à jeun.

  16. Comment ameliorer la selection et le traitement des messages verbaux? (How to Improve the Selection and Processing of Verbal Messages)

    National Research Council Canada - National Science Library

    Rivenez, Marie; Darwin, Chris; Guillaume, Anne

    2005-01-01

    L'objectif de cette recherche est d'ameliorer la selection des messages verbaux. Nous cherchons a determiner les facteurs influencant le traitement d'un message verbal lorsque l'attention est portee sur un autre message...

  17. AcEST: DK948090 [AcEST

    Lifescience Database Archive (English)

    Full Text Available erase A OS=Aspergillus tubingen... 50 1e-05 sp|P0C1S9|DGLB_RAT Sn1-specific diacy...|P47145|YJ77_YEAST Putative lipase YJR107W OS=Saccharomyces ce... 50 8e-06 sp|O42815|FAEA_ASPTU Feruloyl est

  18. Using the Lives Saved Tool to aid country planning in meeting mortality targets: a case study from Mali.

    Science.gov (United States)

    Keita, Youssouf; Sangho, Hamadoun; Roberton, Timothy; Vignola, Emilia; Traoré, Mariam; Munos, Melinda

    2017-11-07

    Mali is one of four countries implementing a National Evaluation Platform (NEP) to build local capacity to answer evaluation questions for maternal, newborn, child health and nutrition (MNCH&N). In 2014-15, NEP-Mali addressed questions about the potential impact of Mali's MNCH&N plans and strategies, and identified priority interventions to achieve targeted mortality reductions. The NEP-Mali team modeled the potential impact of three intervention packages in the Lives Saved Tool (LiST) from 2014 to 2023. One projection included the interventions and targets from Mali's ten-year health strategy (PDDSS) for 2014-2023, and two others modeled intervention packages that included scale up of antenatal, intrapartum, and curative interventions, as well as reductions in stunting and wasting. We modeled the change in maternal, newborn and under-five mortality rates under these three projections, as well as the number of lives saved, overall and by intervention. If Mali were to achieve the MNCH&N coverage targets from its health strategy, under-5 mortality would be reduced from 121 per 1000 live births to 93 per 1000, far from the target of 69 deaths per 1000. Projections 1 and 2 produced estimated mortality reductions from 121 deaths per 1000 to 70 and 68 deaths per 1000, respectively. With respect to neonatal mortality, the mortality rate would be reduced from 39 to 32 deaths per 1000 live births under the current health strategy, and to 25 per 1000 under projections 1 and 2. This study revealed that achieving the coverage targets for the MNCH&N interventions in the 2014-23 PDDSS would likely not allow Mali to achieve its mortality targets. The NEP-Mali team was able to identify two packages of MNCH&N interventions (and targets) that achieved under-5 and neonatal mortality rates at, or very near, the PDDSS targets. The Malian Ministry of Health and Public Hygiene is using these results to revise its plans and strategies.

  19. Comment fonctionne l’Univers ? Ce que le LHC peut nous apprendre

    CERN Multimedia

    CERN. Geneva

    2008-01-01

    L'Univers en son enfance était une "soupe" de particules, de plus en plus chaudes (de plus haute énergie) à mesure qu'on remonte vers sa naissance, le "big bang". C'est ainsi que les observations à des énergies de plus en plus élevées nous permettent, par exemple, de nous approcher de plus près de la prime jeunesse de l'Univers et, donc, de mieux le comprendre. L'étude du macro- et du micro-cosme sont une science unique dans laquelle, de façon surprenante, ce que nous comprenons le moins bien est le vide, qui ne semble pas l'être: il existe une différence fondamentale entre le vide et le néant. Le LHC pourrait nous permettre de voir les vibrations de la "substance" du vide, qu'on appelle les particules 'de Higgs'.

  20. Lele de l'IL6 dans le cancer du foie lié à l'hépatopathie métabolique

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le cancer du foie est souvent mortel. Il n'existe que très peu d'options de traitement, et il s'agit de l'un des cancers dont l'incidence augmente dans le monde entier. L'obésité ou les maladies métaboliques (comme le diabète et la stéatose hépatique) constituent des facteurs de risque du cancer du foie qui sont mal compris.

  1. Le mal et ses complots imaginaires

    OpenAIRE

    Frankfurter, David

    2012-01-01

    Les récits d’abus rituels sataniques que les médias ont largement diffusés, aux États-Unis et au Royaume-Uni, entre le début des années 1980 et la fin des années 1990, soutenaient le parallèle avec les allégations avancées, durant l’Antiquité et au début des Temps modernes, contre les chrétiens, les hérétiques, les juifs ou les sorcières. Quelle est la nature de ces parallèles ? Cet article examine plusieurs types de modèles convoqués lors de diverses occurrences historiques des peurs panique...

  2. Le harcèlement organisationnel des relations sous emprise

    CERN Document Server

    Guhel, Cécile

    2014-01-01

    Le lien entre harcèlement et emprise professionnelle est bien réel. Il est aussi puissant que destructeur. L'aide extérieure est importante mais la prise de conscience du sujet et sa mise à distance sont primordiales pour le retour à Soi. Un facteur de risque organisationnel est un facteur qui relève de l'organisation et qui comporte le risque ou la probabilité qu'un tel comportement abusif voie le jour et qu'il ait des effets négatifs. Un tel facteur peut également contribuer à la persistance ou à l'aggravation du comportement. En abordant la relation d'emprise sous l'éclairage de différentes théories psychologiques, cela vous permettra d'observer les mécanismes intrapsychiques conscients et inconscients qui sous-tendent les comportements de l'instigateur de la relation d'emprise d'une part, et de sa victime d'autre part. Enfin, à travers trois témoignages, de salariées en poste, vous découvrirez combien la parole sur le travail est importante dans la prise de conscience du processus de de...

  3. Le château et la ville : Angers (XIIIe-XVIe s.

    Directory of Open Access Journals (Sweden)

    François Comte

    2010-02-01

    Full Text Available Le château d'Angers est établi sur un point haut de la ville qui domine la Maine et en contrôle le passage. C'est encore l'un des repères les plus visibles lorsqu'on aborde la ville. Les représentations ont toujours privilégié ce stéréotype d'Angers. Mais cette image est bien postérieure à la construction du château au XIIIe s., qui intervient à une période de rivalité entre le duc de Bretagne et le roi de France. En 1227, la garde de plusieurs villes d'Anjou est confiée au duc Pierre Maucler...

  4. La concurrence des experts. Ou qui a le droit de dire ce qu’est la “traite des blanches” dans l’Allemagne de Weimar Competition Among Experts. Or who has the Right to say what Constitutes “White Slavery” in Weimar Germany

    Directory of Open Access Journals (Sweden)

    Benoît Majerus

    2011-03-01

    Full Text Available A travers une polémique qui éclate en 1929 dans le milieu associatif et social juif de la république de Weimar, cet article s’intéresse à la problématique de la constitution de l’expertise. A l’époque, différents acteurs s’opposent, chacun prétendant avoir la légitimité de “dire la vérité” à propos de la traite des blan­ches en Allemagne. Le “champ de la connaissance”, composé d’auteurs issus des sciences humaines comme Max Kreutzberger, s’oppose au “champ de l’ex­périence”, composé de personnes qui travaillent dans des associations juives et qui essayent d’établir un lien entre traite, prostitution et combat moral. Cette po­lémique constitue un cas d’étude révélateur des tensions qui naissent lors de la construction d’un savoir social sur la prostitution dans l’entre-deux-guerres.Through a polemic which broke out in 1929 in the Jewish associative and social medium of the Weimar Republic, this article looks into the problematic of establishing expertise. At the time, various contending actors each claimed to have legitimacy, “to know the truth” about white slavery in Germany. The “field of savants”, composed of authors issuing from the human sciences - like Max Kreutzberger, were opposed by the “the experimental field”, composed of people working in Jewish associations that tried to establish a bond between slavery, prostitution and moral combat. This polemic is a revealing case study of the tensions which arose in the development of social knowledge on prostitution in the inter-war period.

  5. The linear chromosome of the plant-pathogenic mycoplasma 'Candidatus Phytoplasma mali'

    Directory of Open Access Journals (Sweden)

    Migdoll Alexander M

    2008-06-01

    Full Text Available Abstract Background Phytoplasmas are insect-transmitted, uncultivable bacterial plant pathogens that cause diseases in hundreds of economically important plants. They represent a monophyletic group within the class Mollicutes (trivial name mycoplasmas and are characterized by a small genome with a low GC content, and the lack of a firm cell wall. All mycoplasmas, including strains of 'Candidatus (Ca. Phytoplasma asteris' and 'Ca. P. australiense', examined so far have circular chromosomes, as is the case for almost all walled bacteria. Results Our work has shown that 'Ca. Phytoplasma mali', the causative agent of apple proliferation disease, has a linear chromosome. Linear chromosomes were also identified in the closely related provisional species 'Ca. P. pyri' and 'Ca. P. prunorum'. The chromosome of 'Ca. P. mali' strain AT is 601,943 bp in size and has a GC content of 21.4%. The chromosome is further characterized by large terminal inverted repeats and covalently closed hairpin ends. Analysis of the protein-coding genes revealed that glycolysis, the major energy-yielding pathway supposed for 'Ca. P. asteris', is incomplete in 'Ca. P. mali'. Due to the apparent lack of other metabolic pathways present in mycoplasmas, it is proposed that maltose and malate are utilized as carbon and energy sources. However, complete ATP-yielding pathways were not identified. 'Ca. P. mali' also differs from 'Ca. P. asteris' by a smaller genome, a lower GC content, a lower number of paralogous genes, fewer insertions of potential mobile DNA elements, and a strongly reduced number of ABC transporters for amino acids. In contrast, 'Ca. P. mali' has an extended set of genes for homologous recombination, excision repair and SOS response than 'Ca. P. asteris'. Conclusion The small linear chromosome with large terminal inverted repeats and covalently closed hairpin ends, the extremely low GC content and the limited metabolic capabilities reflect unique features of 'Ca

  6. AcEST: DK954060 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK954060 CL412Contig1 Show DK954060 Clone id TST39A01NGRL0019_G24 Library TST39 Length 6...26 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_G24. 5' end sequence. Accession DK95406...s Res. 25:3389-3402. Query= DK954060|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0019_G24, 5' (626 le...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK954060|Adiantum ca...TST39A01NGRL0019_G24 626 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_G2

  7. Mel Gibson contre le boulevard Raspail

    Directory of Open Access Journals (Sweden)

    Boris Jeanne

    2007-03-01

    Full Text Available Que peuvent faire les historiens et les anthropologues spécialistes de l’Amérique face à la puissance médiatique et commerciale d’Apocalypto, le dernier film de Mel Gibson, produit par Buena Vista (c'est-à-dire Disney et ayant déjà engrangé plus de 50 millions de dollars de recette avant même sa sortie en France ? Le cinéma est un art du présent, et quelle que soit l’exactitude de la reconstitution historique qu’il prétend parfois présenter, il demeure un puissant vecteur d’analyse de la soc...

  8. Le stéréotype dans le roman policier

    Directory of Open Access Journals (Sweden)

    Marion François

    2009-12-01

    Full Text Available Le roman policier offre à l’étude du stéréotype une grande variété de redondances, lexicales et structurelles, qui permettent d’éclairer le concept même de genre, en fait issu du constat de stéréotypie. Il est également manifeste que contrairement aux idées reçues, les clichés font du texte policier un texte littéraire, parce qu’ils naissent d’images associées, distinctes de la réalité, qui révèlent d’ailleurs le cheminement même de l’écriture. Par ailleurs ces images jouent un rôle fondamental dans le plaisir du lecteur, comme dans les contes de fées de notre enfance. Les clichés ouvrent la porte des fantasmes : le stéréotype rejoignant l’archétype, les clichés policiers réactivent de nombreux mythes, le texte évoquant l’Autre Scène. Le constat de stéréotypie provoque l’écriture, en particulier parodique, et stimule le renouvellement et l’essaimage des clichés dans toutes sortes de textes, qui bénéficieront de la présence du déjà-lu, laquelle donne au lecteur une assise pour affronter l’inconnu et une expérience pour apprécier la nouveauté.

  9. Le travesti dans le théâtre du xixe siècle : une distribution à contre-genre ?

    OpenAIRE

    Khoury, Camille

    2018-01-01

    Quelques-unes des actrices les plus célèbres du xixe siècle ont laissé à la postérité le souvenir de leurs rôles travestis. C’est notamment le cas de Virginie Déjazet – au point que le déjazet est rapidement devenu synonyme de rôle travesti – ou encore de Sarah Bernhardt. Le travesti est alors un spectacle commun sur les scènes académiques françaises – tandis que certains rôles sont écrits pour être joués en travesti, de grandes actrices s’emparent de rôles masculins pour confronter leur géni...

  10. 1. Le Soleil, une étoile dans notre Galaxie

    OpenAIRE

    Vial, Jean-Claude

    2017-01-01

    Par une belle nuit sans Lune (et sans nuages), levons les yeux vers le ciel. L’œil est immédiatement attiré par le cortège d’étoiles brillantes qui a donné son nom à la Voie lactée. Il s’agit en fait d’une galaxie de près de 200 milliards d’étoiles qui abrite notre Soleil et ses planètes, c’est notre galaxie, « la » Galaxie, comme une île dans le vaste cosmos. La Galaxie : ses 150 à 200 milliards d’étoiles sont réparties selon des bras spiraux autour d’un noyau central et pour la plupart conf...

  11. Chapitre 2. Le texte dérivé

    OpenAIRE

    2017-01-01

    Les analyses précédentes indiquent qu’il est difficile de séparer une poétique de l’écriture ou de la réécriture, procès toujours prospectif, de celle du texte. En effet, le texte est aussi le résultat d’une activité poétique. Mais les conceptions de la notion de texte ne sont pas des plus univoques. Appliquées à la réécriture filmique des textes littéraires, elles le sont encore moins. Comment en serait-il autrement ? Le film lui-même, considéré comme production sémiotique, ne semble pas pou...

  12. Le style modal de la science-fiction

    Directory of Open Access Journals (Sweden)

    Emmanuel Boisset

    2013-04-01

    Full Text Available La faiblesse de style dont souffrirait la science-fiction est en fait le signe que la science y est davantage discours du possible que description du réel. Un « style modal » va suspendre la valeur de vérité, et le style de la possibilité va décontextualiser les métaphores disponibles. En science-fiction, le processus métaphorique génère et structure la diégèse. Un exemple chez Iain M. Banks montre un dialogue quasi incompréhensible mettre à l’épreuve la signification comme possibilité. Les métaphores figées sont revitalisées par la décontextualisation de la fiction, dont le texte peut exploiter l’impertinence.

  13. Le dualisme Chipaya

    Directory of Open Access Journals (Sweden)

    1974-01-01

    Full Text Available L’auteur, partant des observations de Métraux sur Chipaya, apporte des idées neuves sur les ayllu constituant le village, basées sur une enquête approfondie et un plan détaillé du village : deux divisions principales apparaissent, celles-ci se divisant a leur tour en quatre ayllu. La chute brutale de la démographie depuis la seconde moitié du XVIe siècle a fait disparaître les 4 ayllu originels mais l’examen des archives permet d’observer un très vigoureux redressement démographique à partir des derniers 150 ans. Ce redressement démographique semble précipiter un nouvel éclatement de la communauté chipaya. El autor partiendo de las observaciones de Métraux sobre Chipaya, aporta sobre los ayllu que constituían el pueblo, basadas en una encuesta profunda y un plano detallado del pueblo: aparecen dos divisiones principales, dividiéndose éstas a su vez en cuatro ayllu. La caída brutal de la demografía desde la segunda mitad del siglo XVI ha hecho desaparecer los 4 ayllu primitivos pero el examen de los archivos permite observar un resurgimiento vigoroso a partir de los últimos 150 años. Este resurgimiento demográfico parece precipitar una nueva explosión de la comunidad chipaya.

  14. Crime Mapping , ou le réductionnisme bien intentionné.

    Directory of Open Access Journals (Sweden)

    Boris Beaude

    2009-05-01

    Full Text Available En 2008, le British Crime Survey fit remarquer que le risque d’être victime d’un crime est au plus bas depuis le lancement de son étude systématique en 1981. Il précisa à cette occasion que cette tendance est observable dans l’ensemble des pays développés. En Angleterre, la criminalité aurait baissé de 39% depuis 1997, dont 40% pour les crimes violents et 55% pour les cambriolages. 2 Ce constat questionne le traitement médiatique et politique de la criminalité qui, ...

  15. Le Service Accueil et Contrôle d'Accès

    CERN Document Server

    Ducastel, C

    1999-01-01

    L'utilisateur qui vient au CERN pour la première fois, est accueilli généralement par les membres du service 'Accueil et Contrôle d'Accès'. Cet utilisateur sera tout d'abord orienté vers un des postes d'hôtesses d'accueil en charge de l'enregistrement et de la délivrance de cartes CERN. Les informations seront saisies et immédiatement disponibles et transmises, via le système AMS, aux équipements de contrôle d'accès et à la Centrale de Surveillance des accès, chargée de la supervision de tout le dispositif de contrôle d'accès au domaine. Ces contrôles aux entrées et accueil des visiteurs individuels sont complétés par des missions de surveillance à l'intérieur du Domaine pour les agents, et par des travaux de gestions de dossiers administratifs (service enregistrement) pour les hôtesses. Un contrat commun assure une uniformité de formation des agents et hôtesses. Ce contrat est assorti d'une clause de Bonus Malus afin de tendre vers une optimisation des performances.

  16. LE SECTEUR INFORMEL EN ALGERIE : APPROCHES, ACTEURS ...

    African Journals Online (AJOL)

    Résumé. Le secteur informel en Algérie est peu étudié de manière directe et .... très diverses que Bernard (1980,1988) a classées en 3 catégories plus ou moins .... sont amenés en raison de l'ambiguïté de la loi et de sa faible appli- cation à ...

  17. LE DÉVELOPPEMENT DÉMOCRATIQUE

    International Development Research Centre (IDRC) Digital Library (Canada)

    Il en est ainsi parce que les normes et les idéaux qui stimulent la recherche scientifique sont également au coeur de la ... les fondements de toute saine démocratie. De même, certaines des recherches appliquées qu'appuie le CRDI peuvent con- .... criminalité et de la violence. En outre, une fois choisi leur propre mode de.

  18. Focus : Le torrent de Faucon (Ubaye

    Directory of Open Access Journals (Sweden)

    Frédéric Liébault, Christophe Peteuil et Alexandre Remaître

    2010-09-01

    Full Text Available Le torrent du Faucon, dans la vallée de l'Ubaye, est connu pour ses nombreux phénomènes torrentiels. Les auteurs nous présentent ici l’étude du bilan sédimentaire du torrent du Faucon à travers l’exemple de la lave torrentielle du 5 août 2003.

  19. Le mélanome malin de la fosse nasale

    Science.gov (United States)

    Rekik, Wafa; Goucha, Aida; Hamdane, Mohamed Moncef; Debbabi, Boutheina; EL May, Ahmed; Gammoudi, Amor

    2012-01-01

    Le mélanome muqueux primitif de la fosse nasale est une tumeur maligne très agressive, rare, constituant 1% de l’ensemble des mélanomes. Sa symptomatologie est non spécifique et son diagnostic est anatomo-pathologique, appuyé par l’immunohistochimie. Son traitement est essentiellement chirurgical basé sur une résection large de la tumeur. Le pronostic est défavorable, caractérisé par des récidives et des métastases fréquentes et un taux de survie bas. Nous rapportons dans ce travail un nouveau cas de mélanome malin primitif de la fosse nasale, tout en précisant les caractéristiques de cette tumeur. PMID:23024827

  20. Afrique subsaharienne | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... d'approvisionnement en eau surchargés sont de plus en plus éprouvés par la croissance galopante des zones urbaines sans compter l'érosion des sols, le rétrécissement des forêts, la désertification et la dégradation des zones humides. Qui plus est, l'épidémie de VIH fait le plus de dégâts en Afrique subsaharienne.

  1. Livres | Page 28 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... la recherche sur des questions essentielles de développement international. ... aux milieux de la coopération au service du développement dans le monde, mais aussi ... Dix ans de réforme : Politique scientifique et technologique en Chine ... Le droit au logement est un droit fondamental de la personne réaffirmé en juin ...

  2. Publications | Page 50 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La prochaine flambée épidémique : se préparer à l'imprévisible. Les maladies infectieuses ignorent les frontières, que ce soit le virus Ebola qui se propage de la Guinée au Liberia, la rougeole qui s'est déclarée dans la vallée du Fraser et dont le virus a été introduit au Canada par.

  3. Publications | Page 56 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Cap sur l'Ouest : les Prairies canadiennes, élément essentiel de la lutte contre la faim dans le monde. Il y a plus de vingt ans, Charlie Mayer, exploitant d'un ranch dans le sud du Manitoba et également ministre fédéral de l'Agriculture, est rentré au Canada troublé par ce qu'il avait entendu.

  4. Livres | Page 23 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Directeur(s) : Gary McMahon et Felix Remy. Maison(s) d'édition : Banque mondiale, CRDI. ISBN: Épuisé. Couverture du livre Des États remaniés : Mondialisation, souveraineté et gouvernance. Des États remaniés : Mondialisation, souveraineté et gouvernance. Le trouble est évident. On le pressent aux échecs quotidiens ...

  5. Publications | Page 51 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Explorez les extrants découlant de plus de quatre décennies de recherche soutenue par le CRDI. Visitez la Bibliothèque numérique du CRDI maintenant. ... Aux fins de l'élaboration de sa prochaine stratégie quinquennale, le CRDI a organisé... Agents de changement : la philanthropie dans certains pays d'Asie du Sud-Est.

  6. Publications | Page 222 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Transport et réduction de la pauvreté : étude de cas sur la contribution du secteur des transports à la réalisation des Objectifs du Millénaire pour le Développement (Burkina Faso) (restricted access). Le Burkina Faso, comme la plupart des pays en développement, est confronté à des problèmes liés à l''aggravation de la ...

  7. Résultats ichthyologiques des voyages scientifiques de Monsieur le Professeur Dr. A. W. Nieuwenhuis dans le centre de Bornéo (1898 et 1900)

    NARCIS (Netherlands)

    Popta, C.M.L.

    1905-01-01

    Dans quelques genres de Cyprinidae, c.-à-d. le Dangila, l’ Osteochilus et le Crossochilus famille des Cyprininae, qui appartiennent à la sousle nombre des écailles de la ligne latérale est plus petit dans les espèces spéciales que dans les espèces anciennes. Le Tylognathus a augmenté ce nombre de 2

  8. 'Love of the heart': romantic love among young mothers in Mali.

    Science.gov (United States)

    Sølbeck, Ditte Enemark

    2010-05-01

    This paper calls attention to an ideal of romantic love among young unmarried mothers in Mali. It demonstrates that romantic love constitutes a motivating force for the agency of young Malian mothers who invest themselves in hopes of romantic outcomes from their relationships. Like the majority of people in Mali, the young mothers in this study dedicated a considerable time each weekday to watching a Venezuelan soap opera, which could be regarded as offering a modern version of Romeo and Juliet. Yet, romance is not the only thing that matters in young mothers' ideals of love. Materiality plays an important role as well. Thus, young mothers have multiple motives for engaging in relationships with men: they seek both romance and material stability, which is why an either love or exchange perspective is insufficient when examining the topic of romantic love in a Malian context.

  9. Physique ou leçons sur les principes généraux de la nature I

    CERN Document Server

    Aristote

    2015-01-01

    Extrait : ""Or il n'en est pas dans la nature de plus certain ni de plus évident que le mouvement sous toutes ses formes ; et voilà comment la Physique d'Aristote n'est au fond qu'une théorie du mouvement. C'est une étude sur le principe le plus général et le plus important de la nature ; car sans ce principe, ainsi qu'Aristote l'a dit bien des fois, la nature n'existe pas ; elle s'identifie en quelque sorte avec lui.""

  10. Le massacre de la mariée

    Directory of Open Access Journals (Sweden)

    Bastiaan van der Velden

    2016-06-01

    Full Text Available Le Massacre des innocents a été pour Marcel Duchamp l’une de ses sources en composant Le Grand Verre. Ce ‘massacre’ est dans ce cas plus précisément une attraction foraine. D’autre part l’infanticide à Bethlehem constitue un sujet maintes fois représenté par différents peintres. Pour Alfred Jarry, auteur littéraire et de théâtre qui a plus particulièrement inspiré Duchamp, le tableau Le Massacre des innocents de Breughel l’Ancien était une pièce clé qui lui permettait de démontrer pourquoi il rejetait l’art historisant en peinture et dans le théâtre.

  11. Le Bon, Gustave

    DEFF Research Database (Denmark)

    Borch, Christian

    2017-01-01

    Gustave Le Bon (1841–1931) was a French physician and crowd psychologist who published extensively on themes such as crowds, war, race, revolution, socialism, and war. His work on crowd psychology in particular was highly influential, including beyond scholarly circles. Le Bon argued that crowds...

  12. Le développement de projets en Bolivie

    OpenAIRE

    Maes, Sandrine; Maes, Jeremy; Rey, Jean-Charles

    2007-01-01

    Ce mémoire traite des projets, de leur développement. Qu’est-ce qu’un projet ? Comment est-il créé ? Le développement de projet est un domaine complexe. Au fil des pages, nous présentons une définition du projet, ainsi que deux manières différentes de le conduire. Ce mémoire parle également de la Bolivie. Nous y découvrirons une autre culture, une autre manière de penser, d’agir, de vivre. Dans ce travail, nous tentons de mettre en évidence comment le développement de projet s’insère da...

  13. Le genre, variable centrale de la violence sociale ?

    OpenAIRE

    Ayral , Sylvie; Raibaud , Yves

    2010-01-01

    Le but de cet article n'est pas de savoir si le genre est une variable centrale de la violence sociale mais comment cette hypothèse (qui induit la possibilité d'un changement social) est réfutée et quelles connaissances sont mobilisées à cet effet. Il s'agit d'identifier les modèles récurrents mis en œuvre par les « membres » (par exemple la communauté scientifique des sciences humaines et sociales) lorsqu'ils.elles examinent le sens de ces modèles par l'observation de « ce que les gens font ...

  14. Aiutare le vittime della mafia a ribellarsi

    Directory of Open Access Journals (Sweden)

    Roberto Riccardi

    2007-09-01

    Full Text Available Nino Miceli is a Sicilian man, owner of a small business: at the beginning of 1990s he is concessionnaire of cars in Gela, an quite big town in Sicily. He works hard and soon he starts to earn a lot. Business is very good, and customers are satisfied and everything seems to go on successfully. But the mafia keeps an eye on him and, at a certain point, he was asked to pay them what in Italy is called “pizzo”. Nino Miceli does not want to pay it, he does not want to surrender to the mafia coercion. However, at the beginning he pays the “pizzo” but then he starts to record the conversation he has with those men (the “mafiosi”, in order to prove and demonstrate the crime. He also looks for protection at the local station of Carabinieri; finally, he decides to report the extortion but, from that time on, he starts to experience more and more serious threats.Helped by an officer of Carabinieri, he becomes a witness of justice and, for that reason, he must change his identity. He leaves Sicily along with his family and move into a different region of Italy, far from his town, where nobody knows him. In 2007 he decides to write a book of memories, titled “Io, il fu Nino Miceli” (in English it could sound like “I was Nino Miceli”. This article tells his story, speaking also about the role played by the Arma of Carabinieri in supporting victims of racket and usury.Nino Miceli est un entrepreneur sicilien originaire de Realmonte, une ville en province d'Agrigento. Au début des années 90, il est proprietaire du garage Lancia à Gela. Il s'engage beaucoup dans son travail et les résultats ne tardent pas à arriver. La clientèle augmente, les affaires vont bon train, mais c'est justement quand l'entreprise est en train de prospérer que la mafia lui demande des comptes. Il doit payer le pot-de-vin comme tous les commerçants du quartier. Nino Miceli n'est pas d'accord avec cela. Au début il subit, mais il commence bientôt

  15. Prevalence of Cutaneous Leishmaniasis in Districts of High and Low Endemicity in Mali.

    Directory of Open Access Journals (Sweden)

    Bourama Traoré

    2016-11-01

    Full Text Available Historically the western sahelian dry regions of Mali are known to be highly endemic for cutaneous leishmaniasis (CL caused by Leishmania major, while cases are rarely reported from the Southern savanna forest of the country. Here, we report baseline prevalence of CL infection in 3 ecologically distinct districts of Mali (dry sahelian, north savanna and southern savanna forest areas. We screened 195 to 250 subjects from 50 to 60 randomly selected households in each of the 6 villages (four from the western sahelian district of Diema in Kayes region, one from the central district of Kolokani and one from the southern savanna district of Kolodieba, region of Sikasso. The screening consisted of: 1] A Leishmanin Skin Test (LST for detection of exposure to Leishmania parasites; 2] clinical examination of suspected lesions, followed by validation with PCR and 3] finger prick blood sample to determine antibody levels to sand fly saliva. LST positivity was higher in the western district of Diema (49.9% than in Kolokani (24.9% and was much lower in Kolondieba (2.6%. LST positivity increased with age rising from 13.8% to 88% in Diema for age groups 2-5 years and 41-65 years, respectively. All eight PCR-confirmed L. major CL cases were diagnosed in subjects below 18 years of age and all were residents of the district of Diema. Exposure to sand fly bites, measured by anti-saliva antibody titers, was comparable in individuals living in all three districts. However, antibody titers were significantly higher in LST positive individuals (P<0.0001. In conclusion, CL transmission remains active in the western region of Mali where lesions were mainly prevalent among children under 18 years old. LST positivity correlated to higher levels of antibodies to sand fly salivary proteins, suggesting their potential as a risk marker for CL acquisition in Mali.

  16. P. falciparum malaria prevalence among blood donors in Bamako, Mali.

    Science.gov (United States)

    Kouriba, B; Diarra, A B; Douyon, I; Diabaté, D T; Kamissoko, F; Guitteye, H; Baby, M; Guindo, M A; Doumbo, O K

    2017-06-01

    Malaria parasite is usually transmitted to humans by Anopheles mosquitoes but it can also be transmitted through blood transfusion. Usually malaria transmission is low in African urban settings. In West Africa where the P. falciparum is the most predominant malaria species, there are limited measures to reduce the risk of blood transfusion malaria. The aim of this study was to evaluate the prevalence of P. falciparum malaria carriage among blood donors in the National Blood Center of Bamako, capital city of Mali. The study was conducted using a random sample of 946 blood donors in Bamako, Mali, from January to December 2011. Screening for malaria was performed by thick smear and rapid diagnostic test (RDT). Blood group was typed by Beth-Vincent and Simonin techniques. The frequency of malaria infection was 1.4% by thick smear and 0.8% by the RDT. The pick prevalence of P. falciparum malaria was in rainy season, indicating a probable high seasonal risk of malaria by blood transfusion, in Mali. The prevalence of P. falciparum infection was 2% among donors of group O the majority being in this group. There is a seasonal prevalence of malaria among blood donors in Bamako. A prevention strategy of transfusion malaria based on the combination of selection of blood donors through the medical interview, promoting a voluntary low-risk blood donation and screening all blood bags intended to be transfused to children under 5, pregnant women and immune-compromised patients during transmission season using thick smear will reduce the risk of transfusion malaria in Mali. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  17. Implementing preventive chemotherapy through an integrated National Neglected Tropical Disease Control Program in Mali.

    Directory of Open Access Journals (Sweden)

    Massitan Dembélé

    Full Text Available BACKGROUND: Mali is endemic for all five targeted major neglected tropical diseases (NTDs. As one of the five 'fast-track' countries supported with the United States Agency for International Development (USAID funds, Mali started to integrate the activities of existing disease-specific national control programs on these diseases in 2007. The ultimate objectives are to eliminate lymphatic filariasis, onchocerciasis and trachoma as public health problems and to reduce morbidity caused by schistosomiasis and soil-transmitted helminthiasis through regular treatment to eligible populations, and the specific objectives were to achieve 80% program coverage and 100% geographical coverage yearly. The paper reports on the implementation of the integrated mass drug administration and the lessons learned. METHODOLOGY/PRINCIPAL FINDINGS: The integrated control program was led by the Ministry of Health and coordinated by the national NTD Control Program. The drug packages were designed according to the disease endemicity in each district and delivered through various platforms to eligible populations involving the primary health care system. Treatment data were recorded and reported by the community drug distributors. After a pilot implementation of integrated drug delivery in three regions in 2007, the treatment for all five targeted NTDs was steadily scaled up to 100% geographical coverage by 2009, and program coverage has since been maintained at a high level: over 85% for lymphatic filariasis, over 90% for onchocerciasis and soil-transmitted helminthiasis, around 90% in school-age children for schistosomiasis, and 76-97% for trachoma. Around 10 million people have received one or more drug packages each year since 2009. No severe cases of adverse effects were reported. CONCLUSIONS/SIGNIFICANCE: Mali has scaled up the drug treatment to national coverage through integrated drug delivery involving the primary health care system. The successes and lessons

  18. What Is Next for Mali? The Roots of Conflict and Challenges to Stability

    Science.gov (United States)

    2013-11-01

    maintaining a livelihood from camels, cattle, sheep, and goats , a practice long predating the creation of the current state boundaries.15 In the era before...the colonial period. The Peulh (also called Fula or Fulani) account for about 11 percent of the population, and they farm or herd cattle in the Niger...Empire that once existed around Gao. They compose 7 percent of Mali’s population and engage in subsis- tence farming in southeastern Mali. The Tuareg

  19. [Contraception and protection against STDs. CERPOD measures use of the Protector condom in Mali].

    Science.gov (United States)

    Konate, M K

    1993-08-01

    In April 1993, a technical assistance contract to measure general condom use, particularly use of the brand name Protector, which has been marketed in Mali since March 1992, was made between the Center of Studies and Research on Population for Development (CERPOD) and the Popular Pharmacy of Mali. In June-July 1991, the SOMARC project and the Malian Institute for Applied Research in Development conducted a baseline survey to determine the condom use rate in Mali before Protector was introduced on the Malian market, so the social marketing project for contraception could be evaluated. It examined knowledge, use, and achievable target level and determined the characteristics of users of the Protector condom. It revealed that more than 90% of both men and women believed birth spacing was a good idea. Men approved of birth spacing for cost-saving reasons, while women approved birth spacing because it allowed mothers time to recuperate between births. Another earlier study in 1987 in Bamako found that 78% of the women already favored birth spacing. 90% of the men in the main cities in Mali knew about condoms. 63% of these men had used them in the past, mainly to prevent sexually transmitted diseases. 30% used them consistently. One hoped that this number was going to grow, since 80% of the men said that they would use condoms in the future. The evaluation of the 1991 social marketing campaign will end in August 1993 and will measure whether it was successful or not. In November 1992, CERPOD followed the framework of a recent baseline survey for an IEC (information, education, and communication) family planning program, operated jointly by the Malian Association for the Protection and Promotion of the Family and Population Communication Services, to measure the effect of the brand name Protector. CERPOD's survey results will be compared with those of the 1993 survey.

  20. Le paludisme, le tsunami silencieux d'Afrique | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    12 janv. 2011 ... Dans un élan de compassion fort justifié, le monde s'est porté au secours des victimes du tsunami qui a touché récemment la région de l'océan Indien. Mais il ignore qu'un « tsunami silencieux », le paludisme, s'abat sans cesse sur l'Afrique et y fait chaque année plus de 1,5 million de victimes, surtout de ...

  1. Lele de paysans mieux informés au Bénin | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    10 déc. 2010 ... Le défi : faire face au chaos climatique. Au Bénin, le secteur agricole constitue environ 36 % du PIB et représente près de 88 % des recettes d'exportation, en plus de satisfaire à la demande locale. Cependant, ce secteur est menacé. Loin d'être la seule cause du sous-développement, les bouleversements ...

  2. Contester le mariage forcé : mettre en place la ligne de défense et le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le mariage forcé viole les principes de liberté personnelle et d'autonomie individuelle. Il est considéré comme une violation des droits de la personne aux termes du droit international en matière de droits de la personne. Ce projet produira des données probantes qui aideront à combattre le mariage forcé en Inde ...

  3. School version of ESTE EU

    International Nuclear Information System (INIS)

    Carny, P.; Suchon, D.; Chyly, M.; Smejkalova, E.; Fabova, V.

    2008-01-01

    ESTE EU is information system and software for radiological impacts assessment to the territory of the country in case of radiation accident inside/outside of the country .The program enables to model dispersion of radioactive clouds in small-scale and meso-scale. The system enables the user to estimate prediction of the source term (release to the atmosphere ) for any point of radiation/nuclear accident in Europe (for any point of the release, but especially for the sites of European power reactors ). The system enables to utilize results of real radiological monitoring in the process of source term estimation. Radiological impacts of release to the atmosphere are modelled and calculated across the Europe and displayed in the geographical information system (GIS). The school version of ESTE EU is intended for students of the universities which are interested in or could work in the field of emergency response, radiological and nuclear accidents, dispersion modelling, radiological impacts calculation and urgent or preventive protective measures implementation. The school version of ESTE EU is planned to be donated to specialized departments of faculties in Slovakia, Czech Republic, etc. System can be fully operated in Slovak, Czech or English language. (authors)

  4. School version of ESTE EU

    International Nuclear Information System (INIS)

    Carny, P.; Suchon, D.; Chyly, M.; Smejkalova, E.; Fabova, V.

    2009-01-01

    ESTE EU is information system and software for radiological impacts assessment to the territory of the country in case of radiation accident inside/outside of the country .The program enables to model dispersion of radioactive clouds in small-scale and meso-scale. The system enables the user to estimate prediction of the source term (release to the atmosphere ) for any point of radiation/nuclear accident in Europe (for any point of the release, but especially for the sites of European power reactors ). The system enables to utilize results of real radiological monitoring in the process of source term estimation. Radiological impacts of release to the atmosphere are modelled and calculated across the Europe and displayed in the geographical information system (GIS). The school version of ESTE EU is intended for students of the universities which are interested in or could work in the field of emergency response, radiological and nuclear accidents, dispersion modelling, radiological impacts calculation and urgent or preventive protective measures implementation. The school version of ESTE EU is planned to be donated to specialized departments of faculties in Slovakia, Czech Republic, etc. System can be fully operated in Slovak, Czech or English language. (authors)

  5. Publications | Page 163 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    En Afrique cependant, plus particulièrement pour les femmes vivant en milieu rural, l'accès à l'information est limité. Les nouvelles technologies de l'information et des... Le laboratoire, le temple et le marché : Réflexions à la croisée de la science, de la religion et du développement. Il s'agit là d'un ouvrage fascinant et très ...

  6. Rapports annuels | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Rapports annuels. Le CRDI publie un rapport annuel dans lequel il présente ses états financiers et ses résultats. Ce rapport met en outre en évidence des chercheurs bénéficiaires de subventions du CRDI et en décrit les projets et les réalisations clés. C'est le principal outil par lequel le Centre rend compte de ses activités ...

  7. Le langage des couleurs dans les films de Zhang Yimou

    OpenAIRE

    Xiaomin Giafferri

    2009-01-01

    Tout film, ou du moins tout film de fiction, est récit. Représentation visuelle et sonore, le film transpose à l’écran la réalité par un enchaînement d’images, où des traits physiques, gestes, mouvements, paysages se combinent pour former un espace de fiction. Le cinéma en tant qu’art possède un langage spécifique ; dans un film coloré, les couleurs comme moyen d’expression font partie du langage pictural. A partir de quatre films de Zhang Yimou connus en Europe, Le so...

  8. Un développement urbain durable et socialement inclusif est-il possible dans le contexte de fragmentation socio-spatiale des métropoles des pays émergents? Réflexions à partir des cas de Recife (Brésil et de Chennai (Inde

    Directory of Open Access Journals (Sweden)

    Carrière Jean-Paul

    2016-12-01

    Full Text Available Dans un contexte globalisé, le développement de villes socialement durables et inclusives implique de nombreux défis contradictoires. L’analyse comparée des cas de Chennai, en Inde, et de Recife, au Brésil, montre qu’au-delà des spécificités de ces métropoles, nous retrouvons des processus de fragmentation socio-spatiale comparables et un réel décalage entre un discours sur l’insertion sociale et des pratiques urbanistiques orientées par la quête d’attractivité, qui se soldent par l’accentuation des inégalités. Ces contradictions renvoient à des conflits entre planification stratégique, jeu des forces des marchés immobilier et foncier, et attentes des populations. L’analyse de ces contradictions invite à repenser l’articulation de la dialectique local/global et à s’interroger sur l’effectivité du « droit à la ville » dans les sociétés de pays émergents. La comparaison développée dans cet article s’appuie sur des recherches menées à Recife dans un premier temps au début de la décennie en cours, puis plus récemment à Chennai.

  9. First report of Echinococcus granulosus (genotype G6) in a dog in Bamako, Mali.

    Science.gov (United States)

    Mauti, S; Traoré, A; Crump, L; Zinsstag, J; Grimm, F

    2016-02-15

    Cystic echinococcosis is one of the most widespread and important helminthic zoonoses, caused by the larval stage of Echinococcus granulosus sensu lato. However, to date there is little information about the disease in West Africa. Faecal and fur samples from 193 dogs, the main final hosts, were collected in 2010 and 2011 in Bamako, Mali. Taeniid eggs were found microscopically in 28/118 (24%) and 80/223 (36%) faecal and fur samples, respectively. One faecal and one fur sample from the same dog were positive for E. granulosus s. l. DNA. In the remaining 27 faecal (96%) and 77 fur samples (96%) only Taenia DNA was detected. Three microscopically positive fur samples were negative by PCR. Sequence analysis of part of the NADH dehydrogenase subunit 1 gene identified the parasite as E. granulosus (genotype G6; Echinococcus canadensis). This is the first study to focus on the final host of E. granulosus s. l. in Mali and the first report of E. canadensis in Mali. Copyright © 2016 Elsevier B.V. All rights reserved.

  10. Assessing Community Readiness to Reduce Childhood Diarrheal Disease and Improve Food Security in Dioro, Mali

    Directory of Open Access Journals (Sweden)

    Erica C. Borresen

    2016-06-01

    Full Text Available Diarrhea and malnutrition represent leading causes of death for children in Mali. Understanding a community’s needs and ideas are critical to ensure the success of prevention and treatment interventions for diarrheal disease, as well as to improve food security to help reduce malnutrition. The objective of this study was to incorporate the Community Readiness Model (CRM for the issues of childhood diarrheal disease and food security in Mali to measure baseline community readiness prior to any program implementation. Thirteen key respondents residing in Dioro, Mali were selected based on varied social roles and demographics and completed two questionnaires on these public health issues. The overall readiness score to reduce childhood diarrheal disease was 5.75 ± 1.0 standard deviation (preparation stage. The overall readiness score to improve food security was 5.5 ± 0.5 standard deviation (preparation stage. The preparation stage indicates that at least some of the community have basic knowledge regarding these issues, and want to act locally to reduce childhood diarrhea and improve food security and nutrition. Proposed activities to increase community readiness on these issues are provided and are broad enough to allow opportunities to implement community- and culturally-specific activities by the Dioro community.

  11. Furfural from Pine Needle Extract Inhibits the Growth of a Plant Pathogenic Fungus, Alternaria mali

    Science.gov (United States)

    Yoo, Sun Kyun; Moon, Sung-Kwon; Lee, Ung-Soo

    2007-01-01

    The antifungal effect of pine needle extract prepared by a distinguishable extraction method and the dry distillation method, was examined. The effect of this extract itself was insignificant. The chemical components of pine needle extract were then investigated by gas chromatographic analysis, and four chemical components, acetol, furfural, 5-methyl furfural, and terpine-4-ol, were identified. The antifungal effects of those four chemical components against Alternaria mali (A. mali), an agent of Alternaria blotch of apple, were then examined. It was observed that the minimum inhibitory concentrations (MICs) were 6.25, 0.78, 0.78, and 12.5 (mg/ml) of acetol, furfural, 5-methyl furfural, and terpine-4-ol, respectively. MICs of furfural and 5-methyl furfural had the same order of magnitude as that of an antifungal agrochemical, chlorothalonil. Although furfural itself can not be completely substituted for an antifungal agrochemical, a partial mixture of furfural and antifungal agrochemical may be used as a substitute. The use of agrochemicals for the prevention of plant disease caused by pathogenic fungus such as A. mali could be partially reduced by the application of this mixture. PMID:24015067

  12. Urinary schistosomiasis among preschool-aged children in Sahelian rural communities in Mali

    Directory of Open Access Journals (Sweden)

    Doumbo Ogobara K

    2011-02-01

    Full Text Available Abstract Background Mass chemotherapy with praziquantel is the main control strategy for schistosomiasis in Mali. However, in the national control programme for schistosomiasis and soil-transmitted helminthiasis, infants and preschool-aged children are overlooked in preventive chemotherapy campaigns. We therefore determined the prevalence and intensity of urinary schistosomiasis in children between the ages 1-4 years in three villages across Diema health district, a rural community with endemic schistosomiasis in Mali. For Schistosoma haematobium diagnosis, a single urine sample of 10 ml obtained from each child was subjected to the standard urine filtration method. Results Of the 338 children examined 173 (51.2% were infected. Both prevalence and intensity of infection varied significantly between communities (p Conclusion Our study showed that preschool children living closely to lakes across in Mali are at high risk to be infected by schistosomiasis and contributed largely to the transmission; therefore schistosomiasis control interventions should also target infants in addition to school children and adults in endemic areas.

  13. Q fever in small ruminants in Mali. Results of a serological survey

    Directory of Open Access Journals (Sweden)

    S. S. Sidibé

    2013-01-01

    Full Text Available In Mali, the loss of reproduction is a major constraint to improving the productivity of small ruminants. The causes of these losses are still poorly known and include infertility, abortions, orchitis and stunting. The purpose of this study was to assess the seroprevalence of Q fever in small ruminant farms where cases of loss of reproduction had been observed, as well as financial losses linked to the recorded abortions. The survey was carried out during the period 2006–2009 in the agropastoral areas of Bougouni (Sikasso Region, Nioro (Kayes Region, Keniebougouwere (Segou Region and Koro (Mopti Region. Out of 718 sera analyzed by indirect ELISA, 155 (21.5 ± 3% tested positive for Coxiella burnetii. The prevalence rate varied according to the site and the birth rank. The highest prevalence rate was observed in Keniebougouwere (35 ± 6%, followed by Nioro (28.5 ± 7.5% and Bougouni (10.8 ± 4.6%, and the lowest in Koro (5.8 ± 3.7%. This study revealed the presence of Q fever in small ruminants in Mali. Complementary investigations that include molecular diagnosis (PCR technique might help understand the etiology of the disease involved in cases of loss of reproduction in small ruminants in Mali. The technical and economical analysis helped to assess the financial value of losses.

  14. Les pôles de compétitivité : le recours au modèle des clusters ?

    Directory of Open Access Journals (Sweden)

    Jean Bouinot

    2007-03-01

    Full Text Available Introduction : définition d’un cluster En novembre 2004, le gouvernement a lancé un appel d’offre pour structurer des pôles de compétitivité que les praticiens français n’hésitent pas à qualifier de cluster, littéralement un rassemblement du type « bouquet de fleurs ». Pour une définition théorique on peut s’appuyer sur une comparaison avec le modèle du district industriel italien (MDII. Le district est spécialisé dans un produit donné (chaussures de sport à Montebelluna, le leader mondial e...

  15. Le projet de station touristique

    OpenAIRE

    Vlès, Vincent

    1996-01-01

    Cet ouvrage traite du savoir-faire du technicien, de l'ingénieur, du directeur d'office de tourisme qui façonne, depuis maintenant près de trois décennies, le territoire local de la production touristique : la station. Il analyse les stratégies, les mises en œuvre, les pratiques de l'aménagement et du développement touristique. Il propose une construction du projet de station, méthode qui est l'aboutissement d'expériences de terrain. Il présente un guide des interventions. Il décrit des modes...

  16. Le Squatteur, le Gentrifieur et le Promoteur. Une leçon de la géographie

    Directory of Open Access Journals (Sweden)

    Laurent Matthey

    2005-03-01

    Full Text Available Posées sur mon bureau : deux photos. Je les regarde. Silencieusement, je les décris et les commente. La première a été prise en novembre 1997. Angle rue Jean-Violette, rue Prévost-Martin, à Genève. On y voit un immeuble, ancien, des échafaudages. Entre cet immeuble et celui qui lui fait face, on a tendu des fanions verts, bleus, orange. Son rez-de-chaussée a été repeint dans une teinte un peu brique. La seconde date d’avril 2005. C’est le même immeuble, presque dix ans plus tard, rénové. Jaun...

  17. Le médicament générique au Maroc: le point de vue du ...

    African Journals Online (AJOL)

    Introduction: Le médicament générique est souvent une origine de préjugés négatifs et de méfiance chez les professionnels de santé et les patients. Ceci pourrait être dû à plusieurs facteurs entre autre le manque des connaissances du patient sur ces médicaments. Le but de notre étude était d'évaluer l'information du ...

  18. Faire la chose « la plus sensée » pour le Canada et pour le monde ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    18 déc. 2014 ... Je faisais partie de la délégation qui a accompagné dernièrement le gouverneur général du Canada, Son Excellence le très honorable David Johnston, et Son Excellence Sharon Johnston au ... Il avait ensuite a déclaré que ce que le CRDI a fait au Chili, c'est qu'il a permis aux idées de continuer de vivre.

  19. Lele des chefs traditionnels au Ghana : un modèle inspirant ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    8 févr. 2011 ... Avec ses partenaires du Sud, avec aussi le soutien du Centre de recherches pour le développement international ( CRDI ), organisme canadien, Ray a étudié lele des chefs traditionnels au Ghana dans la lutte contre le VIH et le sida. Les collectivités politiques antérieures au colonialisme sont une ...

  20. diversité botanique dans le sud du parc national de taï, côte d

    African Journals Online (AJOL)

    AKA Boko Mathieu

    Contrôle du convertisseur monophasé par réseau de neurones ... pour Tc=T1. Le contrôle de cette puissance n'est donc possible que pour des puissances moyennes comprises entre ces deux valeurs limites. 2-2. Modélisation interne ..... performances de la commande numérique non linéaire utilisée en présentant le cas ...

  1. Accessibilité aux emplois en France : lele de la distance à la ville

    Directory of Open Access Journals (Sweden)

    Mohamed Hilal

    2004-12-01

    Full Text Available L'objet de cet article est de modéliser les niveaux d’accessibilité potentielle aux emplois des communes françaises selon lele de la distance à la ville. Pour ce faire, nous présentons, tout d’abord, un modèle d’accessibilité et la méthode mise en œuvre pour calculer de façon systématique, à partir des données du réseau routier, une matrice des plus courts chemins, mesurés en temps, entre les communes françaises. Ensuite, dans la deuxième partie, ces distances sont intégrées dans le modèle d’accessibilité retenu afin de mesurer la disponibilité potentielle aux emplois selon la distance au pôle urbain le plus proche et selon les principales catégories d’espace du zonage en aires urbaines et de son complément rural. Enfin, la mesure d’accessibilité potentielle est comparée à plusieurs mesures d’accessibilité empirique.

  2. Sous type rare du cancer de prostate: Le carcinome sarcomatoide

    African Journals Online (AJOL)

    A. Qarro

    est essentiellement chirurgical qui peut aller de la simple résection de la prostate jusqu'à l'exentération pelvienne associée ou non à la chimiothérapie ou à la radiothérapie. Le pronostic est très mauvais avec 20% de risque de décès la première année qui suit le diagnostic. Nous rapportons une observation d'un patient.

  3. La communication de recrutement dans le milieu hospitalier

    OpenAIRE

    Medina, Pablo

    2011-01-01

    Le développement de la communication institutionnelle et du marketing au sein des institutions hospitalières est très influencé par les changements qui ont lieu dans le milieu sanitaire. La communication de recrutement est l’une des activités les plus stratégiques dans ce cadre, non seulement parce qu’elle répond à des objectifs organisationnels très précis, mais aussi parce qu’elle contribue au développement du champ de la communication institutionnelle dans les hôpitaux. Mais, pour y réussi...

  4. Renewable energy resources in Mali : potential and options for a sustainable development

    Energy Technology Data Exchange (ETDEWEB)

    Diarra, D.C. [Queen' s Univ., Kingston, ON (Canada). Dept. of Mechanical and Materials Engineering Solar Calorimetry Lab; Dembele, P. [Mali-Folkecenter, Faladie SEMA, Bamako (Mali)

    2006-07-01

    With a population of approximately 12 million, the per capita energy consumption of Mali is 228 Kilo tons of oil equivalent per inhabitant per year. Household energy consumption accounts for nearly 86 per cent of the total energy consumed with almost 99 per cent coming from wood energy. Energy consumption in the transportation, industrial and agricultural sectors is 10, 3, and 1 per cent respectively. The energy sector in Mali is characterized by the over-exploitation of forestry resources, dependence on imported oil and an under-exploitation of potential renewable energy resources such as solar, wind and biomass. The supply of solar energy is inexhaustible as the country receives almost 12 hours of sunshine with an average daily insolation of 5-7 KWh/m{sup 2}/day. Applications of photovoltaic (PV) technology in Mali concerns the basic needs of the population such as water pumping, lighting, battery charging and refrigeration. In 1994, the Mali government gave preferential fiscal policy on all solar equipment in order to encourage the wide spread use of solar energy, but technical constraints such as low efficiency, appropriate technology transfer methods, and sustainable financing mechanisms remain to be addressed. This paper described several programs that have been initiated to promote the use of renewable energy, protect the fragile environment threatened by the Sahara Desert and to provide access to drinking water. These achievements however, have not yet guaranteed energy sustainability, particularly in rural areas. It was recommended that efforts should be made to strengthen the renewable energy sector, correct inadequacies, introduce a sustainable renewable energy technology transfer process, and consolidate knowledge and experiences to focus on low cost renewable energy technologies. It was suggested that a natural resource map of the country should be made available in order allow for comparative cost and technology sustainability analysis before deciding

  5. Enseignement Basé sur les Compétences : Manuel d'Application dans le Domaine des Sciences Agronomiques a L'Université d'Abomey-Calavi

    NARCIS (Netherlands)

    Koutinhouin, B.; Hupkes, M.; Gooijer, de G.; Aho, N.; Windmeijer, P.N.

    2011-01-01

    Le présent manuel est produit dans le cadre du Projet d’Appui au Renforcement des Programmes de Formation et de Recherche en Agriculture à la Faculté des Sciences Agronomiques et à l’Ecole Polytechnique d’Abomey-Calavi, financé par le Gouvernement du Royaume des Pays-Bas (Projet NPT/BEN/146). Il est

  6. [A cutting obstacle to the harmonious development of the country. The migratory phenomenon in Mali].

    Science.gov (United States)

    Diarra, S

    1991-04-01

    Mali has long been affected by migration because of its location between North Africa and sub-Saharan Africa. Around 80% of the population depends on agriculture or herding for its livelihood. During the rainy season, from June-October, most of the population is busy in agricultural work, but during the dry season from November to May seasonal migration in search of wage employment is common. Seasonal migration is also part of the long tradition of commerce with neighboring countries. Economic difficulties of the last several years have encourage migration to urban centers and foreign countries. The drought that has afflicted Mali for over a decade is a further impetus to migration. 2 types of migration can be distinguished in Mali, shortterm movements of nomads and seasonal migration lasting less than 6 months, and definitive movements lasting longer including rural-urban and international migration. 4 further categories of migration include rural-rural movements especially in the south and in areas of industrial development, rural-urban migrations which are 1 of the most important factors in rapid urban growth especially around Bamako,, urban-urban migration essentially reflecting step migration from rural areas to secondary urban centers and finally to large cities, and urban-rural migration which occurs much less frequently. Over 80% of temporary movements take place within Mali. About 80% of those residing temporarily outside Mali are men. Temporary migrants inside Mali are oriented from the north to the region of Sikasso and the District of Bamako in the south and primarily are young men aged 15-29. There has been a progressive decline in the proportion of nomads in the general population from 7% in 1976 to 4% in 1987. There has been an increase in definitive migration from areas less favored ecologically to more desirable areas. A 1985 demographic survey found that 21% of the population aged 15 or over were migrants. 51.4% of migrants were male. 86% cited

  7. Le corps poétique ou la poétique du corps

    Directory of Open Access Journals (Sweden)

    Yvonne Goga

    2007-05-01

    Full Text Available Les réflexions sur la poésie de Valéry sont illustrées dans deux volumes : Album de vers anciens et Charmes. Parmi les images les plus représentatives est celle du corps de la femme. Par l’analyse des images sur le corps de la femme, le but de notre étude est celui de souligner l’un des principes de la poétique de Valéry : la relation entre le monde extérieur, le corps et l’esprit, pour créer le poème et le poète.

  8. Trimming and clustering sugarcane ESTs

    Directory of Open Access Journals (Sweden)

    Guilherme P. Telles

    2001-12-01

    Full Text Available The original clustering procedure adopted in the Sugarcane Expressed Sequence Tag project (SUCEST had many problems, for instance too many clusters, the presence of ribosomal sequences, etc. We therefore redesigned the clustering procedure entirely, including a much more careful initial trimming of the reads. In this paper the new trimming and clustering strategies are described in detail and we give the new official figures for the project, 237,954 expressed sequence tags and 43,141 clusters.O método de clustering adotado no Projeto SUCEST (Sugarcane EST Project tinha vários problemas (muitos clusters, presença de seqüências de ribossomo etc. Nós assumimos a tarefa de reprojetar todo o processo de clustering, propondo uma "limpeza" inicial mais cuidadosa das seqüências. Neste artigo as estratégias de limpeza das seqüências e de clustering são descritas em detalhe, incluindo os números oficiais do projeto (237,954 ESTs e 43,141 clusters.

  9. Bases mécanistiques des effets d'un insecticide agrovétérinaire, le fipronil,et/ou de ses métabolites sur la fonction thyroîdienne chez le rat

    OpenAIRE

    Roques, Béatrice

    2012-01-01

    Le fipronil, insecticide largement utilisé, est un perturbateur thyroïdien chez le rat modulant le catabolisme hépatique des hormones thyroïdiennes. Ses effets chez le mouton, considéré comme un modèle plus pertinent que le rat pour étudier une régulation de la fonction thyroïdienne chez l'Homme, sont plus limités. Le but de cette thèse était de caractériser au niveau hépatique le mode d'action du fipronil sur la fonction thyroïdienne en s'intéressant 1) au rôle potentiel du principal métabol...

  10. DNA sequence analysis of herbarium specimens facilitates the revival of Botrytis mali, a postharvest pathogen of apple.

    Science.gov (United States)

    O'Gorman, Daniel T; Sholberg, Peter L; Stokes, Sarah C; Ginns, J

    2008-01-01

    The fungus Botrytis cinerea has been widely accepted as the species responsible for causing gray mold decay of apple, although a second species causing apple decay, B. mali, was reported in 1931. Botrytis mali was validly published in 1931, nevertheless it has always been considered a doubtful species. To study the relationship of Botrytis isolates causing gray mold on apple, DNA sequence analysis was employed. Twenty-eight Botrytis isolates consisting of 10 species were sampled, including two B. mali herbarium specimens from apple originally deposited in 1932. The DNA sequence analysis of the beta-tubulin and glyceraldehyde-3-phosphate dehydrogenase (G3PDH) genes placed the isolates into groupings with defined species boundaries that generally reflected the morphologically based model for Botrytis classification. The B. cinerea isolates from apple and other host plants were placed in a single clade. The B. mali herbarium specimens however always fell well outside that clade. The DNA sequence analysis reported in this study support the initial work by Ruehle (1931) describing the apple pathogen B. mali as a unique species.

  11. Using modeling, satellite images and existing global datasets for rapid preliminary assessments of renewable energy resources: The case of Mali

    International Nuclear Information System (INIS)

    Nygaard, Ivan; Badger, Jake; Larsen, Soeren; Rasmussen, Kjeld; Nielsen, Thomas Theis; Hansen, Lars Boye; Stisen, Simon; Mariko, Adama; Togola, Ibrahim

    2010-01-01

    This paper presents a novel approach to the preliminary, low-cost, national-scale mapping of wind energy, solar energy and certain categories of bio-energy resources in developing countries, using Mali as an example. The methods applied make extensive use of satellite remote sensing and meteorological mesoscale modeling. The paper presents first results from applying the methodology in Mali and discusses the appropriateness of the results obtained. It is shown that northern Mali has considerable wind energy potential, while average wind speeds in the southern part are too low to make wind power a competitive option. Solar energy resources are shown to be abundant in all of Mali, though the highest values are found in the south. The temporal variation is relatively limited. Bio-energy resources are also concentrated in the south, but there are small pockets of high vegetation productivity in the irrigated areas of the Niger inland delta that might be interesting from a renewable energy resource perspective. Finally, the paper discusses the role that renewable energy resources might play in the energy systems of Mali, given the spatio-temporal distribution of renewable energy resources. It is argued that at the current price of about 70 US$/barrel for fossil fuels, renewable energy resources are becoming economically as well as environmentally attractive options. (author)

  12. Le Peer to Peer: Vers un Nouveau Modèle de Civilisation

    Directory of Open Access Journals (Sweden)

    Michel Bauwens

    2006-06-01

    Full Text Available Le « peer to peer » est la dynamique intersubjective caractéristique des réseaux distribués. Le but de cet essai est de montrer qu’il s’agit d’une véritable nouvelle forme d’organisation sociale, apte à produire et échanger des biens, à créer de la valeur. Celle-ci est la conséquence d’un nouvel imaginaire social, et possède le potentiel de devenir le pilier d’un nouveau mode d’économie politique, voire d’un nouveau type de civilisation. Pour cela, nous allons d’abord définir le P2P, décrire en bref ces manifestations, et le différencier d’autres modalités d’échange intersubjectif tel que le marché, la hiérarchie, l’économie du don. Comme principale modalité P2P nous distinguons: Les processus de production P2P, comme troisième mode de production, qui n’est ni géré par un mode hiérarchique ou par l’état, ni répondant à des impératifs de profit ou qui sont modulés par le biais des prix. Les processus de gouvernance P2P, qui gouverne ces processus de production. Les formes de propriété P2P, qui sont destine a empecher l’appropriation prive de cette production pour le commun. Afin d’examiner les characteristiques de cette nouvelle dynamique sociale, nous utilisons la typologie intersubjective de l’anthropologue Alan Page Fisque, qui distingue: 1. l’échange égalitaire (Equality Matching, c..a.d l’economie du don. 2. La relation d’autorité (Authority Ranking tel qu’elle s’exprime dans le mode hierarchique. 3. le marché (Market Pricing. 4. la participation commune (Communal Shareholding. En conclusion, nous examinons les possibilites d’expansion de ce nouveau mode sociale et son insertion dans l’economie capitaliste, en nous nous posons la question: le P2P peut-il etre concu comme alternative sociale et economique aux modeles existants. Abstract: “Peer to peer” is hypothesized as a new social formation with intersubjective dynamics characteristic of distributed

  13. Clone - ClEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...le URL: ftp://ftp.biosciencedbc.jp/archive/clest/LATEST/clest_clone.zip File size: 660 KB Simple search URL ...ion Download License Update History of This Database Site Policy | Contact Us Clone - ClEST | LSDB Archive ...

  14. En quoi est-ce que cela aidera Veronica ? | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Uganda Post and Telecoms Ltd (UPTL), société d'État. C'est à peu près à ce moment qu'il a accepté le poste de directeur exécutif de la Commission des communications de l'Ouganda (UCC), premier organe indépendant de ...

  15. Identification de Staphylococcus aureus : est-il possible de réduire ...

    African Journals Online (AJOL)

    SARAH

    31 janv. 2014 ... influencer la recherche de la staphylocoagulase libre ? 6027. Identification de Staphylococcus aureus : est-il possible de réduire le volume de plasma de lapin sans influencer la recherche de la staphylocoagulase libre ? Bankolé H.S., Dougnon T.V., Fiogbé E.P., Amoussou A.N., Baba-Moussa L.

  16. 1 1) Pourquoi est-ce que je ne parviens pas à ouvrir les formulaires ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC CRDI

    Faites vos calculs avec soin car votre demande pourrait ne pas être admissible.) 6) Existe-t-il une liste de pays admissibles dans lesquels mon établissement ou organisme est autorisé à travailler ou à avoir des partenaires ? Non, le CRDI n'a rien de tel; cependant, il ne soutient des travaux que dans les pays à faible.

  17. Ghana and Mali. Grade 7 Model Lesson for Standard 7.4. World History and Geography: Medieval Sub-Saharan Africa. California History-Social Science Course Models.

    Science.gov (United States)

    Zachlod, Michelle, Ed.

    California State Standard 7.4 is delineated in the following manner: "Students analyze the geographic, political, economic, religious, and social structures of the sub-Saharan civilizations of Ghana and Mali in Medieval Africa. Seventh-grade students focus on the Niger River and the growth of the Mali and Ghana empires; analyze the importance…

  18. Food Groups Associated with a Composite Measure of Probability of Adequate Intake of 11 Micronutrients in the Diets of Women in Urban Mali

    NARCIS (Netherlands)

    Kennedy, G.L.; Fanou-Fogny, N.M.L.; Seghieri, C.; Arimond, M.; Koreissi, Y.; Dossa, R.A.M.; Kok, F.J.; Brouwer, I.D.

    2010-01-01

    The prevalence of micronutrient deficiency is high among women of reproductive age living in urban Mali. Despite this, there are little data on the dietary intake of micronutrients among women of reproductive age in Mali. This research tested the relationship between the quantity of intake of 21

  19. Le genre comme rapport d’inégalité sociale dans le discours publicitaire

    Directory of Open Access Journals (Sweden)

    Jean-Claude Soulages

    2016-12-01

    Full Text Available Loin de se réduire à une simple transaction commerciale, une annonce publicitaire est un espace de croyances sur des identités, des rôles et des pratiques sociales. Au même titre que d’autres productions fictionnelles de la culture de masse, elle représente l’une des faces de ce miroir social alimenté par la circulation incessante d’attitudes et de croyances, affichant même s’il s’agit bien souvent pour cette dernière d’un positionnement ludique, un second monde peuplé par nos avatars. La publicité tout comme le fait la fiction télévisée définit l’horizon des possibles d’une communauté donnée. Ce qu’elles réalisent toutes deux c’est l’entrée de l’imaginaire dans le réel. Même si, à partir des années 70, s’opère un lent défigement des stéréotypes sexistes, le publicitaire ne se fera aucunement le porte-parole explicite d’une quelconque lutte féministe, il optera toujours pour une tactique ambivalente de double speak: des effets de décadrage mettant en exergue des situations délibérément décalées ou burlesques (Un homme qui change les couches de bébé! Un clown qui fait la lessive!, mais cristallisant des inégalités de rôles. En jouant tout à la fois sur le défigement et la réactivation des stéréotypes, c’est bien un rôle de passeur et de go between, qu’est assigné le publicitaire en se faisant l’arbitre ventriloque de ces conflits de légitimité et de construction identitaire qui agitent notre modernité.

  20. Descartes, est-ce la France ?

    Directory of Open Access Journals (Sweden)

    Pierre Macherey

    2004-04-01

    Full Text Available Le cas de Descartes présente un intérêt privilégié pour l’examen des conditions dans lesquelles une philosophie vient à être considérée comme représentant un esprit national. Le livre d’A. Glucksman, Descartes, c’est la France, publié en 1987 à l’occasion du 350e anniversaire de la parution du Discours de la méthode, constitue un exemple extrême de ce type d’opération, qui exploite une doctrine en en infléchissant certains enjeux fondamentaux.Descartes’ case is particularly interesting to examine the conditions under which a philosophy comes to the point of being considered to represent a national thought. A. Glucksman’s book, Descartes, c’est la France, published in 1987, for the 350th anniversary of the publication of the Discours de la méthode is an extreme example of that kind of process, which exploits a doctrine inflecting some of its fundamental stakes.

  1. Au-delà de la croissance rapide : combiner le paradoxe et la logique dominante pour un modèle d’hypercroissance durable

    OpenAIRE

    Chanut-Guieu , Cécile; Guieu , Gilles; Tannery , Franck; Dana , Léo-Paul

    2014-01-01

    International audience; Au-delà de la croissance rapide: Combiner le paradoxe et la logique dominant pour un modèle d'hypercroissance durable Résumé : Lorsque la PME est en croissance rapide, les enjeux qu'elle doit relever sont nombreux et exigeants. Ceci est encore plus vrai pour les PME en hypercroissance, dont le rythme de développement les amène à doubler de taille en quatre années. A travers l'analyse longitudinale et multi-méthodes de la constitution d'un groupe de taille moyenne (600 ...

  2. Une façon plus sécuritaire de combattre le paludisme au Mexique ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    18 oct. 2010 ... Le nombre de cas de paludisme a dégringolé au Mexique — de 25 023 en 1998 (un sommet) à 4 895 en 2001, puis à 1 985 en 2008. Le pays y est arrivé sans recourir au DDT. Aux termes de l'Accord de libre-échange nord‑américain, le Mexique s'était engagé à éliminer graduellement l'utilisation du DDT ...

  3. Économie | Page 5 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Une table ronde sur l'industrie du vêtement en Asie s'est tenue le 26 mars 2015 à Phnom Penh, au Cambodge. Elle était organisée par le Cambodia Development Resource Institute (CDRI) et commanditée par le CRDI. Plus de 45 intervenants de l'industrie du vêtement ont participé à cet événement, notamment des ...

  4. Dynamiques et rôle économique et social du secteur informel des ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'économie des pays en développement, africain notamment, est caractérisée par la coexistence d'un secteur formel et d'un autre dit informel. ... Ce projet vise à mieux comprendre le dynamique actuelle du secteur informel des TIC et lele économique et social qu'il joue au Burkina Faso, au Cameroun et au Sénégal, ...

  5. Les implications socio-economiques des parkings le long de la ...

    African Journals Online (AJOL)

    Cependant, ce rôle de transit s'exerce dans un contexte concurrentiel dans la mesure où le corridor togolais, essentiellement routier, n'est pas le seul qui dessert les pays enclavés. Pour faire face à cette concurrence, chaque pays côtier multiplie des opérations de charme afin d'attirer plus opérateurs économiques de ...

  6. [Paragraphe contenant le titre de l'article, style « Titre article »

    African Journals Online (AJOL)

    Jimi Cissoko

    changes climatic, etc. These effects can be measured with the consumption of .... La même remarque s'observe lorsqu'on change de combustible : le foyer mixte modifié à pétrole (Flm0k2,6+) est fermé, il présente ..... déterminer le choix des populations à changer leurs habitudes. Le Tableau 4montre l'évolution des prix des.

  7. Économie | Page 27 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'Inde s'est lancée dans un train de réformes au milieu des années 1980. ... (la mondialisation) et le relâchement des mesures de contrôle internes ont sans nul ... Ce livre révèle les voies par lesquelles l'innovation en matière de gestion des ...

  8. : tous les projets | Page 382 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Programme: Gouvernance et justice. Financement total : CA$ 213,300.00. Gestion axée sur la demande en vue de l'adaptation à la rareté de l'eau et aux changements climatiques dans le bassin du Saïss (Maroc). Projet. Le bassin du Saïss est un sous-bassin versant du bassin du Sebou, situé dans le nord du Maroc.

  9. L'action du CRDI — le développement du secteur privé

    International Development Research Centre (IDRC) Digital Library (Canada)

    Cathy Egan

    Le CRDI est du nombre. Il reconnaît depuis longtemps la valeur de l'industrie, des échanges et du commerce comme moteurs de la croissance économique. Grâce au soutien concret qu'il a accordé au développement du secteur privé, le CRDI a appris que deux types d'aide peuvent porter fruit : améliorer le con- texte dans ...

  10. Dissection aortique dans le syndrome de Marfan: à propos d'un cas ...

    African Journals Online (AJOL)

    Nous rapportons le cas d'un jeune homme de 30 ans chez qui nous avons fait le diagnostic de la dissection aortique dans le syndrome de Marfan. Il a pu bénéficier d'une intervention chirurgicale à coeur ouvert avec un remplacement de la valve aortique. A ce jour, 30ème mois après l'opération aucune complication n'est ...

  11. Suivre et contrer la circulation de l'information erronée dans le delta ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Un des pires incidents violents au Kenya depuis 2007 est survenu le 22 août 2012, lorsque 52 personnes sont mortes à la suite de violences ethniques entre des cultivateurs orma et des membres de la nation pokomo, un peuple nomade, dans le comté du fleuve Tana. Le présent projet de recherche d'une durée de deux ...

  12. La théorie de la diplomatie dans le Saint Empire Romain

    OpenAIRE

    Weber, Wolfgang E. J.

    2016-01-01

    Principes Dans ce que l’on nomme officiellement, depuis 1500 environ jusqu’à sa fin en 1806, le Saint Empire romain de la nation allemande (Heiliges Römisches Reich Deutscher Nation), le développement de la théorie de la diplomatie, autrement dit de conceptions relatives aux diplomates et à la diplomatie, est le fait d’élites soucieuses de mieux comprendre des problèmes posé...

  13. Les voies d'eau de l'espoir | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    15 déc. 2010 ... Le prochain objectif consistait à procéder au revêtement d'un canal secondaire dans la zone d'irrigation. Comme c'est le cas de tous les canaux secondaires non ... Pour sa part, l'équipe de recherche a versé 51 000 EGP provenant du budget du projet. Le projet d'amélioration du canal a débuté dans un ...

  14. L'apport de l'imagerie dans le diagnostic de la tu- berculose uro ...

    African Journals Online (AJOL)

    D'où le concours de l'imagerie dans le diagnostic et la mise en route du traitement médical. ... tère lombaire selon la technique de Boari. Le ... La sérologie VIH était négative. Les suites ... la recherche de BK (uroculture) s'est révélé positif ; la ...

  15. Liste de vérification Bourse de recherche 2018 pour le CRDI | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Certains numériseurs le feront automatiquement. Cependant, si le vôtre n'offre pas cette possibilité, il existe des méthodes manuelles pour ce faire, qui font appel à Adobe Acrobat, Microsoft Word ou d'autres logiciels. Le CRDI ne fournit pas d'instructions à ce sujet, mais il est possible de trouver des instructions sur Internet.

  16. Le nouveau visage de la philanthropie en Inde | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Connectez-vous avec Nirojan sur LinkedIn. La philanthropie est en hausse en Inde et le phénomène devrait continuer à croître. La nouvelle richesse transforme également le visage des dons de charité et retient l'attention du public. Par conséquent, le nombre de conseillers en philanthropie augmente aussi. La relation ...

  17. Le rêve entendu par les chrétiens de la Communauté Évangélique du Congo

    OpenAIRE

    MANSIANTIMA MIANKENDA , Alain-Fidèle

    2015-01-01

    International audience; Pour Sigmund FREUD, le rêve est une source de connaissance de soi. C'est la « voie royale » de la connaissance de l'inconscient. Selon lui, le sommeil est un état où le dormeur ne veut rien savoir du monde extérieur. Le rêve est donc le gardien du sommeil, c'est lui qui nous permet de rester endormis puisqu'en réalisant les désirs, il supprime le psychisme de ses excitations. Les fidèles de la Communauté Evangélique du Congo, en particulier ceux de la Paroisse de N'dji...

  18. Le CRDI en Afghanistan

    International Development Research Centre (IDRC) Digital Library (Canada)

    Depuis près de 40 ans, le CRDI collabore étroitement avec les chercheurs des pays en développement et les appuie dans leur quête de moyens de créer des sociétés en meilleure santé, plus équitables et plus prospères. Centre de recherches pour le développement international. CP 8500, Ottawa (Ontario) Canada K1G ...

  19. Le CRDI au Bhoutan

    International Development Research Centre (IDRC) Digital Library (Canada)

    Il en résulte des solutions locales, novatrices et durables, qui offrent des choix aux personnes qui en ont le plus besoin et font changer les choses. Centre de recherches pour le développement international. CP 8500, Ottawa (Ontario) Canada K1G 3H9. Pour en savoir plus, consulter la page. Web du Bureau régional de ...

  20. Le CRDI au Kenya

    International Development Research Centre (IDRC) Digital Library (Canada)

    afin d'y favoriser la croissance et le développement. Il en résulte des solutions novatrices et durables qui ont pour but d'améliorer les conditions de vie et les moyens de subsistance. Centre de recherches pour le développement international. CP 8500, Ottawa (Ontario) Canada K1G 3H9. Pour en savoir plus, consulter.

  1. Le CRDI en Jordanie

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... dans les pays en développement afin d'y favoriser la croissance et le développement. Il en résulte des solutions novatrices et durables qui ont pour but d'améliorer les conditions de vie et les moyens de subsistance. Centre de recherches pour le développement international. CP 8500, Ottawa (Ontario) Canada K1G 3H9.

  2. Festivals de cinéma dans le monde arabe

    Directory of Open Access Journals (Sweden)

    Jean-Michel Frodon

    2013-12-01

    Full Text Available Alors que les deux grands festivals « historiques » du monde arabe, Carthage (JCC et Le Caire, sont entrés en décadence, on assiste depuis le début des années 2000 à une véritable explosion du phénomène festivalier dans le monde arabe. Le pays le plus en pointe est le Maroc, quoique de manière contrastée, avec une manifestation de prestige à Marrakech, et une nuée de petites manifestations. Dans les émirats du Golfe, la multiplication des festivals traduit une stratégie de communication plutôt qu’une volonté de développement culturel. Cette stratégie est fragilisée par la concurrence que se livrent les différents acteurs. Dans les autres pays arabes, on trouve une grande variété de situations sous le signe de la dispersion. Pourtant, l’accumulation de festivals (une centaine dans la région finit par avoir des effets d’ensemble, au-delà des buts, moyens et limites de chacun d’eux. Le phénomène festivalier, bien qu’inscrit dans des agendas locaux ou nationaux, génère de manière plus vaste des réseaux générationnels, financiers, de procédures d’expertise, de processus d’interrelation, géographiques mais aussi entre le cinéma et les autres arts ou médias.

  3. Le Kongo de Sony Labou Tansi

    Directory of Open Access Journals (Sweden)

    Céline Gahungu

    2015-02-01

    Full Text Available Les textes inédits de Sony Labou Tansi proposent une réflexion sur l’histoire, et plus singulièrement sur celle du Kongo. Le souvenir du prestigieux royaume apparaît dès les premiers manuscrits, composés au début des années 1970. Loin d’être circonscrit aux écrits de jeunesse, le Kongo surgit sous de multiples formes dans le dédale des textes rédigés au cours des années suivantes. Cette fascination pousse l’écrivain dans une dynamique de recherche esthétique : comment évoquer cet illo tempore mythique sans sacrifier à une historicité convenue ? Comment inventer une écriture en mesure de rendre compte du fabuleux royaume ?L’analyse littéraire ne peut cependant faire fi du contexte politique dans lequel Sony Labou Tansi s’inscrit. Outre sa dimension historique et toponymique, Kongo est un ethnonyme dont l’auteur s’est réclamé. Celui-ci a revendiqué à de nombreuses reprises son appartenance à une identité kongo au point de s’être engagé, à la fin des années 1980, dans les rangs du MCDDI1. Ce discours identitaire et l’adhésion à un parti ethnique ont troublé l’image d’un auteur volontiers perçu comme un démocrate véritable. Est-il possible d’articuler le Kongo littéraire et le Kongo politique ? Le Kongo, dont l’ombre portée apparaît dans les manuscrits littéraires mais également dans les articles et les déclarations politiques, pourrait-il nous aider à saisir les enjeux de l’écriture protéiforme de Sony Labou Tansi ?

  4. Le contrôle de la reproduction chez les poissons.

    Directory of Open Access Journals (Sweden)

    CHEVASSUS B.

    1979-07-01

    Full Text Available L'utilisation de populations monosexes peut permettre d'accroître la rentabilité économique, lorsque la reproduction est trop rapide (aquaculture extensive dans les pays tropicaux ou dans le cas d'espèces où l'un des sexes est plus avantageux (meilleure vitesse de croissance ou maturation plus tardive. Nous avons analysé dans ce papier quatre méthodes permettant la production de populations monosexes. Si l'inversion sexuelle par traitement hormonal ou (a gynogenèse induite (dans le cas d'une homogamétie femelle ne semblent pas directement exploitables, on peut attendre du sexage génétique qui combine ces deux méthodes, des résultats prometteurs. L'hybridation interspécifique peut également conduire à une descendance monosexe dans des cas particuliers.

  5. La culture matérielle enfantine entre le cute et le cool

    Directory of Open Access Journals (Sweden)

    Gilles Brougère

    2012-11-01

    Full Text Available Cet article explore la façon dont on adresse un objet à l’enfant, c’est-à-dire la rhétorique à l’œuvre pour séduire les enfants (et les parents dans certains cas. Si l’éducation peut être présente pour certains produits, domine très largement aujourd’hui une rhétorique du fun, une association de l’objet à l’enfance via le divertissement et l’insertion dans une culture des pairs. Pour partie cet adressage se fait à travers l’utilisation de personnages ou d’univers sous licence qui proposent une rhétorique du fun prête à l’emploi. Mais l’analyse des univers disponibles montre que l’on peut décomposer le fun à travers deux pôles opposés, le cute, dont Hello Kitty constitue un exemple archétypal, et le cool, que Titeuf permet de saisir dans sa logique. A travers la distinction du cute et du cool, il s’agit de contribuer à l’analyse du déploiement contemporain d’une culture du divertissement qui est incorporée aux objets de l’enfance, tout en étant un moyen de capter l’intérêt de ceux-ci.

  6. Établissement d'une plateforme commune de recherche sur le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    épidémie se caractérise par la complexité des sous-types de VIH, est une cible capitale pour la recherche visant à évaluer le vaccin contre le VIH. Cette subvention appuiera l'établissement d'un partenariat réunissant l'Institute of Human ...

  7. La gestion forestière communautaire dans le sud-ouest de Madagascar

    DEFF Research Database (Denmark)

    Casse, Thorkil; Milhøj, Anders

    2012-01-01

    La principale conclusion est que le modèle de transfert de la gestion forestière vers les communautés locales malgaches, du moins dans cette partie du pays, n'a pas modifié significativement l'attitude des villageois vis-à-vis de la conservation de la forêt....

  8. Le rendement du sorgho fera un bond au Soudan grâce à un semoir ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    an dernier le premier prix de l'Innovation Contest in Knowledge Management and Knowledge Sharing in Agricultural and Rural Development in the MENA Region. Ce prix est assorti d'une bourse de 5 000 $. Le WaHIP a été ...

  9. La Collecte de renseignements personnels dans le contexte d'une ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    whoskin

    Le CRDI est assujetti à la Loi sur la protection des renseignements personnels, L.R.C. 1985, c. P-21. (http://www.canlii.org/ca/loi/p-21/). Les renseignements recueillis dans le contexte de votre demande, dont certains peuvent être de nature personnelle, peuvent comprendre notamment ce qui suit : • études et emplois ...

  10. Le développement a un visage et une adresse aux Philippines ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    31 janv. 2011 ... Le barangay, qui est la structure de base de l'organisation administrative, ressemble à un village. D'après le code philippin de l'administration locale, il doit compter au moins 2 000 habitants en zone rurale et 5 000 en zone urbaine. Cellule fondamentale de la planification et de la mise en application des ...

  11. Résultats de recherche | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    26 mars 2018 ... Le programme conjoint canado-israélien de recherche en santé est un programme d'une durée de sept années et d'un budget de 35 millions de CAD, conclu entre le CRDI, l'Israel Science Foundation, l'Azrieli Foundation et les Instituts de recherche en s. Livres.

  12. Nouveau partenariat pour le développement de l'Afrique | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    22 juil. 2011 ... Devant elle, la promesse d'un avenir meilleur lui est offerte par le Nouveau partenariat pour le développement de l'Afrique (NEPAD), un plan radical qui offre ... Les populations africaines réclament de vraies élections, un débat public plus libre et un gouvernement plus responsable et respectueux des lois.

  13. : tous les projets | Page 413 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    S'attaquer à la marginalisation, à la criminalité et à la violence chez les jeunes - lele du capital social communautaire. Projet. Il est maintenant reconnu que les adolescents ont besoin d'un capital social positif (réseaux sociaux, relations interpersonnelles) pour devenir des adultes productifs et socialement responsables.

  14. Le renforcement des systèmes de santé | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    4 avr. 2013 ... Avec le soutien du CRDI, Walter Flores et une coalition dirigée par le Centro de Estudios para la Equidad y Gobernanza en los Sistemas de Salud ... Les briques et les clics sont importants; il est essentiel de disposer d'infrastructures convenables et de systèmes efficaces de gestion de l'information.

  15. Incidence de la taxation selon le sexe : améliorer la production de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Incidence de la taxation selon le sexe : améliorer la production de revenus et la ... et de réduire la pauvreté, il est essentiel de comprendre la nature des réformes fiscales ... Le CRDI félicite la première cohorte de chercheuses en science des ...

  16. Le Chien de faïence

    Directory of Open Access Journals (Sweden)

    Marie-Laure Schultze

    2011-11-01

    Full Text Available Marie-Laure Schultze est enseignante-chercheure depuis une vingtaine d'années. Elle a travaillé en Angleterre, au Canada et surtout en France, où elle est actuellement en poste à Aix-Marseille Université. Elle y a ouvert avec une collègue des ateliers (exceptionnellement rares dans les universités françaises de traduction créatrice et d’écriture plurilingue ; ces ateliers sont destinés à leurs étudiants apprenant l’anglais et consolidant le français. En parallèle, et dans les interstices laissés par sa recherche sur la place de l’écriture créatrice dans l’apprentissage des langues et sa famille (un compagnon et trois enfants constituent le noyau de la drupe, elle écrit et publie bon an mal an cahin caha ses textes (de la fiction courte, du théâtre, deux romans en chantier, des histoires pour enfants... sur son blog http://carnetdetextes.wordpress.com/

  17. Hypnose : que se passe-t-il dans le cerveau ?

    OpenAIRE

    Touzet , Claude

    2017-01-01

    The Conversation; L'hypnose est un état de "transe" imposé au sujet qui permet d'obtenir de celui-ci qu'il se conforme aux suggestions qui lui sont faites indépendamment de leur véracité. Par exemple, le sujet n'éprouve pas de douleur alors même que nous savons que ce qu'il subit est douloureux.

  18. Publications | Page 34 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Prévenir la violence tout en réduisant la pauvreté. Est-ce qu'un programme de réduction de la pauvreté peut aussi contribuer à réduire la criminalité et la violence? De nouvelles conclusions découlant de recherches financées par le CRDI portent à croire que cela pourrait être possible si ce genre de programme est mis en ...

  19. Publications | Page 33 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Prévenir la violence tout en réduisant la pauvreté. Est-ce qu'un programme de réduction de la pauvreté peut aussi contribuer à réduire la criminalité et la violence? De nouvelles conclusions découlant de recherches financées par le CRDI portent à croire que cela pourrait être possible si ce genre de programme est mis en ...

  20. Publications | Page 29 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Prévenir la violence tout en réduisant la pauvreté. Est-ce qu'un programme de réduction de la pauvreté peut aussi contribuer à réduire la criminalité et la violence? De nouvelles conclusions découlant de recherches financées par le CRDI portent à croire que cela pourrait être possible si ce genre de programme est mis en ...

  1. Le chaos et l'harmonie la fabrication du Réel

    CERN Document Server

    Xuan Thuan, Trinh

    1998-01-01

    Cette fin de siècle a vu un véritable bouleversement dans notre façon de concevoir le monde. Après avoir dominé la pensée occidentale pendant trois cents ans, la vision newtonienne d'un univers fragmenté, mécaniste et déterministe a fait place à celle d'un monde exubérant de créativité. Le Réel n'est plus déterminé seulement par des lois naturelles appliquées à des conditions initiales particulières, mais aussi moulé et façonné par une suite d'événements contingents et historiques qui peuvent bouleverser la réalité à son niveau le plus profond. Celui du bolide rocailleux venu percuter la Terre il y a quelque 65 millions d'années et responsable de la mort des dinosaures en est un exemple. Les lois physiques ont perdu leur rigidité. Avec l'avènement de la mécanique quantique, le hasard est entré en force dans le monde subatomique. Le monde macroscopique n'a pas été épargné. Avec la théorie du chaos, le hasard et le non-déterminisme ont envahi non seulement la vie de tous le...

  2. Le numérique pour stopper le moulin à rumeurs | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    7 sept. 2016 ... Au sud-est du Kenya, une information erronée peut se révéler mortelle, mais une organisation canadienne oeuvre à la prevention des conflits. Un projet financé par le CRDI mise sur la technologie des textos pour lutter contre la désinformation et à sauver des vies au Kenya. Cet article fait partie d'une série ...

  3. Des drones survolant le delta | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    25 nov. 2016 ... Photo prise par un drone survolant la ville de Fuvemeh. Appeaning-Addo et al. 2015. Les vagues balayant le rivage de Fuvemeh, une ville ghanéenne qui est située près du delta du fleuve Volta et que menacent les inondations et l'érosion des côtes. Par Brian Owens, Canadian Geographic. La région du ...

  4. Pour que brûle le feu du changement | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    7 déc. 2010 ... Créé en 1994, il finance des recherches aussi variées que pertinentes ... Grâce à cette recherche, les consommateurs sont beaucoup plus ... en intégrant politiques et programmes est en partie à l'origine de ce succès. ... un rapport qui lie sans équivoque le tabagisme à la maladie et au décès prématuré.

  5. Le principe d'Anselme : la lecture de l'argument d'Anselme par Charles Hartshorne

    NARCIS (Netherlands)

    Manson, Nadine

    2007-01-01

    Peut-on ou non prouver Dieu? Cette question tire son origine du XI-ème siècle, et plus particulièrement de celui que l'on appelle le << père de la Scolastique>>, Anselme de Canterbury. Le monde a bien changé depuis Anselme. La philosophie n'est plus divine, elle n'est plus qu'humaine. Dieu n'est

  6. Le type et l'authenticité du texte et leur influence sur la compréhension

    OpenAIRE

    Meta Lah

    2004-01-01

    L'objet de cette étude est d'analyser lele du texte dans la compréhension écrite, notamment sous deux de ses aspects: le type et l'authenticité. Le but est surtout pra­ tique: en apprendre plus sur lele du texte pour pouvoir ensuite mieux enseigner et évaluer la compréhension écrite. Dans la pratique pédagogique il arrive souvent que les exercices de compréhen­ sion écrite proposés aux élèves ne les differencient pas assez, ce qui soulève certai­ nes questions sur ce qui est plus facile...

  7. ÉTUDE DE CAS — Costa Rica : Du choix pour le consommateur à l ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    17 déc. 2010 ... La CPC s'est adressée aux parties en cause pour obtenir l'information qui lui permettrait d'évaluer le pouvoir de marché de chacune. Une situation atypique, car normalement, c'est la CPC qui a le fardeau de la preuve, souligne Pamela Sittenfeld, directrice générale de la CPC au moment de l'enquête, ...

  8. Le piano touchant/touché: l'instrument du contretemps chez Gide, le cas du Journal et des Notes sur Chopin

    OpenAIRE

    Zorica Vukušić, Maja

    2011-01-01

    André Gide, romancier, essayiste, critique et traducteur, a été le diariste dont le journal (écrit de 1887 jusqu`à 1949) est imbibé de musique. Gide a aussi été pianiste – amateur (dans le sens barthésien du terme), tout comme Nietzsche, Sartre ou Barthes. Leur proximité nous est donnée dans une sorte de polémique imaginée qui dépasse le discours. Sans doute Adorno et Jankélévitch ont été meilleurs pianistes et meilleurs philosophes de la musique, mais Gide s`est éloigné de la ...

  9. La importancia de la experiencia estética y el arte actual

    OpenAIRE

    Tejada, Jesús

    2003-01-01

    Es imprescindible que la reflexión estética aborde el problema de la crisis del arte actual y que analice las distintas respuestas que en la práctica se le están dando. La renovación del diálogo con planteamientos estéticos tradicionales puede arrojar una nueva luz sobre la actividad de la creatividad artística, al destacar los conceptos de emoción y conocimiento entre otros.

  10. Increasing Access to Family Planning Choices Through Public-Sector Social Franchising: The Experience of Marie Stopes International in Mali.

    Science.gov (United States)

    Gold, Judy; Burke, Eva; Cissé, Boubacar; Mackay, Anna; Eva, Gillian; Hayes, Brendan

    2017-06-27

    Mali has one of the world's lowest contraceptive use rates and a high rate of unmet need for family planning. In order to increase access to and choice of quality family planning services, Marie Stopes International (MSI) Mali introduced social franchising in public-sector community health centers (referred to as CSCOMs in Mali) in 3 regions under the MSI brand BlueStar. Potential franchisees are generally identified from CSCOMs who have worked with MSI outreach teams; once accredited as franchisees, CSCOMs receive training, supervision, family planning consumables and commodities, and support for awareness raising and demand creation. To ensure availability and affordability of services, franchisees are committed to providing a wide range of contraceptive methods at low fixed prices. The performance of the BlueStar network from inception in March 2012 until December 2015 was examined using information from routine monitoring data, clinical quality audits, and client exit interviews. During this period, the network grew from 70 to 135 franchisees; an estimated 123,428 clients received voluntary family planning services, most commonly long-acting reversible methods of contraception. Franchisee efficiency and clinical quality of services increased over time, and client satisfaction with services remained high. One-quarter of clients in 2015 were under 20 years old, and three-quarters were adopters of family planning (that is, they had not been using a modern method during the 3 months prior to their visit). Applying a social franchising support package, originally developed for for-profit private-sector providers, to public-sector facilities in Mali has increased access, choice, and use of family planning in 3 regions of Mali. The experience of BlueStar Mali suggests that interventions that support quality supply of services, while simultaneously addressing demand-side barriers such as service pricing, can successfully create demand for a broad range of family

  11. Increasing Access to Family Planning Choices Through Public-Sector Social Franchising: The Experience of Marie Stopes International in Mali

    Science.gov (United States)

    Gold, Judy; Burke, Eva; Cissé, Boubacar; Mackay, Anna; Eva, Gillian; Hayes, Brendan

    2017-01-01

    Background: Mali has one of the world's lowest contraceptive use rates and a high rate of unmet need for family planning. In order to increase access to and choice of quality family planning services, Marie Stopes International (MSI) Mali introduced social franchising in public-sector community health centers (referred to as CSCOMs in Mali) in 3 regions under the MSI brand BlueStar. Program Description: Potential franchisees are generally identified from CSCOMs who have worked with MSI outreach teams; once accredited as franchisees, CSCOMs receive training, supervision, family planning consumables and commodities, and support for awareness raising and demand creation. To ensure availability and affordability of services, franchisees are committed to providing a wide range of contraceptive methods at low fixed prices. Methods and Results: The performance of the BlueStar network from inception in March 2012 until December 2015 was examined using information from routine monitoring data, clinical quality audits, and client exit interviews. During this period, the network grew from 70 to 135 franchisees; an estimated 123,428 clients received voluntary family planning services, most commonly long-acting reversible methods of contraception. Franchisee efficiency and clinical quality of services increased over time, and client satisfaction with services remained high. One-quarter of clients in 2015 were under 20 years old, and three-quarters were adopters of family planning (that is, they had not been using a modern method during the 3 months prior to their visit). Conclusion: Applying a social franchising support package, originally developed for for-profit private-sector providers, to public-sector facilities in Mali has increased access, choice, and use of family planning in 3 regions of Mali. The experience of BlueStar Mali suggests that interventions that support quality supply of services, while simultaneously addressing demand-side barriers such as service pricing

  12. Le fictif et le réel dans L’Empereur et l’assassin de Chen Kaige

    Directory of Open Access Journals (Sweden)

    Xiaomin Giafferri

    2008-12-01

    Full Text Available Comme tout texte historique littéraire refait l’Histoire en la manipulant, le récit filmique est doublement mensongère du fait de sa double représentation : le décor et les acteurs représentent une situation qui est la fiction, et le film lui-même représente sous forme d’images juxtaposées cette première représentation. Sans vouloir faire la part du réel et de l’imaginaire, le présent travail tente de montrer comment, dans le film L’empereur et l’assassin de Chen Kaige, l’illusion de l’authenticité s’établit à travers les mécanismes de la fictionnalisation de l’Histoire. L’observation de leur manifestation est amenée à considérer deux axes principaux : l’organisation du récit et la mise en scène des personnages.

  13. The match between motivation and performance management of health sector workers in Mali

    Directory of Open Access Journals (Sweden)

    Touré Hamadassalia

    2006-02-01

    Full Text Available Abstract Human resources for health (HRH play a central role in improving accessibility to services and quality of care. Their motivation influences this. In Mali, operational research was conducted to identify the match between motivation and the range and use of performance management activities. Objectives To describe the factors motivating and demotivating health workers in Mali and match the motivators with the implementation of performance management. Methods First an exploratory qualitative study was conducted: 28 interviews and eight group discussions were held. This was followed by a cross-sectional survey, during which 370 health workers were interviewed. The study population consisted of health workers of eight professional groups. The following issues were investigated: • motivating and demotivating factors; • experiences with performance management, including: job descriptions, continuous education, supervision, performance appraisal and career development. Findings The study showed that the main motivators of health workers were related to responsibility, training and recognition, next to salary. These can be influenced by performance management (job descriptions, supervisions, continuous education and performance appraisal. Performance management is not optimally implemented in Mali, as job descriptions were not present or were inappropriate; only 13% of interviewees received 4× per year supervision, and training needs were not analysed. Some 48% of the interviewees knew their performance had been appraised in the last two years; the appraisals were perceived as subjective. No other methods were in place to show recognition. The results enabled the research team to propose adaptations or improvements upon existing performance management. Conclusion The results showed the importance of adapting or improving upon performance management strategies to influence staff motivation. This can be done by matching performance management

  14. René Girard, Le bouc émissaire

    OpenAIRE

    Pailler, Jean-Marie

    2017-01-01

    René Girard est mort le 4 novembre 2015. Un retirage d’une de ses œuvres majeures, Le bouc émissaire, publiée en 1982, a eu lieu vers la fin de ce même mois. Ce retirage d’opportunité nécrologique allait, hélas, s’avérer plus opportun encore que prévu. Entre-temps s’était produite la tuerie du Bataclan, le 13 novembre. Cet événement et la chaîne de ceux qui ont suivi se prêtent à plusieurs lectures. L’une des plus suggestives – et des moins rassurantes – est celle qui fait appel aux rivalités...

  15. Une Analyse de film pour comprendre le racisme

    OpenAIRE

    Rosiejka, Veronica Ann

    2014-01-01

    Il y a une nouvelle vague de racisme ouvert en France. Cependant, c'est un phénomène avec des racines sociales et historiques complexes. Ce mémoire cherche à comprendre le racisme de deux manières : généralement, aussi bien que spécifiquement à la France. Le centre d'attention principal de cette étude est la psychologie du racisme, comment le racisme fonctionne et ses conséquences, éléments qui sont étudiés à travers l'analyse d'une série de neuf courts-métrages,...

  16. Le Bestiaire d'amour de Gustave Flaubert (1)

    OpenAIRE

    Loïc Windels

    2010-01-01

    « Désirer, c'est tuer ». Voilà ce qu’un Ministère de la Prévention fera bientôt imprimer sur le bandeau accompagnant les ventes du second des Trois contes. Du reste, il est certain que sa carte du Tendre empiète quelque peu sur les géographies du Cruel. Qui se penche sur son bestiaire en relève généralement assez vite le caractère symbolique et la couleur pré-freudienne. Flaubert ferait, avec le légendaire médiéval, ce que Freud peu après avec la mythologie grecque. Ces remarques et quelques ...

  17. Le matérialisme scientifique

    Science.gov (United States)

    Meunier, Jean-François

    2004-03-01

    De nos jours, il arrive quotidiennement aux grands hommes d'avoir à fréquenter d'ignorants mortels épris d'une conviction maladive que la science est la grande responsable de tous les maux du monde. Évidemment sans physique atomique, il n'y aurait pas eu d'Hiroshima et sans révolution industrielle, pas de pollution et etc. Cependant, ces accusations envers le progrès technique sont tout à fait injustes, irréfléchies et, j'irai même jusqu'à dire, irresponsables, puisque le calcul, i.e. la planification, même la plus élémentaire, est ce qui caractérise le mieux, pragmatiquement, la société humaine. À mon avis, les problèmes sociaux tireraient plutôt leur origine de sciences sociales irréalistes, qui, concrètment, inspireraient ou serviraient d'alibis à ceux qui détiennent véritablement le pouvoir. Dans cet article, je tenterai donc de démontrer la meilleure véracité et efficacité du matérialisme scientifique. Cette doctrine, dont Mario Bunge est le plus illustre représentant, s'appuy sur les résultats théoriques et expérimentaux des sciences factuelles ainsi que sur l'exactitude logique des mathématiques, utilisées ici comme langage universel de l'expression des idées. Cette conception philosophique qui s'inspire principalement du modèle des théories physiques, stipule que les réalités sociales sont, comme tout autre réalité, matérielles, mathématisables et représentables comme des systèmes en interaction. En fait, le modèle des physiciens ayant historiquement fait ses preuves en matière de testabilité et de cohérence interne est proposé d'être appliquer aux sciences sociales, aujourd'hui scindées des sciences dites pures sous l'inspiration des pseudo penseurs néo-kantiens, phénoménologiques et post-moderne. Cette nouvelle approche permettrait ainsi d'évoluer plus exactement vers une compréhension des bases sociales et biologiques du comportement humain afin de développer une éthique sans cesse plus r

  18. Le travail en évolution

    OpenAIRE

    Alexandre, Marie; Attali, Michaël; Baeza, Carole; Champy-Remoussenard, Patricia; Deschenaux, Frédéric; Deville, Julie; Gonin, Audrey; Guedj-Chauchard, Muriel; Guillemot, Valérie; Hardouin, Magali; Hébrard, Pierre; Labbé, Sabrina; Maillard, Fabienne; Roussel, Chantal; Saint-Martin, Jean

    2014-01-01

    Le travail est une réalité sociale souvent perçue comme « centrale » dans l’organisation de la société et soumise à des « métamorphoses » rapides et permanentes qui se répercutent sur les pratiques éducatives. À l’heure où le chômage et les formes de précarité vont grandissant, où la demande de professionnalisation des dispositifs de formation se fait pressante, des questions complexes pour la recherche en éducation se trouvent posées. Les processus de professionnalisation, s’ils interpellent...

  19. Programme de bourses de recherche sur le changement climatique ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Une faculté d'adaptation limitée est souvent reconnue comme l'un des principaux facteurs de vulnérabilité aux changements climatiques. Le programme Adaptation aux changements climatiques en Afrique (ACCA) du CRDI vise à aider les sociétés africaines à faire face aux changements climatiques. Cette subvention ...

  20. Livres | Page 27 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... en appuyant la recherche sur des questions essentielles de développement international. ... Dix ans de réforme : Politique scientifique et technologique en Chine ... Knowledge Shared : Participatory Evaluation in Development Cooperation ... Le droit au logement est un droit fondamental de la personne réaffirmé en juin ...

  1. La croissance demographique et son impact sur le developpement ...

    African Journals Online (AJOL)

    La croissance demographique et son impact sur le developpement des grandes villes au ... La ville de Porto-Novo au Bénin n'est pas en marge de cette réalité que ... and the need for improving its framework of life through its development.

  2. Publications | Page 120 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Au Costa Rica, l'autorité de la concurrence inflige des amendes à Coca-Cola. Le consommateur moyen n'est pas toujours pleinement conscient des avantages que procure une politique de la concurrence. Mais les habitants du Costa Rica en ont pris conscience lorsqu'une décision de l'... ÉTUDE DE CAS — Rosario, ...

  3. Centre de recherches pour le développement international ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Julie Pépin

    employé est un voyageur occasionnel (selon la définition donnée à la section 4); ou ... droit à une avance de déplacement ni à un remboursement des frais ..... incluses dans le coût des billets d'avion à divulguer au public. 14.

  4. Publications | Page 138 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Au Costa Rica, l'autorité de la concurrence inflige des amendes à Coca-Cola. Le consommateur moyen n'est pas toujours pleinement conscient des avantages que procure une politique de la concurrence. Mais les habitants du Costa Rica en ont pris conscience lorsqu'une décision de l'.

  5. Asie centrale | Page 35 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Langue English. Read more about Soutien aux processus d'élaboration des politiques de réglementation des biotechnologies en Asie du Sud-Est. Langue French. Read more about Innovation en matière de biocarburants sous le signe de l'inclusion en Indonésie. Langue French. Read more about Toward Inclusive Biofuel ...

  6. Tumelo le Moruo

    Directory of Open Access Journals (Sweden)

    Vuyani S. Vellem

    2015-03-01

    Full Text Available Paleng ya rona batho ba batsho, tumelo ya boKreste e fihlile lefatsheng la rona la Afrika Borwa mmoho le dikgoka tsa ditjhaba tsa boPhirima. BoKreste bo fihlile ka nako ya dintwa tseo mohopolo wa tsona e neng e le ho hapa lefatshe la, batho ba batsho. Ka mantswe amang, rona batho ba batsho, re ile ra qetella re le setjhaba se ileng sa hlolwa, mme lefatshe la rona la nkuwa ka dikgoka. Ka hare ho dikgoka tsena, ho ne ho dutse tumelo ya boKreste. Makgowa a ile are: �A re kwaleng mahlo re rapeleng, rona ra kwala mahlo, mme ha re qeta hore Amen, re bula mahlo, ra fumana lefatshe le nkuwe matsohong a rona ho setse Bibele.� Re ile ra sala le Bibele eo ka yona re lekileng dilemong tse fitileng ho lwana ntwa ya topollo, kapa tokoloho hofihlela selemong sa 1994. Le ha re ile ra fumana tokoloho ka selemo seo, hare so ka re lokoloha ho tsa moruo. E kaba sena se bolela eng mabapi le tumelo ya rona ya boKreste? Segolweng sena re leka ho araba potso ena. Tumelo ke eng ho batho ba sa lokolohang moruong wa naha ya bona? Re lekola pale ya boKreste, tumelo ya batho le maemo a kereke ntlheng ya ho tadimana le tokoloho ka tumelo.Faith and economics. In our history from a black perspective, Christianity arrived through violent conquest from the west. Evidentially, this faith coincided with wars of dispossession and the ultimate defeat of black Africans. It is difficult to separate the violent defeat of black Africans from the arrival of Christian faith. This well-known statement within the circles of black Theology of liberation: When the white man arrived in our land he said, �let us pray and after prayer, when we opened our eyes, our land was taken and only the Bible was left in our hands,� captures the black sentiment of this history. Ironically, it was this Bible that black Africans used to wage their struggle for liberation up to the demise of apartheid in 1994.Nonetheless, political liberation is not enough as the struggle for economic liberation

  7. Snježana Malić-Limari, MSc in Natural Sciences

    Directory of Open Access Journals (Sweden)

    Sven Jelaska

    2010-06-01

    Full Text Available Snježana Malić-Limari successfully defended her Master’s thesis Evaluation of Medvednica Nature Park with Respect to Land Cover, Landform and Visitor System at the Faculty of Science of the University of Zagreb on November 23, 2009. The Master’s thesis was evaluated by the following Committee: Prof. Dr. Božena Mitić, Assist. Prof. Dr. Sven Jelaska (mentor and Prof. Dr. Sanja Tišma, Institute for International Relations.

  8. The sustainability of cassava-based bioethanol production in southern Mali

    DEFF Research Database (Denmark)

    Rasmussen, Kjeld; Birch-Thomsen, Torben; Bruun, Thilde Bech

    2015-01-01

    of labour input. Analysis of the significance of current cassava production for food security shows that bioethanol production should be based on the attiéké variety of cassava, thereby avoiding interference with the important role of the bonouma in assuring food security in northern Mali. The key factor......The demand for biofuels has been rising, which has led developing countries to focus on production of feedstocks for biodiesel and bioethanol production. This has caused concerns for the impacts on food security, food prices and environmental sustainability. This paper examines a hypothetical case...

  9. Constructing a survey over time: Audio-visual feedback and theatre sketches in rural Mali

    Directory of Open Access Journals (Sweden)

    Véronique Hertrich

    2011-10-01

    Full Text Available Knowledge dissemination is an emerging issue in population studies, both in terms of ethics and data quality. The challenge is especially important in long term follow-up surveys and it requires methodological imagination when the population is illiterate. The paper presents the dissemination project developed in a demographic surveillance system implemented in rural Mali over the last 20 years. After basic experience of document transfer, the feedback strategy was developed through audiovisual shows and theatre sketches. The advantages and drawbacks of these media are discussed, in terms of scientific communication and the construction of dialogue with the target population.

  10. Notes from the church of the Virgin at the island of Mali grad

    Directory of Open Access Journals (Sweden)

    Cvetkovski Sašo

    2010-01-01

    Full Text Available In this text the unknown parts of the wall paintings from the Church of the Virgin at the island of Mali Grad (The Great Prespa Lake are analyzed: the figure of a monk praying to St. Paraskeve, on the southern wall of the nave, as well as the painting on the southern faüade with the depictions of St. George on horseback, the Virgin as Empress enthroned, and the bust of two saints, St. Paraskeve and St. Nicholas. The monk is identified with the hegoumenos Jona, mentioned in the donor’s inscription dating from 1369.

  11. Achieving Peace in Northern Mali: Past Agreements, Local Conflicts, and the Prospects for a Durable Settlement

    Science.gov (United States)

    2015-01-01

    conflict- mitigation mechanisms used in northern Mali—such as political agreements and integration of former militants into security forces—as well as...21. 24 Keita, 2002, p. 23. 25 Sophie Boukhari, “Mali: A Flickering Flame,” UNESCO Courier, Vol. 53, No. 1, January 2000, pp. 26–28, p. 27. 26 Susanna...state do not have the level of tensions they had under Tandja.65 Issoufou also took measures to mitigate the consequences that the Libyan crisis had

  12. After the Fall of Qaddafi: Political, Economic, and Security Consequences for Libya, Mali, Niger, and Algeria

    Directory of Open Access Journals (Sweden)

    Ricardo René Larémont

    2013-06-01

    Full Text Available On 20 October 2011, Muammar Qaddafi, the leader of Libya, was killed by members of a local militia in his hometown of Sirte. Qaddafi’s death and his regime’s end fractured a security structure that had brought some stability to Libya, Mali, Niger, and to a much lesser extent southern Algeria. Because of his regime’s demise, a new swathe of instability that comprises fractured, compromised, or failed states has emerged in the Sahelian region, giving ample opportunities to militant entrepreneurial groups that have organized and are inhibiting the re-creation of more stable states and societies.

  13. Le Combat de l’amour divin et de l’amour profane : un ballet de Charpentier pour le collège d’Harcourt

    OpenAIRE

    Demeilliez , Marie

    2014-01-01

    International audience; De l’activité de Marc-Antoine Charpentier au service des jésuites, nous sont parvenus un vaste répertoire religieux ainsi que le célèbre « opéra chrétien » David et Jonathas (1688), l’une des rares partitions composées pour le collège Louis-le-Grand qui soit conservée. Alors que le musicien en fut le maître de musique pendant plusieurs années, l’on sait peu de choses de sa participation aux somptueuses représentations théâtrales dont le collège s’est fait une spécialit...

  14. Le système alimentaire mondial est-il soluble dans le développement durable ?

    OpenAIRE

    Rastoin, J.L.

    2006-01-01

    In a process of world economic domination by an agro-industrial and agro-tertiary food system, the author wonders about the feasibility of an alternative model. The intensive agro-industrial model (financiarized, concentrated, specialized and globalized), allows remarkable results in terms of products prices and safety, but generates negative externalities. In the long term, this model could threat the food equilibrium of the populations and ecological balance of our planet. The concept of su...

  15. Quand le lait devient enjeu social : le cas de la société peule dans le Séno (Burkina Faso

    Directory of Open Access Journals (Sweden)

    Madina Querre

    2003-09-01

    Full Text Available L’intérêt pour le « lait » en tant que sujet de recherche est issu, ici, de questionnements autour de l’allaitement en tant que facteur de transmission du VIH. En effet, la transmission du VIH par l’allaitement représente un important problème de santé publique dans les pays du Sud. La mise en place des programmes de prévention reste un problème complexe qui touche divers domaines dont une partie concerne directement notre discipline, étant d’ordre social et culturel. Les perceptions qui valorisent l’allaitement maternel sont très ancrées dans la plupart des cultures « tradi­tionnelles », mettant en valeur celles du lait. Le lait prend en effet dans la société peule une valeur qui va au-delà de la simple question de l’allaitement, étant présent au cœur même de la structure socio-économique. C’est cet aspect qui constituera le propos de cet article.Le terme Kossam, qui désigne le lait, signifie « ce qui est meilleur ». A la base de l’organisation socio-économique peule, son exploitation révèle une originalité particulière concernant les femmes : c’est le lait qui donne aux femmes la possibilité d’une émancipation sociale et économique. En effet, tel que cela sera développé dans cet article, le lait de vache est la propriété de la femme dès l’instant où elle est mariée ; elle peut alors en disposer selon ses intérêts pour la consommation et/ou la commercialisation. Elle peut donc avoir une certaine marge de liberté dans ses actions sans être sous la tutelle complète de son époux. Le fait même qu’elle en soit propriétaire fait référence à un fonctionnement et à une représentation sociale spécifiques.Le lait et sa productrice, la vache, sont au cœur du fonctionnement socio-économique peul. Le lait est considéré comme étant à la base de l’alimentation ; même si dans les faits l’alimentation est aussi organisée autour du mil. Aussi, envisager le

  16. Des filles en or : lele méconnu des femmes dans les mines ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    17 oct. 2017 ... C'est là que Mme Nakacho a commencé, il y a trois ans. ... et peu de recherches ont été faites sur les rôles des femmes dans ce secteur. ... pour adapter les lois et les politiques gouvernementales de sorte qu'elles appuient le ...

  17. Bibliographie de l’île de Clipperton – Île de La Passion (1711-2005)

    OpenAIRE

    Jost, Christian

    2008-01-01

    L’île de Clipperton, baptisée « Île de La Passion » par ses découvreurs français en 1711, porte pourtant le nom d’un pirate anglais. Malgré les très courtes périodes d’occupation qu’elle connut au début du XXe siècle et dans les années 1960, son histoire est jalonnée de nombreux écrits. Son intérêt scientifique sur le plan des études environnmentales et les enjeux économique et géopolitique récemment renouvelés conduisent l’auteur à publier ici cette bibliographie de plus de trois cent cinqua...

  18. Storicizzare le teorie psicocritiche

    Directory of Open Access Journals (Sweden)

    Roberto Talamo

    2015-07-01

    Full Text Available Le teorie psicoanalitiche della letteratura, dopo una fase di alterne fortune, sono oggi praticate da una cerchia di adepti sempre più ristretta. Le nuove koinè critico-teoriche tendono infatti a relegare la dottrina freudiana all’interno di un sapere letterario (e non interpretativo o a sostituire ad essa strumenti ritenuti più efficaci nella descrizione della sfera del mentale in letteratura (neuroestetica e neuronarratologia. La proposta storiografica che qui si avanza non vuole prendere parte in questo dibattito pro o contro la psicocritica, ma vuole leggere le proposte di teoria psicoanalitica della letteratura alla luce di una riflessione sul concetto di ibridazione, concetto sul quale queste teorie hanno costruito il loro confronto con i paradigmi teorici di volta in volta egemoni.

  19. Rebelle De Fatou Keita Ou le Combat Feminin Contre la Patriarchie ...

    African Journals Online (AJOL)

    Le combat féministe est un sujet d'actualité dans une Afrique toujours gouvernée par des systèmes phallocentriques qui emprisonnent la femme ou l'enterrent dans la misère. L'écriture, parmi d'autres moyens, est une arme par excellence utilisée dans le combat contre le système patriarcal. L'écrivaine féministe s'en sert ...

  20. A. Bandura. Auto-efficacité. Le sentiment d’efficacité personnelle

    OpenAIRE

    Rondier, Maïlys

    2009-01-01

    Albert Bandura est docteur en psychologie et enseigne à l’université de Stanford (Californie). Il est l’auteur de L’Apprentissage social (Mardaga, 1985). Depuis les années 80, Albert Bandura s’intéresse au sentiment d’efficacité personnelle. Ce concept s’inscrit dans le cadre de la théorie sociocognitive (théorie issue du béhaviorisme et du cognitivisme). Selon cette théorie, le fonctionnement et le développement psychologique doivent être compris en considérant trois facteurs en interaction ...

  1. Être et exister: le cas de La Nausée

    Directory of Open Access Journals (Sweden)

    Maarten van Buuren

    2007-06-01

    Le trajet de La Nausée est un trajet descendant, comparable à Mort à venise. Celui de L’Etre et le Néant est un trajet ascendant comparable à La Montagne magique. Par rapport à L’Etre et le Néant qui décrit l’extase triomphante de l’esprit, La Nausée se dessine comme l’étape précédente: celle de la descente en enfer.

  2. Extrême-Orient | Page 89 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Dans les couples où seul l'un des partenaires est séropositif pour le VIH (couples sérodiscordants), la prise d'antirétroviraux par le partenaire séropositif peut réduire le taux de transmission du VIH, du moins à court terme. C'est ce qui ressort d'une étude menée par Yiming Shao, titulaire d'une chaire de recherche du CRDI, ...

  3. Recherche pour le développement — Cambodge | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    11 janv. 2011 ... Après avoir été dévasté par la guerre civile et avoir subi l'occupation étrangère et le règne violent des Khmers rouges, le Cambodge s'est dirigé vers une transition radicale.En vertu des Accords de paix de Paris de 1991, le cessez-le-feu a été instauré, et les Cambodgiens ont été tenus d'organiser des ...

  4. Le Tableau du maître flamand : œuvre/bibliothèque

    Directory of Open Access Journals (Sweden)

    Anne-Sophie Huguet

    2002-11-01

    Full Text Available L’auteur montre le renouveau du roman policier chez Arturo Pérez-Reverte, grâce à une métaphore de la lecture comme jeu d’échecs. En conditionnant lele du lecteur, le jeu acquiert une dimension métaphysique. La frontière entre fiction et réalité est brouillée par les multiples références intertextuelles et à l’iconographie, vues comme les méandres d’une bibliothèque labyrinthique.

  5. Effet-dose de l’acide oléique alimentaire. Cet acide est-il conditionnellement essentiel ?

    Directory of Open Access Journals (Sweden)

    Bourre Jean-Marie

    2000-11-01

    Full Text Available Dans un travail précédent [1] nous avons montré que, globalement, au terme de la période de gestation-lactation chez des rats de 21 jours, la carence alimentaire en acide oléique entraîne une diminution de la concentration en 18:1(n-9; la synthèse endogène ne compense donc pas l’absence d’acide oléique dans les aliments. Afin de déterminer exactement l’effet de la présence et de la concentration de l’acide oléique dans l’alimentation sur la composition en acides gras de divers organes, les huiles végétales commerciales n’étant pas utilisables (car contenant toujours de l’acide oléique, des triglycérides ont été synthétisés par voie chimique et enzymologique; ils ont été formés soit d’acide oléique, soit d’acide alpha-linolénique, soit d’acide linoléique. La détermination de l’effet-dose a été réalisée avec un protocole expérimental portant sur 7 groupes de rats ayant reçu chacun des aliments de composition identique (en particulier au niveau des acides gras indispensables : les acides linoléique et alpha-linolénique mais dont la teneur, variable, en acide oléique était située entre 0 et 6 000 mg pour 100 g d’aliments. Les rates ont été nourries avec les régimes à partir de 2 semaines avant l’accouplement, leurs portées ont été sacrifiées soit à 21, soit à 60 jours. Quand la teneur de l’acide oléique augmente dans les aliments, les principales modifications observées chez les animaux de 21 jours sont les suivantes.– Concernant le 18:1(n-9 : dans le foie, le muscle, le coeur, les reins et les testicules, sa concentration constante (le plateau de la courbe est atteinte aux environs de 4 g d’acide oléique pour 100 g d’alimentation. En deçà de cette dose, la réponse est croissante. Dans le cerveau, la myéline et les terminaisons nerveuses (mais non le nerf sciatique, la teneur en acide oléique reste optimale et constante.– La concentration du 16:1(n-7 diminue

  6. Le zapping, les ethnologues, et leurs Indiens

    Directory of Open Access Journals (Sweden)

    Frédérique Langue

    2005-06-01

    Full Text Available Comme toujours s'agissant des expositions mises en scène au Grand Palais, la présentation est parfaite, impeccable. La mise en valeur des objets venus aussi bien de musées brésiliens qu'européens, et les commentaires qui les accompagnent, orientent le visiteur dans un labyrinthe "exotique" de poteries et d'objets de plume, coupé de temps à autre de documentaires portant sur les rituels amérindiens, chants psalmodiques à l'appui. L'auditoire y semble comme vissé sur place, davantage d'ailleur...

  7. Thai in-service teacher understanding of nature of science in biology teaching: Case of Mali

    Science.gov (United States)

    Aiemsum-ang, Napapan; Yuenyong, Chokchai

    2018-01-01

    This paper aimed to investigate the existing ideas of nature of science (NOS) teaching in Thailand biology classroom. The study reported the existing ideas of nature of science (NOS) teaching of one biology teacher Mrs. Mali who had been teaching for 6 years at in a school in Khon Kaen city. Methodology regarded interpretive paradigm. Tools of interpretation included 2 months of classroom observation, interviewing, and questionnaire of NOS. The findings revealed Mali held good understanding of the nature of science in the aspect of the use of evidence, the aspect of knowledge inquiry through different observation and deduction, the aspect of creativity and imagination influencing science knowledge inquiry, and the aspect of changeable scientific knowledge. Her biology teaching indicated that she used both the deficient nature of science approach and the implicit nature of science approach. The implicit nature of science approach was applied mostly in 7 periods and only 2 periods were arranged using the deficient nature of science approach. The paper has implication for professional development and pre-service program on NOS teaching in Thailand.

  8. The yellow Fever epidemic in Western mali, september-november 1987: why did epidemiological surveillance fail?

    Science.gov (United States)

    Kurz, X

    1990-03-01

    Recent yellow fever epidemics in West Africa have underlined the discrepancy between the official number of cases and deaths and those estimated by a retrospective epidemiological investigation. During the yellow fever epidemic that broke out in western Mali in September 1987, a total of 305 cases and 145 deaths were officially notified, but estimates revealed true figures abut five times higher. This paper attempts to discuss the factors that hindered early case detection and more complete reporting. They were, first, the insufficient training on the clinical diagnosis, the blood sampling method for laboratory confirmation, and the curative treatment of patients (resulting in low utilization of services); second, the lack of an action plan to prepare in advance a quick response to the epidemic, affecting reporting procedures at the peripheral level and active case-finding during the outbreak; and third, the lack of laboratory facilities for a quick confirmation of the disease. The difficulties experienced during the yellow fever epidemic in Mali demonstrated the importance of a preparedness strategy for epidemic control, based on an integrated approach of epidemiological surveillance within basic health service activities. The need for regional collaboration and for institutionalized funds in the donor community that could be mobilized for epidemic preparedness activities is also emphasized.

  9. Mating performance of Glossina palpalis gambiensis strains from Burkina Faso, Mali, and Senegal

    International Nuclear Information System (INIS)

    Mutika, Gratian N.; Kabore, Idrissa; Parker, Andrew G.; Vreysen, Marc J.B.; Seck, Momar T.; Sall, Baba; Bouyer, Jeremy

    2012-01-01

    The mating performance of Glossina palpalis gambiensis Vanderplank (Diptera: Glossinidae) mass- reared in Burkina Faso (BKF strain) was compared with that of target populations originating from the Bamako peri-urban area of the Niger River Basin, Mali (MLI strain) and the Niayes area, Senegal (SEN strain). The tests were carried out using a field cage either set up outdoors in Burkina Faso or inside the laboratory in Austria. The target population strains(MLI and SEN) were a few generations from the wild whereas the laboratory-reared flies (BKF) were adapted to laboratory rearing over many generations. The laboratory-reared BKF strain significantly out-competed the MLI strain in the mating tests, but showed close to equal competitiveness with the SEN strain. At least one-third of possible matings occurred during each observation period. The females from the two target populations readily mated with males from the BKF strain. The selected mating parameters and behaviour in the cage showed that there was mating compatibility between the strains and this absence of obvious mating barriers indicates the potential of using BKF strain males in programmes that have a sterile insect technique (SIT) component targeting the two G.p.gambiensis populations of Mali and Senegal.

  10. The spatial distribution of Anopheles gambiae sensu stricto and An. arabiensis (Diptera: Culicidae in Mali

    Directory of Open Access Journals (Sweden)

    N. Sogoba

    2007-05-01

    Full Text Available Variations in the biology and ecology and the high level of genetic polymorphism of malaria vectors in Africa highlight the value of mapping their spatial distribution to enhance successful implementation of integrated vector management. The objective of this study was to collate data on the relative frequencies of Anopheles gambiae s.s. and An. arabiensis mosquitoes in Mali, to assess their association with climate and environmental covariates, and to produce maps of their spatial distribution. Bayesian geostatistical logistic regression models were fitted to identify environmental determinants of the relative frequencies of An. gambiae s.s. and An. arabiensis species and to produce smooth maps of their geographical distribution. The frequency of An. arabiensis was positively associated with the normalized difference vegetation index, the soil water storage index, the maximum temperature and the distance to water bodies. It was negatively associated with the minimum temperature and rainfall. The predicted map suggests that, in West Africa, An. arabiensis is concentrated in the drier savannah areas, while An. gambiae s.s. prefers the southern savannah and land along the rivers, particularly the inner delta of Niger. Because the insecticide knockdown resistance (kdr gene is reported only in An. gambiae s.s. in Mali, the maps provide valuable information for vector control. They may also be useful for planning future implementation of malaria control by genetically manipulated mosquitoes.

  11. Exploring innovative ways to conduct coverage surveys for neglected tropical diseases in Malawi, Mali, and Uganda.

    Science.gov (United States)

    Woodhall, Dana M; Mkwanda, Square; Dembele, Massitan; Lwanga, Harriet; Drexler, Naomi; Dubray, Christine; Harris, Jennifer; Worrell, Caitlin; Mathieu, Els

    2014-04-01

    Currently, a 30-cluster survey to monitor drug coverage after mass drug administration for neglected tropical diseases is the most common methodology used by control programs. We investigated alternative survey methodologies that could potentially provide an estimation of drug coverage. Three alternative survey methods (market, village chief, and religious leader) were conducted and compared to the 30-cluster method in Malawi, Mali, and Uganda. In Malawi, drug coverage for the 30-cluster, market, village chief, and religious leader methods were 66.8% (95% CI 60.3-73.4), 74.3%, 76.3%, and 77.8%, respectively. In Mali, results for round 1 were 62.6% (95% CI 54.4-70.7), 56.1%, 74.8%, and 83.2%, and 57.2% (95% CI 49.0-65.4), 54.5%, 72.2%, and 73.3%, respectively, for round 2. Uganda survey results were 65.7% (59.4-72.0), 43.7%, 67.2%, and 77.6% respectively. Further research is needed to test different coverage survey methodologies to determine which survey methods are the most scientifically rigorous and resource efficient. Published by Elsevier B.V.

  12. le du Liver X Receptor dans la régulation transcriptionnelle de la lipogenèse

    OpenAIRE

    Ducheix, Simon

    2013-01-01

    Chez les mammiferes, la lipogenese ou synthese de novo des acides gras joue un rôle essentiel a l'homeostasie energetique. Elle est particulierement active dans le foie. Le Liver X Receptor (LXR) est un recepteur nucleaire de classe II qui est implique dans la regulation de l'expression de genes importants dans cette voie metabolique. Au niveau hepatique, LXR regule directement l'expression de certains genes de la lipogenese et aussi l'expression des facteurs de transcription SREBP-1c et ChRE...

  13. Physique ou leçons sur les principes généraux de la nature II

    CERN Document Server

    Aristote

    2015-01-01

    Extrait : ""Définition de la nature : elle est dans les êtres, le principe du mouvement et du repos. Des êtres naturels. L'existence de la nature est évidente ; il n'est pas nécessaire de la démontrer.""

  14. Physical Properties of P.V.C. Attenuated Network Copolymers Produced by Ionizing Radiation; Proprietes physiques des copolymeres obtenus sous l'action de rayonnements ionisants et dont le reseau est attenue par l'effet du chlorure de polyvinyle; Fizicheskie svojstva polivinilkhloridnykh obednennykh tsepej sopolimerov, poluchennykh v rezul'tate vozdejstviya ioniziruyushchej radiatsii; Propiedades fisicas de los copolimeros de redes atenuadas por cloruro de polivinilo obtenidos por irradiacion

    Energy Technology Data Exchange (ETDEWEB)

    Pinner, S H [Tube Investments Research Laboratories, Hinxton Hall, Cambridge (United Kingdom)

    1960-07-15

    The cross-linking of polyvinyl chloride with ionizing radiation poses special problems. Due to rather unfavourable cross-linking and dislinking parameters for this polymer, the radiation doses necessary for high cross-link densities are uneconomicall y large and discolouration and dehydrohalogenatio n are simultaneously produced. These difficulties have been overcome by the incorporation into the P. V. C., prior to irradiation, of diallyl and triallyl esters. Heavily cross-linked products are thereby obtained with relatively low doses of ionizing radiation. Examination of the physical properties of the products suggests that these are not simply graft copolymers, which term normally implies the presence of long branch chains, but are polymer attenuated allyl networks. In these materials, the desirable properties of the parent polymer and of the allyl network are combined. The tensile strength, modulus and elongation of the attenuated network copolymers are presented and discussed as a function of temperature and of the concentration and functionality of the allyl ester. Reference is also made to the swelling and chemical resistance of the products. (author) [French] La reticulation du chlorure de polyvinyle sous l'action des rayonnements ionisants pose des problemes particuliers. Les parametres de reticulation et de degradation etant plutot defavorables pour ce polymere, les doses d'irradiation necessaires a l'obtention de fortes densites de pontage sont trop elevees pour donner des resultats economiquement interessants; elles provoquent simultanement la decoloration et la deshalogenhydratation. Il a ete possible de surmonter ces difficultes par introduction d'esters diallyliques et triallyliques dans le chlorure de polyvinyle, avant irradiation. Ce procede permet d'obtenir au moyen de doses d'irradiation relativement faibles des produits fortement reticules. L'etude des proprietes physiques de ces produits montre qu'il s'agit non pas de simples copolymeres greffes

  15. Economic and social sustainability performance of jatropha projects: results from field surveys in Mozambique, Tanzania and Mali

    NARCIS (Netherlands)

    Romijn, H.A.; Heijnen, S.; Rom Colthoff, J.; Jong, de B.; Eijck, van J.A.J.

    2014-01-01

    This paper presents results from comprehensive field surveys of jatropha projects in Mozambique, Tanzania and Mali in 2012. The article singles out the salient economic and social impact results and derives lessons. The results clearly demonstrate the weak business case for jatropha biofuel

  16. Economic and Social Sustainability Performance of Jatropha Projects: Results from Field Surveys in Mozambique, Tanzania and Mali

    NARCIS (Netherlands)

    Romijn, Henny; Heijnen, Sanne; Rom Colthoff, Jouke; de Jong, Boris; van Eijck, Janske

    2014-01-01

    This paper presents results from comprehensive field surveys of jatropha projects in Mozambique, Tanzania and Mali in 2012. The article singles out the salient economic and social impact results and derives lessons. The results clearly demonstrate the weak business case for jatropha biofuel

  17. Sharia as ‘Desert Business’: Understanding the Links between Criminal Networks and Jihadism in Northern Mali

    DEFF Research Database (Denmark)

    Haugegaard, Rikke

    2017-01-01

    How can we understand the social and economic dynamics that enable the operative space of the militant networks in northern Mali? This article argues that jihadist militant groups are actors in local power struggles rather than ‘fighters’ or ‘terrorists’ with extremist ideological motivations. I ...

  18. Dusukasi-The Heart That Cries: An Idiom of Mental Distress Among Perinatal Women in Rural Mali.

    Science.gov (United States)

    Lasater, Molly E; Beebe, Madeleine; Warren, Nicole E; Souko, Fatoumata; Keita, Mariam; Murray, Sarah E; Bass, Judith K; Surkan, Pamela J; Winch, Peter J

    2018-04-25

    Perinatal mental health problems such as depression and anxiety are prevalent in low and middle-income countries. In Mali, the lack of mental health care is compounded by few studies on mental health needs, including in the perinatal period. This paper examines the ways in which perinatal women experience and express mental distress in rural Mali. We describe a process, relying on several different qualitative research methods, to identify understandings of mental distress specific to the Malian context. Participants included perinatal women, maternal health providers, and community health workers in rural southwest Mali. Participants articulated several idioms of distress, including gèlèya (difficulties), tôôrô (pain, suffering), hamin (worries, concerns), and dusukasi (crying heart), that occur within a context of poverty, interpersonal conflict, and gender inequality. These idioms of distress were described as sharing many key features and operating on a continuum of severity that could progress over time, both within and across idioms. Our findings highlight the context dependent nature of experiences and expressions of distress among perinatal women in Mali.

  19. Aeolian and fluviolacustrine landforms and prehistoric human occupation on a tectonically influenced floodplain margin, the Méma, central Mali

    Science.gov (United States)

    B. Makaske; E. De Vries; J. A. Tainter; R. J. McIntosh

    2007-01-01

    The Méma is a semi-arid region in central Mali with a rich archaeological heritage indicating the former existence of large urban settlements. The archaeological data suggest millennia of occupation history of the Méma preceding relatively sudden abandonment by the 14th or 15th century AD. Population numbers have remained low since then and today...

  20. "Sundiata, Lion King of Mali." Adapted by Kim Hines, Featuring Griot Alhaji Papa Susso, Cue Sheet for Students.

    Science.gov (United States)

    Freeman, Aakhu TuahNera

    This performance guide is designed for teachers to use with students before and after a performance of "Sundiata: Lion King of Mali," adapted by Kim Hines and featuring Griot Alhaji Papa Susso. The guide, called a "Cuesheet," contains seven activity sheets for use in class, addressing: (1) Sundiata: Man & Myth (discusses…