WorldWideScience

Sample records for le mali est

  1. Le CRDI au Mali

    International Development Research Centre (IDRC) Digital Library (Canada)

    contre le paludisme n les chercheurs contribuent à l'amélioration des services de santé n de jeunes femmes participent à la vie politique. Soutien accordé par le CRDI depuis 1971. 93 activités d'une valeur de 15 millions cad. Les chercheurs ont aidé à offrir l'enseignement primaire dans les langues maternelles. CRDI.

  2. Le Centre du Mali : épicentre du djihadisme?

    NARCIS (Netherlands)

    Sangaré, B.

    2016-01-01

    La multiplication d'épisodes violents dans le centre du Mali, depuis la moitié de l'année 2015, démontre à quel point la paix reste fragile dans ce pays. La signature des accords pour la paix et l'amorce d'un processus de réconciliation ont certes marqué une avancée pour le gouvernement, mais la

  3. Mali.

    Science.gov (United States)

    1989-12-01

    Mali has an area of 474,764 square miles, the capital is Bamako with a population of 800,000 and the terrain is desert and savanna. The climate ranges from semitropical to arid and the total population is 7.6 million with a growth rate of 2.7%. The ethnic groups are Mande 50%, Peul 17%, Songhai 6%, Yuareg and Moor 5%, and the religions are Islam 90%, indigenous 9%, and Christian 1%. The languages are French and Bambara and the life expectancy is 47 years, with an infant mortality rate of 173/1,000. The labor force is 72% agriculture, industry and commerce 12%, and services 16%. The government is a republic with a constitution, president, national assembly and a supreme court. Agricultural products include millet, sorghum, corn, rice, livestock, sugar, cotton, and peanuts. They export cotton and cotton product, animals, fish, tannery products, and peanuts. In 1958 Soudan and Senegal joined together to form the Mali Federation which collapsed in 1960. Soudan then proclaimed itself the republic of Mali, which lasted until 1967. A military coup took over in 1968 and civilian rule did not return until 1974 when the constitution was approved. Mali is 1 of the 10 poorest nations in the world because it has not developed its mineral resources and agriculture exports. Mali receives much foreign aid from nations around the world including China, US, and the Soviet Union.

  4. Bessines – Le Grand Champ Est

    OpenAIRE

    Lemaître, Séverine; Landreau, Guilhem; Ferrié, Jean-Georges; Maguer, Patrick

    2013-01-01

    Identifiant de l'opération archéologique : 204625 Date de l'opération : 2008 (SP) Plusieurs opérations de diagnostics et de fouilles ont été entreprises depuis 2003 au sud-est de la Communauté d’Agglomérations de Niort. Elles montrent une occupation protohistorique particulièrement dense de l’âge du Bronze à l’âge du Fer, au sud-est de l’ancien golfe des Pictons, notamment sur les communes adjacentes de Niort, à Aiffres et à Bessines. Suite au dépôt d’un projet de ZAC, une opération de diagno...

  5. Le travail social est-il de gauche ?

    OpenAIRE

    Girault, Eloïse

    2011-01-01

    Le sociographe est une revue de recherches en travail social, publiée par différents instituts de formation en travail social et qui entend proposer « un cadre de travail, d'écritures, de lectures et d'échanges pour développer une réflexion sur les méthodes et les pratiques d'intervention ». Dans ce numéro, Le sociographe s'efforce d'apporter des éléments de réponse à la question suivante : « Le travail social est-il de gauche ? ». Cette interrogation est fort légitime dans la mesure où, comm...

  6. « Le Paradis, c’est les autres »

    Directory of Open Access Journals (Sweden)

    Rachid Amirou

    2008-11-01

    Full Text Available L’engouement pour des sites ou des lieux est souvent dû à des « Nous » (des communautés éphémères, qui se constituent et qui consacrent ainsi l’espace de visite. La consécration collective est souvent un préalable au succès de certaines destinations (Ibiza, Saint-Tropez, Marrakech, etc.. Le succès des formules de villages de vacances hermétiquement fermés à l’extérieur et indifférents au pays de séjour atteste de l’existence d’un état d’esprit qu’on a classé sous le terme générique de « bulle touristique ». Cependant, la constitution de ces « bulles » – c’est-à-dire la rencontre d’un imaginaire, d’un « nous » et d���un espace touristiques – ne se fait pas uniquement par l’exclusion de l’autre. Elle repose aussi sur un principe interne positif : le rêve d’une sociabilité parfaite, une sorte de paradis relationnel. Le « paradis » touristique, c’est d’abord une rencontre de plain-pied avec les autres (« l’ambiance », souvent d’ailleurs avec les mêmes – rencontre synonyme de relations différentes et moins stressantes, basées sur une connivence réelle ou fantasmée. La généalogie de ce paradis touristique relationnel, qui peut être aussi un enfer pour les autres, reste à décrire et à expliciter, en montrant comment il compose le noyau central de l’imaginaire touristique.

  7. Heaven on Earth? The development of tourism in the Dogon Country and the Hombori Mountains (Mali Le Paradis sur Terre ? Le développement du tourisme au Pays Dogon et dans les Monts Hombori (Mali

    Directory of Open Access Journals (Sweden)

    Olivier Walther

    2008-10-01

    Full Text Available Cet article étudie le développement touristique inégal de deux destinations touristiques du Mali: le Pays Dogon, un must du marché touristique ouest-africain, et les Monts Hombori, considérés comme un « paradis sur Terre » en raison de leur exceptionnelle biodiversité. En s’appuyant sur les travaux de Butler (1980, nos travaux suggèrent que ces lieux touristiques se situent à des stades très différents de leur cycle de vie touristique. Au Pays Dogon, l’intérêt constant manifesté par les anthropologues depuis les années 1930 a conduit au classement du site au Patrimoine de l’Humanité. Rien de tel à Hombori, où les amateurs de tourisme de montagne contemporains peuvent être considérés comme les pionniers de cette destination.This paper studies the unequal development of two tourist destinations in Mali: Dogon Country, a well-established tourist market area, and the Hombori Mountains, considered as a kind of “heaven on earth” due to their preserved biological biodiversity. Building on Butler’s destination life cycle model (1980, our research suggests Dogon Country benefits from a considerable, long-term advantage in terms of image, which has led to its inclusion within UNESCO’s World Heritage List. The situation is totally different in the Hombori Mountains where current mountain tourists can be considered as the trailblazers for this particular destination.

  8. Le bonheur n’est pas l’essentiel ?

    Directory of Open Access Journals (Sweden)

    Salome Berthon

    2007-01-01

    Full Text Available Si nos recherches ethnologiques portent en creux la marque du bonheur et du plaisir, à notre connaissance, ces notions ont rarement sinon jamais été exploitées systématiquement. Des émotions positives que l’on nous narre, en des termes souvent valorisants, aux formes du plaisir que les corps, expressifs ou silencieux, traduisent, c’est au croisement de nos terrains respectifs, pointant différents indicateurs, que nous avons tenté de définir ces notions. Visant à dépasser l’anecdotique et le liminaire au moyen d’une méthodologie « prospective », cette écriture commune fait place libre à une réflexion sur le bonheur et les plaisirs en anthropologie. Distinguant l’immédiateté du plaisir, de l’aspect différé, construit, négocié du bonheur, nous tâchons de voir en quoi, selon les situations et les relations, ils relèvent tantôt du « choisi », tantôt du « subi ». Nous portons ensuite un regard réflexif sur la position du chercheur, dont la subjectivité et les affects n’ont de cesse de mettre son ethnographie et son objectivité à l’épreuve. Si son autorité le conduit à dénier cette part émotionnelle, il devra pourtant s’engager, donner de sa personne pour gagner la confiance de ses interlocuteurs, ouvrir au discours et dévoiler quelques traces, faire surgir le non-dit des émotions, observer tant l’intime que le collectif et, in fine, comprendre ce qui du bonheur fait sens. Amorçant notre conclusion, nous nous interrogeons sur les causes et les effets de ces émotions positives, croisant pratiques et représentations, paroles et silences, automatisme et évidence, naturalité et construction, stabilité et mouvement, etc.

  9. Qu’est-ce que le naturalisme ?

    Directory of Open Access Journals (Sweden)

    Olivier Morin

    2012-01-01

    Full Text Available Cet article répond aux critiques récemment adressées aux tenants du « naturalisme social » dans les pages de la revue SociologieS. Il le fait en défendant un naturalisme minimal, bâti sur trois idées : l’interdisciplinarité est permise ; la pensée est un processus causal qui a lieu dans un monde matériel ; l’humanité est une espèce animale. Ces idées pourront sembler triviales ; le débat auquel nous assistons montre qu’il n’en est rien. Je passerai en revue les arguments les plus fréquemment opposés à ce naturalisme. Le dialogue entre sciences cognitives et sciences sociales ne prélude pas à une O.P.A. de la neurobiologie sur les autres disciplines. Aucun chercheur sérieux ne voit la cognition humaine comme un assemblage de modules à l’architecture entièrement fixée dès la naissance et incapables d’interagir avec leur environnement. Le fait que les processus mentaux n’aient pas lieu uniquement dans nos têtes est aujourd’hui un lieu commun des sciences cognitives. Enfin, l’étude de l’évolution de l’humanité, vue comme une espèce biologique, est porteuse de conclusions qui pour être très générales, n’en sont pas moins pertinentes pour les sciences sociales.What is Naturalism?This article responds to recent critics addressed to the advocates of « social naturalism » in the journal SociologieS. It does so by defending a minimal naturalism structured around three ideas: interdisciplinarity is allowed; thought is a causal process that occurs in a material world; humanity is a species. These ideas may seem trivial; the debate we’re assisting to shows us otherwise. I will go through the arguments that most frequently oppose naturalism. The dialogue between cognitive and social sciences is not a prelude to the takeover of neurobiology on other disciplines. No serious researcher sees human cognition as an assembly of architectural modules entirely fixed from birth and incapable of

  10. Le salaire minimum n'est pas toujours le meilleur moyen d'accroître ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    4 mai 2016 ... La hausse du salaire minimum a longtemps été considérée, pour la plupart des pays, comme un moyen de protéger les travailleurs pauvres et leur famille. De fait, cette intervention vigoureuse sur le marché du travail est une mesure de protection sociale à laquelle ont recours beaucoup de pays ...

  11. Le développement durable : est-il possible? est-il mesurable?

    Directory of Open Access Journals (Sweden)

    Belmokaddem MOSTEFA

    2011-04-01

    Full Text Available A la première question, nous répondrons bien sûr, par l’affirmative puisque tous les pays sont engagés dans une nouvelle approche du développement qui ne consiste pas seulement à produire le plus de biens et au moindre coût, afin de vendre beaucoup et réaliser de grands profits. C’était la vision en vigueur dans toutes les techniques de gestion mais on s’est rendu compte que cette production, supposée au moindre coût, était en fait, souvent d’un coût exorbitant, relativement aux dégâts occasionnés dans l’environnement et dans les nuisances occasionnées à la santé de l’homme et à sa tranquillité. Il est temps d’inclure d’autres variables dans le calcul du prix de revient tout en revoyant certaines techniques de production trop salissantes, dangereuses ou grosses consommatrices d’énergie. Nous répondrons aussi par la négative quand on pense qu’au niveau micro économique, les comportements sont édictés par les satisfactions immédiates et les maximisations des profits. Ces comportements qui ne s’intéressent qu’aux résultats à court terme, ne s’intègrent pas facilement dans les plans de développement visant les équilibres macro économiques à long terme.A la deuxième question, nous dirons qu’il y a effectivement des indicateurs pour tester les niveaux de qualité dans l’éducation, la santé, les ressources naturelles... et les gains tirés au niveau social mais les calculs économiques qui déterminent la rentabilité des projets, les profits espérés, les risques financiers encourus ne sont pas toujours en rapport avec les efforts pour réaliser le développement durable qui, eux dépassent la simple notion d’efficacité et de satisfaction. Quand on pense aux générations futures, ce n’est pas seulement en termes de durée dans le temps mais aussi dans la manière d’apprécier les gains espérés.Notre recherche repose sur ces questions qui minent bien des efforts alors qu

  12. Environnement et ambiances bioclimatiques dans le Sud-Est du ...

    African Journals Online (AJOL)

    Pour le traitement de ces données climatologiques,, il a été question de calculer les moyennes mensuelles des indices bioclimatiques sur la normale considérée. ... le pouvoir réfrigérant (K) et la tension de vapeur (tvap) connaissent des variations et déterminent les sensations organiques et corporelles des populations.

  13. Sécurité d'État et insécurité nationale au Mali : les logiques ...

    African Journals Online (AJOL)

    De 1963 à janvier 2012, la République du Mali – État et communautés – est confrontée à une série de crises multidimensionnelles. Malgré la signature d'un accord de paix issu du Processus d'Alger en juin 2015, le monopole et l'initiative de la violence illégitime reviennent aux mouvements rebelles du Nord Mali et à leurs ...

  14. Sécurité d'État et insécurité nationale au Mali: les logiques ...

    African Journals Online (AJOL)

    De 1963 à janvier 2012, la République du Mali – État et communautés – est confrontée à une série de crises multidimensionnelles. Malgré la signature d'un accord de paix issu du Processus d'Alger en juin 2015, le monopole et l'initiative de la violence illégitime reviennent aux mouvements rebelles du Nord Mali et à leurs ...

  15. Accouchement gémellaire en milieu africain: une analyse de 10 ans dans le district de Bamako au Mali

    Science.gov (United States)

    Théra, Tiounkani; Mounkoro, Niani; Traore, Soumana Omar; Hamidou, Albachar; Traore, Mamadou; Doumbia, Saleck; Tall, Saoudatou; Kouma, Aminata

    2018-01-01

    Introduction Le but de cette étude était de déterminer les facteurs influençant le pronostic de l'accouchement du deuxième jumeau. Méthodes L'étude était rétrospective et a porté sur tous les cas d'accouchements gémellaires enregistrés à la maternité du Centre de Santé de Référence de la commune V du District de Bamako du 1erJanvier 2007 au 31 Décembre 2016 soit sur une période de dix ans. Résultats Nous avons enregistré 34.899 accouchements dont 1374 accouchements gémellaires soit une fréquence de 2,54%; près de 15% étaient des primipares; 39,16% étaient référées; 69,10% et 15,5% autres sans aucun suivi prénatal. Les facteurs influençant négativement pronostic du deuxième jumeau étaient: un délai ≥ 15minutes entre les jumeaux, le recours tardif à la césarienne, la non qualification de l'accoucheur, la grossesse monochoréale, le faible poids de naissance. Par contre la parité, la réalisation de manœuvres obstétricales n'avaient aucune influence sur le pronostic du deuxième jumeau. Conclusion Le pronostic du deuxième jumeau est fortement influencé par un délai de naissance de plus de 15 minutes entre les jumeaux, les autres facteurs agissant comme des cofacteurs. PMID:29662606

  16. Le privé est professionnel ?

    OpenAIRE

    Boni-Le Goff, Isabel

    2017-01-01

    L’article traite des “régimes temporels” des salariés qualifiés du conseil en management. Il souligne la fluctuation des temporalités auxquelles un.e consultant.e peut être soumis.e et montre combien le cadrage organisationnel du temps remet en cause l’opposition et la frontière entre vie privée et vie professionnelle. Face aux normes de disponibilité extensive et à la figure professionnelle légitime d’un expert “sans attache”, les consultant.e.s en couple avec enfant(s) font l’expérience de ...

  17. L'Inde : où est le milieu ? | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    1 avr. 2011 ... Mais ils n'ont pas créé les emplois « fiables » dont l'Inde a désespérément besoin. Le travail peu rémunéré demeure un problème de taille sur le marché du travail indien. Pourtant, l'étude réalisée par M. Mazumdar sur la pauvreté, la croissance et l'inégalité montre que le nombre d'Indiens vivant dans la ...

  18. I MALI

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. I MALI. Articles written in Bulletin of Materials Science. Volume 39 Issue 7 December 2016 pp 1709-1724. Synthesis, characterization and isotherm studies of new composite sorbents · E S ZAKARIA I MALI M KHALIL T Y MOHAMED A EL-TANTAWY · More Details Abstract ...

  19. Les arbres fruitiers sahéliens dans l'économie rurale; Cas du Burkina Faso et du Mali

    NARCIS (Netherlands)

    Kuhlman, J.W.; Coulibaly, K.; Yago, E.L.; Michels, R.; Berg, van den J.

    2010-01-01

    Ce document est le compte-rendu d’une enquête réalisée dans neuf villages au Mali et au Burkina Faso sur l’importance des fruits et d’autres produits provenant des arbres fruitiers indigènes. Ces arbres font partie du paysage agricole de la savane ouest-africaine. L’étude porte sur lele de ces

  20. Regard critique sur On Est Ensemble: 852 mots pour comprendre le ...

    African Journals Online (AJOL)

    Résumé: L'ouvrage intitulé On Est Ensemble: 852 mots pour comprendre le français du Gabon (L. Ditougou, 2009) constitue une contribution importante dans l'histoire du français parlé au Gabon. Cette œuvre présente cependant quelques insuffisances sur le plan métalexicographique. Celles-ci portent sur les pré-textes, ...

  1. Le big bang n'est pas une théorie comme les autres

    CERN Document Server

    Bonnet-Bidaud, Jean-Marc; Leglu, Dominique; Reinisch, Gilbert

    2009-01-01

    Le big bang n'est pas une théorie comme les autres. Ce n'est d'ailleurs pas une théorie physique au sens propre du terme, mais un scénario cosmologique issu des équations de la relativité générale. Il est le modèle qui s'ajuste le mieux aux observations actuelles, mais à quel prix ? Il nous livre un Univers composé à 96 % de matière et d'énergie noires inconnues. C'est donc un euphémisme que de dire que le big bang semble poser autant - sinon plus - de questions qu'il n'en résout. En ce sens, le big bang apparaît davantage comme une paramétrisation de notre ignorance plutôt que comme une modélisation d'un phénomène. Pourtant, le succès du big bang et l'adhésion qu'il suscite, tant dans la sphère scientifique que dans la sphère médiatique, ne se démentent pas. Surmédiatisé, son statut dépasse celui de modèle théorique, et la simple évocation de son nom suffit pour justifier des opérations de marketing scientifique ou rejeter des cosmologies alternatives. Pour éclaircir les pr...

  2. L’interface Habitat / Habitant : quand le lieu de vie est porteur de maladie - Le cas du radon en PACA

    Directory of Open Access Journals (Sweden)

    Cissé E.

    2012-10-01

    Full Text Available Les préoccupations sont croissantes pour étudier les liens entre des conditions environnementales spécifiques et la fréquence de certaines pathologies. Nous proposons d’analyser ici le lien présupposé entre une exposition au radon et le cancer du poumon. Le radon, est un gaz radioactif d’origine naturelle (issu de la désintégration naturelle de l’uranium présent dans la croûte terrestre et plus particulièrement dans certaines formations géologiques. A partir du sol et de l’eau, le radon se diffuse dans l’air (exhalation et se trouve, par effet de confinement, à des concentrations plus élevées à l’intérieur des bâtiments qu’à l’extérieur. Les descendants solides du radon sont alors inhalés avec l’air respiré et se déposent dans le poumon. Il est établi par diverses études scientifiques que le radon a un impact non négligeable sur certains cancers, notamment du poumon (augmentation de 16 % du risque de cancer du poumon par tranche de 100 Bq/m3, et des cancers digestifs via la consommation d’eau qui s’est chargée en radon au contact du socle. Le nombre annuel de décès par cancer du poumon attribuable à l’exposition domestique au radon en France métropolitaine varie entre 1 200 à 3 575 en fonction des relations exposition-réponse utilisées. Plusieurs régions en France se caractérisent par une problématique radon reconnue et étudiée depuis longtemps (Bretagne, Massif central, Corse. Or, si le radon ne recouvre pas l’ensemble de la région PACA, certaines zones géographiques sont particulièrement concernées et méritent d’être étudiées : le Massif des Maures dans le Var, du Mercantour dans les Alpes-Maritimes et du Briançonnais dans les Hautes-Alpes. La région PACA est une des régions de France et d’Europe les plus touchées par la pollution atmosphérique principalement due à l’augmentation du trafic routier et des contributions de régions industrialisées telles que

  3. Il est temps que le Canada rende la justice accessible à tous | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Il est temps que le Canada rende la justice accessible à tous. Adrian Di Giovanni, Lotta Teale, Vivek Maru. 29 juin 2016. Des étudiantes à l'école secondaire Female Experimental High School à Herat en Afghanistan. Photo : Graham Crouch / Banque mondiale. Lorsqu'on prive un enfant d'accès à l'école ou qu'on exclut ...

  4. Et le gagnant est... Brendan Baker en entrevue | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2 févr. 2011 ... Plus les Canadiens verront d'exemples positifs, plus ils comprendront les difficultés que doivent surmonter les populations des pays en développement, et plus ils éprouveront du souci et de l'empathie à leur égard. Si le piège de la pauvreté persiste encore, c'est entre autres parce que les gens d'ici ...

  5. Baisse de la transmission de la douve du foie dans le nord-est de la ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    mortelle de cancer du foie liée à l'O. viverrini. Dans cer- taines régions, près de 85 % de la population est porteuse du parasite. Les villages du nord-est de la Thaïlande, où l'on raffole du poisson cru, ont des taux d'infection parmi les plus élevés du pays. Les personnes infectées peuvent porter le parasite adulte pendant ...

  6. Croissance de Auchenoglanis occidentalis (Pisces, Claroteidae dans le Delta Central du Niger (Mali, Afrique de l'ouest

    Directory of Open Access Journals (Sweden)

    Niaré, T.

    2013-01-01

    Full Text Available Growth of Auchenoglanis occidentalis (Pisces, Claroteidae in the Central Delta of Niger River Flood Plain (Mali, West Africa. Growth biology of Auchenoglanis occidentalis (Valenciennes, 1840 is studied from individuals monthly sampled on two different annual cycles (1991 and 1997 in the fishing port of Mopti. Individual age of fishes was determined by squelettochronology. Chronological follow-up of relative margin diameter (dr of spine ray section was used for validation of the periodicity of annulus formation. Only one annulus is formed annually. Period of growth recovery shows an individual variability with an early starting up from the lowwater level, in May. The seasonal cycle of growth of this benthic fish, A. occidentalis, depends more on the availability of the trophic resources than of abiotic factors. However, the optimal period of growth always remains the high-water one in this river with flood plain. Fishes condition factor's varies between 1.97±0.27 à 2.57±0.41. Year x season interaction affects this parameter. Growth realized during the first year (189.17±4.57 and 261.25±12.19 mm as well as the later growths depend on hydrological conditions and are influenced by fishing pressure. Presence of 3+ age class fishes shows that demographic structure is not qualitatively modified despite changes arisen in the Delta.

  7. Le criquet du Mato Grosso : l'agriculture est-elle responsable ?

    Directory of Open Access Journals (Sweden)

    Lecoq, M.

    1995-01-01

    Full Text Available Le criquet du Mato Grosso : l'agriculture est-elle responsable ?. Investigations through bibliographical references and among the local population provided a collection of documents and evidences showing without any doubt that Rhammatocerus schistocercoides (ReHN, 1906 [Orth. Acrididae Gomphocerinae] outbreaks in Mato Grosso (Brazil are not a new event neither by nature nor by magnitude. Therefore, the present conception on the origin of those outbreaks need to be drastically revised. The previous hypotheses, implying an overrated agricultural development of concerned areas since 1980, must then be rejected.

  8. Le marché du capital-risque en Wallonie: une nouvelle initiative est-elle nécessaire?

    NARCIS (Netherlands)

    de Harlez, Y.; Schwienbacher, A.; Van Wymeersch, C.

    2009-01-01

    Dans la plupart des pays européens, les autorités publiques ont mis en place ces dernières années des mesures destinées à accroître l’offre de capital-risque aux entreprises nationales. C’est notamment le cas des Pays-Bas avec le programme Technopartner Seed Capital et de l’Allemagne avec le

  9. Déchets nucléaires : où est le problème ?

    CERN Document Server

    Sorin, Francis

    2015-01-01

    Faut-il avoir peur des déchets nucléaires ? Sont-ils vraiment, comme le pense une partie du public, ce fardeau empoisonné ingérable faisant peser une menace fatale sur nous-mêmes et sur nos descendants ? Ou sont-ils au contraire, comme l'estime la grande majorité des scientifiques, des résidus que l'on sait fort bien conditionner et mettre hors d'état de nuire ? Entre le public inquiet et les ingénieurs rassurants, comment comprendre l'immense décalage des attitudes ? Et comment, face à ces déchets laissés en héritage, faire la part des choses entre ceux qui dénoncent "un crime contre les générations futures" et ceux qui jugent "la difficulté résolue" ? Bref, "Où est le problème ?" Sans craindre de bousculer bien des idées reçues mais sans méconnaître les risques encourus, Francis Sorin éclaire ici en quelques chapitres percutants les problèmes et les solutions liés à la gestion de ces déchets en France. II s'attache particulièrement au devenir des déchets de haute activité et...

  10. La Pedagogie Convergente: Son Experimentation au Mali et son Impact sur le Systeme Educatif. Monographies Innodata (The Convergent Pedagogy: Its Experimentation in Mali and Its Impact on the Educational System. Innodata Monographs).

    Science.gov (United States)

    Traore, Samba

    In this monograph, convergent pedagogy, which is a foreign language education approach to develop functional bilingualism in students, is described as a new approach to teaching language in bi- or multilingual contexts. Convergent pedagogy was introduced to the Mali educational system as a language education experiment in 1987. This monograph is a…

  11. Le "champ" de l'accompagnement des demandeurs d'emploi est-il un "marché" ?

    OpenAIRE

    Remy, Céline

    2015-01-01

    Le but de ce chapitre est d’interroger le champ de l’accompagnement des demandeurs d’emploi comme étant ou non un marché conventionnel. Pour ce faire, les concepts de marché, de quasi-marché, de marché public et de champ sont clarifiés dans un premier temps. Pour comprendre le fonctionnement du marché de l’accompagnement, il est nécessaire dans un deuxième temps d’examiner quatre dimensions qui sont le périmètre et le financement de celui-ci mais également la sélection des opérateurs externes...

  12. Le dessalement de l’eau de mer est-il une voie d’avenir?

    Directory of Open Access Journals (Sweden)

    Jean-Noël Salomon

    2012-06-01

    Full Text Available La pénurie en eau semble devenir une perspective inquiétante pour l’humanité. Aujourd’hui les pays en situation de stress hydrique sont de plus en plus nombreux tandis que les besoins ne cessent de grandir. Face à ce constat, nombre de solutions techniques ont été apportées dont celle du dessalement de l’eau de mer. Cette activité est en pleine expansion du fait d’une amélioration constante des techniques et d’un coût de plus en plus réduit. Déjà le dessalement représente la principale source d’eau potable pour un grand nombre de pays (îles, pays à climat désertique ou subdésertique, etc.. Mais, ce coût restant encore bien supérieur à celui des autres modes d’alimentation, cette technique reste réservée à des États ayant des ressources financières et énergétiques consistantes (Moyen Orient, pays développés, ce qui limite les possibilités. L’avenir du dessalement doit également prendre en compte ses effets sur l’environnement car de plus en plus d’études en montrent les effets pervers et …coûteux. Cet article entend faire le point et attirer l’attention sur l’ensemble de cette technique qui offre une alternative intéressante au spectre de la pénurie d’eau annoncée par bien des médias dans le contexte du réchauffement climatique.

  13. Le dessalement de l’eau de mer est-il une voie d’avenir?

    OpenAIRE

    Jean-Noël Salomon

    2012-01-01

    La pénurie en eau semble devenir une perspective inquiétante pour l’humanité. Aujourd’hui les pays en situation de stress hydrique sont de plus en plus nombreux tandis que les besoins ne cessent de grandir. Face à ce constat, nombre de solutions techniques ont été apportées dont celle du dessalement de l’eau de mer. Cette activité est en pleine expansion du fait d’une amélioration constante des techniques et d’un coût de plus en plus réduit. Déjà le dessalement représente la principale source...

  14. Le Prix mondial de l'alimentation est décerné à un ancien boursier ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    26 mai 2016 ... M. Hillel est chercheur principal au Center for Climate Systems Research, qui relève de l'Earth Institute de l'Université Columbia, et travaille avec le NASA Goddard Institute for Space Studies. Il a oeuvré par le passé avec de nombreux organismes de développement international et s'était vu octroyer une ...

  15. Le fascisme, c’est du théâtre. Macchina scenica e meccanica narrativa

    Directory of Open Access Journals (Sweden)

    Emanuele Canzaniello

    2015-11-01

    Full Text Available «Le fascisme, c’est du théâtre», sostiene Jean Genet, e come tale i suoi legami con la natura e la prassi della messa in scena sono essenziali alla specificità del fenomeno. La resa spettacolare della nazionalizzazione delle masse è stata senz’altro tra i temi fondamentali della ricerca sui totalitarismi. Il mio proposito è qui quello di intarsiare alcuni nuclei consolidati della ricerca storica con le rese squisitamente letterarie di quello che fu poco più che un  decennio di immensi tableaux vivants, visioni di un nuovo ordine di massa. Un’opera d’arte collettiva, basata su una premessa  fondamentale: dare “figurabilità” ai detriti e alle rovine (rimosse? di alcuni miti delle origini propri della cultura romantica, e  consapevolmente avviare e mettere in luce un enorme processo più generale di disgregazione del logos e di tutta la civiltà europea nella sua prospettiva diremo cartesiana, geometrica e razionalista. Il mio discorso si fonda, anche se in breve, su un testo solo: la Gerbe des forces (1937 di A. de Châteaubriant, uno dei più singolari resoconti di pellegrinaggio politico verso il miraggio totalitario che si sia dato tre le due guerre mondiali. Soccorsi non secondari sono il saggio di Sontag Under the sign of Saturn (1980 e quello di Tame La Mystique du Fascisme dans l’oeuvre de Robert Brasillach (1986. According to Jean Genet: «Le fascisme, c’est du théâtre», and as such its relationship with the nature and praxis of staging are essential to the specificity of the phenomenon. The magnificent representation of mass nationalisation is beyond doubt one of the fundamental issues when investigating totalitarianisms. My aim here is to link some wellestablished nuclei of historical research to the literary outputs of what was little more than a decade of immense tableaux vivants, visions of a new mass order. A collective work of art, based on a fundamental premise: to give ‘figurality’ to the rubble

  16. Le Makhzen est-il soluble dans la mondialisation ?

    Directory of Open Access Journals (Sweden)

    Jean-Luc Piermay

    2010-09-01

    Full Text Available L’article étudie les processus de fabrication des territoires à l’œuvre au Maroc depuis un demi-siècle, à travers l’exemple des dynamiques économiques et notamment industrielles. Si en matière de politiques publiques, cette question constitue un domaine d’intervention essentiel sous le règne de Mohammed VI, elle a bénéficié depuis la proclamation de l’indépendance d’une stratégie constante d’intégration du territoire national, stratégie toujours visible à travers le traitement qui est fait des marges spatiales du pays. En revanche, les territoires infranationaux sont peu pris en considération, voire vus avec méfiance, sinon en tant que projections locales des réseaux sociaux et politiques émanant du pouvoir central.Through the economic and industrial dynamics, this paper examines how the building of territories has taken place in Morocco from one half-century. Among the public policies, the economic question is the main field of State intervention under the reign of Mohammed VI. But from Independence (1956 the building of the national territory has taken advantage of an unchanging strategy of integration, still visible through the policies applied to the spaces neighbouring the borders. On the other side, infra national territories are little taken into account, even often seen with suspicion, except as local projections of the social and political networks coming from the State authorities.

  17. Le projet du code civil roumain. Est-il moderne, européen, rigoureux?

    Directory of Open Access Journals (Sweden)

    Marilena Uliescu

    2009-06-01

    Full Text Available Depuis plus de quarante ans le monde des juristes roumains est hanté par la modification - au nom de la modernisation - du vieux code civil. Ainsi que nous l'avons déjà dit, en Corse en 2004, à l'occasion du bicentenaire du code Napoléon, celui-ci a connu en Roumanie un transplant réussi. En effet, l'adoption du Code civil roumain en 1865 - copie presque conforme du code civile français - a posé les fondements du droit civil roumain moderne avec ses principes et ses institutions et y a introduit également la terminologie juridique moderne. La conception générale, les principes, les institutions de droit civil mais surtout la rigueur de la terminologie et des règles ont déterminé - malgré certaines fractures, régies par des lois spéciales - sa miraculeuse survie après presque dix lustres de droitsocialiste.

  18. De quelques retours de M. Chat : Historiographie politique dans Le fond de l’air est rouge

    Directory of Open Access Journals (Sweden)

    Jeremy Hamers

    2012-10-01

    Full Text Available Dans son film de montage Le fond de l’air est rouge, Chris Marker compile un ensemble de représentations hétérogènes issues d’une décennie de luttes (ouvrières, étudiantes, indépendantistes, etc. dans le monde. Par l’assemblage de ces images, le cinéaste déploie une historiographie a priori mélancolique et défaitiste. Le présent texte entend dépasser cette interprétation unilatérale de la critique politique des images pour y identifier les traces d’un retour chronique à l’espoir militant.

  19. Le sens de l’observation est-il utile en sociologie ?

    Directory of Open Access Journals (Sweden)

    Jean Peneff

    2011-10-01

    Full Text Available Le sens de l’observation est non seulement utile mais indispensable en sociologie. Cette capacité est d’abord une pratique de la connaissance ordinaire mais elle peut s’affiner et se perfectionner. La sociologie française s’est récemment rapprochée de l’ethnographie et a opéré un renversement en faveur de l’observation, à la lumière des critiques sur la validité et sur le prétendu universalisme des formules classiques. Parmi les quatre grandes méthodologies sociologiques que sont les enquêtes par questionnaire, les interviews, l’étude de documents et l’observation sociologique, les trois premières ont leur histoire et leur inventaire instrumental est bien décrit, mais pas l’observation. Pourtant, en sociologie, plusieurs courants relatifs à l’observation ont cohabité. L’article s’attache à les retracer, à en détailler les conditions et à réhabiliter l’observation directe ou indirecte, spontanée ou préparée, présente ou légèrement rétrospective comme instrument indispensable à qui veut comprendre des univers sociaux éloignés du sien, tous ceux que l’on ne connaît guère intimement par contact direct.Is the sense of observation useful in sociology?The sense of observation is not only useful but it is essential in sociology. This ability is firstly an ordinary knowledge practice, but it can be refined and improved. French sociology got recently closer to ethnography and a change in favor of observation occurred, on the basis of the criticism of the validity and the so-called universalism of the classical formulas. Among the four major sociological methodologies, the survey investigations, the interviews, the document analysis, and the sociological observation, the three first ones have their history, and their tool inventory is properly described, except for observation. Yet, in sociology, several trends related to observation have lived together. This article attempts to retrace them, to

  20. Association entre le travail par quarts et l’obésité chez les hommes dans le nord-est de l’Ontario

    Directory of Open Access Journals (Sweden)

    Anne Grundy

    2017-01-01

    Full Text Available Introduction : Même si certaines études suggèrent une association entre le travail par quarts et l’obésité, peu sont fondées sur la population ou tiennent compte de divers horaires de travail par quarts. L’obésité étant associée à plusieurs problèmes de santé chroniques, il est important de comprendre quelles formes de travail par quarts ont une incidence sur elle et d’effectuer des travaux permettant d’évaluer de façon plus détaillée l’exposition au travail par quarts. Méthodologie : Au moyen d’une régression logistique polytomique multivariée, nous avons étudié l’association entre le travail par quarts (de soir ou nuit, par quarts ou autre type de rotation et le surpoids et l’obésité, en fonction d’une mesure transversale de l’indice de masse corporelle chez 1 561 hommes. Ces hommes avaient déjà servi de témoins dans une étude cas-témoins sur le cancer de la prostate menée dans le nord-est de l’Ontario de 1995 à 1999. Nous avons obtenu l’information sur leurs antécédents de travail (notamment sur le travail par quarts, leur taille et leur poids à partir de données autodéclarées recueillies par questionnaire. Résultats : Nous avons observé une association entre le fait d’avoir déjà travaillé par quarts (par opposition au fait de n’avoir jamais travaillé par quarts et le surpoids (RC [rapport de cotes] = 1,34; IC [intervalle de confiance] à 95 % : 1,05 à 1,73 ainsi que l’obésité (RC = 1,57; IC à 95 % : 1,12 à 2,21. Nous avons également observé des associations statistiquement non significatives avec le fait d’avoir déjà travaillé (par opposition au fait de n’avoir jamais travaillé de façon permanente selon un quart de soir ou de nuit. Nous avons par ailleurs observé une tendance à la hausse statistiquement significative en ce qui concerne le risque de surpoids et d’obésité en fonction de la durée du travail par quarts. Conclusion : Tant l

  1. La guerre contre les drogues illicites : Est-ce qu’elle est perdue ? - Has the war against drugs been lost ? - La guerra contro le droghe è persa ?

    Directory of Open Access Journals (Sweden)

    Dominick M.

    2009-08-01

    Full Text Available Le système légal du Mexique est dans un état de ruine à cause des cartels de la drogue soutenus et subventionnés par les États-Unis d'Amerique. En effet, les États-Unis sont le marché principal de la marijuana, de la cocaine et, en moindre quantité, des drogues synthétiques provénantes du Mexique. L’article met en évidence que les régions frontalières du Mexique sont pris en otage entre d’une part, les principaux producteurs mondiaux de coca et d’autre part, les principaux consommateurs (de l’Amerique du Nord et de l’Europe. Pour cela, l’avis de l’autrice et de son collaborateur est que le Mexique ne peut résoudre seul les problèmes liés au narcotrafique. The Mexican legal system is in a state of ruin because of illegal drug cartels supported, sustained and subsidized by the United States of America. It is the U.S. which is the market for marijuana, cocaine and to a lesser extent synthetic drugs trafficked through Mexico. This article evidences that especially the frontier regions of Mexico have been taken hostage between, on the one hand, the principal world producers of cocaine and, on the other hand, the principal consumers (from North America and from Europe. Accordingly, it is the view of the author and her collaborator that Mexico cannot resolve in isolation the problems involved in narco-trafficking.Il sistema legale messicano versa in uno stato disastroso a causa dei cartelli della droga sostenuti e sovvenzionati dagli Stati Uniti d’America. Infatti, gli USA rappresentano il principale mercato della marijuana, della cocaina e delle droghe sintetiche (queste ultime in misura minore provenienti dal Messico. L’articolo mette in evidenza che le regioni frontaliere del Messico sono prese in ostaggio, da una parte, dai principali produttori modiali di cocaina e, dall’altra, dai principali consumatori (che si trovano nell’America del Nord ed in Europa. Pertanto, secondo l’autrice ed il suo collaboratore

  2. Leishmaniose viscerale et leucemie aigüe lymphoblastique B: quel est le rapport?

    Science.gov (United States)

    El Youssi, Hind; Touaoussa, Aziz; Bergui, Imane; Bougrine, Nawal; Amrani, Moncef Hassani

    2015-01-01

    L'association leishmaniose viscérale et leucémie aigue a été rarement rapportée dans la littérature, cependant le diagnostic concomitant de ces deux entités n'a jamais été rapporté au Maroc. Le lien entre ces deux pathologies n'a pas encore été établi et le traitement n'a pas encore été codifié. Nous rapportons le cas d'un garçon de 12 ans chez qui une leishmaniose viscérale et une leucémie aigue lymphoblastique type B ont été diagnostiquées simultanément. Malgré l'administration d'un traitement antiparasitaire associé à une chimiothérapie l’évolution était marquée par le décès du patient. PMID:26090011

  3. SÉCURITÉ ÉNERGÉTIQUE OUEST-EST: LELE DE LA GRÈCE

    OpenAIRE

    Aristeidis KAVARLIGKOS

    2014-01-01

    La civilisation occidentale fondée et structurée sur la production et la consommation de biens et services a soif d'énergie, afin de soutenir cet édifice. Aujourd'hui, les économies émergentes ont trop pesé sur cette demande, entraînant inévitablement la concurrence dans le domaine de la sécurité énergétique mondiale, ce qui fait des pays producteurs d'hydrocarbure des régulateurs des affaires du monde. Comme un "deus ex machina " les gisements trouvés dans la Méditerranée orientale, la modif...

  4. Danièle Linhart et Aimée Moutet (dir.), Le travail nous est compté. La construction des normes temporelles au travail

    OpenAIRE

    Bouffartigue, Paul

    2009-01-01

    Cet ouvrage mobilise une douzaine d’auteurs et réunit treize études de cas qui constituent autant de terrains d’enquête, par ailleurs diversement situés dans le temps et l’espace : les années 1950-1960 pour ce qui est de deux firmes automobiles en France ; les années 1990-2000 pour les onze autres monographies. Trois établissements sont situés à l’étranger – deux en Russie (roulements à bille, agence bancaire), un en Allemagne orientale (aciérie). Les huit autres secteurs professionnels conce...

  5. Le succès est relatif — Wara Alderete | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    26 janv. 2011 ... L'Argentine tarde à ratifier la Convention-cadre pour la lutte anti-tabac (CCLAT) de l'Organisation mondiale de la santé, qui impose aux gouvernements qui la ratifient de prendre de véritables mesures de lutte contre le tabagisme, dont de nouvelles lois et des mesures relatives aux prix, d'investir dans ...

  6. En Afrique, l'avenir est mobile | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    25 janv. 2011 ... Dans les pays industrialisés, les assistants numériques personnels (ANP) servent souvent à la gestion d'agenda, mais des chercheurs financés par le CRDI démontrent que les ANP sans fil peuvent contribuer à améliorer la prestation des soins en Afrique. « Commençons à considérer les ANP comme des ...

  7. Le concept de « société » n’est plus un absolu.

    OpenAIRE

    Christian Ruby

    2006-01-01

    L’auteur (1925), polonais, est sociologue (Varsovie). Suite à la publication de quelques ouvrages analysant les sociétés contemporaines, dont l’un portait sur Le Coût humain de la mondialisation (Paris, Hachette, 2003, traduction de Globalization : The Human Consequences , Cambridge, Polity Press, 1998), il s’attache ici à deux objets : l’historicisation du concept de société et la formulation de la description pertinente de l’existence sociale contemporaine. Ces deux ...

  8. "Quand voyager mentalement dans le temps est difficile) - Une étude comparative des souvenirs et projections définissant le soi chez des patients dépressifs et des sujets contrôles sains

    OpenAIRE

    Wagener, Aurélie; Thirion, Julie; PITCHOT, William; Blairy, Sylvie

    2016-01-01

    INTRODUCTION. Les patients dépressifs présentent des difficultés à effectuer le voyage mental dans le temps, une des fonctions principales de la mémoire autobiographique, c’est-à-dire à se projeter mentalement dans le passé et le futur. Cette étude s’intéresse à des événements passés et futurs potentiels particuliers qui sont les souvenirs et les projections futures définissant le soi (SDS et PFDS, respectivement). Les SDS et les PFDS sont des événements autobiographiques particuliers hauteme...

  9. Le détritisme carbonate profond dans le Crétacé inférieur du Sud-Est français. Ses rapports avec l'eustatisme

    OpenAIRE

    Ferry , Serge

    1987-01-01

    Mémoire HS n° 13 - Géologie Alpine : Le détritisme dans le Sud-Est de la France - Colloque Association des Géologues du Sud-est - Grenoble 11-12 décembre 1986; 10 cycles eustatiques sont définis dans le Crétacé inférieur du Sud-Est français. Sur les plates-formes carbonatées, ils correspondent aux principales séquences "klupféliennes" de comblement, pour lesquelles le moteur tectonique (à-coups de subsidence) est mis en doute. Ces cycles ne sont repérables dans les séries de bassin que si l'a...

  10. RIEN N’EST FIXE: L’EXPÉRIENCE-NIETZSCHE ET LE QUOTIDIEN ÉDUCATIONNEL

    Directory of Open Access Journals (Sweden)

    Luciano Bedin da Costa

    2011-12-01

    Full Text Available Cet article est une lecture du quotidienne éducationnel par la philosophie de riedrich Nietzsche (1844-1900 avec des concepts tels quels : expérience, nihilisme, ressentiment, mauvaise conscience, force et de la volonté de puissance. La théorie de Nietzsche est utilisé comme un outil de réflexion sur les pratiques quotidiennes vécu dans l'éducation, de rompre avec l'inertie du discours des pleurs et nihiliste. Ce que nous appelons l'expérience de Nietzsche implique un autre regard, une grande santé et une éthique pour une évasion de la cristallisation et production des différences. MOTS-CLÉS : expérience; Nietzsche, nihilisme, formation, volonté de puissance

  11. Le contact forêt-savane dans l'est du Cameroun et Chromolaena odorata : considérations préliminaires

    OpenAIRE

    Achoundong, G.; Bonvallot, Jacques; Happi, Y.

    1996-01-01

    Cette étude préliminaire des contacts forêt-savane porte sur une zone de l'est du Cameroun, au sud de la ville de Bertoua. Sous climat équatorial de transition, la savane de Kandara est caractérisée par une avancée rapide de la forêt sur les formations graminéennes malgré les feux de brousse - souvent tardifs - annuels. Lele passif et actif de #Chromolaena odorata$ est analysé. Dans le contexte général de conquête forestière, cette plante semble accélérer le phénomène. (Résumé d'auteur)...

  12. La redécouverte du droit : le trajet parcouru

    NARCIS (Netherlands)

    Hesseling, G.S.C.M.; Oomen, B.M.

    2005-01-01

    Au Mali, l'année 1991 marque la fin du régime autoritaire de la IIe République et le début d'une ère plus démocratique. En février 1993 est votée la loi-cadre sur la décentralisation. Au moment où, en 2001, les premiers juristes commencent leur aventure de recherche - qui aboutira à l'ouvrage

  13. L'Inde : où est le milieu ? | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    1 avr. 2011 ... Des entrepreneurs futés, favorisés par les réformes économiques opérées au début des années 1990, ont tiré parti des nouveaux débouchés sur les ... À long terme toutefois, M. Mazumdar est d'avis qu'il s'agit d'un encouragement manifeste à privilégier l'expansion horizontale plutôt que verticale. S'il était ...

  14. : tous les projets | Page 254 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'élevage du mouton joue un rôle de premier plan pour ce qui est d'assurer la subsistance des ménages vivant en milieu rural au Mali et dans d'autres pays semi-arides d'Afrique de l'Ouest. Date de début : 1 mars 2011. End Date: 1 août 2014. Région: Mali. Programme: Fonds canadien de recherche sur la sécurité ...

  15. Boom aurifère et dynamiques économiques entre Sénégal, Mali et Guinée

    Directory of Open Access Journals (Sweden)

    Faty B. Mbodj

    2009-03-01

    Full Text Available La conjoncture mondiale et les réformes minières entreprises par des pays comme la Guinée (1995, le Mali (1999 et le Sénégal (2003 ont créé les conditions favorables à l’investissement de multinationales de l’or dans un espace transfrontalier situé entre l’est du Sénégal, l’ouest du Mali et le nord-est de la Guinée. A travers les activités annexes et les investissements directs occasionnés, ces multinationales apparaissent comme un facteur d’intégration nationale et sous régionale de ces zones aurifères jusqu’ici en marge. Toutefois, l’insuffisance de leurs contributions financières, la gestion peu efficace de celles-ci, ainsi que la concurrence directe et indirecte que subissent les économies agricoles soulèvent des interrogations sur l’avenir économique des régions étudiées face aux activités extractives.The mining reforms undertaken by countries like Guinea (1995, Mali (1999 and Senegal (2003 have created favorable conditions for the investment of gold multinationals in a transborder area located between the east of Senegal, the west of Mali and the north-east of Guinea. Through the side activities and direct investments brought about, these firms appear as an opportunity to integrate these marginalized zones within the national and regional economies. However, their financial contributions are insufficient and they provoke direct and indirect competition on local agricultural economies, raising questions on the role of extractive activities for the economic future of the areas studied.

  16. Glasses for Mali

    CERN Multimedia

    PH Department

    2008-01-01

    We are collecting old pairs of glasses to take out to Mali, where they can be re-used by people there. The price for a pair of glasses can often exceed 3 months salary, so they are prohibitively expensive for many people. If you have any old spectacles you can donate, please put them in the special box in the ATLAS secretariat, Bldg.40-4-D01 before the Christmas closure on 19 December so we can take them with us when we leave for Africa at the end of the month. (more details in ATLAS e-news edition of 29 September 2008: http://atlas-service-enews.web.cern.ch/atlas-service-enews/news/news_mali.php) many thanks! Katharine Leney co-driver of the ATLAS car on the Charity Run to Mali

  17. IDRC in Mali

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC has been supporting research in Mali since 1971. Much of this support has centered on sustainable farming practices. Agroforestry, for example, was the focus of research from. 1998 to 2008, involving Université Laval and the World Agroforestry Centre. Researchers demonstrated to Malian farmers that by planting ...

  18. IDRC in Mali

    International Development Research Centre (IDRC) Digital Library (Canada)

    Timbuktu. This telecentre allowed residents, particularly women and youth, to connect with the broader world. This project demonstrated the important role digital technology can play in rural development and served as a model for a series of multimedia centres that. UNESCO set up throughout Mali. C. U. R. T. C. A. R. N.

  19. African Peacekeepers in Mali

    DEFF Research Database (Denmark)

    Haugegaard, Rikke

    Dette fælles DIIS-FAK forskningsprojekt undersøger de interne dynamikker i FN’s stabiliseringsmission i Mali (MINUSMA). Studiet af interoperabilitet i missionen vægtes med fokus på afrikanske styrkers opfattelser og motivation for deltagelse i MINUSMA. De afrikanske styrkers bidrag til FN er et u...

  20. LES VARIANTES LEXICALES POUR LE MOT ESPADRILLES AU PARANÁ ET DANS LA RÉGION NORD-EST DU BRÉSIL: UNE ETUDE ETHNOLINGUISTIQUE

    Directory of Open Access Journals (Sweden)

    Vanderci de Andrade AGUILERA

    2013-12-01

    Full Text Available Cette étude concerne les variantes lexicales pour le mot espadrilles dans l’Etat du Paraná et dans la région Nord-Est du Brésil, sous un regard ethnolinguistique. Le corpus est composé par les donnés obtenues à partir de la question numéro 276 du Questionnaire Semantique-Lexical de l’Atlas Linguistique du Paraná (ALPR, dont l’auteur est le professeur Vanderci de Andrade Aguilera (1994, de l’Université de l’Etat de Londrina, autant que les variantes lexicales pour le mot espadrilles trouvées dans deux ouvrages littéraires d’auteurs originaires du Nord-Est du Brésil – Fogo Morto, de José Lins do Rego (2009 et Vidas Secas, de Graciliano Ramos (1969. Dans ces livres, les espadrilles jouent un rôle fondamental, tout en reflétant son importance dans le vestiaire de cette région, du moins jusqu’à moitié du XXème siècle. On rechercha des éventuelles ressemblances ou différences existentes entre les variantes lexicales de la chaussure mentionnée par les informateurs “paranaenses” et le modèle cité dans les ouvrages des écrivains Rego et Ramos. Dans les deuxs sources – la linguistique et la littéraire – on privilégia l’analyse semantique des unités lexicales et le contexte dans lequel elles ont été enregistrées. L’étude démontra que l’unité lexicale espadrilles et ses variantes phonétiques similaires dans les deux corpora, aussi que les variantes lexicales populaires présentes dans l’Atlas Linguistique du Paraná (ALPR. En dépit des simitudes l’esthétique et la fonction des espadrilles ne sont pas les mêmes dans les localitées concernées.

  1. L'aiguillat commun (Squalus acanthias) dans le nord-est du Pacifique et histoire de son utilisation

    National Research Council Canada - National Science Library

    Ketchen, K. S

    1986-01-01

    ... présent rapport passe en revue la taxonomie, la distribution, les migrations, la définition des stocks et le cycle vital de l'aiguillat commun dans le contexte d'un compte rendu de son utilisation à travers les...

  2. Lele de la sphère publique en réseau pour ce qui est de favoriser ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Una Hakika : Porter à grande échelle les solutions numériques pour la gestion des conflits au Kenya et en Birmanie. L'information erronée, qu'elle soit le fruit de rumeurs ou d'une désinformation intentionnelle, peut alimenter le conflit et exercer de profondes répercussions sur la paix, la... Voir davantageUna Hakika : Porter ...

  3. Sorghum and rice: Mali

    International Nuclear Information System (INIS)

    2003-01-01

    Agriculture is the mainstay of the Malian economy and yet cereal imports absorb 6.5% of GDP. Food self-sufficiency is therefore a national priority. The Joint FAO/IAEA Division is supporting a programme to improve local varieties of sorghum and rice by using nuclear techniques to develop new cultivars that will produce higher yields under Mali's semi-arid climatic conditions. (IAEA)

  4. Chimioprophylaxie du paludisme pendant la grossesse : évaluation de l'observance à Sikasso (Mali) par la méthode de Saker-Solomons

    OpenAIRE

    Arnold, Mireille

    2004-01-01

    Dans les régions endémiques, le paludisme contribue au développement d'une anémie sévère chez la femme enceinte et au faible poids de naissance de l'enfant. Dans ce contexte, une prophylaxie hebdomadaire de chloroquine est préconisée pour toutes les femmes enceintes au Mali. Une enquête transversale sur un échantillon représentatif de la population de femmes enceintes suivies aux consultations prénatales de Sikasso a permis d'évaluer l'observance de la chimioprophylaxie par questionnaire et r...

  5. Chimioprophylaxie du paludisme pendant la grossesse: évaluation de l'observance à Sikasso (Mali) par la méthode de Saker-Solomons

    OpenAIRE

    Arnold, Mireille; Rougemont, André

    2004-01-01

    Dans les régions endémiques, le paludisme contribue au développement d'une anémie sévère chez la femme enceinte et au faible poids de naissance de l'enfant. Dans ce contexte, une prophylaxie hebdomadaire de chloroquine est préconisée pour toutes les femmes enceintes au Mali. Une enquête transversale sur un échantillon représentatif de la population de femmes enceintes suivies aux consultations prénatales de Sikasso a permis d'évaluer l'observance de la chimioprophylaxie par questionnaire et r...

  6. le de la société civile pour ce qui est d'influencer les politiques de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    le de la société civile pour ce qui est d'influencer les politiques de santé publique en faveur des femmes autochtones du Mexique. Au Mexique, les iniquités relatives à l'accès aux services de santé et aux services connexes sont sensiblement plus marquées chez les populations autochtones, et en particulier chez les ...

  7. Stéréotyper le Féminin: entre le Doxique et l’Esthétique (Estereotipar o Feminino: entre o Dóxico e o Estético)

    OpenAIRE

    Maingueneau, Dominique; UNIVERSITÉ PARIS XII - VAL-DE-MARNE – PARIS/FRANCE

    2007-01-01

    RÉSUMÉ Cet article cherche à montrer que l’attitude masculine à l’égard des stéréotypes sur les femmes peut correspondre à deux manières de “gérer” l’énigme que représente pour l’homme la différence sexuelle: un régime doxique, celui de l’ “Homme Ordinaire”, et un régime esthétique, celui de “l’Artiste”. Le premier régime trouve à se manifester dans les proverbes, par exemple, dont la visée essentielle est de définir un ordre dans lequel le féminin se voit assigner “sa” place. Il est illustré...

  8. Activité physique, indice de masse corporelle, masse graisseuse par impédance: lequel de ces facteurs est le plus associé au risque cardiovasculaire pour nos patients?

    OpenAIRE

    SPRENG, L.

    2015-01-01

    Contexte: Les maladies cardiovasculaires représentent la première cause de mortalité en Suisse et dans le reste du monde depuis des années. Pourtant, elles sont le plus souvent causées par des facteurs de risque évitables et modifiables comme le tabac, l'inactivité physique, le surpoids, le stress, etc. Un dépistage est recommandé dès l'âge de 40 ans et chaque 5 ans chez toutes personnes asymptomatiques afin de pouvoir traiter au plus vite l'apparition d'un nouveau facteur de risqu...

  9. Agroforesterie et alimentation des moutons au Mali | CRDI - Centre ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Review of pasture and fodder production and productivity for small ruminants in the Sahel. 53216. Rapports. Accroître la sécurité alimentaire en associant étroitement élevage, arbres et cultures par la pratique de l'agroforesterie au Mali : rapport technique final (1er mars 2011 - 1er septembre 2014). Téléchargez le PDF.

  10. « Mon pays, c’est mes enfants et mes petits-enfants » : exils et transcendance dans Le Bonheur a la queue glissante d’Abla Farhoud

    Directory of Open Access Journals (Sweden)

    Kelly Anne Maddox

    2010-05-01

    Full Text Available L’identitaire dans ce premier roman de Farhoud est inextricablement liée à l’exil, que ce soit l’exil physique, ou bien, l’exil intérieur. D’une part, l’exil physique se manifeste par la migration, d’abord lorsque le personnage principal, Dounia, quitte son village pour vivre dans celui de son mari, et ensuite lorsqu’elle émigre au Canada. D’autre part, l’exil intérieur provient de la subordination imposée par la culture patriarcale. Nous comptons examiner ces deux formes d’exil, ainsi que les conséquences qui en résultent, telles que la marginalisation, la dépossession linguistique, et le refoulement identitaire. Nous discuterons également des tentatives qu’entreprend Dounia de transcender sa marginalisation en établissant des relations interpersonnelles.

  11. Quel est lele des environnements audio-graphiques synchrones dans les interactions d’un cours de langue en ligne?

    Directory of Open Access Journals (Sweden)

    Chahrazed Mirza

    2010-01-01

    Full Text Available L’enseignement-apprentissage du français langue étrangère par communication synchrone multipoint en ligne se pose comme une pratique d’avenir pour l’apprenant à distance. Nourri de dix ans d’expérience de ces environnements, cet article porte un regard critique sur cette pratique en examinant le rapport entre socioconstructivisme, scénarios communicatifs, technologie et appropriation de la langue dans deux formations spécifiques. Selon les théories socioculturelles dont disent s’inspirer les concepteurs de formation dans leur choix d’outils et de scénarios, la mise en place de scénarios communicatifs et leur réalisation active par les apprenants constituent les moteurs de l’apprentissage. Néanmoins, comment ce principe s’actualise-t-il dans la pratique? Pour répondre à cette question, nous étudierons la mise en œuvre de scénarios socioconstructivistes dans deux plateformes audio-synchrones différentes. De cette étude, nous conclurons que la nature du rapport scénario/outil/usagers (et usages influe sur le processus d’appropriation de la langue. Nos conclusions nous permettront aussi d’ouvrir des pistes vers une recherche sur la transférabilité des pratiques d’une technologie à une autre.

  12. Ophiostomales (Ascomycètes) associées à Ips acuminatus Gyll (Coleoptera : Scolytidae) sur le pin sylvestre (Pinus sylvestris L.) dans le sud-est de la France et comparaison avec Ips sexdentatus Boern

    OpenAIRE

    Lieutier, François; Garcia, J.; Yart, Annie; Vouland, G.; Pettinetti, M.; Morelet, M.

    1991-01-01

    Les Ophiostomatales associées à lps acuminatus ont été isolées des insectes, de leurs galeries et de l’aubier des pins sylvestres attaqués, dans le Sud-Est de la France (département du Var), pendant l’épidémie de 1987 et 1988. Des isolements ont aussi été réalisés dans la même région en 1987 sur des populations endémiques d’Ips sexdentatus, et dans 2 autres régions (l’Orléanais (1988) et le Mont Ventoux (1989)) sur des populations endémiques d’I acuminatus. Les vitesses de croissance des ...

  13. Achieving Peace in Northern Mali: Past Agreements, Local Conflicts, and the Prospects for a Durable Settlement

    Science.gov (United States)

    2015-01-01

    2006 pour le changement ) AFISMA African-Led International Support Mission in Mali AQIM al Qaeda in the Islamic Maghreb ARLA Revolutionary...Alliance démocratique du 23 mai 2006 pour le changement ). MNLA = Mouvement national de libération de l’Azawad. HCUA = Haut conseil pour l’unité de l’Azawad...Security Management in Northern Mali: Criminal Networks and Con- flict Resolution Mechanisms, Brighton, UK: Institute of Development Studies, Research

  14. Pourquoi le « Disque Blanc » des Beatles est-il Blanc ?

    Directory of Open Access Journals (Sweden)

    Bernard Gensane

    2006-02-01

    Full Text Available Dans « Strawberry Fields Forever » (février 1967, John Lennon prévient, dans une perspective postmoderne, que la représentation artistique est impossible car « nothing is real ». Au même moment, Paul McCartney propose, avec « Penny Lane » (février 1967, une des plus troublantes définitions de ce qu’est la représentation artistique : « And though she feels as if she’s in a play / She is anyway ». Que se passe-t-il, en effet, lorsque l’art est sciemment accepté comme un faux-semblant à la foi...

  15. Le

    NARCIS (Netherlands)

    de Beer, P.T.; Luttikhuizen, R.; Barbier, J.C.; Gautii, J.

    1998-01-01

    Interventions ` visie ` la fois iconomique et sociale, les politiques publiques de l'emploi (PPE) de chaque pays trouvent leur logique dans une relation itroite avec chacun des systhmes nationaux de protection sociale. La premihre partie de cet ouvrage est consacrie ` la prisentation de cas

  16. « Depuis quand le requin est un mammifère ?!?!?! » La pragmaticalisation de la séquence interrogative depuis quand

    Directory of Open Access Journals (Sweden)

    Hernández Patricia

    2016-01-01

    Full Text Available Ce travail aborde les emplois non temporels de la séquence interrogative depuis quand dans des énoncés du type « Depuis quand le requin est un mammifère ?!?!?! », emplois expressifs fréquents en contextes dialogiques. Sans étude particulière dans la littérature, de tels cas peuvent être caractérisés, dans le cadre d’une approche cognitive, comme étant pragmaticalisés (Dostie 2004 i.e. laissant transparaître la subjectivité du locuteur (Traugott 2010. Depuis quand devient ainsi un marqueur discursif (Traugott, Dasher 2004, Dostie, Pusch 2007 autant dans des structures phrastiques (« Depuis quand l’opinion personnelle d’un obscur politicien est-elle vérité ? » que comme mot-phrase (« Le verbe peinturer existe ? Depuis quand ? ». Sur la base d’une grammaire émergeant du discours (Hopper 1987, nous décrivons l’emploi de cette formule à partir de l’analyse d’un corpus d’énoncés relevés sur des sites internet recueillant l’opinion des internautes. Dans ces emplois, nettement subjectifs, depuis quand joue lele d’un marqueur de discordance, cette notion se prêtant, en discours, à des modulations contextuelles. Ce sont ces variations qui nous permettront de proposer une première typologie des emplois subjectivisés de depuis quand en tant que marqueur de discordance : (i manifestation de l’étonnement (« Depuis quand doit-on prouver son innocence ? », (ii expression de la désapprobation (« Depuis quand faut-il manifester sa liberté d’expression en critiquant ceux qui vous ont soutenu et promu ? », (iii mise en scène de l’incongru (« Depuis quand les morts consomment-ils de l’eau ? ». Notre analyse prend en compte, également, des aspects caractéristiques de tels emplois à savoir les questions rhétoriques et l’ironie. Une attention particulière est accordée à des emplois tels que « Depuis quand un procureur s’appelle lui-même comme témoin ? », analysés en termes

  17. Impact des plateformes multifonctionnelles sur l’activité économique des femmes et l’éducation des enfants au Mali

    OpenAIRE

    Catherine ARAUJO BONJEAN; Moussa KEITA; Martine AUDIBERT

    2015-01-01

    Initié au Mali dans les années 1990 avec le soutien du PNUD, le programme plateformes multifonctionnelles (PTFM) vise à lutter contre la pauvreté en développant l’offre énergétique en milieu rural. L’énergie fournie par un moteur diesel sert essentiellement à transformer les produits agricoles, activité traditionnellement réservée aux femmes. L’objectif de ce travail est d’évaluer l’impact des PTFM sur l’activité économique des femmes et l’éducation des enfants à l’aide de méthodes quasi-expé...

  18. Le chantier médiéval dans le Sud-Est de la France: regard sur les techniques de construction et l’organisation du chantier à partir de quelques exemples (XIe-XIVe siècles

    Directory of Open Access Journals (Sweden)

    Esquieu, Yves

    2005-12-01

    Full Text Available The present article illustrates several aspects of the archaeological research on mediaeval construction in south-eastern France (11th-14th cent. by studies in building archaeology led by the authors in various architectural and scientific contexts. It focuses on questions such as the know-how and its transfer, changes in the architectural project, the organization of the building process and its techniques and strategies, by analyzing the masonry and structure of the edifice and, in the case of the pope’s palace in Avignon, by combined research on the architecture and the written sources.Le présent article illustre différents aspects de la recherche sur la construction du XIe au XIVe siècle dans le Sud-Est de la France à l’exemple d’études monumentales menées par ses deux auteurs dans différents contextes architecturaux et scientifiques. Il aborde les questions du savoir-faire et de sa transmission, des changements de projet, et l’organisation du chantier, à partir des indices de la lecture des élévations et, dans le cas de la construction du palais des papes d’Avignon, de l’étude conjointe des sources écrites.

  19. Quelle sorte d'être est le soi? Les implications ontologiques d'une herméneutique du soi

    Directory of Open Access Journals (Sweden)

    Marc-Antoine Vallée

    2010-12-01

    Full Text Available Cet article vise à dégager les implications ontologiques du projet Ricoeurien d’une herméneutique du soi tel que formulé dans Soi-même comme un autre. L’auteur retrace d’abord la double approche de Ricoeur proposant de penser l’attestation du soi suivant la notion aristotélicienne de l’être-vrai et l’homme capable selon les catégories de l’acte et de la puissance. Soulignant le caractère fragmentaire et insuffisant des analyses de Ricoeur, il explore ensuite une troisième façon de nommer l’être du soi selon la catégorie de la relation, développant ainsi l’idée d’une “ontologie de la relation” sous-jacente à cette herméneutique du soi. This article aims to make explicit the ontological implications of the Ricœurian project of a hermeneutics of self as formulated in Oneself as Another. The author first redraws Ricœur’s double approach proposing to think the attestation of the self following the Aristotelian notion of being-true and the capable man following the categories of actuality and potentiality. Underlining the fragmentary nature and the incompleteness of Ricœur’s analysis, he then explores a third way to speak about the being of the self following the category of relation, thus developing the idea of an underlying “ontology of the relation” implied by this hermeneutics of the self.  

  20. La bibliothèque du CERN | Pauline Gagnon présente : « Qu'est-ce que le boson de Higgs mange en hiver et autres détails essentiels » | 24 mars

    CERN Multimedia

    2015-01-01

    Mardi 24 mars 2015 à 16h00 à la bibliothèque du CERN (bât. 52-1-052) * Le café sera servi à partir de 15h30 *   Juillet 2012 : le CERN, le Laboratoire européen de la physique des particules, annonçait en grande pompe la découverte du boson de Higgs. La nouvelle a fait le tour du monde. Mais combien de gens comprennent vraiment ce que c'est et pourquoi cette découverte fut suivie du prix Nobel de physique en 2013 pour les théoriciens François Englert et Peter Higgs, qui en avaient prédit l'existence 48 ans auparavant ?  Le boson de Higgs était le chaînon manquant du modèle théorique actuel qui décrit ce qui compose toute la matière qu'on voit autour de nous. Ce livre explique comment tout cela fonctionne et lele du boson de Higgs. Et le livre va be...

  1. Le Conseil du CERN s'est réuni à Genève (Suisse); Josef Rembser élu comme président du Conseil; le Prix Nobel Carlo Rubbia nommé prochain Directeur Général (1989-1993); La Commission Abragam présente son rapport

    CERN Multimedia

    CERN Press Office. Geneva

    1987-01-01

    Le Conseil du CERN s'est réuni à Genève (Suisse); Josef Rembser élu comme président du Conseil; le Prix Nobel Carlo Rubbia nommé prochain Directeur Général (1989-1993); La Commission Abragam présente son rapport

  2. Il est beau le lavabo, il est laid le bidet

    DEFF Research Database (Denmark)

    Nølke, Henning

    1998-01-01

    Artiklen analyserer dislokering af subjektet på fransk. Der skelnes mellem tre hovedtyper: venstredislokering med og uden intonationsbrud og højre dislokering. I alle tilfælde indeholder sætningskernen principielt en pronominel kopi af subjektet. Det påvises, at de tre typer svarer til tre forske...

  3. Efficient transformation and expression of gfp gene in Valsa mali var. mali.

    Science.gov (United States)

    Chen, Liang; Sun, Gengwu; Wu, Shujing; Liu, Huixiang; Wang, Hongkai

    2015-01-01

    Valsa mali var. mali, the causal agent of valsa canker of apple, causes great loss of apple production in apple producing regions. The pathogenic mechanism of the pathogen has not been studied extensively, thus a suitable gene marker for pathogenic invasion analysis and a random insertion of T-DNA for mutants are desirable. In this paper, we reported the construction of a binary vector pKO1-HPH containing a positive selective gene hygromycin phosphotransferase (hph), a reporter gene gfp conferring green fluorescent protein, and an efficient protocol for V. mali var. mali transformation mediated by Agrobacterium tumefaciens. A transformation efficiency up to about 75 transformants per 10(5) conidia was achieved when co-cultivation of V. mali var. mali and A. tumefaciens for 48 h in A. tumefaciens inductive medium agar plates. The insertions of hph gene and gfp gene into V. mali var. mali genome verified by polymerase chain reaction and southern blot analysis showed that 10 randomly-selected transformants exhibited a single, unique hybridization pattern. This is the first report of A. tumefaciens-mediated transformation of V. mali var mali carrying a 'reporter' gfp gene that stably and efficiently expressed in the transformed V. mali var. mali species.

  4. Eesti tahab suurendada osalust Mali missioonil

    Index Scriptorium Estoniae

    2013-01-01

    Kaitseministeerium saatis valitsusele otsuse eelnõu, millega Eesti saadab Euroopa Liidu Mali väljaõppemissioonile kuni kümneliikmelise väljaõppemeeskonna staabiohvitseridest, kelle ülesanne on osaleda Mali üksuste väljaõppe planeermises ja nõustamises. Eelnõu annab kaitseväele võimaluse saata Malisse ka instruktorite grupp, kelel ülesanne on õpetada välja Mali valitsuse relvajõud

  5. Prévention de la transmission mère-enfant du VIH/sida au Bénin: le consentement des femmes au dépistage est-il libre et éclairé ?

    Science.gov (United States)

    Kêdoté, N.M.; Brousselle, A.; Champagne, F.; Laudy, D.

    2016-01-01

    Résumé Introduction Dans les politiques internationales et nationales sur le VIH/sida, le consentement libre et éclairé est reconnu comme une composante essentielle des programmes de dépistage. Le consentement libre et éclairé implique pour les femmes enceintes d’obtenir des informations sur le programme de prévention de la transmission du VIH de la mère à l’enfant (PTME), de les comprendre et de faire un choix autonome après avoir évalué les risques et avantages. Cependant, aucune évaluation du programme de PTME ne s’est intéressée au consentement. L’objectif de cet article est d’explorer le caractère libre et éclairé du consentement des femmes enceintes quant au dépistage et à leurs motivations à faire le test. Méthode Nous avons utilisé des données récoltées dans le cadre d’une analyse d’implantation du programme de PTME au Bénin. Cette analyse s’appuie sur un devis d’étude de cas multiples incluant six maternités choisies parmi les 56 sites fonctionnels. Spécifiquement pour l’analyse du consentement, nous avons associé les données provenant d’une enquête à celles d’une recherche qualitative. Résultats Hormis trois cas de dépistage à l’insu, le caractère volontaire du consentement au test est respecté sur les sites de PTME. Vingt-neuf cas de refus ont été identifiés. Les raisons les plus souvent évoquées par les femmes enceintes sont la peur du résultat positif et de ses conséquences sur la vie familiale dans 55,2 % des cas et l’attente de l’accord ou du désaccord du mari dans 27,6 % des cas. Si globalement le consentement a été volontaire sur tous les sites, son caractère éclairé est moins probant. PMID:27840660

  6. Vents d’Est, vents d’Ouest : L'introduction de l'esprit des Lumières dans le Vietnam au début du XXe siècle

    OpenAIRE

    Phuong Ngoc, Nguyen

    2015-01-01

    International audience; À partir du milieu du XIXe siècle, le royaume Dai Nam des Nguyen passe progressivement sous l'autorité française : après l'attaque du port de Tourane (actuellement Đà Nẵng) en 1858, Saigon est prise en 1859, le sud du pays devient une colonie française sous l'appellation de Cochinchine à partir de 1862 et le reste du pays, divisé en Tonkin et Annam, entre définitivement en 1884 dans l’empire sous le régime du protectorat. La langue française étant la langue de l'admini...

  7. Twitter a­-t­-il bousculé le droit parlementaire ? : Le jour où le #directAN s'est invité dans l'hémicycle

    OpenAIRE

    Chibois , Jonathan

    2014-01-01

    International audience; En février 2013, lors de l'examen à l'Assemblée nationale du projet de loi sur l'ouverture du mariage aux couples de même sexe, l'agitation est telle sur Twitter que, au quatrième jour de délibération, la séance publique dans l'hémicycle est levée pour quelques minutes. À plusieurs reprises ensuite, fréquentes sont les allusions à des échanges de tweets entre députés, jugés inappropriés, pour lesquels sera demandée, sans succès, une régulation du président de séance. L...

  8. The Sign Language Situation in Mali

    Science.gov (United States)

    Nyst, Victoria

    2015-01-01

    This article gives a first overview of the sign language situation in Mali and its capital, Bamako, located in the West African Sahel. Mali is a highly multilingual country with a significant incidence of deafness, for which meningitis appears to be the main cause, coupled with limited access to adequate health care. In comparison to neighboring…

  9. Triatominae et Cactaceae : un risque pour la transmission de la Trypanosomose américaine dans le péridomicile (nord-est du Brésil

    Directory of Open Access Journals (Sweden)

    Emperaire L.

    2006-06-01

    Full Text Available Les observations de terrain réalisées dans le nord-est du Brésil ont montré la fréquente association, dans l’espace péridomiciliaire, entre un cactus, le Cereus jamacaru, la présence de nids dans ses branches et celle de Rhodnius neglectus et de Triatoma pseudomaculata, espèces vectrices du parasite Trypanosoma cruzi, agent de la maladie de Chagas. L’analyse des variables architecturales de cette Cactaceae montre que la présence de nids, et donc d’insectes, est inféodée aux pratiques traditionnelles de gestion de ce cactus. Cette étude souligne l’intérêt d’une approche intégrée de l’écologie des Triatominae pour l’identification des variables indicatrices de risque.

  10. Mali president kaotaks surmanuhtluse / Allan Espenberg

    Index Scriptorium Estoniae

    Espenberg, Allan

    2007-01-01

    Mali president Amadou Tourmani Toure pöördus riigi iseseisvuse väljakuulutamise 47. aastapäeva puhul rahva poole läkitusega, kus teatas surmanuhtluse likvideerimise seaduseelnõu parlamenti saatmisest. Presidendi säärane initsiatiiv pole aga meeltmööda Mali moslemivaimulikele. Praeguseks on Amnesty Internationali andmetel umbes pooled maailma riikidest surmanuhtluse tühistanud

  11. Eesti saadab Mali missioonile kaks staabiohvitseri

    Index Scriptorium Estoniae

    2013-01-01

    Välisminister Urmas Paet ütles eile, et valitsus andis oma toetuse missioonile Malis, kus on viimastel nädalatel ägenenud islamistlike mässuliste rünnakud. Missioon pole sõjaline, vaid selle eesmärgiks on treening ja õpetus Mali enda sõjaväele. Eesti saadab missioonile ilmselt ühe või kaks staabiohvitseri

  12. Nonhealing Ulcer: Acroangiodermatitis of Mali

    Directory of Open Access Journals (Sweden)

    Neeraj Varyani

    2011-01-01

    Full Text Available An 18-year-old male presented with a nonhealing wound on left lower limb, pain and swelling over multiple joints, weight loss, and yellowish discoloration of eyes and urine for the past 4 years. On examination, the patient had pallor, icterus, and generalized lymphadenopathy with a nonhealing unhealthy ulcer over left medial malleolus. He had deformed joints with hepatomegaly and splenomegaly. His laboratory investigations were positive for antinuclear antibody (ANA and anticardiolipin antibody (ACLA. Synovial fluid analysis showed inflammatory findings. Biopsy of margin of the ulcer showed findings consistent with Acroangiodermatitis of Mali. The patient was treated with disease-modifying antirheumatic drugs (DMARDs and aspirin for juvenile idiopathic arthritis and secondary antiphospholipid antibody syndrome (APS, respectively. The ulcer was managed conservatively with systemic antibiotics and topical steroids along with limb elevation and compression elastic stockings. The patient's symptoms improved significantly, and he is in our followup.

  13. Associations islamiques et démocratie participative au Mali

    OpenAIRE

    Jonckers, Danielle

    2011-01-01

    La liberté d'expression et d'association s'exerce avec vitalité au Mali depuis l'insurrection de 1991 qui a mis fin à la dictature, instauré une démocratie parlementaire décentralisée et adopté une constitution conférant le droit à la désobéissance civile et réaffirmant la laïcité. Les citoyens interpellent les politiques, investissent l'espace public, s'expriment dans les médias et les radios libres, organisent des manifestations et des forums sociaux d'envergure internationale. Ils s'organi...

  14. Sud du Sahara | Page 246 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... des Caraïbes et du Pacifique - phase III. Langue French. Read more about Women, Migration and Rights in Mali and Sénégal. Langue English. Read more about Femmes, migration et droits au Mali et au Sénégal. Langue French. Read more about Modèle d'édition et autre modèle d'octroi de licences (PALM Africa).

  15. Le virus de l'enroulement des feuilles du cerisier, largement repandu en France sur noyer, est-il a l'origine de l'incompatibilite de greffage du noyer Juglans regia sur Juglans nigra

    OpenAIRE

    Delbos, R.; Bonnet, A.; Dunez, Jean

    1984-01-01

    Sur les 2 millions de noyers exploités en France, la moitié environ est cultivée en verger : 20 p. 100 des arbres du verger français de noyer sont greffés sur Juglans nigra, le reste étant greffé sur J. regia. Des symptômes de nécrose de la zone de greffe sont signalés assez couramment sur les arbres greffés sur J. nigra, surtout depuis quelques années ; ces symptômes sont tout à fait semblables à ceux décrits aux U.S.A. dans le cas d’arbres greffés sur J. hindsii ou « Paradox » (J. hinds...

  16. Etendue des prestations de l'assurance-maladie sociale : le catalogue des prestations est- il suffisant pour que tous accèdent à des soins de qualité ?

    OpenAIRE

    Polikowski, Marc; Lauffer, Régine; Renard, Delphine; Santos-Eggimann, Brigitte

    2000-01-01

    Le projet "prestations de l'assurance-maladie sociale" est l'un des projets partiels élaborés par l'Office fédéral des assurances sociales (OFAS) dans le cadre de l'analyse des effets de la LAMal. Deux approches complémentaires sont adoptées pour répondre à la question du caractère suffisant du "catalogue" suisse des prestations à charge de l'assurance-maladie sociale: d'une part, la comparaison des "catalogues" des prestations remboursées en Suisse et à l'étranger et, d'autre part, l'examen ...

  17. Sédimentation et diagenèse des minéraux argileux du Jurassique supérieur-Crétacé dans le Jura méridional et le domaine subalpin (France, Sud-Est). Comparaison avec le domaine Atlantique Nord

    OpenAIRE

    Deconinck , Jean-François

    1984-01-01

    Le but de cette thèse est de décrire et d'expliquer l'évolution des assemblages argileux dans les Alpes occidentales depuis l'Oxfordien jusqu'au Crétacé supérieur, et de la comparer à celle connue dans l'Atlantique nord grâce aux forages DSDP. Etude géologique, sédimentologique et géochimique. Les assemblages argileux du Mésozolque supérieur (Malm - Crétacé) du domaine subalpin et du Jura mérldional sont étudiés par diffraction des rayons X, microscopie électronique à transmission et analyses...

  18. L'utilité de la télémédecine au Mali | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    30 avr. 2013 ... Cette mise en relation avec des pairs en milieu urbain a énormément atténué le sentiment d'isolement qu'éprouvaient les médecins exerçant dans le Mali rural. Un réseau international. Par son succès et sa croissance, le réseau a commencé à attirer l'attention de pays voisins. Avec l'aide des Hôpitaux ...

  19. Effet du biotope sur la diversité floristique et le polymorphisme phénotypique des groupements à Tamarix africana Poir. dans les zones arides de la région de Khenchela (Est Algerien

    Directory of Open Access Journals (Sweden)

    Khabtane Abdelhamid

    2012-12-01

    Full Text Available RESUME Le genre Tamarix (Tamaricaceae regroupe plus de 80 espèces, parmi eux le Tamarix africana Poir. qui représente une très grande ubiquité en Algérie, soit du point de vue climatique (humidité et sécheresse, édaphique (sols salés et calcaires; où il représente l’espèce  à caractère typique des plantes thermo xérophytes. Pour contribuer à la connaissance de cette espèce et de son comportement nous avons essayé de suivre le comportement  phytosociologique ainsi que sa variabilité morphologique (l’hauteur, le recouvrement basale, nombre des ramifications à la base.. dans trois biotopes, extrêmement différents du point de vue climatique et édaphique,  dans les zones steppiques arides de la région de Khenchela (Est Algérien et qui sont  choisis  selon un transect Nord - Sud. Les résultats révèlent que les groupements à Tamarix africana Poir. représentent une richesse floristique importante, qui se diffère d’un site à l’autre, avec un polymorphisme phénotypique adaptée aux conditions spécifiques à chacun des trois sites et qui lui permet d’être l’espèce à forme arbustive  la plus adaptée pour la réhabilitation des écosystèmes dégradés dans les zones de transitions Désert-NordMots clés Tamarix africana P. - ubiquité- thermo xérophytes-  régions arides- halophytes- polymorphisme phénotypique

  20. Publications | Page 225 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La présente étude vise à contribuer à la gestion durable des ressources en eau dans le Zou, en adaptant un modèle hydrologique régional aux processus hydrologiques et au transport de sédiments dans le bassin versant du Klou, qui tient compte du climat, du couvert végétal et des pratiques socio-... Mali : revue de la ...

  1. Friction and Inequality among Peacekeepers in Mali

    DEFF Research Database (Denmark)

    Cold-Ravnkilde, Signe Marie; Albrecht, Peter; Haugegaard, Rikke

    2017-01-01

    The United Nations Multidimensional Integrated Stabilization Mission in Mali (MINUSMA) was established in 2013 to support Mali’s peace process. It represents an emerging practice of deploying UN peacekeeping missions in asymmetrical conflict environments where there is no peace to keep. While MIN...

  2. Securing the dangerous UN convoys in Mali

    DEFF Research Database (Denmark)

    Haugegaard, Rikke; Albrecht, Peter; Ravnkilde, Signe Cold

    2017-01-01

    It has proven particularly challenging for the UN stabilization mission in Mali (MINUSMA) to transport fuel, food and water to military camps in Sector North on the frontline of the mission. Convoy escorts drain the UN mission of resources and is one of its most dangerous tasks, mainly carried out...

  3. Le cinéma est-il bachelardien? hypothèse théoriques autour de la matière (et des images

    Directory of Open Access Journals (Sweden)

    Éric Thouvenel

    2012-10-01

    Full Text Available Either in his epistemological or "poetic" writings, Gaston Bachelard has almost never referred to the cinema – of which he was contemporary –, unlike other artistic practices, more valued, such as painting or engraving. Where, exceptionally, he mentions the device that produces moving images, this is called as a foil or a negative model, also like his theoretical "opponent" Henri Bergson. This text offers from this "missed encounter" between Bachelard and films to re-examine the relation of the philosopher with the material, either in the books on the four elements and in the epistemological works like Le matérialisme rationnel and Les intuitions atomistiques. Indeed, cinema is an ambiguous art: deeply material in its main relationship with the real and, at the same time, secured by its mode of production (recording and presentification (projection of the images, an immaterial dimension that is now accelerating. By his constant attention to the tangible presence of things, to the qualities of material, to the fundamental relationship between the eye and the hand in a perspective even more phenomenological, Bachelard's thinking help to think the material dimension of motion pictures, often underestimated or simply removed. Conversely, the cinema has been accustomed us to original forms of perception (the blur, the fade, the overprinting, the slow or accelerated motion, which can explain certain aspect of philosopher’s thinking, which have been very few convened.

  4. Pobreza, desigualdad y modelos de bienestar en los países de la UE-15. ¿Cómo le está afectando la crisis?

    OpenAIRE

    López Páramo, Ricardo

    2016-01-01

    Traballo Fin de Grao en Administración e Dirección de Empresas El objetivo fundamental de este trabajo es analizar la pobreza y desigualdad en la Unión Europea, clasificando a los países por modelos del bienestar y comparando la situación actual con la existente en 2009, año en que se inició la crisis económica en la que todavía nos encontramos. Esto nos permitirá conocer qué situación presenta cada país en términos de pobreza y desigualdad, tanto al inicio de la crisis como en la actualid...

  5. Vaincre le vampire violet | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Est depuis le début des années 1990 lorsque le Centre de recherches pour le développement international, une société d'État canadienne, l'a invité à se pencher sur le problème de la striga en Afrique subsaharienne.

  6. Vienne 1780-Paris 1793 ou Le plus révolutionnaire des deux musées n’est peut-être pas celui auquel on pense d’abord...

    OpenAIRE

    Pommier, Édouard

    2011-01-01

    L’ouverture, en 1783, du musée impérial de Vienne, au palais du Belvédère, qui avait été la résidence du prince Eugène, est un événement important dans l’histoire des musées. En effet, Christian von Mechel, qui avait été chargé par Joseph II de l’organiser, adopte pour la première fois et de manière systématique le parti d’une présentation des tableaux de la collection des Habsbourg par « écoles » et, en principe, à l’intérieur des écoles, suivant une progression chronologique. Ce système, ad...

  7. The right to energy is a social, economical and environmental emergency; Le droit a l'energie est une urgence sociale, economique et environnementale

    Energy Technology Data Exchange (ETDEWEB)

    Coulon, Pierre-Jean

    2010-09-15

    2 billion people on the planet do not have access to energy. This energy deficiency has an impact on health, infant mortality, life expectancy, education, and women's emancipation and it slows development. Following the Copenhagen summit, in a financial crisis context that heavily impacted the world economies, energy issues demand real political commitment, because solutions exist. They include awareness-building, responsibility and commitment of society, because a better accessibility for the populations can't be achieve without the beneficiaries. [French] 2 milliards d'individus n'ont pas acces a l'energie sur la planete. Impact sur la sante, sur la mortalite infantile, sur l'esperance de vie, sur l'education, sur l'emancipation des femmes a cette situation de carence energetique est un frein au developpement. Au lendemain du Sommet de Copenhague, dans un contexte de crise financiere qui a impacte lourdement l'economie mondiale, les questions energetiques necessites une reelle volonte politique, car des solutions existent. Celles-ci passent notamment par la sensibilisation, la responsabilisation et l'implication de la societe civile, car permettre une meilleure accessibilite des populations ne peut pas se faire sans les beneficiaires eux-memes.

  8. La gouvernance de la sécurité au Mali : entre libéralisation et/ou ...

    African Journals Online (AJOL)

    Il sera question d'identifier, de décrire et d'analyser les stratégies esquissées en vue du renforcement des mécanismes de contrôle social et public d'édiction de la sécurité dans les États en crise ou en phase de sortie de crise grave, tel le Mali. Après avoir examiné les transformations/mutations de la gouvernance de la ...

  9. Contribution méthodologique pour la connaissance du rôle des acteurs locaux dans la réalisation d’un projet de territoire : le cas du projet de la réserve naturelle de Réghaia dans la zone côtière Est de l’Algérois

    Directory of Open Access Journals (Sweden)

    Mohamed Larid

    2010-12-01

    Full Text Available Dans le domaine de la gestion territoriale, on peut constater le manque et l’insuffisance des outils d’analyse des stratégies des acteurs. Ceci est encore plus ressenti dans les sociétés du monde en développement, où les mécanismes de gestion et d’administration du territoire sont souvent dysfonctionnels. Une meilleure connaissance des relations entre les intervenants dans l’application d’un projet territorial, permet des éclairages sur le contexte de sa réalisation et des orientations suceptibles d’avantager sa réussite. Les repères sur les logiques de comportement aident à cerner les enjeux et à poser les questions clés, pour atteindre les objectifs fixés et conforter l’accomplissement des actions arrêtées. Le présent article rend compte des résultats d’une expérience de terrain, réalisée dans une zone côtière humide de la région algéroise. Il propose une contribution, sur le plan méthodologique, pour la collecte d’informations pertinentes sur le comportement et les possibilités des acteurs dans la réalisation d’un projet local, orienté vers la valorisation et la protection d’un patrimoine naturel important.In the field of territorially management, we can see the insufficiency of analysis tools on the strategies of actors. This is even more crucial in case of the developing world, where the management and territorially administration are often dysfunctional. Better knowledge of the roles of stakeholders in the implementation of a territorial project, provides insights of the context of its implementation and guidance likely to favor its success. The logical behavior help to identify issues and key questions, to achieve the objectives and ensure the completion of actions agreed. This article reports the results of a field experiment conducted in a coastal wetland in the region of Algiers. It offers a contribution, on the methodology for collecting information on the behavior and capabilities of

  10. Medicinal plants from Mali: Chemistry and biology.

    Science.gov (United States)

    Wangensteen, Helle; Diallo, Drissa; Paulsen, Berit Smestad

    2015-12-24

    Mali is one of the countries in West Africa where the health system rely the most on traditional medicine. The healers are mainly using medicinal plants for their treatments. The studies performed being the basis for this review is of importance as they will contribute to sustaining the traditional knowledge. They contribute to evaluate and improve locally produced herbal remedies, and the review gives also an overview of the plant preparations that will have the most potential to be evaluated for new Improved Traditional Medicines. The aim of this review is to give an overview of the studies performed related to medicinal plants from Mali in the period 1995-2015. These studies include ethnopharmacology, chemistry and biological studies of the plants that were chosen based on our interviews with the healers in different regions of Mali, and contribute to sustainable knowledge on the medicinal plants. The Department of Traditional Medicine, Bamako, Mali, is responsible for registering the knowledge of the traditional healers on their use of medicinal plants and also identifying compounds in the plants responsible for the bioactivities claimed. The studies reported aimed at getting information from the healers on the use of medicinal plants, and study the biology and chemistry of selected plants for the purpose of verifying the traditional use of the plants. These studies should form the basis for necessary knowledge for the development of registered Improved Traditional Medicines in Mali. The healers were the ethnopharmacological informants. Questions asked initially were related to wound healing. This was because the immune system is involved when wounds are healed, and additionally the immune system is involved in the majority of the illnesses common in Mali. Based on the results of the interviews the plant material for studies was selected. Studies were performed on the plant parts the healers were using when treating their patients. Conventional chromatographic

  11. Publications | Page 196 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Gestion et valorisation des déchets d'équipements électroniques et informatiques en Afrique de l'Ouest (cas du Bénin, du Mali et du Sénégal) : rapport sur le cas du Bénin, 2007-2010 (restricted access) ...

  12. Gestion de l'eau en milieu aride : considérations physiques et sociales pour l'identification des territoires pertinents dans le Sud-Est tunisien

    Directory of Open Access Journals (Sweden)

    Bruno Romagny

    2006-02-01

    Full Text Available La situation actuelle des ressources en eau et de leurs usages dans le Sud-Est tunisien présente des enjeux qui sont communs à de nombreuses régions du bassin méditerranéen : des ressources limitées et déjà largement exploitées pour répondre à la croissance des besoins, le recours accru aux ressources dites non conventionnelles, une situation de concurrence entre usages sectoriels, une marchandisation croissante des ressources, et des conditions climatiques contraignantes qui viennent renforcer les tensions autour de l'eau. Dans le contexte des mutations en cours, face aux risques de déficits en eau et à la nécessité d'un développement économique et social équilibré, ces caractéristiques, parmi d'autres, font de la Jeffara tunisienne un cas d'étude exemplaire des difficultés que pose la gestion intégrée de l'eau. Celle-ci doit prendre en compte les différentes sources d'approvisionnement ainsi que les différents usages associés, et donc l'identification des territoires pertinents pour cette  gestion, compte tenu des relations amont-aval naturelles et artificielles d'une part, et des cohérences institutionnelles et sociales d'autre part.The current situation of the water resources and their uses in South-Eastern Tunisia presents stakes which are common to many areas of the Mediterranean basin : limited and already largely exploited resources to address the growth of the needs, the increasing use of so-called non conventional resources, a competition between sectoral uses of water, an increasing merchandising of the resources, and constraining climatic conditions which reinforce the tensions around water. In the context of the changes in progress, facing the hazard of water deficits and with the need for a balanced economic and social development, these characteristics, among others, make Tunisian Jeffara be an exemplary case of study of the difficulties raised by the integrated water resources management. This one

  13. Friction on the Frontline - African Soldiers in Mali

    DEFF Research Database (Denmark)

    Haugegaard, Rikke

    This conference abstract is a presentation of some of the findings from fieldwork conducted in Mali in june 2016, together with Signe Cold-Ravnkilde and Peter Albrecht from DIIS. The abstract highlights some of the frictions in the UN mission MINUSMA in Mali, especially perceptions, leadership...

  14. Malaria prevention practices in mopti region, Mali | Rhee | East ...

    African Journals Online (AJOL)

    Objectives: To assess insecticide-treated nets (ITNs) use, other malaria prevention measures, knowledge of malaria and diffusion of information about ITNs by the National Malaria Control Programme (NMCP) in Mali. Design: A descriptive cross-sectional study. Setting: Four villages in Mopti region, Mali that had participated ...

  15. A role for telemedicine in Mali | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    From the Swiss Alps to remote Mali. Bagayoko looked outside Mali to find someone with experience in telemedicine. He contacted Dr Antoine Geissbuhler, at the University of Geneva, to ask him to be on his thesis committee. Geissbuhler agreed, based on a shared interest in medical imaging, e-health, and new medical ...

  16. Cytology of infection of apple leaves by Diplocarpon mali

    Science.gov (United States)

    Diplocarpon mali, the causal agent of Marssonina leaf blotch of apple, causes severe defoliation during the growing season. Little information is available on the mode of infection and infection process. In this study, the infection strategies of D. mali in apple leaves were investigated using fluor...

  17. Cotton Production in Mali: Subsidies or Sustainable Development?

    Science.gov (United States)

    Moore, Lindsey

    2007-01-01

    Current trade rules concerning cotton subsidies are intricately linked with poverty and hunger in Mali. Over half of Mali's economy and over 30 million people depend directly on cotton. It is the main cash crop and the most important source of export revenue. Cotton also plays a key role in development policies and in the fight against poverty by…

  18. Mali, um Estado sub-representativo de sua sociedade

    Directory of Open Access Journals (Sweden)

    Emiliano Unzer Macedo

    2013-04-01

      This article examines the conditions for the actual crisis in Mali. The historic misrepresentation of northern regions in the government of Mali may elucidate the causes of the civil crisis that may be not sufficiently explained only in terms of strategy for mineral resources or spread of Islamic extremism in the country.

  19. Qui est Méduse?

    Directory of Open Access Journals (Sweden)

    Julia Kristeva

    2015-04-01

    Full Text Available Une belle histoire de têtes coupées traverse l'Antiquité grecque : celle des Gorgones, trois monstres ailés au corps de femme et à la chevelure de serpents, dont le regard changeait en pierre celui qui se risquait à les contempler – Méduse, Euryalé et Sthéno. Pour commencer, Méduse est une jeune fille qui se fait remarquer : séduite puis violée par Poséidon, elle se révèle fertile puisqu'elle accouche de faux jumeaux, le cheval Pégase et le géant Chrysaor. Une longue fable la transforme en terrible puissance. Pour simplifier, disons que le monstre est par deux fois tué : Persée assassine d'abord Méduse pour assurer la protection de sa mère, Danaé, importunée par le roi Polydectès. Ensuite, il délivre Andromède des liens méduséens qui la retiennent et, pour ce faire, tranche la tête de la Gorgone. La mer se teinte de sang, tandis que le vainqueur tient à l'écart l'épouvantail de Méduse, de peur que ne soient changés en statues de pierre ceux qui s'exposeraient à sa vue.

  20. « Le Paradis, c’est les autres ». Isolat relationnel et expérience du paradis : une entrée par le tourisme “Heaven is other people”. Relational isolation and experience of Heaven in tourism

    Directory of Open Access Journals (Sweden)

    Rachid Amirou

    2008-10-01

    Full Text Available L’engouement pour des sites ou des lieux est souvent dû à des « Nous » (des communautés éphémères, qui se constituent et qui consacrent ainsi l’espace de visite. La consécration collective est souvent un préalable au succès de certaines destinations (Ibiza, Saint-Tropez, Marrakech, etc.. Le succès des formules de villages de vacances hermétiquement fermés à l’extérieur et indifférents au pays de séjour atteste de l’existence d’un état d’esprit qu’on a classé sous le terme générique de « bulle touristique ». Cependant, la constitution de ces « bulles » – c’est-à-dire la rencontre d’un imaginaire, d’un « nous » et d’un espace touristiques – ne se fait pas uniquement par l’exclusion de l’autre. Elle repose aussi sur un principe interne positif : le rêve d’une sociabilité parfaite, une sorte de paradis relationnel. Le « paradis » touristique, c’est d’abord une rencontre de plain-pied avec les autres (« l’ambiance », souvent d’ailleurs avec les mêmes – rencontre synonyme de relations différentes et moins stressantes, basées sur une connivence réelle ou fantasmée. La généalogie de ce paradis touristique relationnel, qui peut être aussi un enfer pour les autres, reste à décrire et à expliciter, en montrant comment il compose le noyau central de l’imaginaire touristique.The appeal of sites or places often stems from the existence of "Us" entities (short-lived communities, which come together and thus consecrate the visited space. Collective consecration is often a prerequisite to the success of some destinations (Ibiza, Saint-Tropez, Marrakech, etc. The success of vacation villages hermetically closed to the outside world and indifferent to the surrounding country is testimony to the existence of a state of mind that has been classed within the generic term "tourist bubble". However, the constitution of such "bubbles" - that is to say, the meeting

  1. The European Union Training Mission in Mali: A case study

    Directory of Open Access Journals (Sweden)

    Dicke Rachel

    2014-10-01

    Full Text Available For several years, the European Union (EU has been increasing its international presence and moving into the role of a global security actor. To support the goal of greater crisis management capabilities, European security integration (ESI has been deepening. This article therefore examines an Ell operation - the European Union Training Mission in Mali (EUTM Mali - with the aim of gauging the success of the EU's efforts at ESI. To determine the success of EUTM Mali and thus of ESI, three propositions are examined: if EUTM Mali is a security operation showing successful security integration, there will be evidence of (i broad participation, (ii financial burden-sharing and (iii the successful incorporation of troops and equipment. The first and third propositions are supported whereas the second does not receive as much support. Overall, EUTM Mali shows considerable success and bodes well for further ESI.

  2. Le lait local en périphérie de Bamako : une filière en sursis ?

    Directory of Open Access Journals (Sweden)

    Sophie Molina d’Aranda de Darrax

    2009-03-01

    Full Text Available 95 % de la consommation de lait de la population bamakoise est assurée par les importations. Pourtant, le Mali est l’un des pays d’Afrique de l’Ouest disposant du cheptel laitier le plus conséquent. L’objet de cette étude est d’interroger les pratiques de production laitière en périphérie de Bamako et leurs déterminants, afin de comprendre pour quelles raisons la production laitière et la part de lait local dans la consommation de la ville n’augmentent pas malgré la demande urbaine croissante, et d’envisager des solutions pour y remédier. Pour ce faire, nous analyserons les paramètres physiques, territoriaux et techniques qui entravent la production laitière en périphérie de Bamako et conditionnent la quantité de lait local disponible, sur la base d’études de terrain et d’interviews d’acteurs réalisées entre février et mai 2008.95% of Bamako’s dairy products consumption is ensured through milk powder importations, while Mali is one of the most important dairy cattle countries in West Africa. This study aims at analyzing milk production practices and determining elements to understand why milk production around Bamako doesn’t raise despite that consumption is growing fast, and propose solutions to improve that situation. In order to answer that question, we’ll study physical, geographical and technical aspects of milk production around Bamako through interviews and field work realized between February and May, 2008.

  3. ’Itinéraires de la faim’ des migrants subsahariens expulsés d’Algérie au Mali Organizing survival among sub-Saharan migrants expelled from Algeria to Mali

    Directory of Open Access Journals (Sweden)

    Clara Lecadet

    2010-12-01

    Full Text Available En Algérie, l’expulsion des migrants d’origine subsaharienne vers la frontière Nord du Mali est devenue depuis le début des années 2000 un processus régulier. Rationnement alimentaire drastique dans les prisons algériennes, angoisse vitale dans les ghettos organisés en micro-communautés nationales aux abords de la frontière, leitmotiv de l’aide d’urgence : la faim constitue une caractéristique majeure de l’expérience vécue par les expulsés. Elle est à la fois une violence intime, une donnée politique, un motif d’intervention humanitaire. On parlera ainsi d’itinéraires de la faim pour appréhender le processus de l’expulsion et les parcours erratiques de l’après-expulsion : ils sont ici envisagés à la fois du point de vue du dispositif étatique algérien qui en porte la responsabilité et des contre-dispositifs précaires mis en œuvre par les expulsés pour survivre. Les expulsés auto-organisés, les associations d’expulsés, l’intervention ponctuelle des ONG, tentent en effet de faire face aux expulsions par des formes de regroupement, d’accueil et de restauration atypiques dans un contexte d’abandon et de dénuement radical.Since the beginning of the century the expulsion of sub-Saharan migrants from Algeria to the Northern Malian border has become a regular event. Hunger is the main aspect of expelled migrant life, caused by poor rations in Algerian jails, daily fear in the ghettos organized into national micro-communities on the border and the limited supply of emergency aid. Hunger is simultaneously a primal suffering, a political issue and an argument for humanitarian aid. We describe the process of expulsion and the erratic journey of migrants after deportation as itineraries of hunger. These itineraries are considered from two points of view; the state processes involved in these collective deportations and the precarious strategies invented by expelled migrants to survive. A combination

  4. Le sud-est européen et l'Europe: Origines et perspectives d'une altérité mal assumée en marge de l'élargissement européen

    Directory of Open Access Journals (Sweden)

    Bojović Boško

    2004-01-01

    Full Text Available (francuski Depuis l'Antiquité l'histoire de la Péninsule balkanique est jalonnée d'alternances entre clivages culturels ou politiques et synthèses de civilisation: Grèce, Rome, Byzance, Empire ottoman. Ce qui a créé une superposition de nuances et de différenciations ethniques et nationales selon les lignes de partage confessionnelles et culturelles, idéologiques et politiques. La rémanence de ces lignes de partage, issues en partie du Moyen Age, et qui ne cessent de se démultiplier depuis le XIXe siècle, fait que les Balkans oscillent de nos jours entre adhésion aux processus d'intégration euro-atlantiques et processus de désintégrations successives sur la base des singularisassions communautaires et de pulsions identitaires. Menace majeure de la stabilité européenne au XIXe siècle connue à l'époque sous la dénomination de "Question d'Orient", la crise balkanique est depuis la fin du XXe siècle une zone d'ombre sur la toile d'intégration européenne. Les redoutables difficultés à gérer cette crise désormais redevenue chronique, font que les Balkans, indépendamment ou non de toutes autres contradictions euro-atlantiques, apparaissent comme un espace crucial au sein duquel la future Grande Europe joue tout ou partie de son avenir.

  5. Et semester i Mali og Ghana

    DEFF Research Database (Denmark)

    Eskemose Andersen, Jørgen; Andreasen, Jørgen

    2007-01-01

    Et semesterkursus afholdes hvert andet år i Afrika med en gruppe studerende fra Kunstakademiets Arkitektskole. Kurset knytter sig til den forskning, som gennem flere år er udført af ansatte ved Department of Human Settlements (DHS). Kurset prioriterer udforskningens metoder og dialog med lokale b...... beboere og myndigheder. Kursets pædagogiske sigte er at konfrontere deltagerne med deres faglige felt i en radikalt anderledes kultur. Kurset indledes en måned i Mali med en indføring i metoder. Hovedstudiet er i Ghana med et ophold på 2½ måned i byen Kumasi....

  6. Activities Report 2007 PATTEC-Mali

    International Nuclear Information System (INIS)

    2007-01-01

    This annual report is a summary of main activities undertaken in 2007 under the Pan African Tsetse and Trypanosomiasis project. It results from the initiative of African governments in 2000 to eradicate tsetse flies and trypanosomiasis from infested areas in the African continent in order to mitigate poverty and improve food security in six countries (Ethiopia, Uganda, Kenya, Mali, Burkina, Ghana). . areas An integrated approach of combating tsetse is used, from simples techniques such as trapping nets impregnate with insecticides and skin treatment of animals for suppression, and sterile insect technique for eradicating of the residual population of glossina.Methods and basic socio-epidemiological conducted in the field are presented

  7. Hermon est

    OpenAIRE

    Aliquot, Julien

    2012-01-01

    105. Deir el-Aachaiyer Architecture : Krencker & Zschietzschmann 1938, p. 256-264, 292-293, pl. 110-115 et 118, 27 (état des lieux en 1905, compléments en 1933) ; Dentzer-Feydy 1999, p. 531-532 et 551 (notes et dessins de W.J. Bankes) ; Chéhab 1949-1950, p. 111 (tête tourelée de Tyché). Photos : Taylor 1971, p. 86-89 ; Blas de Roblès, Pieri & Yon 2004, p. 179-180 ; Nordiguian 2005, p. 104-105. Site revu. Épigraphie : IGLS 11, 4 (dédicace). Le village moderne de Deir el-Aachaiyer (1250 m d’alt...

  8. Evaluation of the child oral health promotion 'MaliMali' Programme based on schools in the Kingdom of Tonga.

    Science.gov (United States)

    Takeuchi, Reiri; Kawamura, Kohji; Kawamura, Sayuri; Endoh, Mami; Uchida, Chizuru; Taguchi, Chieko; Nomoto, Takato; Hiratsuka, Koichi; Fifita, Sisilia; Fakakovikaetau, Amanaki; Kobayashi, Seigo

    2017-08-01

    The South Pacific Medical Team (SPMT) has supported oral health care for Tongan juveniles since 1998. This voluntary activity, named the MaliMali ('smile' in Tongan) Programme, is evaluated in detail in this paper. This evaluation was guided by the Reach, Effectiveness, Adoption, Implementation, Maintenance (RE-AIM) framework. The objectives were to explore: (i) whether the programme was accessible to Tongan schoolchildren (Reach); (ii) the impact of the programme on decayed, missing and filled teeth (DMFT) scores and toothbrushing habits (Effectiveness); (iii) factors that affected the adoption of the programme (Adoption); (iv) whether implementation was consistent with the programme model (Implementation); and (v) the long-term sustainability of the programme (Maintenance). The MaliMali Programme has grown into an international project, has spread countrywide as a uniform health promotion and is reaching children in need. Following implementation of this programme, the oral health of Tongan juveniles has improved, with a decrease in the mean DMFT index and an increase in toothbrushing. To provide training that will allow Tongans to assume responsibility for the MaliMali Programme in the future, dental health education literature was prepared and workshops on oral hygiene and the MaliMali Programme were held frequently. At present, the programme is predominantly managed by Tongan staff, rather than by Japanese staff. This evaluation found the MaliMali Programme to be feasible and acceptable to children and schools in the Kingdom of Tonga. The programme promotes oral health and provides accessible and improved oral health care in the school setting, consistent with the oral health-promoting school framework. © 2016 FDI World Dental Federation.

  9. Le Sanskrit

    CERN Document Server

    Balbir, Nalini

    2013-01-01

    Cet ouvrage est destiné à tous ceux qui souhaitent se mettre ou se remettre à l'étude du sanskrit et ne peuvent y consacrer que quelques minutes par jour. En suivant le principe de la méthode quotidienne Assimil, vous acquerrez progressivement le vocabulaire et la grammaire de base qui sont nécessaires à la lecture des textes de la littérature sanskrite classique. Vous trouverez dans cette méthode une approche vivante de la langue et de la culture sanskrite classique à travers des textes d'abord adaptés pour le débutant puis authentiques. En quelques mois, vous manierez la langue sans efforts ni hésitation, de manière très naturelle. Les enregistrements reprennent l'intégralité des textes en sanskrit des leçons et des exercices de traduction du livre. Ils sont interprétés, à un rythme progressif, par des locuteurs natifs professionnels.

  10. L'analyse des semences d'arachide fermières pour le contrôle de ...

    African Journals Online (AJOL)

    Le manque de semences sélectionnées en qualité satisfaisante et en quantités suffisantes est une contrainte majeure à la production de l'arachide (Arachis hypogea L.) en Afrique centrale. La multiplication de semences en milieu paysan est le moyen de propagation le plus rapide, le moins cher et le plus durable.

  11. Discordance gradient-surface dans le rétrécissement mitral: le gradient moyen transmitral est-il un critère de sévérité ou un indice de tolérance du rétrécissement mitral serré?

    Science.gov (United States)

    Najih, Hayat; Arous, Salim; Laarje, Aziza; Baghdadi, Dalila; Benouna, Mohamed Ghali; Azzouzi, Leila; Habbal, Rachida

    2016-01-01

    Le rétrécissement mitral (RM) rhumatismal demeure une valvulopathie fréquente dans les pays en voie de développement. Cependant, les pays industrialisés ont vu l'émergence ces dernières années de nouvelles étiologies de RM; notamment l'origine médicamenteuse et/ou toxique responsable de valvulopathies restrictives aussi bien sténosantes que régurgitantes. Pour cette raison, l'évaluation échocardiographique du RM et surtout, la définition de critères objectifs pour conclure au caractère serré du RM reste toujours d'actualité. Les objectifs du travail sont: évaluer l'existence ou non d'une corrélation directe entre le gradient moyen transmitral (GMT) et la sévérité du RM chez les patients porteurs d'un RM serré ou très serré (critère primaire) et analyser les différents paramètres qui conditionnent le gradient moyen transmitral (GMT) (Critère secondaire). Il s'agit d'une étude transversale monocentrique incluant tous les patients admis au service de Cardiologie du CHU Ibn Rochd de Casablanca pour un RM serré ou très serré, sur une période d'une année (Janvier 2014 à Décembre 2014). Nous avons analysés séparément deux groupes de patients : ceux avec un gradient moyen transmitral10mmHg (groupe2). 50 patients porteurs d'un RM serré ou très serré ont été inclus. L'âge moyen de nos patients est de 41,7 ans avec prédominance féminine (sex ratio: 0,25). 64% de nos patients avaient un RM serré et 36% avaient un RM très serré. 52% (26 patients) avaient un GMT 10mmHg, ce qui suggère l'absence de corrélation directe entre la sévérité du RM et le GMT (coefficient de Pearson R: -0,137). Pour la dyspnée, 80% des patients du groupe 1 étaient dyspnéiques stade II de la NYHA et 70% des patients du groupe 2 étaient dyspnéiques stade III (41%) ou IV (29%) de la NYHA, ce qui signifie l'existence d'une corrélation significative entre le GMT et la sévérité de la dyspnée (R: 0,586 et p: 0,001). L'étude analytique de la fr

  12. Peuplement et organisation du territoire dans une région d'implantation ibâḍite : le Jebel Demmer dans le sud-est de l'Ifrîqiya (ve/xie- ixe/xve siècle

    Directory of Open Access Journals (Sweden)

    Mohamed Hassen

    2012-12-01

    Full Text Available Cet article s’intéresse aux formes de peuplement et d’organisation du territoire dans le Jebel Demmer à l’époque médiévale, lorsque cette région du sud de l’Ifrîqiya comportait encore une importante population ibadite, elle-même scindée en plusieurs groupes. Après avoir évoqué la délimitation du territoire à l’époque médiévale, l’article propose une réflexion sur l’apparition et la typologie des qsûr. Leur développement en tant qu’unités fondamentales dans l’organisation de l’espace local est rattaché aux invasions hilaliennes, qui provoquèrent un afflux important de populations ibâḍites dans cette région, qui devint pour quelque temps l’un des bastions de cette minorité en Ifrîqiyya. Enfin, la diffusion du malékisme est évoquée, faisant ressortir la lenteur de ce processus, encore inachevé au début du xve siècle.

  13. Le paludisme au Mexique

    International Development Research Centre (IDRC) Digital Library (Canada)

    Nancy Minogue

    Le paludisme est depuis longtemps un important problème de santé publique au Mexique, où les conditions qui prévalent ... C'est dans les régions côtières que le problème a persisté le plus longtemps, les mesures ... recherche sur l'écologie des moustiques a permis d'en découvrir les raisons. « Les moustiques ne se ...

  14. Publications | Page 95 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI et la lutte contre le paludisme. DOCUMENT D'INFORMATION. Le paludisme tue un enfant africain toutes les 30 secondes. Avec le VIH/sida et la tuberculose, le paludisme est l'un des principaux problèmes de santé publique menaçant le.

  15. Enjeux fonciers et développement "durable" au Mali

    OpenAIRE

    Chene-Sanogo, Alima

    2012-01-01

    Making the land issue a total economic phenomenon and capital the driving force of development equates to giving free rein to the commodification of the land. Is it really necessary for Mali to sell off its agricultural land and its land resources to access development? For what development? Does development demand that family-run small farming operations and age-old, traditional land management methods be sacrificed? Ever since the country attained national sovereignty in 1960, Mali ‒ a poor...

  16. Mali and Islamic Extremism: Applying Lessons Learned from Afghanistan

    Science.gov (United States)

    2016-11-21

    punishments without 114 Mali and Islamic Extremism MCU Journal trial, the overall population had a greater sense of security and law and order with...Mali; how- ever, a recent UN Human Rights Council report indicates alarming rates of arbitrary arrests and prisoner abuse by the Malian armed forces...bad actors in the area to believe they will benefit somehow by taking an American hostage, either through ransom or a prisoner exchange.95 It is

  17. Networking in the Desert - Operational and Analytical Challenges for MINUSMA in Mali

    DEFF Research Database (Denmark)

    Haugegaard, Rikke

    This paper will initiate a discussion of the operational and analytical challenges in understanding network dynamics in Mali, and how these dynamics can be seen as one source of conflict in Mali. The paper is based on a field visit to Mali in 2014.......This paper will initiate a discussion of the operational and analytical challenges in understanding network dynamics in Mali, and how these dynamics can be seen as one source of conflict in Mali. The paper is based on a field visit to Mali in 2014....

  18. Le laboratoire, le temple et le marché

    International Development Research Centre (IDRC) Digital Library (Canada)

    Chapra est conseiller économique auprès de l'Agence monétaire d'Arabie Saoudite. Il a beaucoup écrit sur l'économie et la finance en pays islamique, et son ouvrage le plus important est Towards a Just Monetary System: A Discussion of Money, Banking, and Monetary Policy in the Light of Islamic Teachings (1985).

  19. Reflexion sur le climat, l'effet de serre et le rechauffement global ...

    African Journals Online (AJOL)

    Le climat de la Terre est largement influencé par l'état de son atmosphère. Le rayonnement solaire jouerait un rôle primordial dans la climatologie terrestre certes, néanmoins, il n'est plus en mesure à lui tout seul d'expliquer le climat qui prédomine, en moyenne, à la surface de la terre. L'effet de serre serait le phénomène ...

  20. Le développement durable est-il bienvenu dans les organisations ? Cas de l’implantation d’un Système de Management Environnemental en Tunisie

    Directory of Open Access Journals (Sweden)

    Moez Ben Yedder

    2009-02-01

    Full Text Available Les entreprises sociétalement responsables sont celles qui s’inscrivent dans une logique de développement durable. Leur engagement se matérialise, notamment, par le déploiement de systèmes de gestion respectueux de l’environnement tels que les systèmes de management environnemental (SME. En plus de leur portée écologique, ces derniers ont une visée sociale puisqu’ils permettent d’améliorer les conditions de travail des opérateurs. Toutefois, leur mise en place peut être gênée par ces derniers s’ils ne retrouvent pas leurs intérêts lors de l’instauration d’un tel système. L’objectif de ce texte est d’étayer cette idée à partir de l’étude de cas d’une entreprise tunisienne où l’instauration d’un SME n’a pu aboutir en partie à cause de la résistance du personnel. Dans ce sens, nous appuierons l’idée selon laquelle les pratiques du Développement Durable et de la Responsabilité Sociale de l’Entreprise ne se greffent pas ex abrupto sur une entreprise mais nécessitent certains préalables d’ordre organisationnel pour être mis en place.Socially responsible firms are the ones which act in accordance to sustainable development logic. Their engagement is materialised by deploying environment friendly practices such as environmental management system (EMS. Those systems have also a social purpose in the way that they allow enhancing work conditions of operators. However, their setting could be embarrassed by those ones because of the change of habits that it implies for them. The purpose of this study is to shore up this idea by resorting to a case study of a Tunisian firm in which the setting of the environmental management system turned failed in part because of the resistance of the personnel. We will defend the idea that practices of sustainable development and corporate social responsibilities couldn’t be correctly adopted by firms without taking into consideration to some organizational

  1. le des acteurs dans le processus de conservation et de valorisation du patrimoine local du village berbère de Chenini (Sud-est Tunisien), analyse des jeux d'acteurs par la méthode MACTOR

    OpenAIRE

    Khattali, H.; Sghaier, M.; Sandron, Frédéric

    2016-01-01

    Le village de Chenini dispose d'un potentiel patrimonial d'une richesse exceptionnelle. Aujourd'hui, plusieurs menaces inquiétantes ont été identifiées dans le village risquent d'endommager la valeur culturelle et le développement local durable. Le présent travail a pour objectif de mettre en exergue l'importance du patrimoine local existant et d'analyser l'implication des acteurs dans le processus de sa conservation et de sa valorisation. L'approche méthodologique repose sur l'analyse de jeu...

  2. TYPOLOGIE DE LA PÊCHE SUR LE LAC FAÉ (CÔTE D’IVOIRE ET IMPLICATIONS POUR UNE GESTION RATIONNELLE DES RESSOURCES HALIEUTIQUES

    Directory of Open Access Journals (Sweden)

    DA COSTA K. S.

    2007-01-01

    Full Text Available Cette étude réalisée en septembre 1996 dans le cadre du Projet d’Étude Participative AISA/IDESSA a permis de faire l’historique des activités halieutiques et la typologie de la pêche sur le lac Faé. La pêche dans ce réservoir est artisanale et de type individuel. Démarrée en 1980 avec l’implantation des pêcheurs étrangers originaires du Mali, cette activité est pratiquée par deux types d’acteurs : les professionnels (étrangers et les occasionnels (Bakwés. Les engins de pêche sont ceux classiquement utilisés dans les pêcheries continentales de Côte d’Ivoire : filets maillants, mono et multifilaments, nasses (grillagées, en filets ou en bambou et pièges en bambous de Chine. La densité des pêcheurs artisans sur le lac Faé est de 6,4 pêcheurs/km2, soit trois fois supérieure à la norme optimale de 2 pêcheurs/km2 admise par la législation ivoirienne Par conséquent, des mesures de gestion devraient être prises par la Direction de la Production Halieutique (DPH pour contrôler le flux migratoire des pêcheurs vers cette retenue, afin d’infléchir la densité observée. Le maintien ou l’accroissement de celle-ci pourrait engendrer une surexploitation rapide des stocks, et constituer une source potentielle de conflits entre étrangers et autochtones. A cet effet, des recommandations pour une pratique durable de la pêche sur cette retenue sont proposées.

  3. Epidémiologie de la Péripneumonie Contagieuse bovine(PPCB) dans les régions du Delta Central du Mali : évaluation des performances de deux tests de diagnostic pour analyser la dynamique de transmission et développement d'outils d'aide à la décision pour la surveillance et le contrôle

    OpenAIRE

    Sidibé, Cheick Abou Kounta

    2012-01-01

    Deux tests sérologiques (test de fixation de complément (CFT) et l'ELISA de compétition (cELISA)) sont recommandés par l'OIE et utilisés couramment au Laboratoire Central Vétérinaire de Bamako parfois en parallèle dans le diagnostic et le dépistage de la péripneumonie contagieuse bovine (PPCB). La performance de ces tests a été estimée différemment par plusieurs auteurs dans des contextes épidémiologiques différents à partir de méthodes statistiques standards avec un statut sanitaire réel des...

  4. Rebelión y sharía en el Sahel: una aproximación al estallido de la rebelión tuareg y la ocupación del norte de Mali por grupos yihadistas e islamistas armados

    Directory of Open Access Journals (Sweden)

    David Nievas

    2014-01-01

    Full Text Available Mali ha sufrido en 2012 y 2013 uno de los periodos de crisis más graves que se recuerdan en su historia contemporánea. Este trabajo pretende aportar elementos para comprender los principales actores que han protagonizado el levantamiento tuareg en el norte de Mali y la posterior ocupación por parte de grupos yihadistas e islamistas durante cerca de 10 meses.

  5. Networking in the Desert - Operational and Analytical Challenges for MINUSMA in Mali

    DEFF Research Database (Denmark)

    Haugegaard, Rikke

    This paper will initiate a discussion of the operational and analytical challenges in understanding network dynamics in Mali, and how these dynamics can be seen as one source of conflict in Mali. The paper is based on a field visit to Mali in 2014....

  6. Le financement de l'éducation dans les collectivités locales, quels ...

    African Journals Online (AJOL)

    Le financement de l'éducation dans les collectivités locales, quels défis ? Marie Elisabeth Dembélé. Abstract. This article aims to analyse the support provided by the state to local collectivities in Mali, to target the expenditure categories included in the funding and observe their appropriation by the beneficiaries of education ...

  7. Le Grand Inquisiteur : Âme et corpsQu’est-ce qu’une conversion sans adhésion de l’âme ?

    Directory of Open Access Journals (Sweden)

    Caroline Julliot

    2012-02-01

    Full Text Available Cet article vise à replacer dans le contexte philosophique et métaphysique général du romantisme la forme particulière de conversion figurée à travers le personnage du Grand Inquisiteur - en montrant en quoi elle se constitue en rupture totale avec la vérité historique.This article aims to replace in the general philosophical and metaphysical context of the romanticism the particular shape of conversion represented through the character of the Great inquisitor - by showing in what it is constituted in total break with the historical truth.

  8. Archéologie des monastères du premier millénaire dans le Centre-Est de la France. Conditions d’implantation et de diffusion, topographie historique et organisation

    Directory of Open Access Journals (Sweden)

    Sébastien Bully

    2009-12-01

    Full Text Available Lorsqu’en 1997 le Conseil national de la recherche archéologique publiait le bilan 1990-1994 de la recherche en France et sa nouvelle programmation, figurait parmi les thèmes prioritaires : « Les origines et les fonctions des premiers bâtiments monastiques : églises et organisation des bâtiments communautaires, relations entre architecture et règle monastique » . Il était alors rappelé que l’on ne savait rien des fondations colombaniennes et très peu des abbayes carolingiennes. Depuis lors, d...

  9. Nanostructures pour le développement de vaccins contre le virus de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Institut national de la recherche agronomique (France). Ce projet est financé par le fonds d'innovation en vaccins pour le bétail, un partenariat entre la fondation Bill et Melinda Gates, Affaires Mondiales Canada et le Centre de recherches pour le ...

  10. GeneXpert MTB/RIF dans le dépistage de la tuberculose pulmonaire à l’Hôpital Provincial Général de Référence de Bukavu, à l’Est de la République Démocratique du Congo: quelles leçons tirées après 10 mois d’utilisation?

    Science.gov (United States)

    Lupande, David; Kaishusha, David; Mihigo, Carine; Itongwa, Moise; Yenga, Gustave; Katchunga, Philippe

    2017-01-01

    Introduction En Afrique subsaharienne, les méthodes de diagnostic de la tuberculose sont insuffisantes et reposent essentiellement sur la microscopie. Elles constituent un réel frein pour le contrôle de la tuberculose. La présente étude voudrait évaluer les performances du GeneXpert MTB/RIF vis à vis de la microscopie classique de Ziehl-Neelsen à l’Hôpital Provincial Général de Référence de Bukavu, à l’Est de la République Démocratique du Congo après 10 mois d’utilisation. Méthodes Les résultats de la coloration au Ziehl-Neelsen et de la biologie moléculaire sur GeneXpert MTB/RIF de 452 patients suspects de tuberculose ont été colligés. La validité d’un test par rapport à l’autre dans la détection de la tuberculose a été étudiée. Résultats Dans le groupe entier, la fréquence de la tuberculose pulmonaire était de 16.3%. La positivité était significativement plus élevée pour le GeneXpert MTB/RIF que pour le Ziehl-Neelsen dans le groupe entier (15.9% vs 9.3%, p= 0.03) et chez les séropositifs pour le VIH (52.0% vs 24.0%; p = 0.007). Cependant, la sensibilité de GeneXpert MTB/RIF comparé au Ziehl-Neelsen n’était pas maximale (95.2%). Enfin, GeneXpert MTB/RIF a détecté 20.8% de résistance à la rifampicine. Conclusion La présente étude confirme la supériorité de GeneXpert MTB/RIF sur la coloration de Ziehl-Neelsen dans la détection de la tuberculose et dans la prédiction de la multi résistance. Son utilisation systématique couplée au Ziehl-Neelsen permettrait de mieux contrôler la tuberculose en Afrique subSaharienne. PMID:29187929

  11. Contester le mariage forcé : mettre en place la ligne de défense et le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le droit civil en matière de mariage est la Loi spéciale sur le mariage, qui permet aux parties de différentes religions de se marier sans changer de religion. Elle exige le consentement explicite des deux partenaires pour que le mariage soit possible. Le consentement demeure le point central de la loi sur le mariage; ...

  12. Sur le genre Apoleon, Gorh

    NARCIS (Netherlands)

    Fairmaire, L.

    1887-01-01

    Dans les »Notes from the Leyden Museum”, vol. VII (1885) p. 51, Mr. Gorham a décrit sous le nom d’ ’Apoleon un nouveau genre de Bostrychide, créé pour un insecte de Malacca, rencontré aussi au Laos, à Bornéo et à Sumatra, A. edax. Ce genre est identique avec le genre Dysides Perty, dont le type, D.

  13. A grammar of Tadaksahak a northern Songhay language of Mali

    NARCIS (Netherlands)

    Christiansen-Bolli, Regula

    2010-01-01

    This dissertation is a descriptive grammar of the language Tadaksahak spoken by about 30,000 people living in the most eastern part of Mali. The four chapters of the book give 1. Information about the background of the group. 2. The phonological features of the language with the inventory of the

  14. Support for Community Telecentres and Networks in Mali | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Telecentres across French-speaking West Africa are struggling to attain financial sustainability while remaining relevant to their communities. This is ... This grant will allow AfrikLINKS to extend its support services to all telecentres in Mali, thereby offering telecentre practitioners a timely and effective reference service.

  15. Integrating agroforestry and sheep feed in Mali | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The challenge. Sheep herding plays a significant role in the livelihoods of rural households in Mali and other semi-arid countries of West Africa. Although sheep herding could improve the incomes of rural women, its potential is not being realized because a lack of feed reduces the meat production of sheep. Agroforestry ...

  16. Un nouvel habitat du Bronze final IIIb dans le Val d’Orléans et ses traces de métallurgie du fer : Bonnée, Les Terres à l’Est du Bourg (Centre, Loiret A new settlement from late Bronze IIIb in the val d’Orléans: Bonnée, Les Terres à l’Est du Bourg (lands to the east of the town (Centre, Loiret

    Directory of Open Access Journals (Sweden)

    Stéphane Joly

    2011-12-01

    Full Text Available La multiplication récente des diagnostics archéologiques autour du petit bourg actuel de Bonnée a permis la détection d’une occupation du Bronze final IIIb (circa 900-750 av. n.-e. sur environ un hectare aux Terres à l’Est du Bourg. Les limites inhérentes à ce type d’intervention réduisent l’interprétation des structures et toute approche spatiale de ce probable habitat repéré. L’étude conjointe des différents mobiliers en particulier céramique et métallurgique, mais aussi le torchis et la faune, atteste de sa culture matérielle et de son intérêt. Ces scories pourraient être parmi les plus anciennes traces en région Centre d’activité métallurgique du fer. Des activités de post-réduction sont avérées et certaines opérations de forgeage sont supposées.La découverte de cet habitat dans ce secteur du lit majeur de la Loire, apporte de nouvelles données concernant l’occupation du sol et ses problématiques évolutives dans le Val d’Orléans sur ces périodes de transition avec le Hallstatt ancien.The recent increase in the archaeological evaluations around the village of Bonnée has enabled the discovery of a final Bronze Age IIIb settlement (circa 900-750 BP on about a hectare of the Terres à l’Est du Bourg. The limits inherent in this type of work restrict the interpretation of structures and all spatial approaches to this likely dwelling. The joint study of the different furnishings, in particular ceramics and metal, but also the cob and fauna, attests to its material culture and its interest. The slag could be amongst the oldest iron metallurgy remains from the Centre region. Some activities of post-forging are proven and certain operations are guessed at. The discovery of this settlement in this sector of the major bed of the Loire, has produced new data concerning the occupation of the land and its evolutionary problems in the valley of Orleans over these periods of transition in the early

  17. Un oiseau "sabote" le CERN

    CERN Multimedia

    Colson, Sébastien

    2009-01-01

    Un oiseau, un simple oiseau, est parvenu à bloquer à lui tout seul l'accélérateur à particules à 3,7 milliards d'euros. UNe histoire quasiment bulresque qui a toutefois impacté le fonctionnement de la machine durant près de cinq jours, puisque c'est le système de refroidissement qui a été affecté. (1 page)

  18. Le stockage inertiel

    OpenAIRE

    KAUV, J; BONAL, J

    2010-01-01

    La fourniture d'une énergie propre et abondante à une population mondiale largement appelée à croître va être un défi considérable pour le XXIe siècle. Aujourd'hui nous dépendons encore considérablement des énergies fossiles, certes très énergétiques et d'utilisation commode, mais épuisables et productrices de CO2 responsable du réchauffement climatique. Le stockage d'énergie électrique et de chaleur est un domaine technique difficile et délicat, mais dont le développement est indispensable p...

  19. Rapport financier trimestriel pour le trimestre qui a pris fin le 31 ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Office 2004 Test Drive User

    31 déc. 2016 ... Lʼinformation et les divulgations contenues dans le Rapport annuel 2015-2016 sʼappliquent au trimestre sur lequel porte le présent rapport trimestriel, sauf indication contraire. Budget 2016-2017 révisé. Le Conseil des gouverneurs a approuvé le budget 2016-2017 avant le début de lʼexercice. Cʼest.

  20. (TEC) et ciblage des pauvres au Mali

    International Development Research Centre (IDRC) Digital Library (Canada)

    Comment est-ce que c'est vrai. La preuve par … □ Différentiel de ciblage entre P et NP. □ Part normalisée de consommation/achat des Pauvres. □ Part normalisée de la pression fiscale. (totale et de porte) sur les achats des P. □ Part normalisée des "exonérations" revenant aux Pauvres ...

  1. Validation of reference genes for gene expression analysis in Valsa mali var. mali using real-time quantitative PCR.

    Science.gov (United States)

    Yin, Zhiyuan; Ke, Xiwang; Huang, Dingxuan; Gao, Xiaoning; Voegele, Ralf T; Kang, Zhensheng; Huang, Lili

    2013-09-01

    Valsa mali var. mali (Vmm), is the predominant species of apple valsa canker in China. Modern analysis of genes involved in virulence or pathogenicity usually implicate gene expression analysis most often performed using real-time quantitative polymerase chain reaction (RT-qPCR). However, for relative gene expression analysis pertinent reference genes have to be validated before using them as internal reference. This has not been reported for Vmm, so far. Therefore, eight commonly used housekeeping genes (ACT, CYP, EF1-α, G6PDH, GAPDH, L13, TUB, and UBQ) were cloned and evaluated for their expression stability by geNorm and NormFinder. Overall, all of the candidate reference genes were found to be suitable for gene expression analysis. After analysis of 10 samples from different strains and abiotic stress treatments, G6PDH appeared to be the most suitable reference gene, whereas GAPDH was the least suitable. Moreover, taking G6PDH combined with L13 or CYP as reference genes, improved the reliability of RT-qPCR significantly. The influence of the reference system on expression data was demonstrated by analyzing Vmmpg-1 encoding an endo-polygalacturonase gene. Pectinases are considered key pathogenicity factors for this fungus. In order to better understand the role of pectinases in pathogenicity of Vmm, RT-qPCR was used for expression analysis. Our results may provide a guideline for future studies on gene expression of V. mali var. mali by using RT-qPCR.

  2. Le LHC, priorité absolue

    CERN Multimedia

    Huet, S

    2002-01-01

    Le LHC, sa mise en est repoussee a 2007 quand les physiciens esperaient 2006. Le CERN a sous-estime les couts, environ 11% pour les 1 200 aimants supraconducteurs. Les Etats membres n'augmenteront pas leurs subventions, il propose donc cette semaine un plan drastique : tout pour le LHC (1/2 page).

  3. Analysis of the potential for sustainable, cassava-based bioethanol production in Mali

    DEFF Research Database (Denmark)

    Rasmussen, Kjeld; Bruun, Thilde Bech; Birch-Thomsen, Torben

    ) at the Technical University of Denmark (DTU) and conducted in cooperation with Direction Nationale de l’Energie (DNE) and Centre National de l’Energie Solaire et des Energies Renouvelables (CNESOLER) in Mali. The subcontracted institutions comprise Geographic Resource Analysis & Science A/S (GRAS), Department......The present project is covered in five main reports: 1) Analyses of the potential for sustainable, cassava-based bio-ethanol production in Mali 2) Agricultural residues for energy production in Mali 3) Pre-feasibility study for an electric power plant based on rice straw 4) Estimation of wind...... and solar resources in Mali 5) Screening of feasible applications of wind and solar energy in Mali: Assessment using the wind and solar maps for Mali The project is being carried out by a group of university departments, research institutions and consultants led by the UNEP Risø Centre (URC...

  4. Peut-on voyager dans le temps ?

    CERN Multimedia

    CERN. Geneva

    2008-01-01

    La possibilité de voyager dans le temps est régulièrement évoquée par les magazines scientifiques (et parfois même par les scientifiques). Elle est également le sujet de nombreux romans de science-fiction. Nous discuterons d’abord du sens qu’on peut donner à l’expression « voyager dans le temps », puis nous expliciterons ce que la physique contemporaine dit à ce propos.

  5. Le profil entrepreneurial : Facteur discriminant du developpement ...

    African Journals Online (AJOL)

    Le développement économique est un objectif majeur pour tout pays. Selon le classement établi par le Forum économique mondial, le développement économique dépend du niveau du PIB per capita et de la part des exportations des biens minéraux dans l'exportation totale. A partir de la base de données GEM Algérie, ...

  6. Le beau et le vrai

    Directory of Open Access Journals (Sweden)

    Létitia Mouze

    2006-05-01

    Full Text Available La vie des abeilles de Maeterlinck est un ouvrage à la fois scientifique et littéraire, non pas parce qu’il appartiendrait à la science par son exactitude et à la littérature par son style, mais en ce qu’il invite à penser l’unité des deux domaines. Les aspects littéraires de l’ouvrage (beauté de l’écriture, usage des images, de l’analogie, etc. ne sont pas des accessoires, mais des outils indispensables à l’élaboration d’un authentique savoir sur les abeilles, c’est-à-dire un savoir qui reconnaît la part d’inconnu et le mystère qui subsistent en dépit de toutes les explications physiques et mécaniques que l’on peut par ailleurs donner des phénomènes observés. Etre scientifique, dans cette perspective, c’est-à-dire donner à connaître, c’est donc être littéraire. Cette conception de la science repose en dernière instance sur une conception philosophique de l’univers comme un tout où toutes choses sont reliées, unies, par des relations d’analogies, ce qui fonde et justifie l’emploi d’un style symboliste.The life of bees, one of Maeterlinck’s works, is together a scientific and literary book, not because of it scientific exactness and its literary style, but for the reason it suggests the unity of both these domains. Literay’s aspects of this work (writing’s beauty, use of images, analogy, etc. are not secondary but necessary to elaborate an authentic knowledge about bees, that means a knowledge which admit the unknown part and the mistery that subsist despite all the physical and mechanical explanations we can give moreover about the observed phenomenons. Be a scientist, in this sense, that is give something to know, therefore means be literary. Finally, this conception of science consist in a philosophiacl conception of Universe as a whole where everything links together, and is united by analogical relations, that base and justify the use of a symbolist style.

  7. Comparaison n'est pas raison…

    Directory of Open Access Journals (Sweden)

    Yves Guermond

    2004-11-01

    Full Text Available Dans le contexte très politisé de la question palestinienne il est difficile de séparer l’analyse scientifique des réactions passionnelles, et l’utilisation de l’apartheid comme repoussoir peut donner l’impression de dédouaner le gouvernement israélien. C’est d’ailleurs un peu semble-t-il l’intention de Frédéric Giraut quand il écrit que « l’usage radical et systématique de l’analogie vise à condamner l’Etat d’Israël et le sionisme dans leur nature même ». « Cette approche infondée » serait ,...

  8. Tabagisme et dysfonction erectile chez les personnes vivant avec le ...

    African Journals Online (AJOL)

    La dysfonction erectile (DE) est un probleme de sante publique qui altere la qualite de vie des patients. Chez les personnes infectees par le VIH, le tabagisme en association ii d'autres facteurs pourrait accroitre le risque de survenue de ce trouble. L'objectif de cette etude est de determiner la prevalence de laDE, les ...

  9. Initiative Think tank | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'ITT est le fruit d'un partenariat regroupant cinq bailleurs de fonds. Lancée en 2008, l'ITT est administrée par le Centre de Recherches pour le Développement International (CRDI), un organisme canadien.

  10. Le faussaire roman

    CERN Document Server

    D'Anna, Gianfranco

    2016-01-01

    À l'aube du XXIe siècle, le monde de la science est sur le point de vivre une révolution. Le jeune physicien allemand Albert Hendrick Thebell, des célèbres laboratoires de recherche B-Labs, à Summit, dans le New Jersey, publie, dans les plus grandes revues scientifiques internationales, une série d'articles dans lesquels il prétend avoir obtenu des résultats extraordinaires qui pourraient révolutionner les bases mêmes de la technologie. Rapidement, la communauté scientifique puis les médias saluent en lui un futur prix Nobel; on compare même son génie à celui d'Albert Einstein. Le progrès scientifique semble avoir franchi une étape décisive, susceptible d'amener un futur meilleur. Mais ces découvertes sont-elles authentiques ? Car pendant ce temps, dans les mêmeslaboratoires, des voix s'élèvent pour contester non seulement les théories de Thebell mais aussi la légitimité même de ses expériences ; certains le soupçonnent d'avoir combiné la plus grande fraude scientifique de tous l...

  11. Estimation of wind and solar resources in Mali

    Energy Technology Data Exchange (ETDEWEB)

    Badger, J.; Kamissoko, F.; Olander Rasmussen, M.; Larsen, Soeren; Guidon, N.; Boye Hansen, L.; Dewilde, L.; Alhousseini, M.; Noergaard, P.; Nygaard, I.

    2012-11-15

    The wind resource has been estimated for all of Mali at 7.5 km resolution using the KAMM/WAsP numerical wind atlas methodology. Three domains were used to cover entire country and three sets of wind classes used to capture change in large scale forcing over country. The final output includes generalized climate statistics for any location in Mali, giving wind direction and wind speed distribution. The modelled generalized climate statistics can be used directly in the WAsP software. The preliminary results show a wind resource, which is relatively low, but which under certain conditions may be economically feasible, i.e. at favourably exposed sites, giving enhanced winds, and where practical utilization is possible, given consideration to grid connection or replacement or augmentation of diesel-based electricity systems. The solar energy resource for Mali was assessed for the period between July 2008 and June 2011 using a remote sensing based estimate of the down-welling surface shortwave flux. The remote sensing estimates were adjusted on a month-by-month basis to account for seasonal differences between the remote sensing estimates and in situ data. Calibration was found to improve the coefficient of determination as well as decreasing the mean error both for the calibration and validation data. Compared to the results presented in the ''Renewable energy resources in Mali - preliminary mapping''-report that showed a tendency for underestimation compared to data from the NASA PPOWER/SSE database, the presented results show a very good agreement with the in situ data (after calibration) with no significant bias. Unfortunately, the NASA-database only contains data up until 2005, so a similar comparison could not be done for the time period analyzed in this study, although the agreement with the historic NASA data is still useful as reference. (LN)

  12. Development of the Falea Polymetallic Uranium Project, Mali

    International Nuclear Information System (INIS)

    Ring, Bob; Freeman, Paul

    2014-01-01

    Falea project basics: • Project now owned by Denison Mines; • ANSTO Minerals working with owner and their consultant, DRA; • Located in south western Mali, West Africa, near the intersection of the Senegal and Guinea borders; • Established mining region (mainly gold); • Location on plateau favourable for underground operation; • Significant uranium, silver and copper mineralisation - different to other U deposits; • Excellent metallurical outcomes to date

  13. [National debate on the Mali population policy project].

    Science.gov (United States)

    Dabo, K

    1990-08-01

    In July 1990 in Bamako, Mali, the government held a national debate on the population policy project. Participants were from the Democratic Union of the Malian People, the Minister of Planning, and the national and regional upper management levels of the national unions of women, youth, and workers of Mali. Observers were representatives from UNFPA, BIT, and the World Bank. The Center of Studies and Research on Population for Development (CERPOD) and the Malian Association for the Protection and Promotion of the Family (AMPPF) were invited to the opening and closing ceremonies. The debate aimed to allow participants to learn about the form and contents of the project and of the draft document of Mali's population policy and to appreciate it in its theoretical and practical relevance. The same document was discussed and recommendations made during a workshop in April 1990 by various leaders of projects supported by UNFPA, AMPPF, CERPOD, and different members of the Studies and Coordination of Population Activities Group. Reports of the first plenary session were on the analysis of the demographic-economic situation of Mali and its different regions, and on the objectives and strategies of the population policy. The demographic-economic study is very important in the scientific formulation of a population policy because a poor diagnosis, poor identification of demographic-economic problems, or their bad formulation leads most often to irreversible errors. Three working groups provided reports containing observations and concrete recommendations to improve the document. The second plenary session was devoted to and adopted the reports. Some objectives contained in the pre-project were control of population growth through accelerated socioeconomic development and adapting fertility to development, food security, improvement of the health status of the population, promotion of family planning and family protection, promotion of human resources, protection and

  14. Devolution and human resources in primary healthcare in rural Mali

    Directory of Open Access Journals (Sweden)

    Dao Dramane

    2011-06-01

    Full Text Available Abstract Devolution, as other types of decentralization (e.g. deconcentration, delegation, privatization, profoundly changes governance relations in the health system. Devolution is meant to affect performance of the health system by transferring responsibilities and authority to locally elected governments. The key question of this article is: what does devolution mean for human resources for health in Mali? This article assesses the key advantages and dilemmas associated with devolution such as responsiveness to local needs, downward accountability and health worker retention. Challenges of politics and capacities are also addressed in relation to human resources for health at the local level. Examples are derived from experiences in Mali with a capacity development programme and from case studies of other countries. It is not research findings that are presented, but highlights of key issues at stake aimed at inspiring the debate in Mali and elsewhere. A first lesson from the discussion suggests that in the context of human resources for health, decentralization of authority and resources is not the main issue. The challenge is to develop or strengthen accountability of those who decide and act, whether they are local politicians, bureaucrats or community representatives. If decentralization policies do not address public accountability, they will not fundamentally change human resource management, quality and equity of staffing. A second lesson is that successful devolution requires innovations in capacity development of all actors involved and in designing effective incentive measures. A final key conclusion is that the topic of devolution policy and its effects on human resources for health, and vice versa, merit more attention. A better understanding may lead to more appropriate policy designs and better preparation for the actors involved in countries that are embarking on decentralization, as is the case in Mali.

  15. Epidemiologic aspects of scabies in Mali, Malawi, and Cambodia.

    Science.gov (United States)

    Landwehr, D; Keita, S M; Pönnighaus, J M; Tounkara, C

    1998-08-01

    The prevalence rates of scabies are compared in Bamako, Mali, Karonga District, Malawi, and Battambang Province, Cambodia. In Mali, children attending three different urban schools catering for different socio-economic levels were examined specifically for scabies. In Malawi, data were collected during a total population survey for leprosy. In Cambodia, a sample survey was carried out in a rural area to determine the prevalence of leprosy and other skin diseases. In Mali, the prevalence rate of scabies among all the children examined was 4% (44/1103), but only 1.8% (7/388) in the higher socio-economic group. In Malawi, the overall prevalence rate of scabies was 0.7% (408/61,735). The highest rate (1.1%) was found among children 0-9 years of age. In Cambodia, the overall prevalence in the 13 villages screened was 4.3% (645/14,843). The highest rate (6.5%) was found among children 0-9 years of age. Scabies was most prevalent among children in Cambodia and Malawi, but there were considerable differences in the overall rates between the two areas studied. The data from all three countries indicate that poor socio-economic conditions, in particular crowding and public water supplies, are risk factors for scabies.

  16. Technical support by Solthis for health-care workers in order to decentralise medical treatment for people living with HIV in the Ségou region of Mali

    Directory of Open Access Journals (Sweden)

    A. Akonde

    2009-01-01

    Full Text Available Medical treatment for people living with HIV/AIDS started in Mali as early as 1997 thanks to civil society. The national response was officialised by the adoption of the Malian Initiative for Access to Antiretroviral Therapy (Initiative Malienne d’Accès aux Antirétroviraux IMAARV. In 2004 ART, drugs against opportunistic infections and basic biological monitoring were made available free of charge by decree. In 2005, decentralisation of health-care to regions and circles became one of the main thrusts of the national strategy for the fight against the pandemic. Sub-Saharan African countries are making significant efforts to provide full geographical coverage of their national territory.It is in this “scaling-up” context that the Solthis NGO (Solidarité Thérapeutique et Initiatives contre le Sida began cooperating with Malian actors to extend access to quality treatment for patients living with HIV/AIDS in the city and region of Ségou. Based on a developmental approach, Solthis opted for continuing in situ technical support for national actors in the fight against AIDS. Thanks to the daily presence of a team “in the field” Solthis devotes a large part of its activities to capacity-building for health-care workers through an exchange of medical and scientific expertise. Efforts were also made to improve health-care workers’ working conditions and to make various tests and drugs accessible to patients infected with HIV. The initial aim was to encourage universal access to ART. Today, the Ségou programme supported by Solthis has developed over 1,500 new treatments in the region. In addition, every PMTCT centre in the region offers prevention and treatment services to mothers and children. Today, the Ségou region is an integral part of the IMAARV initiative as a decentralisation pilot project.Le traitement médical des malades atteints du VIH/SIDA a débuté au Mali dès 1997 grâce à la société civile. La r

  17. [Mali: the offer of education disturbed by demographic variables].

    Science.gov (United States)

    Tounkara, B

    1990-12-01

    Although educational reforms in 1962 have played a positive role in the socioeconomic and cultural development of Mali, the most recent analyses of the educational system have shown it to be in crisis for reasons both endogenous and exogenous. Huge class sizes, lack of teaching materials, and insufficient training of teachers have affected the quality of education. 80% of Mali's population is illiterate but the rate of school attendance is under 30%. Financial resources devoted to education have not grown as fast as population. The situation is made worse by structural adjustment programs of the past few years that have encouraged the government share of educational expenses to decline and the role of parents and the private sector to increase. The 1987 Demographic and Health Survey showed that Mali's rate of population growth is 2.7%/year. 45% of the population is under 15, amounting to some 3.5 million children. Great efforts are needed just to provide schools and teachers and to maintain the rate of school attendance at its current level of 27%, 1 of the lowest in the world. To attain the goal of 50% school attendance by the year 2000, the number of students beginning primary school should increase by 11.3% per year. But currently the number of students aged 6-11 is actually shrinking by almost 1% per year. At the level of the family, the expenses of school attendance are an important factor in nonattendance. The high annual costs constitute an insurmountable barrier for parents of large families. The loss of children's labor in rural areas is an added cost of schooling. School attendance in Mali is becoming a source and means of social inequality. The seasonal or permanent migration of a large part of the population has also been an obstacle to school attendance. the unavailability of mothers who teach during their 3 months of maternity leave and 2 hours daily break for breast feeding, in addition to absenteeism when their children are sick, is another effect

  18. Le surpoids, l'obésité et le contrôle glycémique chez les diabétiques ...

    African Journals Online (AJOL)

    utilisation et du stockage des sucres apportés par l'alimentation, sa prise en charge est assurée par le suivi du surpoids et l'obésité et le contrôle glycémique régulier. L'objectif de ce travail était l'étude du surpoids, l'obésité et le contrôle glycémique ...

  19. AcEST(EST sequences of Adiantum capillus-veneris and their annotation) - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris

  20. Le métalangage comme procédé discursif structurant du récit dans Allah n’est pas obligé d’Ahmadou Kourouma

    Directory of Open Access Journals (Sweden)

    Yayo Vincent DANHO

    2014-07-01

    Full Text Available The refusal to admit the formalistic principle of the closing of the meaning in Allah n’est pas obligé is tangible evidence of the authority of the metalanguage in this narrative. This study shows how the language used to refer to itself, is part of a speech in the second degree. To do this, this analysis seeks to show that the narrative in metalinguistic discourse is made possible by the interrogative system and reformulation in indirect speech. The narrative, based on equational formula A = A ', hints at the reflexive dimension of novel writing and translation operation that is performed there. This form of translatology, which is not without influence on the story, reveals two types of augmentation: extension and expansion, which are at the origin of the African genrologique reactivation of new type.

  1. Le vieillard et le chevalier

    Directory of Open Access Journals (Sweden)

    Mélanie JECKER

    2010-05-01

    Full Text Available La fin du Moyen Âge fascine. Deux facteurs principaux expliquent l’attraction qu’exerce cette période : elle apparaît d’une part comme un moment historique riche car double, phase de transition entre le Moyen Âge et la Renaissance, où se mêlent des cadres de représentation anciens et nouveaux. L’insinuation d’une pensée humaniste balbutiante s’y traduirait notamment par l’émergence de la notion d’individu, qui constitue l’un des objets de ce travail. Il faut invoquer, d’autre part, l’image macabre d’un bas Moyen Âge hanté par l’idée de la maladie et de la mort depuis l’épidémie de peste noire de 1348, obsédé par la brièveté de la vie humaine. Ces deux facettes de « l’automne du Moyen Âge » tel que l’évoque avec poésie Joan Huizinga sont-elles autre chose qu’une plaisante image d’Epinal? Cette étude cherche précisément à déterminer le degré de validité de ces deux topiques, à travers l’analyse de la représentation des âges de la vie dans un corpus bien défini, celui de la biographie chevaleresque castillane du XVe siècle. L’intérêt porté à l’individu, la conscience de la singularité impliquent en effet celle du caractère mouvant de la personne, or quel thème mieux que celui des âges permet de confirmer ou d’infirmer l’hypothèse du surgissement d’une nouvelle manière de concevoir l’homme, proprement « renaissante », en ce siècle de transition , La nature même du corpus retenu – des récits biographiques – suggère en effet une mutation dans l’appréhension de la personne, une attention prêtée à sa progressive transformation. L’étude de la représentation de la vieillesse, en particulier, révèle non seulement à quel point était alors réelle cette prétendue obsession de la déchéance physique et de la mortalité, mais aussi dans quelle mesure étaient soulignés et valorisés les changements individuels parallèles à l

  2. Le monde quantique

    CERN Document Server

    Aspect, A; Bensaude-Vincent, B; Castiel, A; Chevalley, C; Darrigol, O; Deligeorges, S; D'Espagnat, B; Laloë, F; Lévy-Leblond, J-M; Messiah, A; Paty, M; Vuillemin, J; Wheaton, B R

    1984-01-01

    Le monde quantique La physique quantique, après trois quarts de siècle, n'en finit pas d'être moderne. Elle est présente quotidiennement dans les laboratoires où les physiciens étudient atomes, noyaux et particules. Elle est entrée dans l'industrie où lasers, transistors et supraconducteurs lui doivent d'exister. Et elle continue à alimenter le débat philosophique sur la nature de la réalité dont elle montre la non-séparabilité fondamentale. Ses concepts de base, son développement, ses applications, ses controverses sont ici présentés par une pléiade de physiciens, d'historiens et de philosophes.

  3. Farmers on the move : mobility, access to land and conflict in Central and South Mali

    NARCIS (Netherlands)

    Nijenhuis, K.

    2013-01-01

    In contrast to their sedentary image, farmers in Central and South Mali are surprisingly mobile. Many have settled in scattered farming hamlets where they are rapidly expanding the areas under agriculture. This study focuses on farmers’ mobility in relation to accessing land in two regions in Mali

  4. Women, Migration and Rights in Mali and Sénégal | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    In West Africa, notably Mali and Sénégal, the flow of women's migration takes place mainly within and between countries. Due to poverty, lack of economic opportunity and lack of education, young migrant women risk violation of their basic human rights. Moreover, although Mali and Sénégal have in place a legal arsenal ...

  5. Traditional medicine practitioners? knowledge and views on treatment of pregnant women in three regions of Mali

    OpenAIRE

    Nordeng, Hedvig; Al-Zayadi, Waled; Diallo, Drissa; Ballo, Ngolo; Paulsen, Berit Smestad

    2013-01-01

    Background Despite the widespread use of medicinal plants in Mali, knowledge about how traditional practitioners (TPs) treat pregnant and lactating women is lacking. Aim of the study The aim of this study was to investigate how traditional practitioners in Mali treat common diseases and ailments during pregnancy. Methods Data wa...

  6. Women, Migration and Rights in Mali and Sénégal | CRDI - Centre ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    In West Africa, notably Mali and Sénégal, the flow of women's migration takes place mainly within and between countries. Due to poverty, lack of economic opportunity and lack of education, young migrant women risk violation of their basic human rights. Moreover, although Mali and Sénégal have in place a legal arsenal ...

  7. Lecture actentielle dans Trop c'est trop de Protais Asseng | IKANGA ...

    African Journals Online (AJOL)

    La naissance de cet enfant lui conférait le titre de "Papa national" Bakony symbolise la recherche de bonheur sur le dos d'un humain. C'est de l'exploitation de la femme par l'homme. Mais la multipare Bissabey, son épouse, n'est pas de son avis. Cette instrumentalisation est alors la pomme de discorde entre le couple et ...

  8. Travailler le vison

    OpenAIRE

    Gorre, Jean-François

    2007-01-01

    Dans notre société, la fourrure est porteuse de valeurs symboliques. D'autres travaux ont montré comment elle est l'expression du jeu entre nature et culture : investissement de la force de l'animal, expression du sauvage, marque de la domestication de la nature (Delort 1973, Pouchelle 1981). Notre propos sera différent. Nous étudierons dans le cadre du métier de fourreur, à travers une technique particulière, l'« allonge », la teneur de l'affrontement entre deux groupes socio-professionnels....

  9. La Turquie face à la globalisation. Convergence d’intérêts entre les acteurs religieux particularistes : le cas du sud-est européen dans les années 1990 Turkey and Globalisation. Convergence of Interests between Particularists Religious Actors. The South-East Europe during the ’90s

    Directory of Open Access Journals (Sweden)

    Nikolaos Raptopoulos

    2011-03-01

    Full Text Available La globalisation, en favorisant l’interaction des idées et des hommes, est de ces facteurs qui sont capables de mettre en cause des systèmes sociopolitiques rigi­des. Cette contribution s’intéresse plus précisément au cas de figure du système kémaliste turc. L’islam turc, composante incontestée de l’identité nationale, est de plus en plus impliqué dans le système sociopolitique contemporain en tant qu’idéologie globalisante promue par certains acteurs. Cette situation, prévisi­ble pour la scène interne, se confirme aussi dans l’action et l’interaction des protagonistes au niveau international. En Turquie, l’islam, religion monothéiste, est devenu un véhicule d’interaction : d’une part entre l’État (laïc et nationa­liste et les acteurs sociaux islamiques ; d’autre part, entre ces mêmes acteurs et les communautés turques et musulmanes des régions de l’aire ottomane, no­tamment du sud-est de l’Europe.By fostering interaction globalization can question socio-political rigidity. This was the case with kemalist Turkey. Part and parcel of national identity, Turkish Islam is increasingly involved in the socio-political set up in the form of a global ideology. Recognizable locally, this process also carries international weight. Monotheistic Islam has acted in Turkey as a go-between : between the nationalistic, lay State and Islamic actors, between these latter and Islamic elements in regions of the former ottoman empire, notably in south-eastern Europe

  10. Le dernier Wittgenstein et le dernier Husserl sur le langage

    Directory of Open Access Journals (Sweden)

    Paul Ricoeur

    2014-07-01

    Full Text Available This article presents an edited version of lectures given by Paul Ricœur at Johns Hopkins University in April 1966. Ricœur offers a comparative analysis of Wittgenstein’s and Husserl’s late works, taking the problem of language as the common ground of investigation for these two central figures of phenomenology and analytic philosophy. Ricœur develops his study in two parts. The first part considers Husserl’s approach to language after the Logical Investigations and concentrates on Formal and Transcendental Logic; leaving a transcendental reflection on language behind it re-examines a phenomenological conception, according to which the sphere of logic is not separable from that of experience. The main focus of the second part is Wittgenstein’s later philosophy as it moved on from the conception of an isomorphic relation between language and the world, as set out in the picture theory in the Tractatus Logico-Philosophicus, to the more pragmatic notion of a language-game in the Philosophical Investigations. In order to get beyond the irrevocable differences between the two philosophies and the unresolved theoretical issues on both sides, Ricœur suggests turning to a semiological paradigm based on the Saussurean distinction between “language” and “speaking.” Keyword: Analytic Philosophy, Husserl, Phenomenology, Semiology, Wittgenstein.  Résumé Cet article est une version éditée de conférences données par Paul Ricœur à la Johns Hopkins University en avril 1966. Ricœur propose une analyse comparée des dernières œuvres de Wittgenstein et Husserl, avec le problème du langage comme sol commun d’investigations pour ces deux figures centrales de la phénoménologie et la philosophie analytique. Cette analyse de Ricœur se joue à travers deux parties. La première partie revient sur l'approche du langage chez Husserl depuis Recherches logiques avec une attention particulière aux développements de Logique formelle et

  11. Le modèle basque

    Directory of Open Access Journals (Sweden)

    Juan-Angel PORTUGAL

    1986-12-01

    Full Text Available À l'intérieur du quadrilatère basque se dessine un sous-espace triangulaire dont les sommets sont les capitales provinciales; les côtés délimitent une aire prospère. La localisation de ces trois noyaux résulte d'une décision politico-économique et d'une diffusion de l'industrialisation. Ce triangle est un espace dynamique et attractif, autant dans le domaine de la démographie que du développement économique et industriel.

  12. “La vida está fuera del tiempo”. León Tolstói entre la práctica vital y la predicación moral

    Directory of Open Access Journals (Sweden)

    Rabe, Ana María

    2010-10-01

    Full Text Available At the turn of the 20th century, Leo Tolstoy was considered an important ethical figure in Russia as well as in other cultural spheres. He was idolized as a moral example who preached life and work in the countryside in harmony with nature, charity, simplicity and denial of property; values that the aristocratic writer seemed to realize himself. At the same time, the public and ecclesiastic authorities of Russia feared the big influence emanating from the severe criticism and denunciations by which Tolstoy unveiled injustice, violence and hypocrisy of the Russian institutions. As the article shows, Tolstoyan ideas about love thas is realized here and now, denial of any recompense, nonviolent resistance, decease as a decline in everyday life and vital practice that is integrated in present played an important role in the intellectual circles of that time, e. g. in Bunin, Gorki, Heidegger, Gandhi, Nietzsche or Lukács. Tolstoy’s conception of life as pure present, as being “beyond” time and thus gaining felicity and eternity –an idea suggested by Saint Augustine–, impressed especially the young Wittgenstein. The article presents these ethical, religious and existential ideas as they appear in the Tolstoyan religio-theoretical writings and narrations while showing at the same time the contrary positions of Tolstoy’s thought and character on which they are built.

    A finales del XIX y principios del XX León Tolstói fue considerado un importante modelo ético dentro y fuera de Rusia. La gente del pueblo lo veneraba como ejemplo moral que predicaba la vida y el trabajo en el campo en concordancia con la naturaleza, el amor al prójimo, la sencillez y renuncia a la propiedad, valores que el escritor aristócrata parecía llevar él mismo a la práctica. A la vez, las autoridades estatales y eclesiásticas de Rusia temían la gran influencia que ejercían las severas críticas y acusaciones con las que el famoso novelista y

  13. Le Projet d’Ole Lando sur les Contrats

    DEFF Research Database (Denmark)

    Holle, Marie-Louise

    2017-01-01

    En 2016 le projet de recherche le plus important jusqu’à présent sur le droit nordique des contrats a pris fin et un livre, de presque 400 pages, en a marqué l’aboutissement. Le résultat du projet est un « restatement » tel qu’il existe aux États-Unis. Le Restatement porte sur les règles et les...

  14. Dans le tourbillon des particules

    CERN Document Server

    Zito, Marco

    2015-01-01

    Accélérateurs géants, détecteurs complexes, particules énigmatiques... La physique subatomique peut sembler bien intimidante pour le novice. Et pourtant, qui n a jamais entendu parler du boson de Higgs et du CERN, le laboratoire européen où il a été découvert en 2012 ? Nul besoin d être un spécialiste pour comprendre de quoi il s agit. Aujourd hui, une théorie extraordinairement élégante, le Modèle Standard, décrit tous les résultats des expériences dans le domaine. Trente-sept particules élémentaires et quatre forces fondamentales : c est tout ce dont nous avons besoin pour expliquer la matière et l Univers ! Ce livre, destiné à un large public, raconte sans équations le long parcours qui a abouti au Modèle Standard. Ce parcours, parfois sinueux, a été entamé lorsque les Grecs anciens, et peut-être d autres avant eux, ont imaginé que la matière est composée de petites « billes ». Il faudra attendre plusieurs siècles pour qu on réalise que la matière, à l échelle micros...

  15. Le LHC, un tunnel cosmique

    CERN Document Server

    CERN. Geneva

    2009-01-01

    Et si la lumière au bout du tunnel du LHC était cosmique ? En d’autres termes, qu’est-ce que le LHC peut nous apporter dans la connaissance de l’Univers ? Car la montée en énergie des accélérateurs de particules nous permet de mieux appréhender l’univers primordial, chaud et dense. Mais dans quel sens dit-on que le LHC reproduit des conditions proches du Big bang ? Quelles informations nous apporte-t-il sur le contenu de l’Univers ? La matière noire est-elle détectable au LHC ? L’énergie noire ? Pourquoi l’antimatière accumulée au CERN est-elle si rare dans l’Univers ? Et si le CERN a bâti sa réputation sur l’exploration des forces faibles et fortes qui opèrent au sein des atomes et de leurs noyaux, est-ce que le LHC peut nous apporter des informations sur la force gravitationnelle qui gouverne l’évolution cosmique ? Depuis une trentaine d’années, notre compréhension de l’univers dans ses plus grandes dimensions et l’appréhension de son comportement aux plus peti...

  16. Can the UN Stabilize Mali? Towards a UN Stabilization Doctrine?

    Directory of Open Access Journals (Sweden)

    Arthur Boutellis

    2015-06-01

    Full Text Available Almost two years after the deployment of the United Nations Multidimensional Integrated Stabilization Mission in Mali (MINUSMA in July 2013, the increasing number of asymmetric terrorist attacks targeting UN peacekeepers – in the context of a drawn-out peace process – has raised a number of questions in Mali, the sub-region, and in New York, over the relevance and adequacies of MINUSMA’s mandate and capabilities. It also raises a broader issue, of whether the consent-based UN peacekeeping tool is appropriate and can be effective in carrying out stabilization mandates in such a context and what doctrine such operations should be based on. The UN is indeed under increasing pressure from host countries and some African troop-contributing countries to go on the offensive. Member States have also increasingly recognized terrorism and organized crime as a strategic threat, and while opposed to the UN directly engaging in counterterrorism (CT operations, some may wish to see the UN playing a greater stabilization role following the January 2013 French military intervention in Mali. However, little guidance and means have been given so far to UN missions for dealing with such threats and implementing effective stabilization mandates. The High-Level Panel on Peace Operations, which recently released its report, noted that the usage of the term “stabilization” by the UN requires clarification. This article analyses the complex and evolving nature of threats in northern Mali and implications for MINUSMA and describes the military and political tools – including mediation – so far available within and outside the UN. The article concludes that the UN is bound to move towards stabilization when and if deployed in contexts such as Mali’s if it wants to remain relevant. However, such a move should be based on an overarching UN stabilization doctrine and context-specific UN-wide stabilization strategies which are first and foremost political

  17. : tous les projets | Page 261 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Région: Burkina Faso, Mali, Senegal, Togo, North of Sahara, South of Sahara. Programme: Gouvernance et justice. Financement total : CA$ 399,800.00. Stimulation de l'entrepreneuriat dans les Caraïbes. Projet. Les pays des Caraïbes présentent une grande diversité sur le plan culturel et économique. Date de début : 25 ...

  18. Le livre sur le livre traité de documentation

    CERN Document Server

    Otlet, Paul

    2015-01-01

    Paul Otlet est considéré comme le père des sciences de l'information. Ouvrage fondateur et fondamental, le Traité de documentation. Le livre sur le livre (1934) est l'aboutissement de son travail inlassable pour rassembler, classer et partager les connaissances. Otlet y propose une remarquable synthèse du savoir sur le livre et le document en même temps qu'il anticipe Internet et l'hypertexte. La réédition du Traité de documentation, 70 ans après la disparition de son auteur, coïncide avec la réouverture du Mundaneum à Mons, où le fabuleux héritage documentaire légué par Paul Otlet et Henri La Fontaine est conservé. « Ici, la table de travail n'est plus chargée d'aucun livre. À leur place se dresse un écran et à portée un téléphone. Là-bas, au loin, dans un édifice immense, sont tous les livres et tous les renseignements. De là, on fait apparaître sur l'écran la page à lire pour connaître la réponse aux questions posées par téléphone. » Préfaces de Benoît Peeters (éc...

  19. [Doctoral thesis: Demographic growth and economic and social development in Mali].

    Science.gov (United States)

    Dabo, K

    1999-12-01

    A doctoral thesis is described analyzing the relationships between demographic growth and economic and social development in Mali. The hypothesis is stated that demographic growth impedes economic development and any improvement in populations¿ standards of living. The hypothesis was verified using data for the period from 1960 to the present. Over that period, Mali conducted two general population censuses in 1976 and 1987, as well as several demographic research studies. The thesis is comprised of 4 parts, of which the first generally describes Mali. The second part analyzes the relationship between population growth and economic and social development in Mali. Study results are presented, followed by an analysis of the effects of economic and social development upon population growth in Mali through factors such as urbanization, education level, literacy, income, employment, occupation, gross domestic or gross national product by inhabitant, infant mortality rate, life expectancy at birth, contraceptive practice, fertility opinions and desires, women¿s status, and migration in Mali. Analysis indicates that Mali has not completely begun its demographic transition, but that traditional pronatalist behaviors are changing. Population policies and programs are explored in the third part of the thesis, followed by the fourth part which focuses upon methodological questions.

  20. [Plasma selenium and peripartum cardiomyopathy in Bamako, Mali].

    Science.gov (United States)

    Cénac, A; Touré, K; Diarra, M B; Sergeant, C; Jobic, Y; Sanogo, K; Dembele, M; Fayol, V; Simonoff, M

    2004-01-01

    Peripartum heart failure due to unexplained dilated cardiomyopathy is a common disorder as Savannak-Sahelian Africa. One of the many suspected risk factors identified is selenium deficiency. The purpose of this study was to measure plasma selenium levels in patients with peripartum heart failure due to cardiomyopathy in Bamako, Republic of Mali and compare data with healthy Sahalian women with the same obstetrical status. Plasma selenium was measured in a patient group consisting of 28 Malian women presenting peripartum heart failure and in a control group of 28 healthy breast-feeding Nigerien women of comparable age. The criteria for matching the two groups was parity (similar number of deliveries) since multiparity is a risk factor for peripartum cardiomyopathy. The Wilcoxon test (nonparametric) was used to compare the 2 groups considering up value < 0.05 as significant. Plasma selenium was significantly lower in patients from Mali than in controls from Niger (65 +/- 17 ng/ml vs. 78 +/- 17 ng/ml, p = 0.01). The results of this study showing lower plasma selenium in Bamako patients with peripartum cardiomyopathy than in a matching healthy control population confirms the previous data from the Niamey study.

  1. [Implementation of the hypertension network in Mali (RHYTM)].

    Science.gov (United States)

    Lafay, V; Diarra, M; Coulibaly, S; Coulibaly, S; Desplats, D

    2006-10-01

    In view of the rising prevalence of arterial hypertension and its complications throughout sub-Saharan Africa including in rural areas, the Association of the Rural Doctors of Mali asked its NGO partner, Sant6 Sud, for assistance in setting up a medical network dedicated to hypertension. This report describes the implementation of the Mali Hypertension Network (French acronym, RHYTM) that involved three stages, i.e., physician training, development of appropriate protocols and field trials. The physician training stage was carried out over a one-week period and covered all the aspects of hypertension. In the second stage international guidelines were used as a basis for development of appropriate protocols for the rural setting. Field trials were conducted in the villages to verify the feasibility of the protocols and functionality of the network. Treatment of hypertension depends mainly on lifestyle and dietetic measures with emphasis on reducing salt intake. Drug treatment is based primarily on first-intention use of thiazidic diuretics. Management of this chronic pathology runs up against socio-cultural, economic and logistic obstacles. These problems are discussed and possible solutions are proposed. This preliminary experience will provide epidemiologic and clinical data on a sample population including more than 80000 people and explore the possibility of extending the network to other zones in this area of Africa.

  2. LE SECTEUR INFORMEL EN ALGERIE : APPROCHES, ACTEURS ...

    African Journals Online (AJOL)

    du respect des lois et des règlements et de l'Etat de droit de façon générale. 1.4. L'approche du secteur informel selon le Bureau International du Travail (BIT) ... qui ne tiennent pas une comptabilité complète et dont la person- l'importation…) mais également dans le secteur immobilier dont le fonctionnement est informel.

  3. Photovoltaic energy in Mali. Technical and organisational challenges of solar solutions deployment

    International Nuclear Information System (INIS)

    Lacroix, Olivier; Lesaffre, Dominique

    2011-01-01

    In 2008, electricity access rate in rural Mali was below 11%. In view of the challenges of electrification and development of rural areas in Mali, solar energy is seen as a strategic technology. The SIDI has asked ENEA to work on the technical and organisational terms ensuring sustainable access and spreading of photovoltaic systems in rural Mali. As such, in this report, ENEA improves the knowledge of the sector's private actors, suggests support architectures tackling the problematic, and highlights critical points by market segments

  4. Oser le corps

    Directory of Open Access Journals (Sweden)

    Alex Cormanski

    2015-05-01

    Full Text Available Le corps est la voie primordiale dans le processus d’énonciation, mais reste encore (trop souvent corps étranger dans le processus d’enseignement/apprentissage des langues étrangères. Or entrer dans une langue étrangère, se l’approprier physiquement, sonner juste dans une autre langue, précisément pour qu’elle ne soit plus étrangère, implique un travail sur le corps, peut impliquer un transfert de corporéité. Oser les pratiques de corps dans la classe de langue : voie incontournable pour éviter les voix dissonantes. Dare the body voice Abstract: Focusing and working on the body is inescapable in the process of enunciation, but unfortunately not sufficiently put into practice in language learning. Speaking a foreign language, being attuned in that target language, i.e. to sound as close as possible to a native speaker, implies to work on the body physically as well as mentally, which means dealing with representation because of the transfer of identity the user may experience. Dare the body voice for a body change when switching from a language to another is a necessary direction the teacher ought to lead the learners to work on.

  5. L’introuvable capitale du Mali. La question de la capitale dans l’historiographie du royaume médiéval du Mali The capital that cannot be found: The question of the capital in the historiography of the medieval kingdom of Mali

    Directory of Open Access Journals (Sweden)

    Hadrien Collet

    2013-05-01

    Full Text Available Parmi les nombreuses hypothèses portant sur la capitale du Mali à son apogée (xiiie-début xve siècle, celle de Niani, apparue sous la plume des « historiens coloniaux », a connu la plus belle fortune. Construite par l’histoire coloniale, puis partiellement déconstruite à partir des années 1970, l’hypothèse de Niani, bien que porteuse d’une façon de faire de l’histoire aujourd’hui révolue, continue d’avoir ses partisans. Apparue en 1923, elle traverse l’époque coloniale et celle des indépendances des années 1960 avant de se retrouver confrontée à la méthode critique de l’histoire académique et de l’archéologie. Cette étude propose donc d’appréhender l’historiographie spécifique à Niani, qui reflète les évolutions de l’écriture de l’histoire ancienne du Soudan, et de faire le point sur l’état des recherches actuelles sur la question de la capitale du Mali.In the writings of “colonialist historians”, the hypothesis of Niani was certainly the main one formulated about the capital of medieval Mali at its height, from the 13th till the middle of the 15th century. This hypothesis, produced by colonial history in 1923 but partially deconstructed since the 1970s, still has strong support despite its outdated approach to writing history. It was advanced during the colonial era and the period of independence (the 1960s, before being subjected to a critique from academic history and archaeology. The historiography of Niani is presented as a reflection of trends in the writing of the history of the ancient Sudan, and current research on Mali’s capital is examined.

  6. Transparence | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La transparence est un élément clé de l'engagement du gouvernement du Canada envers le gouvernement ouvert, dont l'objectif est d'améliorer l'accès aux données, aux renseignements et aux échanges. Le CRDI s'emploie à la transparence en fournissant des renseignements sur son site Web, dans ses publications, ...

  7. Le modèle spatial de la capitale allemande

    Directory of Open Access Journals (Sweden)

    Antoine Laporte

    2013-06-01

    Full Text Available En Allemagne, en 1999, le Chancelier fédéral et son gouvernement ont quitté Bonn pour Berlin. Ce transfert du pouvoir est accompagné de celui d’une grande partie de l’appareil d’État et de la haute administration, et des fonctions qui leur sont traditionnellement attribuées comme la presse, les lobbys ou encore la diplomatie. Le déplacement du statut de capitale effective de l’Allemagne de Bonn à Berlin est le résultat des évolutions géopolitiques d’un pays ayant recouvré son unité et sa pleine et entière souveraineté. Installer le pouvoir exécutif et législatif à Berlin était une démarche hautement symbolique, visant à normaliser la position de l’ancienne capitale de la RDA et du IIIe Reich comme véritable centre politique de l’Allemagne. Or le déplacement des institutions fédérales n’est pas qu’un acte symbolique. Il entraîne également à l’échelle intra-urbaine des dynamiques très concrètes sur le tissu urbain et participe à la mise en place de nouvelles centralités dans la ville. En effet, le statut de capitale d’État prédestine l’agglomération à la coprésence de nombreuses fonctions urbaines spécifiques plus ou moins directement liées à l’exercice ou à la symbolique du pouvoir.

  8. EST-SSRs

    African Journals Online (AJOL)

    user1

    2012-09-04

    Sep 4, 2012 ... sequence repeats (EST-SSRs) for Musa and their applicability in authentication of a Musa ... understanding of Musa genetics, in marker-trait associations, thereby enhancing the effectiveness of breeding programs. Key words: EST ...... antioxidant, in cavendish banana. J. Agric. Food Chem. 48(3):844-. 848.

  9. Le contrôle de gestion environnementale d'une entreprise

    OpenAIRE

    Marquet-Pondeville, Sophie

    2001-01-01

    Dans cette recherche, nous étudions comment s’opère le contrôle de gestion environnementale. Cette problématique est abordée dans une perspective contingente et nous proposons un modèle théorique qui met en évidence l’impact de certaines variables sur les systèmes de contrôle de la gestion environnementale. Certains liens présents dans ce modèle sont discutés à travers une étude de cas.

  10. Sur le chemin de Buchenwald

    OpenAIRE

    Bessière, Bernard

    2017-01-01

    En 1963, âgé de 37 ans, l’activiste communiste Jorge Semprún publie en français le roman Le Grand Voyage dans lequel il raconte le périple de 800 km qui l’avait conduit en train de Compiègne jusqu’à Buchenwald en septembre 1943. Il avait alors 19 ans. C’est dans ce camp de la mort situé près de Weimar – cité de Goethe, que Semprún admirait – qu’il sera interné jusqu’à sa libération par les troupes américaines en avril  1945. Pendant les quatre jours et cinq nuits de ce « grand voyage », le dé...

  11. Sexospécificités | Page 192 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    DOCUMENT D'INFORMATION. Le paludisme tue un enfant africain toutes les 30 secondes. Avec le VIH/sida et la tuberculose, le paludisme est l'un des principaux problèmes de santé publique menaçant le développement des pays les plus pauvres. – fiche d'information « Qu'est-ce que le paludisme ? » de l'OMS.

  12. Publications | Page 227 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... au Togo" (open access). Le projet Savoirs locaux et gestion de la biodiversité : Habitudes alimentaires et utilisation des plantes alimentaires mineures ou menacées de disparition au Togo est financé par le Centre de Recherche et de Développement International (CRDI) et exécuté par le Laboratoire de Botanique et.

  13. Publications | Page 33 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le Centre de recherches pour le développement international (CRDI) appuie le projet Research into Open Educational Resources for Development ou ROER4D (Recherche sur les ressources éducatives libres au service du développement), dont l'objectif est d'améliorer les politiques, les pratiques et la recherche en ...

  14. Publications | Page 34 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le Centre de recherches pour le développement international (CRDI) appuie le projet Research into Open Educational Resources for Development ou ROER4D (Recherche sur les ressources éducatives libres au service du développement), dont l'objectif est d'améliorer les politiques, les pratiques et la recherche en ...

  15. Eau, terre et vie : Communication participative pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    6 févr. 2007 ... Eau, terre et vie : Communication participative pour le développement et gestion des ressources naturelles ... Le CRDI investit dans des solutions locales aux problèmes auxquels l'Inde est confrontée, comme le stress thermique, la gestion de l'eau et les migrations liées aux changements climatiques.

  16. Recherche | Page 5 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Gestion des risques climatiques pour la planification de l'agriculture ... La province du Cap-Occidental est le secteur le plus rentable sur le plan de l' agriculture en Afrique du Sud et contribue de manière importante à la balance des .

  17. Mali tõotab sõjalist tööpõldu aastateks / Evelyn Kaldoja

    Index Scriptorium Estoniae

    Kaldoja, Evelyn, 1980-

    2015-01-01

    Malis on praegu käimas kolm rahvusvahelist sõjalist missiooni, mis kestavad tõenäoliselt veel aastaid. Terroriorganisatsioonid, mis tegutsesid enamasti riigi põhjaosas, külvavad hirmu ka lõunas

  18. José Antonio Ocampo : l'inclusion sociale et économique est ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    14 oct. 2015 ... Le développement rural est essentiel à la paix en Colombie, compte tenu du fait que le conflit qui perdure est principalement à caractère rural, a déclaré l'éminent économiste du développement, José Antonio Ocampo, lors d'une allocution qui a attiré un grand nombre de personnes, à Ottawa, le 25 ...

  19. Profil lipidique des personnes vivant avec le VIH sous antirétroviral ...

    African Journals Online (AJOL)

    Au regard des connaissances actuelles, aucune étude n'est disponible au Bénin sur le profil lipidique des personnes vivant avec le VIH. L'objectif de la présente étude est de décrire le profil lipidique des personnes vivant avec le VIH sous antirétroviral suivies au CHU-O/P de Porto-Novo. Il s'est agi d'une étude ...

  20. Kenya | CRDI - Centre de recherches pour le développement ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le Kenya est depuis longtemps le centre économique de l'Afrique de l'Est. Cependant, malgré des progrès économiques considérables au cours de la dernière décennie, la pauvreté et des inégalités persistent. Le bureau du CRDI à Nairobi est le point central des efforts du Centre en Afrique subsaharienne et il supervise ...

  1. Le vase de Pandore

    Directory of Open Access Journals (Sweden)

    Nicola Panichi

    2000-06-01

    Full Text Available Il s’agit ici de suivre les stratégies discursives par lesquelles Érasme situe sa Lingua sous le patronage symbolique de deux mythes des plus opératoires à la Renaissance : le vase de Pandore et la tour de Babel, tous deux verrouillant le texte, l’un en guise d’incipit, l’autre d’explicit, dans un dialogue où chacun use de l’autre pour renforcer les significations et instaurer le régime sémantique du texte, tant linguistique qu’éthique. Ce sont ces jeux complexes entre différents niveaux de discours dont dépend le sens ultime de l’œuvre que cet article s’attache à saisir.Se trata de seguir aquí las estrategias discursivas mediante las cuales Erasmo sitúa su Lingua bajo el dominio simbólico de dos de los mitos más funcionales del Renacimiento: el vaso de Pandora y la torre de Babel, los cuales limitan el texto, uno a modo de íncipit, otro de excipit, en un diálogo en el que se valen el uno del otro para reforzar los significados y establecer el régimen semántico del texto, tanto lingüístico como ético. Son esos juegos complejos entre diferentes niveles de discurso, de los que depende el sentido último de la obra, que este artículo intenta captar.

  2. Le réseau GEOHealth d'Afrique orientale pour la prévention des ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ce projet est mis en oeuvre dans le cadre de l'initiative Global Environmental and Occupational Health, sous la direction du Fogarty International Center des National Institutes for Health des États-Unis, en collaboration avec le Centre de recherches pour le développement international. Le volet de recherche générale est ...

  3. Prévalence du tabagisme chez le personnel de l'Hôpital Général de ...

    African Journals Online (AJOL)

    Les personnes pensent que c'est leur devoir de questionner sur le tabac et de prendre en charge les fumeurs, mais ils sont presque un sur deux à ignorer la loi Camerounaise. Conclusion: Le tabagisme chez le personnel hospitalier est une réalité au Cameroun ; le personnel soignant et les pouvoirs publics devraient ...

  4. 3. Le moraliste, le sociologue et le juge : objectivation et production de la connaissance

    OpenAIRE

    Noreau, Pierre

    2018-01-01

    Commedia del diritto Œuvre spécialement réalisée pour cet ouvrage par Maya Pankalla Le rapport qu’entretiennent les sciences sociales et le monde des valeurs est traversé par l’ambiguïté. Ce que nous pourrions appeler ici l’« engagement sociologique » de Guy Rocher témoigne de cette tension continue ; il exemplifie les relations complexes qui lient le mouvement de la pensée au monde de l’action. Comme il le rappelle lui-même dans ses entretiens avec Georges Khal, à la fin d’u...

  5. L’Association du personnel, le TREF, le Comité des Finances et le Conseil du CERN

    CERN Multimedia

    Staff Association

    2016-01-01

    L’Association du personnel, forte de son approche participative et consensuelle, recherche toujours le meilleur accord possible pour l’Organisation et son personnel. Pour ce faire, discussions et concertation avec la Direction, travail d’explication et de persuasion au TREF et ailleurs auprès des délégués des États membres sont nos principaux atouts. TREF (Tripartite Employment Conditions Forum), un Forum d’échanges, de discussions « L’objectif du Forum est d’améliorer le processus de prise de décision  en donnant aux personnes concernées la possibilité et le temps de comprendre pleinement la position de tous les participants. » (CERN/RTG/8) Le Forum tripartite sur les conditions d’emploi (TREF), créé par le Conseil du CERN en juin 1994, est composé de r...

  6. Guinean biodiversity at the edge : rodents in forest patches of southern Mali

    OpenAIRE

    Granjon, Laurent; Duplantier, Jean-Marc

    2011-01-01

    Southern Mali mainly belongs to the Sudanian savanna bioclimatic zone, but forest patches showing botanical affinities with Guinean humid forest remain as gallery forests or ravine forests. To characterize the rodent diversity of this area and check for the presence of some species of Guinean affinities in this group, rodent assemblages were sampled in four regions of southern Mali, using trapping and observational data in forest and surrounding habitats. Twenty-four species were recorded, co...

  7. Avian influenza in backyard poultry of the Mopti region, Mali.

    Science.gov (United States)

    Molia, Sophie; Traoré, Abdallah; Gil, Patricia; Hammoumi, Saliha; Lesceu, Stéphanie; Servan de Almeida, Renata; Albina, Emmanuel; Chevalier, Véronique

    2010-06-01

    This study reports the first evidence of circulation of avian influenza viruses (AIV) in domestic poultry in Mali. In the Mopti region, where AIV have already been isolated in migratory water birds, we sampled 223 backyard domestic birds potentially in contact with wild birds and found that 3.6% had tracheal or cloacal swabs positive by real-time reverse transcription PCR (rRT-PCR) for type A influenza viruses (IVA) and that 13.7% had sera positive by commercial ELISA test detecting antibodies against IVA. None of the birds positive by rRT-PCR for IVA was positive by rRT-PCR for H5 and H7 subtypes, and none showed any clinical signs therefore indicating the circulation of low pathogenic avian influenza. Unfortunately, no virus isolation was possible. Further studies are needed to assess the temporal evolution of AIV circulation in the Mopti region and its possible correlation with the presence of wild birds.

  8. Crisis in Mali: Ambivalent Popular Attitudes on the Way Forward

    Directory of Open Access Journals (Sweden)

    Massa Coulibaly

    2013-07-01

    Full Text Available This article asks what Malians think about their country’s political crisis, including its causes, status, and possible solutions. An Afrobarometer survey of public opinion conducted at the end of 2012 finds the electorate in an apprehensive and ambivalent mood. Malians express declining faith in democracy as well as considerable (but diminishing trust in the army. In a sign of democratic resilience, however, a large and broad majority continues to believe in elections as the best way to reconstitute a government. But only in the context of a stable and intact state – with an inclusive constitutional settlement, trustworthy civilian institutions, and engaged citizenry – will Mali be ready again for routine presidential and legislative elections.

  9. « Suivre la route ».Mobilités et échanges entre Mali, Mauritanie et Sénégal

    Directory of Open Access Journals (Sweden)

    Armelle Choplin

    2010-12-01

    Full Text Available Cinquante ans après l’indépendance du Sénégal, du Mali et de la Mauritanie, la question de l’intégration régionale, de la fluidification des échanges et des mouvements de populations entre les trois Etats se pose avec acuité. Il s’agit de confronter les principes de la CEDEAO (libre circulation des biens et des hommes à la réalité des mobilités dans cette région. Reposant sur une enquête de terrain multi-située le long de la route, cet article rend compte des contradictions entre l’essor des réseaux de transports, l’intensification des échanges et les pratiques sociales transnationales entravées par de nombreux contrôles.Fifty years after the independence of Senegal, Mali and Mauritania, the issue of regional integration and political relations between the three states is at stake. The ECOWAS promotes the establishment of a common market and free movement of people. This article sheds light on the spreading of transports networks, increasing exchanges and people transborder practices. Based on a multi-sited fieldwork along the “route”, this paper highlights new form of popular transnationalism but also the contradiction between Ecowas theoretical principles and the growing controls, which hinder circulation.

  10. Good Morning Babilonia … le patrimoine « immatériel » des universités est-il un acte manqué ? Brèves réflexions sur le cas de l’Université libre de Bruxelles

    Directory of Open Access Journals (Sweden)

    Didier Devriese

    2012-03-01

    Full Text Available La situation institutionnelle de l’Université libre de Bruxelles, comme de la plupart des Universités belges, suppose la possession en propre d’un patrimoine et une autonomie de gestion complète en la matière. Cette situation appelle indubitablement de nombreuses questions. Il s’agit notamment de s’interroger sur la conscience de l’existence de ce patrimoine chez les membres de la communauté, sur son existence – ou non - comme élément de construction de l’identité collective de l’Université et sur une valorisation ad hoc, tant vis-à-vis des membres de la communauté universitaire qu’à l’extérieur de celle-ci. Par-delà le contexte institutionnel, légal et réglementaire, on évoquera ici quelques étapes de l’histoire des unités patrimoniales (Archives, musées, Réserve précieuse … et on s’interrogera sur les intentions qui président à la constitution d’un patrimoine raisonné.As an institution, the Free Brussels University, like any other Belgian University, has its own cultural patrimony and has the right to manage it by itself. This obviously gives rise to a number of questions. What is the awareness of this patrimony among University members? How does it help establishing a collective identity? How can it be used and promoted inside and outside the University? Beyond the legal, institutional and regulatory contexts, here will be brought up a few steps in the History of patrimonial units (Archives, museums, Réserve précieuse…, as well as a reflection about the purpose behind the establishment of a reasoned patrimony.

  11. Le marketing : quelle contribution au bien commun ?

    OpenAIRE

    Béji-Bécheur, Amina

    2015-01-01

    National audience; Partons d'un constat : le marketing est né pour servir l'entreprise capitaliste et le développement de ses marchés. Le but ultime étant la création de richesses et par ricochet le bien-être des populations. Un ensemble d'outils marketing ont été créés pour accompagner les enjeux de performance économique des entreprises. Reprenant les travaux de Jean-Claude Moisdon (Du mode d'existence des outils de gestion, les instruments de gestion à l'épreuve de l'organisation 1), ces o...

  12. Infarctus du myocarde chez le Togolais : Facteurs de risque eyt ...

    African Journals Online (AJOL)

    Le diagnostic de l'infarctus du myocarde (IDM) chez les noirs n'est pas aisé. Effet l'électrocardiographie (ECG) présente souvent chez ces derniers, des atypies de repolarisation. Le dosage des enzymes cardiaques devient donc incontournable. Notre objectif est d'évaluer les facteurs de risque chez les malades Togolais ...

  13. Case Report - Le kyste hydatique du cordon spermatique: Une ...

    African Journals Online (AJOL)

    L' hydatidose est une anthropo-zoonose due au développement chez l'homme de la forme larvaire du taenia Echinococcus granulosis. La plupart des kystes hydatiques se localisent dans le foie et les poumons. Le kyste hydatique du cordon spermatique est extrêmement rare avec seulement 4 cas rapportés dans la ...

  14. Prevalence du cancer de la prostate a l'autopsie chez le noir africain ...

    African Journals Online (AJOL)

    Objectifs : Le cancer de la prostate est le cancer le plus fréquent de l'homme de plus de 50 ans dans les pays occidentaux. En Afrique le bas niveau de médicalisation et les difficultés à l'accès des services de santé rendent cette affection moins connue et le diagnostic tardif, parfois même non diagnostiquée. Le but de cette ...

  15. Vers une plus grande collaboration régionale — le CRDI appuie le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    26 janv. 2011 ... Bien qu'ils aient souvent de la difficulté à se démarquer face à la véritable dynamo économique qu'est la Chine, des pays tels que le Laos, le Cambodge et le Vietnam, qui tentaient d'échapper à la guerre il y a à peine 25 ans, connaissent une croissance explosive encore plus remarquable. Renaissance ...

  16. Rapport financier trimestriel pour le trimestre qui a pris fin le 31 ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sophie Comeau

    31 déc. 2011 ... Le Centre de recherches pour le développement international. CRDI , qui est un élément clé de l'aide internationale du. Canada depuis 1970, appuie des travaux de recherche dans les pays en développement afin d'y favoriser la croissance et le développement. Il veille aussi à promouvoir la diffusion.

  17. Le « modèle germanique » Français

    OpenAIRE

    Lefebvre , Armelle

    2009-01-01

    Resume Le concept d?Allemagne permet de reveler, selon une approche , l?ampleur des desaccords ayant preside a la definition du concept d?Etat en France. De ce dernier, l?on aborde divers emplois qu?illustrent des modeles d?Etat. Le opere ainsi dans un debat qui est le creuset de la connaissance politique moderne, avec ses apories: celles de la souverainete externe, de l?ordre interetatique, de la confederation. L?article expose alo...

  18. 205 Le Role de la Litterature dans le Developpement de la Nation ...

    African Journals Online (AJOL)

    Ike Odimegwu

    du plaisir en même temps qu'il le moralise. Elle fait naître dans ses lecteurs ou dans son audience des .... développement de l'esprit>>(319)Par cette définition nous comprenons que le développement signale qu'il du progrès ... qu'elle est une œuvre de l'imagination qui aide l'homme à transcender le monde physique.

  19. LE CARCINOME ONCOCYTAIRE DE LA PAROTIDE : A PROPOS D ...

    African Journals Online (AJOL)

    Après chirurgie, les récidives sont fréquentes. Lele de la radio- thérapie et de chimiothérapie est toujours controversé.Le pronostic est mauvais. Mots clés : Carcinome oncocytaire, parotide, chirurgie, radiothérapie. SUMMARY. Introduction : Oncocyticcarcinomais a rare salivary gland tumor. its management is not codified ...

  20. Le monde virtuel: Miroir des changements reels en Algerie | Nafa ...

    African Journals Online (AJOL)

    Virtuel: ce mot dénote plusieurs sens. Dans un premier temps, le mot virtuel fait référence à Internet qui est le lieu de notre recherche. Deuxièmement, la philosophie explique le mot virtuel en termes de ce qui est possible. Nous en arrivons à l'objet de notre article : une réflexion sur les futurs possibles des nouveaux ...

  1. Une nouvelle ouverture sur le monde pour les femmes | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    'appellent ailleurs dans le dédale d'étals et d'allées serrés. En plus de son travail sur le marché, Jertrudes est également secrétaire de l'association des femmes qui vendent sur ce marché. Le groupe est un endroit où elles ...

  2. : Le cancer du col de l'utérus, nouvelles stratégies de dépistage ?

    OpenAIRE

    Heard , Isabelle; Costagliola , Dominique

    2008-01-01

    National audience; Le cancer du col de l'utérus reste le deuxième cancer le plus fréquent chez les femmes dans le monde, alors que son dépistage, par le frottis, existe depuis plus de 50 ans. En France, le cancer du col de l'utérus est le huitième cancer féminin avec 3 387 nouveaux cas estimés en 2000

  3. Le grand inventaire

    Directory of Open Access Journals (Sweden)

    Michel Melot

    2012-05-01

    Full Text Available Depuis quarante ans qu’il existe, l’Inventaire général des monuments et des richesses artistiques de la France n’a pas seulement progressé, couvrant près de dix mille communes, documentant plus de vingt mille dans cinq millions de pages, trois millions de photographies, et cent mille dessins. Il est devenu ce que ses fondateurs désiraient qu’il fût. Il n’est pas une liste d’objets plus ou moins singuliers qu’on aurait oubliés, mais l’observation méthodique de l’émergence dans le monde de l’ar...

  4. Publications | Page 179 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Lele de l'énergie dans le développement rural. Hisham Zerriffi n'a aucun mal à énumérer les bienfaits de l'électrification des zones rurales : une ... Enterrer la hache de guerre : le CRDI appuie un processus de paix inédit. La plupart des gens pensent que la paix est un état dans lequel soit il « ne se produit rien de ...

  5. Publications | Page 177 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Lele de l'énergie dans le développement rural. Hisham Zerriffi n'a aucun mal à énumérer les bienfaits de l'électrification des zones rurales : une ... Enterrer la hache de guerre : le CRDI appuie un processus de paix inédit. La plupart des gens pensent que la paix est un état dans lequel soit il « ne se produit rien de ...

  6. Plaidoyer pour le lavage de nez dans les pathologies naso ...

    African Journals Online (AJOL)

    Le lavage de nez permet l'humidification des muqueuses partant favorise le nettoyage mucociliaire en enlevant voire diminuant les croutes favorise leur élimination et ainsi la guérison en réduisant le recours aux antibiotiques [4-10]. Sans danger, le lavage de nez est bien tolérée tant chez les enfants que chez les adultes.

  7. Publications | Page 59 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le rapport régional de 2012 du projet Global Entrepreneurship Monitor (GEM), qui porte sur l'Afrique subsaharienne, est le premier à examiner les dynamiques d'entrepreneuriat dans la région. Il a été lancé à Lusaka, en Zambie, le 19 novembre 2013. Les données recueillies par le Zimbabwe sur la pauvreté : un apport ...

  8. Gestion du Centre | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le Comité de gestion du Centre (CGC) est composé des membres de la haute direction du CRDI, notamment les directeurs de nos quatre bureaux régionaux et de nos principaux secteurs de programme. Le CGC travaille en collaboration avec le président afin de soutenir la recherche pour le développement, lui fournissant ...

  9. Le paludisme, le tsunami silencieux d'Afrique | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    12 janv. 2011 ... Dans un élan de compassion fort justifié, le monde s'est porté au secours des victimes du tsunami qui a touché récemment la région de l'océan Indien. Mais il ignore qu'un « tsunami silencieux », le paludisme, s'abat sans cesse sur l'Afrique et y fait chaque année plus de 1,5 million de victimes, surtout de ...

  10. Le théâtre de la politique

    Directory of Open Access Journals (Sweden)

    Michel Contat

    2007-06-01

    Full Text Available Chacun aujourd’hui choisit son Sartre, comme on choisissait son Marx dans les lointaines années 1960, celui des Grundrisse, celui des manuscrits de 1848 ou celui du Capital. Une citation : 'De toute façon, l’ordre social repose aujourd’hui sur la mystification des consciences, comme aussi le désordre. Le nazisme était une mystification et le gaullisme en est une autre, le catholicisme en est une troisième ; il est hors de doute, à présent, que le communisme français en est une quatrième.' C’est Sartre qui parle, le Sartre 1947, celui de Qu’est‐ce que la littérature ? – le Sartre que l’on a peut‐être aujourd’hui le plus de satisfaction à suivre. (Situations II, p. 306. Cité par Julia Kristeva. Le centenaire de 2005 a révélé que Sartre reste toujours l’objet vivant d’une polémique, que ce nom recouvre un homme et une pensée à attaquer, parce que, finalement, comme il le disait, « l’intelligence offense ».

  11. Changer le travail des animaux, pour changer le travail des humains

    OpenAIRE

    Porcher, Jocelyne

    2016-01-01

    Animaux et hommes construisent des liens par le travail, explique l’auteure de cette tribune. Il existe même un « travailler » de l’animal, où celui-ci s’investit et recherche du sens. Réfléchir au travail des animaux, c’est aussi s’interroger sur le travail humain.

  12. Quand le dentier devient danger!

    Science.gov (United States)

    Sadak, Nouzha; Herrak, Laila; Achachi, Leila; El Ftouh, Mustapha

    2017-01-01

    Bien que rare chez l'adulte, l'inhalation de corps étranger (CE) est un accident grave pouvant mettre en jeu le pronostic vital ou entrainer des séquelles importantes. Nous rapportons l'observation d'un patient de 50 ans, sans antécédents pathologiques particuliers, qui s'est présentée aux urgences pour douleur thoracique, toux intermittente et dyspnée d'effort, six jours après avoir inhalé, accidentellement, sa prothèse dentaire en plastique lors d'un repas. L'examen clinique était sans particularités. La radiographie thoracique ainsi que l'ASP ne montraient pas d'anomalie. Une bronchoscopie souple sous anesthésie générale a permis de visualiser le CE au niveau du tronc intermédiaire et l'extraction a été réalisée avec succès évitant ainsi le recours à un geste beaucoup plus invasif. La radiographie standard peut s'avérer utile en visualisant les CE radio-opaque ou par des signes indirects évoquant la présence d'un CE, mais le recours à la bronchoscopie à visée diagnostique et thérapeutique est primordial. PMID:28904706

  13. Le recueil littéraire

    OpenAIRE

    Alduy, Cécile; Asselin, Isabelle; Audet, René; Baetens, Jan; Beaudet, Marie-Andrée; Bissonnette, Thierry; Bonenfant, Luc; Bouchet, André du; Brault, Jacques; Brouillette, Marc André; Clément, Anne-Marie; Denis, Benoît; Doucet, Isabelle; Dumont, François; Dupont, Frances Fortier et Caroline

    2016-01-01

    Architecte d'une œuvre plurielle, le recueil est de toutes nos lectures. Puzzle ou série, cycle ou mélange, il se feuillette, se reprend, se quadrille ou se picore. Mais qu'est-ce donc qu'un recueil ?

  14. La parole est à vous

    CERN Multimedia

    Staff Association

    2015-01-01

    Nous avons identifié, ci-dessous, 3 grands chapitres pour lesquelles bon nombre d’entre vous se posent des questions et ont fréquemment sollicités leurs délégués, qui n’ont pas toujours pu donner de réponses : La retraite et sa préparation. L’affiliation aux régimes sécurité sociale de nos états hôtes et ses conséquences au moment de la retraite. La fiscalité en général. Le service juridique, que nous avons interrogé récemment, n’est pas toujours informé de vos interrogations et de ce fait, il n’a pas encore pu investiguer sur ces questions auprès des services compétents. Il nous a suggéré de vous interroger afin de collecter vos questions, de les synthétiser, afin de les transmettre...

  15. EST Vocabulary Instruction

    Directory of Open Access Journals (Sweden)

    Célia D.S. Bell

    2012-05-01

    Full Text Available This study aims at contributing to the investigation on the instruction of EST (English for Science and Technology vocabulary, in terms of receptive use of the language. It evaluates the effectiveness of two teaching approaches to the acquisition of vocabulary. The first approach consisted of teaching vocabulary through the use of dictionaries, where the words were merely translated into the learners’ L1 or defined in the target language thus promoting superficial level of word processing. The second approach employed activities promoting deep level of word processing. Data were analysed quantitatively. Results indicated that the two approaches seem to have some equipotentiality, as far as EST vocabulary is concerned.

  16. Contester le mariage forcé : mettre en place la ligne de défense et le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Recherche visant à améliorer les possibilités pour les femmes. En Inde, les lois sur le mariage varient selon les religions. Le droit civil en matière de mariage est la Loi spéciale sur le mariage, qui permet aux parties de différentes religions de se marier sans changer de religion. Elle exige le consentement explicite des deux ...

  17. Lele des petites villes dans la poursuite de meilleurs résultats en ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La population et le produit intérieur brut (PIB) de ces petites villes connaissent une croissance impressionnante. Cette tendance devrait s'intensifier au cours des prochaines décennies. Recherche sur les petites villes en vue de meilleurs résultats. Lele des petites villes dans le développement socio-économique est mal ...

  18. : tous les projets | Page 476 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le peuple autochtone Mapuche est établi sur ce qui est aujourd'hui le sud-ouest de l'Argentine et le sud du Chili. Date de début : 31 juillet 2008. End Date: 31 janvier 2011. Sujet: INDIGENOUS POPULATION, PROTECTED AREAS, Natural Resources, RESOURCES MANAGEMENT. Région: Argentina, South America, ...

  19. : tous les projets | Page 475 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le peuple autochtone Mapuche est établi sur ce qui est aujourd'hui le sud-ouest de l'Argentine et le sud du Chili. Date de début : 31 juillet 2008. End Date: 31 janvier 2011. Sujet: INDIGENOUS POPULATION, PROTECTED AREAS, Natural Resources, RESOURCES MANAGEMENT. Région: Argentina, South America, ...

  20. Le regard anachronique

    Directory of Open Access Journals (Sweden)

    Jean-Paul Aubert

    2011-01-01

    Full Text Available Cet article a pour objet l’anachronisme dans le film historique. Il s’appuie sur l’étude du long métrage Goya à Bordeaux, réalisé en 1999 par le cinéaste espagnol Carlos Saura. Cette biographie filmée du peintre Francisco de Goya fait mieux que composer avec l’anachronisme inhérent à toute reconstitution historique. Il l’assume et le revendique. La mise en cause de la chronologie et l’effacement de l’Histoire prennent sens dans la perspective d’une réflexion originale sur l’Histoire de l’art conçue comme un dialogue entre les œuvres et entre les époques.Este artículo está dedicado al problema del anacronismo en las películas históricas. Se basa en el estudio de Goya en Burdeos, un largo metraje rodado en 1999 por el director de cine español Carlos Saura. Esta biografía de Goya no sólo se acomoda con el anacronismo propio de la reconstitución histórica sino que lo asume y lo reivindica. El cuestionamiento de la cronología y el desinterés por la Historia cobran un nuevo sentido en el marco de una reflexión original sobre la Historia del arte concebida como un diálogo entre las obras y entre las épocas.

  1. Le barde et le bouffon

    OpenAIRE

    Fasquel, Samuel

    2013-01-01

    La Gatomaquia de Lope de Vega, La Moschea de Villaviciosa et le Poema heroico de las necedades y locuras de Orlando el enamorado de Quevedo constituent un corpus poétique qui réunit les meilleurs fruits produits par la geste burlesque dans l’Espagne du Siècle d’or. Cet article analyse les profondes différences esthétiques qui caractérisent ces œuvres dans le but de montrer que, malgré ces différences et en dépit de l’importance des éléments carnavalesques et grotesques, ces trois poèmes ne pr...

  2. Le travail … c’est la santé : la santé au travail … une pratique en question Work… is health : health at work … a practice in question La salud laboral… una práctica en cuestionamiento

    Directory of Open Access Journals (Sweden)

    Paul Frimat

    2010-02-01

    Full Text Available C’est en 1946 qu’est née cette institution originale qu’est la médecine du travail. Au départ, principalement basée sur une approche essentiellement individuelle, la notion d’aptitude y occupait une place centrale au sein du système de santé. Ce système a connu des évolutions où l’approche individuelle s’est peu à peu couplée à une dimension plus collective, laissant cependant encore un système largement perfectible. Dans ces évolutions, la décision d’aptitude s’est, quant à elle, complexifiée. De nombreux rapports ont d’ailleurs été écrits ces cinq dernières années afin de mettre en débat à la fois la légitimité de pérenniser un tel concept, mais également son efficacité en ce qui a trait à la prévention des pathologies liées au travail. Une loi sera sans doute prévue fin 2009, 2010… Mais qu’en sera-t-il de la pratique, quelle réalité perdurera ? Apte/inapte ? Comment peut-on aider à la compatibilité entre droit à la santé et droit au travail ? En quoi le système français de l’aptitude et de l’inaptitude a pu offrir des garanties pour l’employeur, le salarié, la société ? Tel sera l’objet de cette intervention.It was in 1946 that this new original institution, occupational medicine, was created in France. At the beginning, based mainly on an essentially individual approach, the concept of medical ability held a central place in the health system. This system has changed and the individual approach is now paired with a more collective vision, leaving the system still largely perfectible. Among these evolutions, the medical ability decision has become increasingly complex. Numerous reports have been written in the last five years to debate the legitimacy of maintaining such a concept, as well as its efficiency as far as the prevention of work-related pathologies is concerned. A law will certainly be expected at the end of 2009/beginning of 2010. But, what about

  3. Rapport financier trimestriel pour le trimestre qui a pris fin le 31 ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Office 2004 Test Drive User

    31 déc. 2015 ... Budget 2015-2016 révisé. Le Conseil a approuvé le budget 2015-2016 avant le début de lʼexercice. Cʼest sur ce budget que sont fondées les sommes budgétaires qui ont été présentés dans le Rapport annuel. 2014-2015. En octobre, on a revu les prévisions budgétaires initiales en tenant compte des.

  4. Le modèle de l’erreur humaine de James Reason

    OpenAIRE

    Larouzée, Justin; Guarnieri, Franck; Besnard, Denis

    2014-01-01

    Ce papier de recherche a pour objet de revenir en détail sur les travaux de recherche du psychologue anglais James Reason, mondialement célèbre pour sa taxonomie de l’erreur humaine et son modèle étiologique de l’accident immensément connu sous le nom de Swiss Cheese Model (SCM) ou Modèle du Fromage Suisse. Ce papier de recherche est une synthèse du parcours scientifique de Reason, il revient aussi sur la conception du modèle et ses évolutions, il traite de ses usages, apports et limites. Il ...

  5. Le Fleix – Bourg Ouest

    OpenAIRE

    Gineste, Marie-Christine

    2013-01-01

    Date de l'opération : 2009 (EX) Le projet d’extension d’une cantine scolaire est à l’origine de cette prescription. Il concerne une parcelle de 1 438 m2 située sur un replat de la terrasse holocène, en bordure d’un affluent de la Dordogne ; le Lasolle du Bost, dans le périmètre supposé de l’agglomération antique appelée « ville de Meille ». L’assiette du projet correspond au XIXe siècle à un secteur agricole non bâti. Deux tranchées ont été réalisées, occasionnant la découverte, surtout au no...

  6. Breastfeeding and weaning in Mali: cultural context and hard data.

    Science.gov (United States)

    Dettwyler, K A

    1987-01-01

    Patterns of infant feeding, based on cultural beliefs, affect the nutritional status, health, and growth of children. In order to understand malnutrition and infant health in a particular community, knowledge of both the beliefs and the practices associated with infant feeding in that community is essential. For this reason, it is critical that research strategies for collecting both traditional 'soft' data (the cultural context) and 'hard' data (observed patterns of infant feeding) be employed. A two-year study of infant feeding in Mali (1982-1983) provides detailed information about breastfeeding and weaning beliefs and practices. In this community, virtually all women breastfed their infants. Infants were nursed on demand, for comfort as well as nutrition. Weaning took place at an average age of 20.8 months, with a range of 6-32 months (N = 136). Bottle/formula use was very rare. Breastfeeding and weaning practices affected the growth and development of infants during the first two years of life. In contrast to many other populations, however, a number of infants in this community showed improved growth after weaning. Some traditional beliefs about infant feeding are changing under the pressure of urban norms, while others remain resistant to change, with varying effects on infant health.

  7. [Ivermectin and pregnancy in mass treatment in Mali].

    Science.gov (United States)

    Doumbo, O; Soula, G; Kodio, B; Perrenoud, M

    1992-01-01

    During july 1989, we have done a retrospective study, in Koba's valley in a savanna onchocerciasis area of Mali, after a mass treatment in rural community with ivermectin. 435 women aged from 15 to 45 years, among 461 with can be submitted to ivermectin risk during their pregnancy period, was seen and overhauled. In 1987, the frequency of women who received ivermectin during their pregnancy period (treated by error), was 17.7%, and 17.3% in 1988. We have seen any difference, between exposed and not exposed women to this error ivermectin treatment, comparing their in utero-mortality, new born mortality an the level of malformations. In spite of careful clinical monitoring in the field, the risk to give ivermectin to pregnancy women in rural community, is very high during mass treatment. Because traditionally (taboos), pregnancy is a forbidden subject. Sociological and anthropological studies, pregnancy field laboratory test and health education, are needed in african rural community before mass treatment with ivermectin.

  8. The Sahelian crisis and the poor : the role of Islam in social security among Fulbe pastoralists, Central Mali

    NARCIS (Netherlands)

    Bruijn, de M.E.

    1994-01-01

    This paper examines how poor members of Fulbe society, a group of agropastoralists in the Sahel, central Mali, are surviving after two decades of environmental disaster. The focus is on the Jalloube of the Hayre in central Mali. Social security relations and institutions based on Islam seem to be

  9. Le futur du travail | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    12 juin 2017 ... Une base de données probantes est nécessaire afin de trouver des solutions stratégiques et sociales appropriées aux divers défis que posent ces nouveaux modes de travail. La recherche sur l'innovation en matière d'éducation et le renforcement des capacités seront également essentiels pour assurer la ...

  10. Le principe non bis in idem et le droit communautaire

    OpenAIRE

    Hedabou, Aziz

    2018-01-01

    Le principe non bis in idem est une garantie fondamentale qui interdit que les mêmes faits soit poursuivi et puni deux fois. Il est reconnu par tous les droits internes et “appartient aux droit universel des nations”. Dès lors, sa lettre et son esprit ne sont plus cantonnés au droit interne et ont tendance à s’internationaliser. En droit communautaire, l’étude du principe non bis in idem peut être envisagée sous trois angles différents. D’abord en droit pénal international unilatéral où chaqu...

  11. Le glaive de la parole

    Directory of Open Access Journals (Sweden)

    Luce Marchal-Albert

    2006-09-01

    Full Text Available Chacun sait, selon le mot de Pierre Viret, « en quelle confusion est la Chrestienté » au xvie siècle en Europe. C’est le deuxième quart du siècle qui nous intéressera ici, et en particulier l’année 1545, qui constitue une année charnière qui voit vaciller l’Église romaine, flamber et culminer la chasse aux hérétiques en même temps qu’elle voit la jeune Église réformée se renforcer et se positionner avec succès dans un champ religieux plus que chaotique. Les ouvrages polémiques réformés écrits...

  12. Aharon Appelfeld et Philip Roth : le réel, l’imaginaire, le double et le fantastique

    OpenAIRE

    Toren, Orly

    2014-01-01

    C’est la marge étroite entre « le réel et l’imaginaire » selon le titre de l’essai de Masha Itzhaki sur Appelfeld que nous souhaiterions explorer à partir de la relation entre Le Temps des prodiges d’Appelfeld et Opération Shylock de Philip Roth. Si la vrai/fausse « confession » de Roth se présente comme le détournement vertigineux des codes du fantastique, de l’autobiographie et de l’autofiction, le roman d’Appelfeld pousse les limites du réalisme par l’interrogation que suscite son titre én...

  13. Leïomyosarcome de la prostate: Neoplasie rare

    Directory of Open Access Journals (Sweden)

    D. Basraoui

    2012-03-01

    La TDM et surtout l'IRM jouent un rôle primordial dans le bilan d'extension locale et à distance du léïomyosarcome prostatique et le seul moyen pour affirmer le diagnostic est l'histologie complétée par une étude immuno-histochimique. Leur prise en charge thérapeutique n'est pas codifiée à l'heure actuelle et leur pronostic reste très sombre.

  14. Abeilles et agriculture : Le tumultueux mariage entre abeilles et agriculture

    OpenAIRE

    Requier, Fabrice; Le Feon, Violette

    2016-01-01

    Le miel est la première image qui vient en tête à l’écoute du mot « abeille ». Pourtant, le miel que nous consommons est produit par une seule espèce, l’abeille mellifère (Apis mellifera), tandis que le mot « abeille » cache en réalité une multitude d’autres espèces très diversifiées et indispensables pour garantir le fonctionnement des écosystèmes et les rendements agricoles.

  15. France’s War in Mali: Lessons for an Expeditionary Army

    Science.gov (United States)

    2014-01-01

    preference for “audacious,” bold, and dramatic movements.20 Napoleon , both 15 Chevènement et al., Rapport d’ information fait au nom de la commission des...France’s] 21 “À la guerre, l’audace est le plus beau calcul du génie.” Napoleon may have been making a pun, since génie refers both to “genius” and...marine 3e Brigade mécanisée Light armored One recon- naissance squadron, one armored squadron AMX-10rC France 92e régiment d’infanterie 3e

  16. Le CRDI au Sri Lanka

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI appuie la recherche au Sri. Lanka depuis 1973. Il s'est d'abord concentré sur l'amélioration des pratiques agricoles. Par exemple, grâce à la mise au point d'un système de rizi - culture permettant d'exploiter les pluies de mousson, les riziculteurs ont triplé leurs rendements en quatre ans. Ils ont été nombreux à ...

  17. Kyste hydatique du foie rompu dans la paroi abdominale et dans le ...

    African Journals Online (AJOL)

    Le kyste hydatique du foie est une parasitose qui sévit à l´état endémique au maroc. La rupture dans la paroi abdominale et dans le psoas est une complication exceptionnelle. Nous rapportons un cas de kyste hydatique du foie rompu dans la paroi et dans le muscle psoas. Le diagnostic a été établi sur les données de ...

  18. Stimuler le tourisme dans les cantons de l'Afrique du Sud | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    12 juil. 2011 ... J'ai vite compris qu'on perd le client si l'on ne répond pas rapidement à un message électronique », affirme-t-elle. Le tourisme dans les cantons. Le Cap est en voie de devenir une destination touristique de choix. Elle se situe au troisième rang en Afrique, après Johannesburg et Le Caire, pour ce qui est du ...

  19. Phyllactinia mali and Podosphaera tridactyla var. tridactyla – new hosts of Ampelomyces quisqualis

    Directory of Open Access Journals (Sweden)

    Beata Czerniawska

    2014-08-01

    Full Text Available In 2002, the occurrence of fungi of the order Erysiphales on plants of the Słowiański Park located in Goorzów Wielkopolski was investigated. Plant samples were collected once a month, from August to November. The samples examined were above ground plant parts colonized by powdery mildew fungi. A total of 78 samples were collected. Apart from 14 species of the order Erysiphales, Ampelomyces quisqualis parasitizing on Erysiphe cichoracearum var. cichoracearum, Phyllactinia mali and Podosphaera tridactyl var. tridactyla was found. Ampelomyces quisqualis affected hyphae, oidia, and young cleistothecia of P. mali. In contrast, in E. cichoracearum var. cichoracearum, Po. tridactyle var. tridactyla, this hyperparasite colonized only hyphae and oidia. This paper for the first trime informs of A. quisqualis parasitizing on P. mali and Po. tridactyla var. tridactyla.

  20. qu'île d'Ampasindava : transformations du paysage et système

    African Journals Online (AJOL)

    France, of an important territory including the peninsula (August ... images satellite montre que le rythme auquel le tavy est pratiqué .... Ce qui est paradoxal, c'est que d'importantes surfaces de zones carto- graphiées comme des forêts humides secondaires par Humbert et Cours Darne (1965) correspondent à des zones ...

  1. CitEST libraries

    Directory of Open Access Journals (Sweden)

    Maria Luísa P. Natividade Targon

    2007-01-01

    Full Text Available In order to obtain a better understanding of what is citrus, 33 cDNA libraries were constructed from different citrus species and genera. Total RNA was extracted from fruits, leaves, flowers, bark, seeds and roots, and subjected or not to different biotic and abiotic stresses (pathogens and drought and at several developmental stages. To identify putative promoter sequences, as well as molecular markers that could be useful for breeding programs, one shotgun library was prepared from sweet orange (Citrus sinensis var. Olimpia. In addition, EST libraries were also constructed for a citrus pathogen, the oomycete Phythophthora parasitica in either virulent or avirulent form. A total of 286,559 cDNA clones from citrus were sequenced from their 5’ end, generating 242,790 valid reads of citrus. A total of 9,504 sequences were produced in the shotgun library and the valid reads were assembled using CAP3. In this procedure, we obtained 1,131 contigs and 4,083 singletons. A total of 19,200 cDNA clones from P. parasitica were sequenced, resulting in 16,400 valid reads. The number of ESTs generated in this project is, to our knowledge, the largest citrus sequence database in the world.

  2. Le déficit de filles

    International Development Research Centre (IDRC) Digital Library (Canada)

    qui veulent former un couple idéal. D'autre part, les chercheuses indiquent que le céli- bat des femmes est perçu comme une « aberration totale ». Tous les répondants ont fait, à ce sujet, des remarques semblables : même la personne la plus riche du monde, disent-ils, ne peut assumer le far- deau financier qu'impose une ...

  3. Quand la musique donne le ton

    DEFF Research Database (Denmark)

    Reeh, Henrik

    2017-01-01

    Le lycée Sainte-Anne de Copenhague est un établissement réputé pour les résultats de ses élèves et pour être le foyer d’une intense tradition chorale et musicologique. L’article interroge les parcours de 32 élèves d’une même classe, tous reçus au baccalauréat 2014 avec une option musique et...

  4. Le cas de l'Inde

    International Development Research Centre (IDRC) Digital Library (Canada)

    pwust

    le développement, l'Inde doit réduire la proportion de personnes vivant en deçà du seuil de pauvreté de 37,5 %, en. 1990, à 18,75 % ... exemple, à la suite du tsunami en Asie, en 2004, c'est le premier ministre qui a décidé de porter assistance. Pour ces types d'opérations, les forces militaires et paramilitaires indiennes.

  5. Les ERP changent-ils le contrôle de gestion ?

    OpenAIRE

    Meyssonnier, François; Pourtier, Frédéric

    2005-01-01

    L'intégration de l'information de gestion dans le cadre d'ERP se généralise et le contrôle de gestion s'effectue maintenant la plupart du temps en environnement ERP dans les grandes entreprises. Un état de l'art est effectué relativement à l'impact des ERP aussi bien sur les concepts et les outils du contrôle de gestion que sur la fonction et lele des contrôleurs de gestion. La démarche de recherche, fondée sur dix études de cas dans une approche intermédiaire entre les monographies qualit...

  6. Traditional medicine practitioners' knowledge and views on treatment of pregnant women in three regions of Mali.

    Science.gov (United States)

    Nordeng, Hedvig; Al-Zayadi, Waled; Diallo, Drissa; Ballo, Ngolo; Paulsen, Berit Smestad

    2013-09-17

    Despite the widespread use of medicinal plants in Mali, knowledge about how traditional practitioners (TPs) treat pregnant and lactating women is lacking. The aim of this study was to investigate how traditional practitioners in Mali treat common diseases and ailments during pregnancy. Data was collected through structured interviews of traditional practitioners in one urban (Bamako) and two rural areas (Siby and Dioila) in Mali. The TPs were interviewed about how they treat common diseases and ailments during pregnancy. They were also asked to name harmful plants in pregnancy and plants that could affect breast milk production. In addition, we asked about nine specific medicinal plants commonly used in Mali; Opilia amentacea (syn. Opilia celtidifolia), Ximenia americana, Cola cordifolia, Combretum glutinosum, Parkia biglobosa, Trichilia emetica, Combretum micranthum, Lippia chevalieri and Vepris heterophylla. A total of 72 traditional practitioners (64% women, age: 34 to 90 years) were interviewed during an eight week period October 2011 to December 2011. They treated between 1 and 30 pregnant women with medicinal plants per months. We found a relatively high consensus for treatment of pregnant women with common diseases and ailments like nausea and dermatitis. The highest informer consensus was found for the treatment of malaria during pregnancy. TPs generally recommended pregnant women to avoid medicinal plants with bitter tastes like stem and root bark of Khaya senegalensis and Opilia amentacea (syn. Opilia celtidifolia). TPs distinguished between oral (potentially unsafe) and dermal use (safe) of Opilia amentacea (syn. Opilia celtidifolia). Cola cordifolia was used to facilitate labor. Experience and knowledge about treatment of pregnant women with medicinal plants was broad among the traditional practitioners in the three investigated regions in Mali. Collaborating with traditional practitioners on the safe use of medicinal plants in pregnancy may promote

  7. Traditional medicine practitioners’ knowledge and views on treatment of pregnant women in three regions of Mali

    Science.gov (United States)

    2013-01-01

    Background Despite the widespread use of medicinal plants in Mali, knowledge about how traditional practitioners (TPs) treat pregnant and lactating women is lacking. Aim of the study The aim of this study was to investigate how traditional practitioners in Mali treat common diseases and ailments during pregnancy. Methods Data was collected through structured interviews of traditional practitioners in one urban (Bamako) and two rural areas (Siby and Dioila) in Mali. The TPs were interviewed about how they treat common diseases and ailments during pregnancy. They were also asked to name harmful plants in pregnancy and plants that could affect breast milk production. In addition, we asked about nine specific medicinal plants commonly used in Mali; Opilia amentacea (syn. Opilia celtidifolia), Ximenia americana, Cola cordifolia, Combretum glutinosum, Parkia biglobosa, Trichilia emetica, Combretum micranthum, Lippia chevalieri and Vepris heterophylla. Results A total of 72 traditional practitioners (64% women, age: 34 to 90 years) were interviewed during an eight week period October 2011 to December 2011. They treated between 1 and 30 pregnant women with medicinal plants per months. We found a relatively high consensus for treatment of pregnant women with common diseases and ailments like nausea and dermatitis. The highest informer consensus was found for the treatment of malaria during pregnancy. TPs generally recommended pregnant women to avoid medicinal plants with bitter tastes like stem and root bark of Khaya senegalensis and Opilia amentacea (syn. Opilia celtidifolia). TPs distinguished between oral (potentially unsafe) and dermal use (safe) of Opilia amentacea (syn. Opilia celtidifolia). Cola cordifolia was used to facilitate labor. Conclusion Experience and knowledge about treatment of pregnant women with medicinal plants was broad among the traditional practitioners in the three investigated regions in Mali. Collaborating with traditional practitioners on the

  8. A quantitative synthesis of the medicinal ethnobotany of the Malinké of Mali and the Asháninka of Peru, with a new theoretical framework

    Directory of Open Access Journals (Sweden)

    Bletter Nathaniel

    2007-12-01

    deux cultures éloignées que dans leur flore générale-est examinée par un re-échantillonnage des données de recherches effectuées parmi les Malinké au Mali et les Asháninka au Pérou, en particulier sur la malaria, la maladie africaine du sommeil, la maladie de Chagas, la leishmania, le diabète, l'eczéma, l'asthme et les fibromes utérins. Dans ces cas précis, la similitude de la flore médicinale s'avère sensiblement plus grande que la similitude de la flore générale, mais seulement quand les maladies en question sont regroupées ensemble comme maladies parasitaires et auto-immunitaires. Si cette hypothèse est prouvée, elle permettra la synthèse des informations recueillies sur les plantes médicinales du monde entier pour en sélectionner de façon plus précise celles qui sont les plus efficaces et qui méritent analyse plus approfondie au laboratoire. Asháninka abstract Aayiantyarori iròpero aavintane, ontzimatye ancovacovatero ayotero ovaqueraripaye incashi iyoyetziri ashaninka, ayotzityaro aajatzi iyotane viracocha paitachari "quimica" ancantero aaca oshintsinka inchashipaye. Atziri yotacotzirori cametsa, ishtoriajacotzirori iyotane ashaninkapaye te iroñàrantero maaroni ocaratzi yamenacotaqueri laboratorioki. Aaviantyarori cametsa, ayotacotero aavintarontsiyetatsiri osamani antzimaventero ishtoriatacotaro, aajatzi osheki opinata ampinaventero aparopaye inchashi, acoviriqui ayotacotero, osaretsikipaye. Tzimatsi ovaquerari quenquishiriantsitatsiri ero opinata osheki ashitoriatacotero aparopaye inchashi, asampiyetatyrey pashinipaye atziri saicatsiri intaina puitarika inchasshi yavintari, ajatzirica oshiyaro ayotzi aaca, quemetachari atziri saikatsiri nampitsiki malinke aajatzi ishiyari ashaninka saicatsiri peruki, tzimatsi inchashi aajatzi yaavintari osheki okamètsatzi aririka anteri mantsiyarentsi icantaitziri ompetarentsi catsirentsi, pochokirentsi, patsarontsi(matatsi ashipetate maaroni, ampochavathate, ancainikentsite, oncatsithakite

  9. A quantitative synthesis of the medicinal ethnobotany of the Malinké of Mali and the Asháninka of Peru, with a new theoretical framework

    Science.gov (United States)

    Bletter, Nathaniel

    2007-01-01

    dans leur flore générale-est examinée par un re-échantillonnage des données de recherches effectuées parmi les Malinké au Mali et les Asháninka au Pérou, en particulier sur la malaria, la maladie africaine du sommeil, la maladie de Chagas, la leishmania, le diabète, l'eczéma, l'asthme et les fibromes utérins. Dans ces cas précis, la similitude de la flore médicinale s'avère sensiblement plus grande que la similitude de la flore générale, mais seulement quand les maladies en question sont regroupées ensemble comme maladies parasitaires et auto-immunitaires. Si cette hypothèse est prouvée, elle permettra la synthèse des informations recueillies sur les plantes médicinales du monde entier pour en sélectionner de façon plus précise celles qui sont les plus efficaces et qui méritent analyse plus approfondie au laboratoire. Asháninka abstract Aayiantyarori iròpero aavintane, ontzimatye ancovacovatero ayotero ovaqueraripaye incashi iyoyetziri ashaninka, ayotzityaro aajatzi iyotane viracocha paitachari "quimica" ancantero aaca oshintsinka inchashipaye. Atziri yotacotzirori cametsa, ishtoriajacotzirori iyotane ashaninkapaye te iroñàrantero maaroni ocaratzi yamenacotaqueri laboratorioki. Aaviantyarori cametsa, ayotacotero aavintarontsiyetatsiri osamani antzimaventero ishtoriatacotaro, aajatzi osheki opinata ampinaventero aparopaye inchashi, acoviriqui ayotacotero, osaretsikipaye. Tzimatsi ovaquerari quenquishiriantsitatsiri ero opinata osheki ashitoriatacotero aparopaye inchashi, asampiyetatyrey pashinipaye atziri saicatsiri intaina puitarika inchasshi yavintari, ajatzirica oshiyaro ayotzi aaca, quemetachari atziri saikatsiri nampitsiki malinke aajatzi ishiyari ashaninka saicatsiri peruki, tzimatsi inchashi aajatzi yaavintari osheki okamètsatzi aririka anteri mantsiyarentsi icantaitziri ompetarentsi catsirentsi, pochokirentsi, patsarontsi(matatsi) ashipetate maaroni, ampochavathate, ancainikentsite, oncatsithakite tsinani. Aririka añaker aajatzi

  10. Comparative morphological analysis of apple blister mite, Eriophyes mali Nal., a new pest in Serbia

    Directory of Open Access Journals (Sweden)

    Biljana Vidović

    2014-06-01

    Full Text Available The apple blister mite, Eriophyes mali Nalepa, 1926 (Acari: Prostigmata: Eriophyoidea, has been recently found in Serbia as a new pest of apple. The history of its research, the results of a morphological analysis and degree of infestation are presented. A comparison of the main morphological features of mites from different populations of remote geographical origin has shown that the apple blister mite from Serbia is most similar to another European population (Bulgarian [or Austrian?] while it differs from E. mali originating from the USA and New Zealand. The percentage of infestation varied from 1.6% to 87.6%, with an average of 22.4%.

  11. Effet du stress salin sur le comportement physiologique et ...

    African Journals Online (AJOL)

    SARAH

    30 juin 2013 ... rapidement dans les feuilles à partir de 25 mmol de NaCl. Le rapport de sélectivité K+/Na+ a été plus discriminant entre les variétés : Midass a présenté le rapport de sélectivité le plus élevé et Nabeul le rapport de sélectivité le plus faible. Conclusion et application : La variété Nabeul qui est de type piment ...

  12. Le patrimoine et ses outils de gestion

    CERN Document Server

    Garcin, J

    2001-01-01

    Les principale taches de gestion du Patrimoine immobilier du CERN sont la saisie des données, leur mise à jour, l'archivage et la mise à disposition des informations. Les outils de gestion actuels : Le Système de Gestion de Base de Données Relationnelles alphanumérique ORACLE permet de gérer toutes les informations du Patrimoine, sur le réseau du CERN. Le logiciel de dessin Graphique MICROSTATION (Bentley) a été installé dans la division ST depuis fin 1991. Les plans de situation des sites, des bâtiments et locaux, des espaces confinés ont été réalisés avec ce logiciel. Les outils de demain : La mise en place du SIG (Système d'Information Graphique) STAR a été réalisée en 1993. Le transfert des plans de locaux de MICROSTATION vers STAR est en cours depuis une année environ. Le dessin de la cartographie des réseaux de canalisations Eaux Usées et Eaux Pluviales est en cours de réalisation. Le Web est l'outil de consultation de l'information par les utilisateurs.

  13. Le risque fiscal réinventé

    OpenAIRE

    Loore, Frédéric

    2016-01-01

    En 2016, le risque fiscal est un concept à réinventer. Pour ce faire, il est utile de l’aborder selon deux questions: 1) Pourquoi le risque fiscal est-il réinventé? La crise financière de 2008 engendre une conscientisation des différents acteurs du monde fiscal. En effet, de nouveaux standards d'évaluation de la responsabilité sociétale des multinationales émergent. L'éthique, par le biais des considérations de l'opinion publique, s'immisce dans les réflexions politiques et influence les diff...

  14. Lactase persistence genotypes and malaria susceptibility in Fulani of Mali

    Directory of Open Access Journals (Sweden)

    Dolo Amagana

    2011-01-01

    Full Text Available Abstract Background Fulani are a widely spread African ethnic group characterized by lower susceptibility to Plasmodium falciparum, clinical malaria morbidity and higher rate of lactase persistence compared to sympatric tribes. Lactase non-persistence, often called lactose intolerance, is the normal condition where lactase activity in the intestinal wall declines after weaning. Lactase persistence, common in Europe, and in certain African people with traditions of raising cattle, is caused by polymorphisms in the enhancer region approximately 14 kb upstream of the lactase gene. Methods To evaluate the relationship between malaria and lactase persistence genotypes, a 400 bp region surrounding the main European C/T-13910 polymorphism upstream of the lactase gene was sequenced. DNA samples used in the study originated from 162 Fulani and 79 Dogon individuals from Mali. Results Among 79 Dogon only one heterozygote of the lactase enhancer polymorphism was detected, whereas all others were homozygous for the ancestral C allele. Among the Fulani, the main European polymorphism at locus C/T-13910 was by far the most common polymorphism, with an allele frequency of 37%. Three other single-nucleotide polymorphisms were found with allele frequencies of 3.7%, 1.9% and 0.6% each. The novel DNA polymorphism T/C-13906 was seen in six heterozygous Fulani. Among the Fulani with lactase non-persistence CC genotypes at the C/T-13910 locus, 24% had malaria parasites detectable by microscopy compared to 18% for lactase persistent genotypes (P = 0.29. Pooling the lactase enhancer polymorphisms to a common presumptive genotype gave 28% microscopy positives for non-persistent and 17% for others (P = 0.11. Conclusions Plasmodium falciparum parasitaemia in asymptomatic Fulani is more common in individuals with lactase non-persistence genotypes, but this difference is not statistically significant. The potential immunoprotective properties of dietary cow milk as a reason

  15. Le Baratze (ou

    Directory of Open Access Journals (Sweden)

    Jacques Blot

    1998-01-01

    Full Text Available El círculo de piedras Mendizabal 7, de 8 metros de diámetro,   presenta una corona externa constituida de grandes bloques   hincados en la tierra, y otra interna y tangente, de elementos idénticos sólo puestos en el suelo. El cajón central está compuesto de cuatro losas y una tapa. No hay depósito de huesos ni de carbón de leña ; sólo se encuentran dos herraduras, entre las cuales una completa de tipo medieval, que podrían permitir de pensar en una construcción del círculo en el periodo histórico.

  16. Le tournoi des ombres

    CERN Document Server

    Treille, Daniel

    2017-01-01

    Le lecteur, transporté avec le narrateur dans une région hors norme, est invité à partager sa fascination pour la beauté du lieu, à découvrir la chronique de son passé, rude et pittoresque. Il va côtoyer une galerie de personnages très attachants, mais aux destinées bousculées par l histoire, et assister à l agitation montante du présent dans un contexte d une actualité brûlante. Ce quatrième roman de Daniel Treille, mêlant hardiment les genres, du quotidien trivial au récit épique, de considérations géopolitiques à quelques avancées de la science moderne, confirme son talent à mener, d une écriture très aboutie, une histoire complexe, peuplée de héros singuliers

  17. Lele de paysans mieux informés au Bénin | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    10 déc. 2010 ... Selon une simulation réalisée par des chercheurs béninois en 2003, si rien n'est tenté pour faire face aux changements climatiques, le rendement de cultures telles que le maïs, l'arachide, le manioc, le niébé et le riz baisserait de 6 %, et celui du coton, de près de 30 %, et ce, d'ici 2025. Alors, comment les ...

  18. Le potager n'est pas plus vert chez le voisin | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    8 sept. 2016 ... Il y avait aussi un problème d'usage, car les gens ignoraient comment les préparer. Et, finalement, un problème d'ordre ... «Ils disaient: “Vous, les scientifiques, vous voulez que nous produisions quelque chose que nous ne connaissons pas, mais qui l'achètera?”» raconteM. Adebooye. Les chercheurs ont ...

  19. L'apport de l'imagerie dans le diagnostic de la tuberculose uro ...

    African Journals Online (AJOL)

    La tuberculose uro-génitale (TUG) est une localisation secondaire de la maladie. Son diagnostic est bactériologique, mais la probabilité de mettre en évidence le bacille de Koch (BK) dans les urines est faible. D'où le concours de l'imagerie dans le diagnostic et la mise en route du traitement médical. Nous rapportons 4 ...

  20. Biodiversité et écologie des mousses au Nord-Est Algérien : cas du ...

    African Journals Online (AJOL)

    Le parc national d'El-Kala est situé à l'extrême Nord-est de l'Algérie, Il renferme un ensemble d'écosystèmes naturels allant de l'aquatique maritime au forestier en passant par le type aquatique lacustre. Le bassin versant du lac Tonga fait partie de cet ensemble de paysages. Compte tenu de la diversité des bryophytes et ...

  1. La pisciculture en cage est prisée au Népal | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    25 oct. 2010 ... Des chercheurs du Nepal Agricultural Research Council ont constaté que l'eau du réservoir créé par le barrage se prêtait exceptionnellement bien à l'élevage des poissons, en particulier des carpes, dans de grandes cages flottantes. Le milieu est idéal pour les poissons car le plancton y abonde.

  2. Pays en transition : pour que les sociétés se transforment, il est ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Conscient du fait que les périodes de transformation risquent de provoquer le chaos, mais qu'elles sont également porteuses de rapides progrès sur le plan social et économique, le CRDI est intervenu dans quelque 25 pays ayant amorcé une transition de la guerre à la paix, de la dictature à la démocratie ou d'une ...

  3. Le continu contre l'espace

    Science.gov (United States)

    Salanskis, Jean-Michel

    Disons pour conclure que, en tout état de cause, la façon de concevoir philosophiquement le conflit du continu et de l'espace que nous avons trouvée chez Hegel n'est pas homogène avec le style et les modalités de la pensée mathématique: 1) d'une part, le lien classique, le lien de référence entre continu et espace en mathématiques n'est pas que l'espace serait premier et privé de pensée, et le continu second, venant dissoudre l'espace en apportant la qualité, l'infini et la pensée, mais tout au contraire, il consiste en ce que l'espace est fondé sur l'abîme infinitaire du continu ; 2) d'autre part, l'éventuel divorce entre l'espace et le continu dans l'aire mathématique n'est pas celui d'une réflexivité purement conceptuelle du continu avec un positivisme géométrique, n'équivaut pas à une rupture disciplinaire ; il est plutôt le symptôme de la dérive d'une herméneutique à l'égard d'une autre, au sein d'un continent juridique commun définissant la discipline (la mathématique ensembliste), cette dérive pouvant, à la limite, induire une refonte de ce sol juridique, sans que jamais il soit question pour autant de nier l'unité des mathématiques, à comprendre ici comme l'unité ultime de responsabilité de la communauté mathématique à l'égard des trois questions Qu'est-ce que l'espace?”, “Qu'est-ce que le continu?” et “Qu'est-ce que l'infini?”.

  4. , TOUCHE PAS À MA TERRE, I ! ' C'EST MA VIE !

    International Development Research Centre (IDRC) Digital Library (Canada)

    .interpares.ca. Fondée en 1975, Inter Pares, dont le nom signifie « entre égaux », est une organisation canadienne de justice sociale œuvrant au Canada et dans le Sud globalisé. Inter Pares s'attache à faire connaître les causes et les effets ...

  5. Reformulation à l’oral et dans le forum Web

    Directory of Open Access Journals (Sweden)

    Eshkol-Taravella Iris

    2016-01-01

    Full Text Available Le cadre du travail réalisé entre dans le domaine de la linguistique de corpus et du Traitement Automatique des Langues (TAL. Les recherches sont fondées sur trois corpus : deux corpus oraux (ESLO1 et ESLO2 et un corpus composé de discussions collectées sur un forum de Doctissimo. Le travail vise à détecter, analyser et comparer la reformulation introduite par trois marqueurs (c’est-à-dire, je veux dire et disons dans le discours oral et le corpus écrit dialogique du Web. L’objectif est d’étudier la raison pour laquelle le locuteur décide de modifier un segment par un autre et de repérer un lien formel entre les deux segments reformulés aux différents niveaux linguistiques (morphologique, lexical, syntaxique, etc..

  6. Le sacré sauvage

    Directory of Open Access Journals (Sweden)

    Roger Bastide

    2010-09-01

    Full Text Available Conférence prononcée le 13 septembre 1973 dans le cadre des Rencontres Internationales de Genève qui avaient pour thème cette année-là « Le besoin religieux ». Cette conférence figure dans les Actes de cette rencontre (Le Besoin religieux, Éditions de la Baconnière, Neuchâtel, 1974, pp. 123-145. Elle a été republiée dans un ouvrage posthume dont elle est l’éponyme, ouvrage édité par Henri Desroche (Paris, éditions Stock, 1975. Nous reproduisons ici le texte intégral original, avec l’aimable autorisation des Rencontres Internationales de Genève auxquelles SociologieS adresse ses remerciements.The wild sacredText of a lecture taken on November the 13th 1973 during the Rencontres Internationales de Genève whom theme was "The religious need". This lecture was first published in: Le Besoin religieux (La Baconnière Editions, Neuchâtel, 1974, pp. 123-145, and published once again in a posthumous book: Le sacré sauvage ("The wild sacred" edited by Henri Desroche (Paris, Stock Editions, 1975. It is reproduced here with the kind authorization of the Rencontres Internationales de Genève. SociologieS gives them sincere thanks.Le Sacré sauvage (Lo sagrado en el mundo primitivoConferencia efectuada el 13 de septiembre de 1973 en el marco de las Rencontres Internationales de Genève (Encuentros Internacionales de Ginebra que tenia como tema general la necesidad de la experiencia religiosa (“Le besoin religieux”, Éditions de la Baconnière, Neuchâtel, 1974, pp. 123-145. Esta conferencia fue publicada de nuevo en un trabajo póstumo que lleva el mismo título, editado por Henri Desroche (Paris, Éditions Stock, 1975. Reproducimos aquí la integralidad del texto original con la amable autorización de las Rencontres Internationales de Genève, a las cuales la revista SociologieS expresa su agradecimiento.

  7. La construction de la matière le modèle Standard

    CERN Document Server

    Léon, Jacques

    2016-01-01

    Qu'est-ce que la matière ? Voilà une question à laquelle il pourrait sembler facile de répondre car il n'est rien de plus concret que la matière. Et pourtant, la réponse qu'en donne la physique contemporaine est pour le moins déconcertante ! Le concept-même de particules, briques élémentaires de la matière, s'est volatilisé, dissout dans des objets mathématiques abstraits et abscons pour les non-initiés. Plus nos théories sont précises et plus l'image qu'elles nous renvoient est insaisissable. En un siècle, la représentation des particules s'est métamorphosée en nuages de probabilité portés par des champs quantiques régis par des symétries confinées dans des espaces abstraits. Mais dans un même temps, nous avons réussi le tour de force d'expliquer toute cette complexité avec seulement 16 particules… et une seule théorie, véritable construction de notre conception de la matière : le modèle standard. Ce livre tente de guider le lecteur dans le dédale de la physique des particu...

  8. Soutenir des politiques d'alimentation plus saine en Asie du Sud-Est ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Soutenir des politiques d'alimentation plus saine en Asie du Sud-Est. Près d'un quart des décès causés par des maladies non transmissibles dans le monde surviennent en Asie du Sud-Est. Ce projet tentera de résoudre le problème en menant des recherches sur la façon dont les politiques peuvent favoriser des ...

  9. Consumption of, and beliefs about fonio (digitaria exilis) in urban area in Mali

    NARCIS (Netherlands)

    Fanou, N.; Koreissi, Y.; Dossa, R.A.M.; Brouwer, I.D.

    2009-01-01

    The study sought to determine beliefs and practices about neglected crops in West Africa, using fonio (Digitaria exilis) as a model to understand how obstacles impede the consumption of this cereal in Bamako, the capital city of Mali. This was a crosssectional study on food ethnography in three

  10. Effects of climate variability and climate change on crop production in southern Mali

    NARCIS (Netherlands)

    Traore, B.; Corbeels, M.; Wijk, van M.T.; Rufino, M.C.; Giller, K.E.

    2013-01-01

    In West Africa predictions of future changes in climate and especially rainfall are highly uncertain, and up to now no long-term analyses are available of the effects of climate on crop production. This study analyses long-term trends in climate variability at N'Tarla and Sikasso in southern Mali

  11. Analyzing changes in productivity and carrying capacity under planned grazing in Madiama Commune, Mali (West Africa)

    OpenAIRE

    Badini, Oumar; Stockle, C.; Jones, J.; Bostick, M.; Kodio, Amadou; Keita, Moussa

    2004-01-01

    This presentation addresses the problems of overgrazing and degradation of pasture land. Policies that can increase pasture productivity and improve the carrying capacity and soil quality of pastures are assessed using CropSyst simulation modeling. Optimal grazing intensity and intervals (rotational grazing) are evaluated and discussed, based on model analysis from the Madiama commune in Mali (West Africa). ME (Management Entity)

  12. Monitoring for impact: Evaluating 20 years of soil and water conservation in southern Mali

    NARCIS (Netherlands)

    Bodnar, F.

    2005-01-01

    A soil and water conservation (SWC) project has been going on in southern Mali since 1986. Donor support was gradually withdrawn between 1998 and 2002, but no final evaluation was undertaken to learn lessons from this long-term and large-scale experience. The objective of this present research was

  13. Assessment of undiscovered oil and gas resources of the Taoudeni Basin Province, Mali and Mauritania, 2015

    Science.gov (United States)

    Brownfield, Michael E.; Schenk, Christopher J.; Klett, Timothy R.; Tennyson, Marilyn E.; Pitman, Janet K.; Gaswirth, Stephanie B.; Le, Phuong A.; Leathers-Miller, Heidi M.; Mercier, Tracey J.; Marra, Kristen R.; Hawkins, Sarah J.

    2016-03-31

    Using a geology-based assessment methodology, the U.S. Geological Survey estimated undiscovered, technically recoverable mean resources of 160 million barrels of conventional oil, 1,880 billion cubic feet of conventional gas, 602 million barrels of shale oil, and 6,395 billion cubic feet of shale gas in the Taoudeni Basin Province in Mali and Mauritania.

  14. Communicating war in Mali, 2012 : On-offline networked political agency in times of conflict

    NARCIS (Netherlands)

    Bruijn, de M.E.; Pelckmans, L.; Sangare, B.

    2015-01-01

    The Arab Spring raised high expectations for political freedom, especially for situations in which the rapid development of ICT intersects with political oppression and rebellion, as was the case in Mali, West Africa. In 2012 the country’s northern part fell into the hands of ‘rebels’ and jihadists

  15. Muslim proselytization as purification : religious pluralism and conflict in contemporary Mali

    NARCIS (Netherlands)

    Soares, B.F.; An-Nai'im, A.A.

    1999-01-01

    This chapter first discusses the nature of religious pluralism in Mali, highlighting some of the practices that many Muslims find objectionable and that, therefore, are a major source of tension between Islam and Muslims, on the one hand, and traditional religions and their practitioners, on the

  16. Clinical manifestations of Waardenburg syndrome in a male adolescent in Mali, West Africa.

    Science.gov (United States)

    Imperato, Pascal James; Imperato, Gavin H

    2015-02-01

    Waardenburg syndrome (WS) is a genetic disorder of which there are four distinct types. These four types are differentiated by the physical defects which they produce. Presented here is the case of a 13-year-old boy with WS Type I who was observed and physically assessed in Mali, West Africa in 1969. His physical findings included a bright blue coloring to the irises of the eyes, profound sensorineural deafness, mutism, dystopia canthorum (lateral displacement of the inner canthi of the eyes), broad nasal root, bushy eyebrows, and scaphoid deformities of the supraorbital portions of the frontal bone. Because family members were not available for interviews or physical examinations, it was not possible to determine if this patient was suffering from a congenital form of the disorder or from a spontaneous mutation. Given the patient's then location in a remote rural area of Mali where electricity was absent, it was not possible to perform additional diagnostic tests. The patient described here is the first with WS in Mali, West Africa to have been medically observed and evaluated and later documented in the medical literature. A second case of the syndrome in Mali was described in the medical literature in 2011 in an 18-month-old infant who did not have sensorineural hearing loss, but who did have a bilateral cleft lip. An historical overview of WS is presented along with details concerning the characteristics of the four types of the disorder.

  17. Fonio (Digitaria exilis) landraces in Mali: Nutrient and phytate content, genetic diversity and effect of processing

    NARCIS (Netherlands)

    Koreissi, Y.; Fanou-Fogny, N.M.L.; Hulshof, P.J.M.; Brouwer, I.D.

    2013-01-01

    The study aimed to assess i) the genetic diversity of fonio (Digitaria exilis) landraces in Mali, ii) the nutrient and phytate content in fonio products and iii) the effect of processing on nutrient content of fonio products. Twelve fonio landraces were collected from farmers in central and southern

  18. Understanding farm trajectories and development pathways: Two decades of change in southern Mali

    NARCIS (Netherlands)

    Falconnier, G.N.; Descheemaeker, K.K.E.; Mourik, van T.A.; Sanogo, O.; Giller, K.E.

    2015-01-01

    Institutional support for smallholders has been the motor for the expanding cotton production sector in southern Mali since the 1970s. Smallholder farms exhibit diverse resource endowments and little is known on how they benefit from and cope with changes in this institutional support. In this paper

  19. Inequality in MINUSMA: African Soldiers are in the Firing Line in Mali

    DEFF Research Database (Denmark)

    Albrecht, Peter; Cold-Ravnkilde, Signe Marie; Haugegaard, Rikke

    2016-01-01

    African and European soldiers in the United Nations peacekeeping mission in Mali (MINUSMA) work under very different conditions regarding levels of training, equipment, general support from their governments and the fact that African troops are deployed in the most dangerous areas. The UN should...

  20. [A Dutchman from Mali with a perianal ulcer caused by cutaneous amoebiasis

    NARCIS (Netherlands)

    Kroft, E.B.M.; Warris, A.; Jansen, L.E.; Crevel, R. van

    2005-01-01

    A 66-year-old Dutchman, living in Mali, presented with an extensive progressive perianal ulcer despite local and antibiotic treatment. Microscopic examination of the stool revealed Entamoeba histolytica/dispar cysts and phagocytosing trophozoites were seen in fresh scrapings of the ulcer, a

  1. Families in movement : transformation of the family in urban Mali, with a focus on intercontinental mobility

    NARCIS (Netherlands)

    Barten, J.

    2009-01-01

    This Masters Thesis is the winner of the ASC's Africa Thesis Award 2008. It deals with changing family relations in African society in the context of intercontinental mobility. Based on many stories of migrants in both Mali and the Netherlands, the book reveals some of the negative sides of close

  2. The hearthhold in pastoral Fulbe society, central Mali : social relations, milk and drought

    NARCIS (Netherlands)

    Bruijn, de M.E.

    1997-01-01

    In pastoral Fulbe society in central Mali women had, and to some degree still have, an important social and economic role, concentrated on a 'milk economy' organized through a female-headed, women-centred unit, called 'fayannde' or 'hearthhold'. In a society of seminomadic pastoralists who live most

  3. Co-learning cycles to support the design of innovative farm systems in southern Mali

    NARCIS (Netherlands)

    Falconnier, Gatien N.; Descheemaeker, Katrien; Mourik, Van Thomas A.; Adam, Myriam; Sogoba, Bougouna; Giller, Ken E.

    2017-01-01

    Farm systems were re-designed together with farmers during three years (2013–2015) in Southern Mali with the aim to improve income without compromising food self-sufficiency. A cyclical learning model with three steps was used: Step 1 was the co-design of a set of crop/livestock technical

  4. Organising trade : a practice-oriented analysis of cooperatives and networks trading cereals in South Mali

    NARCIS (Netherlands)

    Mangnus, E.P.M.

    2015-01-01

    Abstract Farmer organisations have become the centrepiece of pro-poor market development strategies in Africa. Assumed to facilitate scale, quality of produce and professionalism they are regarded as a solution for farmers that are hampered from economic opportunities. In Mali

  5. Le thallium dans les sols et les végétaux supérieurs. I. Le thallium dans les sols

    OpenAIRE

    Tremel, A.; Mench, M.

    1997-01-01

    Le thallium est un métal trace non essentiel qui, malgré sa forte toxicité pour tous les organismes, a peu intéressé jusqu’à ce jour la communauté scientifique. Le but de cette synthèse est de faire le point des connaissances récentes disponibles et les plus significatives concernant les concentrations et le comportement de ce métal dans le sol, ainsi que les aspects réglementaires et les problèmes de réhabilitation qui se rattachent à sa présence dans celui-ci.

  6. Publications | Page 96 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Explorez les extrants découlant de plus de quatre décennies de recherche soutenue par le CRDI. Visitez la Bibliothèque numérique du CRDI maintenant. ... La lutte antitabac en Afrique du Sud : une stratégie gagnante. L'Afrique du Sud, où l'usage du tabac est le deuxième facteur en importance après le VIH/sida en ...

  7. Sophie D'Amours | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le 1er juin 2017, Mme Sophie D'Amours est devenue la première femme à occuper le poste de rectrice à l'Université Laval. Professeure au sein du département de génie mécanique depuis 1995, elle a également occupé le poste de vice-rectrice à la recherche et à la création de 2012 à 2015.

  8. Publications | Page 94 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, ... Le syndrome... Diamants de guerre — pour en finir. L'important accord international sur les diamants conclu cette année ne portera pas fruits s'il n'est pas ...

  9. Le CRDI au Cambodge

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI a été l'un des premiers bailleurs de fonds à établir des relations avec le Cambodge au début des années 1990, alors que le pays progres- sait vers la paix. Depuis, le Centre aide à reconstruire le Cambodge, qui se remet du régime inhumain des Khmers rouges et de décennies de conflits régionaux. Un État ...

  10. 1910 - Le mouchoir

    NARCIS (Netherlands)

    Winkler, M.F.; Cohen, Nadja; Reverseau, Anne

    2015-01-01

    Une histoire littéraire buissonnière. Ainsi pourrait-on qualifier le parcours original auquel nous convie cet ouvrage, qui propose une lecture insolente et insolite de cinquante années de littérature – de 1900 à 1950 – par le prisme des objets. Objets de tous les jours comme le tabac, le vélo ou le

  11. La science, la littérature, le rituel: le vrai dire et le plus que mentir

    Directory of Open Access Journals (Sweden)

    Panagiotis Christias

    2005-03-01

    Full Text Available Le scientifique promet la vérité sans être en mesure d'accomplir sa promesse tandis que l'écrivain promet de mentir mais par son mensonge, il fait plus que mentir. Il ne dit certainement pas la vérité, car la vérité n'est pas sa préoccupation première. Voilà comment nous pouvons résumer les deux attitudes, condamnées à un antagonisme stérile par l'attitude positiviste moderne. Compte tenu donc de l'intention fondatrice de la science, de sa promesse donc originaire et fondatrice, la science doit dire la vérité et rien que la vérité. Ce qui, de l'aveu même de cette même science, est impossible. [...] La littérature se permet de reconstruire des mondes par-delà le vrai et le faux. [...] Un récit littéraire ne demande pas la consécration de la vérité, ne demande pas à être suivi parce que vrai, n'impose rien et n'attend rien. Sa vraie destinée est l'errance et sa vraie conscience est celle de sa dissémination. Celui qui renonce à la prétention de vérité renonce en même temps à la volonté de dominer. Dominer signifie créer un espace de vérité dans lequel celui qui énonce la vérité est le maître légitime de ceux qui sont dans le champ de la conception du monde dont cette vérité est la pierre angulaire.

  12. Le déficit de filles — Le déséquilibre du ratio hommes-femmes en Inde

    International Development Research Centre (IDRC) Digital Library (Canada)

    Dans une « société normale », la proportion de femmes est égale ou un peu supérieure à celle des hommes. Or, ce n'est pas le cas en Inde, où le ratio hommes-femmes – le nombre de femmes par rapport au nombre d'hommes – est l'un des plus déséquilibrés au monde. Bien que la Chine soit aujourd'hui le pays où il ...

  13. Georges et le big bang

    CERN Document Server

    Hawking, Lucy; Parsons, Gary

    2011-01-01

    Georges et Annie, sa meilleure amie, sont sur le point d'assister à l'une des plus importantes expériences scientifiques de tous les temps : explorer les premiers instants de l'Univers, le Big Bang ! Grâce à Cosmos, leur super ordinateur, et au Grand Collisionneur de hadrons créé par Éric, le père d'Annie, ils vont enfin pouvoir répondre à cette question essentielle : pourquoi existons nous ? Mais Georges et Annie découvrent qu'un complot diabolique se trame. Pire, c'est toute la recherche scientifique qui est en péril ! Entraîné dans d'incroyables aventures, Georges ira jusqu'aux confins de la galaxie pour sauver ses amis...Une plongée passionnante au coeur du Big Bang. Les toutes dernières théories de Stephen Hawking et des plus grands scientifiques actuels.

  14. le pommier de cayor, espece emblematique du dallol bosso

    African Journals Online (AJOL)

    usage alimentaire le plus répandu est la consommation crue de la pulpe des fruits frais. Les amandes sont soit consommées crues, soit pilées et utilisées en sauce comme condiments, soit utilisées pour l'extraction traditionnelle d'huile. Le bois de ...

  15. Tanzanie | Page 9 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Salaam, le ronflement des 50 machines à coudre est aussi tenace que le vrombissement d'insectes. Les ouvriers cousent des filets bleus, verts et blancs qui ont été tissés sur les métiers de la manufacture. Ces hommes et ces femmes font partie ...

  16. La lutte contre le tabagisme en Afrique : Peuples, politique et ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    22 déc. 2011 ... Le tabagisme se répand rapidement en Afrique subsaharienne sous l'impulsion d'une forte croissance économique et des tactiques publicitaires agressives des multinationales du tabac ; bien que les interventions politiques y soient bien comprises, l'économie politique du contrôle du tabagisme ne l'est ...

  17. Etude sur le Latin dus codex Bobiensis (k) des evangiles

    NARCIS (Netherlands)

    Hoogterp, Pieter Willem

    1930-01-01

    Le manuscrit dus texte, dont nous allons entreprendre l'étude, se trouve à la Biblioteca Nazionale de Turin (G VII 15). Il est universellement connu sous le nom de Codex Bobiensis (k d'après Tischendorf) et contient des parties de l'évangile selon S. Matthieu (I, 1-III, 10; IV, 2-XIV, 17; XV, 20-36)

  18. Recherche | Page 8 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Économiser l'eau en choisissant les bonnes cultures en Tunisie ... La Tunisie est un pays aux ressources limitées en eau. Bien que l'agriculture ait toujours joué un rôle important dans le développement social et économique du .

  19. Publications | Page 24 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Cependant, il est couramment utilisé comme combustible, dans les régions rurales, pour faire cuire le pain dans un four traditionnel. Objectif du Vietnam : taille optimale pour les entreprises émergentes. La croissance impressionnante du Vietnam depuis les années 1990 lui a permis d'acquérir le statut de pays à revenu ...

  20. Livres | Page 18 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Qualitative Research for Tobacco Control : A How-to Introductory Manual for Researchers and Development Practitioners. Ce guide pratique est destiné à encourager les intervenants, où qu'ils se trouvent dans le monde, à s'engager dans la recherche contre le tabac en faisant appel à des méthodes et des outils qualita.

  1. Publications | Page 175 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Qualitative Research for Tobacco Control : A How-to Introductory Manual for Researchers and Development Practitioners. Ce guide pratique est destiné à encourager les intervenants, où qu'ils se trouvent dans le monde, à s'engager dans la recherche contre le tabac en faisant appel à des méthodes et des outils qualitatifs.

  2. Livres | Page 16 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Qualitative Research for Tobacco Control : A How-to Introductory Manual for Researchers and Development Practitioners. Ce guide pratique est destiné à encourager les intervenants, où qu'ils se trouvent dans le monde, à s'engager dans la recherche contre le tabac en faisant appel à des méthodes et des outils qualita.

  3. Dans le grand collisionneur du CERN

    CERN Document Server

    AUTHOR|(CDS)2051256

    2014-01-01

    Ce livre fait pénétrer le lecteur non initié dans l’instrument scientifique le plus grand du monde. D’ailleurs, le web fut précisément inventé à Genève en vue d’une collaboration aussi gigantesque. Résultat de vingt ans de recherche, le LHC, Grand collisionneur de hadrons, est l’anneau de 26,7 km creusé sous la frontière francosuisse, où sont accélérés, en sens opposés, des paquets de particules jusqu’à des vitesses et des énergies extrêmes. Ainsi la physique s’est-elle engagée dans une étape nouvelle de nos connaissances. Après les grandes découvertes de l’univers et de la réalité microscopique du siècle dernier, le collisionneur nous fait progresser aujourd’hui dans un «nuage de probabilités» aux frontières de l’antimatière. Dans une bousculade de particules, voici le champ convoité du boson de Higgs. Mario Campanelli, professeur associé à l’Université de Londres et collaborateur au projet ATLAS du LHC, propose, dans cet ouvrage, de s’introduire pas �...

  4. Le corpus lexicographique dans les langues à tradition orale: le cas ...

    African Journals Online (AJOL)

    rbr

    Par le truchement de la production orale libre, l'auteur base ses hypothèses de recherche sur une expérience en dialecte fang-mekè, ..... point d'appui dans la recherche des mots dont les définitions ou les portées sémantiques ne figurent pas ..... cet outil indispensable qu'est le dictionnaire. Je pense que ces langues ont.

  5. Le partenariat mondial sur les données ouvertes pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ce projet aidera les gouvernements de pays en développement à élaborer et à gérer des politiques et des pratiques en matière de données ouvertes. .... Le CRDI investit dans des solutions locales aux problèmes auxquels l'Inde est confrontée, comme le stress thermique, la gestion de l'eau et les migrations liées aux ...

  6. LE CHOLESTÉATOME DE L'OREILLE MOYENNE

    African Journals Online (AJOL)

    une forme particulièrement agressive d'otite moyenne chronique dont le traitement est exclusivement chirurgical. Le but de cet article est de présenter une mise au point sur la prise en charge de ..... une éventuelle reprise de la maladie après un geste chi- rurgical d'exérèse quelle que soit la technique opératoire adoptée.

  7. Case Report - Le noeud ileosigmoidien: à propos de 2 cas ...

    African Journals Online (AJOL)

    Le noeud iléosigmoïdien ou l'ileosigmoid knot (ISK), est une entité clinique exceptionnelle, c'est une urgence chirurgicale caractérisée par une strangulation du grêle en formant un noeud autour de la base du colon sigmoïde avec risque de nécrose rapide du grêle et du colon. Nous rapportons deux cas dans le service des ...

  8. Le CRDI et Cancer Research UK lancent une nouvelle initiative ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    18 oct. 2017 ... Politiques de lutte contre l'usage nocif de l'alcool et de réduction de ses méfaits au Liban. L'alcool est le troisième plus important facteur de risque de maladies et d'invalidité dans le monde; il est un facteur de premier plan dans plus d'une soixantaine de maladies. Voir davantagePolitiques de lutte contre ...

  9. Adoption d'innovations agricoles par le truchement de services ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'agriculture est le fer de lance de nombreuses économies en développement, mais la capacité des petits agriculteurs privés de ressources à adopter des innovations agricoles est freinée par le manque d'accès à des services financiers adéquats. Des experts internationaux estiment qu'il existe un manque à gagner ...

  10. Vers une appropriation par le Maroc de son droit des étrangers ?

    OpenAIRE

    Khrouz, Nadia

    2016-01-01

    Le 9 septembre 2013, le Cabinet royal publie un communiqué de soutien aux recommandations émises le jour même par le Conseil national des droits de l’homme (CNDH). Alors que le Royaume est indexé depuis plusieurs années pour le non-respect de ses engagements formels – nationaux et internationaux – concernant le traitement accordé aux étrangers, en particulier subsahariens et en situation administrative irrégulière sur le territoire, l’une de ces recommandations consiste à régulariser la situa...

  11. Le modèle judiciaire libéral mis à l’épreuve : la surveillance des juges sous le Directoire

    OpenAIRE

    Berger, Emmanuel

    2007-01-01

    La justice du Directoire est principalement identifiée aux différentes violations infligées par le gouvernement afin de contrôler le pouvoir judiciaire et durcir la répression criminelle. Cette représentation est, en réalité, partiale. L’auteur tente de le prouver à travers l’analyse d’un aspect essentiel du système judiciaire directorial : la surveillance des juges. L’étude des normes et des pratiques montre que le mode de surveillance établi par le code des délits et des peines respecte la ...

  12. LE LIEN ENTRE FINANCE ET ECONOMIE ISLAMIQUES VIA LE MODELE PRINCIPIEL "ZR"

    OpenAIRE

    BELABES, ABDERRAZAK

    2010-01-01

    A l'heure où certains évoquent l'intégration de la finance islamique à la finance globale, et d'autres rattachent la finance islamique à des thèmes en vogue telles que la finance éthique, la finance participative ou la finance socialement responsable, le présent papier explore le lien entre finance et économie islamiques à partir du modèle principiel "ZR", c’est-à-dire "Zakât" et "Ribâ". Ce modèle montre que les principes invariants de Zakât et Ribâ jouent un rôle central dans l’établissement...

  13. L’entrepreneur, éléments d’une analyse parallèle Léon Walras / joseph alois Schumpeter (The entrepreneur, elements for a paralell analysis Leon Walras / joseph alois Schumpeter)

    OpenAIRE

    Sophie BOUTILLIER

    2010-01-01

    L. Walras, comme J. A. Schumpeter, avaient la même ambition : révolutionner la théorie économique. Ils atteignent cet objectif par des voies différentes (le premier par les mathématiques, le second par l’analyse sociohistorique). Ils formulent ainsi deux théories différentes de l’entrepreneur, agent économique central du capitalisme. Le modèle de Walras est statique. L’entrepreneur est rationnel par son comportement maximisateur. Le modèle de Schumpeter est dynamique. L’entrepreneur est le mo...

  14. Prendre le pli des techniques

    OpenAIRE

    Latour, Bruno

    1983-01-01

    À partir de la notion de mode d’existence développée par Gilbert Simondon et surtout par Etienne Souriau, il est possible d’aborder la question de la technique sans se laisser arrêter par la présence excessive de l’un de ses résultats : les objets techniques. On peut alors essayer de définir le mode propre de la technique comme un mouvement, un projet, un plissage, une forme très particulière de transcendance, qui n’a pas reçu en philosophie le traitement que mérite son importance et son ubiq...

  15. EST2Prot: Mapping EST sequences to proteins

    Directory of Open Access Journals (Sweden)

    Lin David M

    2006-03-01

    Full Text Available Abstract Background EST libraries are used in various biological studies, from microarray experiments to proteomic and genetic screens. These libraries usually contain many uncharacterized ESTs that are typically ignored since they cannot be mapped to known genes. Consequently, new discoveries are possibly overlooked. Results We describe a system (EST2Prot that uses multiple elements to map EST sequences to their corresponding protein products. EST2Prot uses UniGene clusters, substring analysis, information about protein coding regions in existing DNA sequences and protein database searches to detect protein products related to a query EST sequence. Gene Ontology terms, Swiss-Prot keywords, and protein similarity data are used to map the ESTs to functional descriptors. Conclusion EST2Prot extends and significantly enriches the popular UniGene mapping by utilizing multiple relations between known biological entities. It produces a mapping between ESTs and proteins in real-time through a simple web-interface. The system is part of the Biozon database and is accessible at http://biozon.org/tools/est/.

  16. Les Brulures Chimiques Par Le Laurier Rose

    OpenAIRE

    Bakkali, H.; Ababou, M.; Nassim Sabah, T.; Moussaoui, A.; Ennouhi, A.; Fouadi, F.Z.; Siah, S.; Ihrai, H.

    2010-01-01

    Le laurier rose ou Nerium oleander est un arbuste qui pousse naturellement dans les régions méditerranéennes. Au Maroc on le trouve dans les lieux humides. Il est réputé par ses risques de toxicité systémique en cas d'empoisonnement à cause de la présence de deux alcaloïdes, surtout l'oléandrine. La littérature illustre des cas d'utilisation locale des feuilles de cette plante contre la gale, les hémorroïdes et les furoncles. Nous rapportons deux cas de brûlures chimiques par le laurier rose ...

  17. Le Peer to Peer: Vers un Nouveau Modèle de Civilization

    Directory of Open Access Journals (Sweden)

    Michel Bauwens

    2006-06-01

    Full Text Available Le « peer to peer » est la dynamique intersubjective caractéristique des réseaux distribués. Le but de cet essai est de montrer qu'il s'agit d'une véritable nouvelle forme d’organisation sociale, apte à produire et échanger des biens, à créer de la valeur. Celle-ci est la conséquence d'un nouvel imaginaire social, et possède le potentiel de devenir le pilier d'un nouveau mode d'économie politique, voire d'un nouveau type de civilisation. Pour cela, nous allons d'abord définir le P2P, décrire en bref ces manifestations, et le différencier d'autres modalités d'échange intersubjectif tel que le marché, la hiérarchie, l'économie du don.Comme principale modalité P2P nous distinguons: Les processus de production P2P, comme troisième mode de production, qui n'est ni géré par un mode hiérarchique ou par l'état, ni répondant à des impératifs de profit ou qui sont modulés par le biais des prix. Les processus de gouvernance P2P, qui gouverne ces processus de production. Les formes de propriété P2P, qui sont destine a empecher l’appropriation prive de cette production pour le commun.Afin d’examiner les characteristiques de cette nouvelle dynamique sociale, nous utilisons la typologie intersubjective de l’anthropologue Alan Page Fisque, qui distingue: 1. l'échange égalitaire (Equality Matching, c..a.d l’economie du don. 2. La relation d’autorité (Authority Ranking tel qu’elle s’exprime dans le mode hierarchique. 3. le marché (Market Pricing. 4. la participation commune (Communal Shareholding.En conclusion, nous examinons les possibilites d’expansion de ce nouveau mode sociale et son insertion dans l’economie capitaliste, en nous nous posons la question: le P2P peut-il etre concu comme alternative sociale et economique aux modeles existants.

  18. Savoir gérer le mal

    Directory of Open Access Journals (Sweden)

    Michel Maffesoli

    2015-09-01

    Full Text Available Le sens commun, conservatoire immémorial de la sagesse humaine « sait », de savoir incorporé, que le mal, l’ombre, la mort, la douleur sont des caractéristiques essentielles de l’existence en son entièreté. Dès lors les créatures quelles qu’elles soient, sont des manifestations de la vie et, dès lors, méritent une attitude « compassionnelle », fraternelle, parce qu’ensemble elles constituent le flux vital. C’est ainsi que l’on peut comprendre l’utilité sociale de ces divers « mondes intermédiaires » que sont les croyances, religieuses ou philosophiques, au « double », au « daimon », aux esprits et autres figures tutélaires ou effrayantes. Elles aident à vivre, au jour le jour, la souffrance en la communalisant.

  19. Le tourisme alpin

    Directory of Open Access Journals (Sweden)

    Andrea Macchiavelli

    2009-06-01

    Full Text Available La forte croissance qu’ont connue les pays alpins dans les dernières décennies a surtout été fondée sur l’offre des activités du ski, avec comme conséquence, un massif développement immobilier, la multiplication d’infrastructures et l’extension des domaines. Aujourd’hui, le marché du ski semble arriver à saturation, la Convention alpine a mis un frein à la poursuite du développement des domaines skiables et on observe donc avec intérêt la diversification de l’offre soutenue par l’innovation. Après avoir rappelé les facteurs de changement en cours les plus significatifs dans le tourisme montagnard, l’article présente une grille interprétative de l’évolution des destinations touristiques alpines, identifiant les phases qui ont caractérisé son développement. Puis il propose une réflexion sur certaines conditions qui peuvent favoriser l’innovation dans le tourisme alpin, ainsi que sur les contradictions qui les accompagnent souvent. Dans la plupart des cas l’innovation est le résultat d’un processus qui a été lancé et qui s’est développé au sein de la communauté alpine, souvent favorisé et soutenu par des institutions nationales et internationales, et grâce auquel les difficultés structurelles qui ont déjà été abordées précédemment ont pu être surmontées avec succès.The spectacular increase in tourism in the Alps in recent decades has been founded mainly on the boom in skiing, resulting in both strong real estate development and an increasing array of infrastructures and ski runs. Today the ski market seems to have virtually reached saturation point and the winter sports sector needs to diversify its offer through innovation. After a review of the main factors of change in mountain tourism, the paper presents a grid for interpreting the life cycle of alpine destinations, identifying the phases that characterize their evolution. The conditions that may favour innovation in alpine

  20. Kyste hydatique du foie rompu dans la paroi abdominale et dans le muscle psoas: a propos d�une rare observation

    Directory of Open Access Journals (Sweden)

    Issam En-Nafaa

    2011-09-01

    Full Text Available Le kyste hydatique du foie est une parasitose qui sevit a l'etat endemique au maroc. La rupture dans la paroi abdominale et dans le psoas est une complication exceptionnelle. Nous rapportons un cas de kyste hydatique du foie rompu dans la paroi et dans le muscle psoas. Le diagnostic a ete etabli sur les donnees de l'echographie et surtout de la tomodensitometrie. Le patient a ete opere avec des suites simples.

  1. Le gouvernement Mansard

    OpenAIRE

    Curton, Émile de

    2013-01-01

    Le fait même de sa nomination au poste de Gouverneur allait donner au conflit qui opposait Mansard au docteur Alain toute sa dimension. Le Médecin-chef et ses complices avaient manqué leur premier objectif : remettre en cause le ralliement de la colonie avant le départ du Gouverneur de Géry. Toutefois, ils jugeaient toujours possible de saper l’autorité encore fragile du nouveau gouverneur en la contestant. Dans ce but, le chef du service de santé prenait, dès le 15 septembre, une double init...

  2. Le survivant sans le syndrome Schreber

    Directory of Open Access Journals (Sweden)

    Richard Figuier

    2006-09-01

    Full Text Available On a pensé la catastrophe, mais a-t-on suffisamment pensé la survivance et la figure du survivant ? Ce n'est pas un hasard si celle-ci est au centre de Masse et puissance, oeuvre dans laquelle Canetti interroge la « mauvaise » survivance responsable de la poursuite de la logique de guerre. Mais où trouver la « bonne » ? Revenir de la catastrophe ne suffit pas pour être un « survivant authentique », selon l'expression de Kafka. Il faut avoir dépassé, avec Primo Levi et Robert Antelme, l'opposition de la vie comme croissance continue et de la mort comme son horrible contraire, par le don, dans la pauvreté solidaire, de cette vie retrouvée.Hemos reflexionado acerca de la catástrofe, pero ¿hemos meditado lo suficiente sobre la supervivencia y el superviviente? No es una coincidencia si el superviviente es el tema principal de Masse et puissance, obra en la cual Canetti analiza la «mala» supervivencia responsable de la persistencia de la lógica de guerra ¿Dónde sin embargo podemos encontrar la «buena» supervivencia? Superar la catástrofe no es suficiente para ser un «auténtico superviviente», según Kafka. Es fundamental ir más allá, con Primo Levi y Robert Antelme, de la oposición entre la vida, como crecimiento continuo, y la muerte, como su espantoso contrario, mediante la donación de forma solidaria de esta vida reencontrada.Disaster is the theme of many studies, but what about survival and of the figure of the survivor? This issue is central in Mass and power, work in which Canetti questions the “bad” survival, responsible for the continuation of the logic of war. But is there any “good” survival? Coming back from the catastrophe is not enough to be an “authentic survivor”, according to Kafka’s expression. To achieve this, it is necessary to have exceeded, with PrimoLevi and Robert Antelme, the opposition of life as a continuous growth and of death as its horrible opposite, by the gift, in a

  3. Étude ethnobotanique des plantes médicinales utilisées dans le ...

    African Journals Online (AJOL)

    SARAH

    31 mai 2017 ... 2017 Étude ethnobotanique des plantes médicinales utilisées dans le traitement du diabète dans le Département de Zouénoula (Côte d'Ivoire). 11258. Keywords: Ethnobotanical survey, medicinal plants, diabetes, Zouenoula. INTRODUCTION. Le diabète est une affection chronique plurifactorielle.

  4. Liens entre le savoir et l'innovation dans les services de gestion des ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Extrants. Documents. Linking knowledge to innovation in government services: the case of solid waste services in local government in Sri Lanka (K2I Project). Téléchargez le PDF. Rapports ... GrowInclusive : la plateforme tant attendue est en construction. Le CRDI, en partenariat avec le Forum économique mondial, ...

  5. : tous les projets | Page 112 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le programme de recherche Croissance de l'économie et débouchés économiques des femmes (CEDEF) est une initiative de collaboration entre le CRDI, le Department for International Development du Royaume-Uni et la Fondation William et Flora Hewlett. Région: South Asia, North of Sahara, South of Sahara, United ...

  6. Le coeur pulmonaire chronique. A propos de 35 cas colliges à la ...

    African Journals Online (AJOL)

    %), l'asthme (28,6%), la bronchite chronique (20,0%), le tabac (8,6%) et la tuberculose (14,3%). Conclusion : Le CPC est relativement peu fréquent dans notre milieu. La lutte contre l'obésité et le tabagisme, un suivi régulier des BPCO et un ...

  7. Le Programme de soutien à la formation envisage la création de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2 mai 2016 ... Le Centre de recherches pour le développement international (CRDI) appuie le projet Research into Open Educational Resources for Development ou ROER4D (Recherche sur les ressources éducatives libres au service du développement), dont l'objectif est d'améliorer les politiques, les pratiques et la ...

  8. Amélioration des pratiques de l'élevage du bétail Ndama en milieu villageois : l'exemple de Madina-Diassa au Sud du Mali

    Directory of Open Access Journals (Sweden)

    Berti, F.

    1995-01-01

    Full Text Available Improvement of Villager Ndama Cattle Husbandry Practices : the Example of Madina-Diassa in the South of Mali. In the south of Mali, the first 2 periods of the project titled "creation d'un berceau de la race bovine Ndama dans le cercle de Yanfolila" (ONDY led to a 1800 heads of Ndama cattle herd and to improve a genetic selection method. Due to the recurrent costs of the station, the greater part of the selected cattle was transferred to surrounding villages during the third project period. Such a transfer required an adjustment of both selection method and pastoral management. Results in the fields of cattle transfer, animal breeding, genetic selection, pastoral management and sanitary controls are presented. For the authors, the model proposed in the project offers an interesting alternative to cattle selection in a station, providing the acceptance by the entire surrounding population is obtained and providing factors acting on animal husbandry are mastered, especially feeding. Lastly, it has been confirmed that selective cattle breeding is feasible with farmer populations in wet areas in which it is traditionally unpresent. That is likely a way to be worked out, facing the relative saturation and degradation of sahelian areas.

  9. Le modèle fédéral dans le sport français, un principe fondateur dépassé ?

    Directory of Open Access Journals (Sweden)

    Béatrice Barbusse

    2009-06-01

    Full Text Available Dans le sport français, le fédéralisme s’est installé comme une évidence institutionnelle dès la fin du 19e siècle et le début du 20e siècle dans un pays qui pourtant ne se pense pas fédéral. En outre, si son apparition est liée à l’émergence du sport comme nouvelle pratique sociale à côté d’autres pratiques physiques plus traditionnelles, il s’est rapidement imposé comme la pierre angulaire de l’ordre sportif français. Près d’un siècle plus tard, son monopole institutionnel est bousculé voire «concurrencé». Ces constats d’ensemble nous amènent à nous interroger sur les raisons pour lesquelles le sport a épousé le modèle fédéral dans un pays non fédéral, mais aussi sur ses limites actuelles. Est-il encore le modèle approprié aux circonstances contemporaines ? A-t-il toujours sa place dans le système de gouvernance du sport ? Ou bien, a contrario, reste-t-il le dernier rempart légitime face aux excès du sport contemporain (dopage, violence, corruptions, déficits… ? À partir d’une approche socio-historique, il s’est agi dans cet article de reconstruire le fil de la généalogie du fédéralisme sportif tout en s’interrogeant sur ses perspectives. Au delà de la question du fédéralisme, c’est bien celle de la gouvernance du sport contemporain qui est posée.

  10. Factors associated with dog rabies immunisation status in Bamako, Mali.

    Science.gov (United States)

    Mauti, S; Traoré, A; Hattendorf, J; Schelling, E; Wasniewski, M; Schereffer, J L; Zinsstag, J; Cliquet, F

    2017-01-01

    We conducted a cross-sectional survey in Bamako, Mali, to determine for the first time the seroprevalence of rabies virus antibodies in the dog population and people's knowledge, attitudes and practices (KAP) towards the disease and its control. Antibody detection was done with the fluorescent antibody virus neutralisation (FAVN) test, with a positivity threshold of 0.25IU/ml. We visited 2956 households in 2010 and 2011 and found 379 dogs in 279 households. Data were collected on 279 dog-owning households, on 1017 non-dog-owning households and on 311 dogs. A serum or plasma sample was collected from 98 dogs. For 26 dogs we had sufficient data to describe the antibody decline over time after rabies vaccination using a quadratic regression. Ninety percent of interviewed persons (95% CI: 85%-91%) knew about rabies. The majority of interviewees knew that rabies is transmitted from dogs to humans, and some of the characteristic clinical signs seen in rabid dogs (change of behaviour, biting, salivation) could be listed by the majority. When asked how people behave regarding a rabid dog, killing the animal was the most frequent answer (>70%). Most (65% of the non-dog-owners and 81% of the dog-owners) were aware that vaccination of dogs can prevent rabies, but only a minority of dog-owners could answer correctly at what age the dog should get a first rabies vaccination (i.e. at 3 months). There was also strong consensus among dog-owners that it is better to protect their dog from becoming rabid by vaccinating it rather than needing to treat a bitten person. Forty-five percent (n=306; 95% CI 38%-52%) of dogs were reported as vaccinated against rabies at least once, but less than half of these (59/136) had a valid vaccination card. When asked for reasons for non-vaccination, cost was the most frequent reason at 31% (95% CI: 21%-43%), while general negligence was mentioned by 15% (95% CI: 10%-24%). Approximately one third of dog-owners would not pay for vaccination. To reach

  11. La lipogenèse chez le lapin. Importance pour le contrôle de la teneur en lipides de la viande

    OpenAIRE

    Gondret, Florence

    1999-01-01

    La teneur en lipides d’un tissu est la résultante de plusieurs flux métaboliques (dépôt, synthèse, utilisation). Cet article présente les principales caractéristiques de la synthèse des lipides chez le lapin, dans le muscle comparativement aux tissus adipeux visibles et au foie. Le potentiel de synthèse de novo exprimé par le muscle augmente avec l’âge de l’animal, en parallèle à l’accumulation des triglycérides dans les adipocytes intramusculaires. L’activité des enzymes qui fournissent le N...

  12. AcEST: BP920592 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Pasteur... 36 0.14 sp|Q9TTC2|GAG_KORV Gag polyprotein OS=Koala retrovirus GN=gag PE... 36 0.14 sp|P53352|INC...D 862 >sp|Q9TTC2|GAG_KORV Gag polyprotein OS=Koala retrovirus GN=gag PE=3 SV=3 Le

  13. AcEST: DK960831 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |P40798|STC_DROME Protein shuttle craft OS=Drosophila melanoga... 33 1.0 sp|O68988|CSMI_CHLTE Chlorosome pro...++ M LE Sbjct: 101 EAIEDFLCNFLIKMGMTRTLDCFQAEWYELIQKKGSDFKGLGNVPDVYSQVMLLE 155 >sp|P40798|STC_DROME Protein shuttle craft

  14. AcEST: DK949890 [AcEST

    Lifescience Database Archive (English)

    Full Text Available _GOSHI Catalase isozyme 1 OS=Gossypium hirsutum G... 401 e-111 sp|O24339|CATA_SOLAP Catalase OS=Soldanella a...8 EGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCT 414 >sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina PE=2 SV=1 Le

  15. AcEST: DK947961 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ABVR Minor nucleoprotein VP30 OS=Lake Victoria m... 30 9.1 sp|A1AYS1|SELA_PARDP L...E 586 G H+ +G L +P M++ Sbjct: 498 GEVHHC-KGELARALPMMQQ 516 >sp|Q1PDC6|VP30_MABVR Minor nucleoprotein VP30 OS=Lake Victoria

  16. [Social anthropological approach to tuberculosis in Mopti (Mali): popular representations and use of treatment].

    Science.gov (United States)

    Berthe, A; Maguiraga, F; Traoré, L; Mugisho, E; Drabo, M; Traoré, A K; Dujardin, B; Huygens, P

    2009-01-01

    In Mali, there were 4508 new cases of tuberculosis in 2003, and 5222 in 2006. Tuberculosis (TB) is thus an important public health problem, decreasing the physical, financial and social capital of individuals, their families and society. Because responses to TB have not yet applied a sufficiently integrated approach that can improve patients' access to quality care, this FORESA project advocates a patient-centered approach. Before any intervention, FORESA thus sought to analyse the situation of TB in Mali and responses to it. The study aims to analyse the discourse about and popular representations of TB (its forms, its signs), the situations in which people are exposed to it or transmit it, and popular practices related to its prevention and the experience of having it. This qualitative, descriptive and analytical study includes a literature review, in-depth interviews with opinion leaders, community health workers and TB patients, focus groups, and the observations of practices. The interviews were recorded, transcribed, and analysed. Subjects provided informed consent to participation. This study showed that: * the terms for TB in local languages (Bambara, Dogon and Fulfuldé) include white cough, big cough, and long cough; * These communities differentiate between 2 main forms of cough (simple and wet); * TB is perceived as a transmissible disease, a disease of contact with a contaminated body or objects; * TB is seen as a serious, contagious, hereditary, shameful disease that may result from the transgression of social norms; * The prevention of TB consists of avoiding people who have the disease or transmitting factors; * Therapeutic remedies, in order, are self-medication, the use of traditional healers, and finally visits to health centres; * The population wants more information about TB and be involved in the fight against it. This study shows the many points of convergence about TB nosology, etiology and therapy between the Mopti population and other

  17. The linear chromosome of the plant-pathogenic mycoplasma 'Candidatus Phytoplasma mali'

    Directory of Open Access Journals (Sweden)

    Migdoll Alexander M

    2008-06-01

    Full Text Available Abstract Background Phytoplasmas are insect-transmitted, uncultivable bacterial plant pathogens that cause diseases in hundreds of economically important plants. They represent a monophyletic group within the class Mollicutes (trivial name mycoplasmas and are characterized by a small genome with a low GC content, and the lack of a firm cell wall. All mycoplasmas, including strains of 'Candidatus (Ca. Phytoplasma asteris' and 'Ca. P. australiense', examined so far have circular chromosomes, as is the case for almost all walled bacteria. Results Our work has shown that 'Ca. Phytoplasma mali', the causative agent of apple proliferation disease, has a linear chromosome. Linear chromosomes were also identified in the closely related provisional species 'Ca. P. pyri' and 'Ca. P. prunorum'. The chromosome of 'Ca. P. mali' strain AT is 601,943 bp in size and has a GC content of 21.4%. The chromosome is further characterized by large terminal inverted repeats and covalently closed hairpin ends. Analysis of the protein-coding genes revealed that glycolysis, the major energy-yielding pathway supposed for 'Ca. P. asteris', is incomplete in 'Ca. P. mali'. Due to the apparent lack of other metabolic pathways present in mycoplasmas, it is proposed that maltose and malate are utilized as carbon and energy sources. However, complete ATP-yielding pathways were not identified. 'Ca. P. mali' also differs from 'Ca. P. asteris' by a smaller genome, a lower GC content, a lower number of paralogous genes, fewer insertions of potential mobile DNA elements, and a strongly reduced number of ABC transporters for amino acids. In contrast, 'Ca. P. mali' has an extended set of genes for homologous recombination, excision repair and SOS response than 'Ca. P. asteris'. Conclusion The small linear chromosome with large terminal inverted repeats and covalently closed hairpin ends, the extremely low GC content and the limited metabolic capabilities reflect unique features of 'Ca

  18. Le pilotage du changement dans le secteur bancaire Cas pratique banque de l'agriculture et développement rural BADR/BANK

    OpenAIRE

    Touami, Zouaoui

    2014-01-01

    Notre projet s'articule sur l'étude du pilotage de changement dans le secteur bancaire.Le premier chapitre détermine le rapport entre le changement et l'identité de l'entreprise, le deuxième chapitre portera sur le processus du changement.changement. A travers le troisième chapitre on va aborder la notion du pilotage stratégique du changement, le quatrième chapitre est réservé à l'étude du management opérationnel du changement.Le cinquième chapitre sera porté sur la définition du changement s...

  19. Le point de vue d’une historienne

    OpenAIRE

    Gavignaud-Fontaine, Geneviève

    2013-01-01

    Alors que le citoyen et le consommateur interrogent les modes de production agricole, l’agronome est confronté, à travers ses engagements et ses responsabilités, au sens de sa mission. Or l’histoire de sa discipline révèle la permanence des confrontations et la virulence des engagements. Mais comment peut-il faire face à cette histoire ? L’agriculture biologique, en refusant d’utiliser des intrants chimiques, est un exemple d’actualité qui trouve ses racines dans un débat beaucoup plus ancie...

  20. galaxieEST: addressing EST identity through automated phylogenetic analysis.

    Science.gov (United States)

    Nilsson, R Henrik; Rajashekar, Balaji; Larsson, Karl-Henrik; Ursing, Björn M

    2004-07-05

    Research involving expressed sequence tags (ESTs) is intricately coupled to the existence of large, well-annotated sequence repositories. Comparatively complete and satisfactory annotated public sequence libraries are, however, available only for a limited range of organisms, rendering the absence of sequences and gene structure information a tangible problem for those working with taxa lacking an EST or genome sequencing project. Paralogous genes belonging to the same gene family but distinguished by derived characteristics are particularly prone to misidentification and erroneous annotation; high but incomplete levels of sequence similarity are typically difficult to interpret and have formed the basis of many unsubstantiated assumptions of orthology. In these cases, a phylogenetic study of the query sequence together with the most similar sequences in the database may be of great value to the identification process. In order to facilitate this laborious procedure, a project to employ automated phylogenetic analysis in the identification of ESTs was initiated. galaxieEST is an open source Perl-CGI script package designed to complement traditional similarity-based identification of EST sequences through employment of automated phylogenetic analysis. It uses a series of BLAST runs as a sieve to retrieve nucleotide and protein sequences for inclusion in neighbour joining and parsimony analyses; the output includes the BLAST output, the results of the phylogenetic analyses, and the corresponding multiple alignments. galaxieEST is available as an on-line web service for identification of fungal ESTs and for download / local installation for use with any organism group at http://galaxie.cgb.ki.se/galaxieEST.html. By addressing sequence relatedness in addition to similarity, galaxieEST provides an integrative view on EST origin and identity, which may prove particularly useful in cases where similarity searches return one or more pertinent, but not full, matches and

  1. Publications | Page 118 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'argent fait peut-être tourner le monde, mais c'est le café qui le fait démarrer. En 2003, quelque 6 millions de tonnes de café ont été récoltées, torréfiées et consommées dans le... L'agrobiodiversité au Népal, une assurance judicieuse. Hors du champ de l'appareil photo, des voix la taquinent, mais, une main sur la hanche ...

  2. Florencia Ballarino | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    J'ai toujours été très curieuse. Depuis mon enfance, j'aime lire sur les sujets scientifiques. Mais lorsqu'est venu le temps de choisir un domaine d'étude, j'ai opté pour la littérature et le journalisme. Mes parents travaillaient tous deux dans le domaine scientifique, alors j'ai voulu me démarquer. Peu après le début de mes ...

  3. Michaux, «Le Jardin Exalté»

    OpenAIRE

    Vera Lúcia de Carvalho Casa Nova

    2011-01-01

    Resumo: Esse ensaio resulta de uma leitura do texto de H. Michaux, focalizando a relação entre as artes na escritura desse autor.Palavras-chave: Literatura francesa; Henri Michaux; Le Jardin Exalté; artes.Résumé: Cet essai est le résultat d’une lecture qui montre les relations entre les arts dans l’écriture Henri Michaux.Mots-clés: Littérature française; Henri Michaux; Le Jardin Exalté; arts.Keywords: French literature; Henri Michaux; Le Jardin Exalté; arts.

  4. Michaux, «Le Jardin Exalté»

    Directory of Open Access Journals (Sweden)

    Vera Lúcia de Carvalho Casa Nova

    2011-10-01

    Full Text Available Resumo: Esse ensaio resulta de uma leitura do texto de H. Michaux, focalizando a relação entre as artes na escritura desse autor.Palavras-chave: Literatura francesa; Henri Michaux; Le Jardin Exalté; artes.Résumé: Cet essai est le résultat d’une lecture qui montre les relations entre les arts dans l’écriture Henri Michaux.Mots-clés: Littérature française; Henri Michaux; Le Jardin Exalté; arts.Keywords: French literature; Henri Michaux; Le Jardin Exalté; arts.

  5. Le marketing cherche ses marques

    OpenAIRE

    Hentschel, Dieter

    2018-01-01

    Voici maintenant dix ans que, dans le cadre d’une politique continue de diversification des formations offertes aux germanistes, l’IAA a mis en place un enseignement de marketing. Cette innovation n’est pas restée sans suite, puisqu’elle a abouti au repositionnement du DESS « économie et Société dans les pays de langue allemande » qui s’appelle désormais « Gestion et marketing franco-allemands ». L’objectif a été de proposer aux étudiants une formation professionnalisante qui corresponde aux ...

  6. L'hepcidine, le chef d'orchestre de l'homéostasie du fer

    OpenAIRE

    Nicolas, Gaël

    2009-01-01

    Dans un organisme en bonne santé le fer est en mouvement permanent entre les sites où il est absorbé (le duodénum), où il est utilisé (principalement la moelle osseuse) et où il est stocké (le foie et la rate). L'homéostasie de ces mouvements de fer repose sur le contrôle strict de plusieurs paramètres tels que l'absorption intestinale du fer, son utilisation pour l'érythropoïèse, le recyclage du fer à partir des globules rouges défecteux ou en fin de vie et enfin la bonne gestion des stocks ...

  7. Le voyageur et le touriste

    Directory of Open Access Journals (Sweden)

    André Rauch

    2011-06-01

    Full Text Available Les guides qui paraissent dans la première moitié du XIXe siècle, en langue allemande, anglaise et française, ont introduit des usages. Ils ont défini une manière de voyager, arrêté les itinéraires et indiqué les sites ou les lieux qu’il convenait de visiter. Lorsque paraissent les guides pour automobilistes au début du XXe siècle, la route permet d’autres formes de vagabondage, dont la gastronomie est un exemple illustratif. Dans les années soixante-dix, les nouveaux guides ont suscité d’autres curiosités, ils ont aussi indiqué au touriste les budgets qui leur permettraient de s’orienter dans la consommation touristique.Guides published during the first half of 19th century, in German, English and French languages have introduced some customs. They have defined a way of travelling, made up the routes and indicated the places and settings one has to visit. When guides for motorists are published at the beginning of the 20th century, the road allows other forms of wandering, among which gastronomy is an illustrative example. During the seventies, the new guides aroused other curiosities, they also indicated to the tourists the budgets that would allow them to find their way inside tourist consuming.

  8. Le vide univers du tout et du rien

    CERN Document Server

    Diner, Simon

    1997-01-01

    Pourquoi l'Univers plutôt que le vide ? Le temps et l'espace existent-ils en l'absence de l'Univers ? Que reste-t-il quand tout est enlevé ? Pourquoi quelque chose plutôt que rien ? Depuis des siècles, ces interrogations mobilisent philosophes et physiciens. Mais aujourd'hui, le vide n'est pas le rien. Il serait même l'acteur central de l'histoire de la matière et de l'Univers, le partenaire privilégié de la physique. Vide et matière ne sont plus deux manifestations séparées de la nature, mais deux aspects d'une même réalité. Le vide est l'état de base dont la matière émerge, sans couper son cordon ombilical Le vide comme Univers du rien cède la place au vide comme Univers du tout. Que le vide puisse être conçu par les physiciens comme réservoir potentiel d'univers, voici qui ne devrait laisser personne indifférent. Ce livre ouvre un débat et nous convie à une réflexion surprenante.

  9. Lele médiateur de la satisfaction au travail dans le lien entre l’intensité de la gestion des ressources humaines et le roulement du personnel

    Directory of Open Access Journals (Sweden)

    Emmanuel Nwahanye

    2016-09-01

    Full Text Available Ce travail évalue empiriquement lele médiateur de la satisfaction au travail dans le lien entre l’intensité de la gestion des ressources humaines (GRH et le roulement du personnel mis en évidence par de nombreux modèles de départ d’employés. Il est conduit sur un échantillon de 73 institutions financières en activité au Cameroun et fait appel à la méthode causale d’analyse des effets médiateurs adaptée du modèle de Baron & Kenny (1986. Les résultats assortis des régressions montrent, d’une part, que la satisfaction est un médiateur partiel dans le lien entre l’intensité de la GRH et le taux de roulement volontaire. D’autre part, elle est un médiateur parfait dans le lien entre l’intensité de la GRH et la propension à quitter. Il recommande aux dirigeants d’accorder une attention particulière à la satisfaction au travail en matière de rétention du personnel.

  10. Le limus rédempteur de Andrej Tarkovski

    Directory of Open Access Journals (Sweden)

    Paolo Mottana

    2015-04-01

    Full Text Available Le cinéma de Tarkovski est riche de présences symboliques. L'essai rend, à travers le contact prolongé et fidèle aux différentes oeuvres du metteur en scène russe, la constellation de ses éléments archetipiques et de ses figures les plus significatives. Le dialogue terre-eau, le travail du feu, la récurrence de l'arbre, du bois, de l'enfance, le flux lent du temps, la phenomenologie poétique de la maison. Dans le cinéma de Tarkovski on se perd, son oeuvre, un vrai opus magnus alchimique, est un voyage dans la survivance d'un halètement mystique profondément incarné dans la matière terrestre. Son parcours circulaire, de l'arbre brûlé d'Ivan à ce qui renaît à la fin du Sacrifice miraculeusement, c'est une cheville fondamentale pour pouvoir expérimenter la puissance de l'imagination créatrice quand encore elle est l' expression d'une sensibilité inspirée à l'âme du monde".

  11. Ouganda | CRDI - Centre de recherches pour le développement ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le taux de pauvreté en Ouganda est en baisse. Toutefois, cette tendance positive est ralentie par des sécheresses extrêmes, des conflits régionaux, une pauvreté croissante dans le nord du pays et la hausse des inégalités.

  12. 'Love of the heart': romantic love among young mothers in Mali.

    Science.gov (United States)

    Sølbeck, Ditte Enemark

    2010-05-01

    This paper calls attention to an ideal of romantic love among young unmarried mothers in Mali. It demonstrates that romantic love constitutes a motivating force for the agency of young Malian mothers who invest themselves in hopes of romantic outcomes from their relationships. Like the majority of people in Mali, the young mothers in this study dedicated a considerable time each weekday to watching a Venezuelan soap opera, which could be regarded as offering a modern version of Romeo and Juliet. Yet, romance is not the only thing that matters in young mothers' ideals of love. Materiality plays an important role as well. Thus, young mothers have multiple motives for engaging in relationships with men: they seek both romance and material stability, which is why an either love or exchange perspective is insufficient when examining the topic of romantic love in a Malian context.

  13. Anemia and growth retardation associated with Schistosoma haematobium infection in Mali

    DEFF Research Database (Denmark)

    Stecher, Chalotte W; Sacko, Moussa; Madsen, Henry

    2017-01-01

    BackgroundThe aim of this cross-sectional study was to investigate a possible association of Schistosoma haematobium with child growth development and describe a plausible schistosomiasis-related anemia in children and adults in a highly schistosomiasis endemic area of Mali. MethodsUrine, feces a....... Lower height for age z-scores were also associated with anemia. ConclusionsS. haematobium infection is likely to impact on child growth and possibly also anemia in all age groups and advocates for inclusion of whole populations into future control programes.......BackgroundThe aim of this cross-sectional study was to investigate a possible association of Schistosoma haematobium with child growth development and describe a plausible schistosomiasis-related anemia in children and adults in a highly schistosomiasis endemic area of Mali. MethodsUrine, feces...

  14. Les enjeux du modèle standard

    CERN Document Server

    CERN. Geneva

    2008-01-01

    Toute la matière visible dans l'Univers est décrite par le « Modèle Standard ». Selon cette théorie, la matière est constituée d'atomes, qui contiennent des électrons orbitant autour de noyaux, dont les composants fondamentaux sont les quarks. Quatre forces fondamentales agissent entre ces particules élémentaires : les forces électromagnétique est gravitationnelle, et les interactions nucléaires forte et faible. La description fournie par le Modèle Standard de ces particules et de leurs interactions est en parfait accord avec les expériences. Néanmoins, des questions fondamentales restent sans réponse jusqu'à maintenant : d'où vient la masse des particules ? Pourquoi y a-t-il tant de types de particules ? Existe-t-il une théorie unifiée de toutes les interactions ? Quelle est la nature de la matière cachée prédite par les astrophysiciens ? Le LHC au CERN donnera des éléments de réponse à ces questions au-delà du Modèle Standard.

  15. La place de l'imagerie par résonance magnétique dans le ...

    African Journals Online (AJOL)

    Le diagnostic paraclinique est basée sur le couple écho-mammographie a la recherche de multifocalité, multicentricité ou bilatéralité, d'où l'intérêt de l'IRM qui est la technique la plus sensible pour la mise en évidence de ces lésions et qui est devenue un examen de pratique courante dans le carcinome lobulaire du sein.

  16. Bonheur et progrès : mesurer le bien-être au Bhoutan et au Canada ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    31 janv. 2011 ... Mesurer le bien-être. Au Bhoutan, ce tableau de bord porte un nom plein de charme. C'est le bonheur national brut (BNB). Le royaume est-himalayen, bouddhiste, compte environ 800 000 sujets. Enclavé entre les deux pays les plus populeux de la planète, il vient de mettre fin au long isolement qu'il s'était ...

  17. Économie | Page 23 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Colour. #2C81B5. Le G8 (Allemagne, Angleterre, Canada, États-Unis, France, Italie, Japon, Russie et Union européenne) est aujourd'hui le principal vecteur politique de la mondialisation. Il est également la force politique qui soutient le plus fermement les institutions multilatérales façonnant la gouvernance économique ...

  18. Développement d'un nouveau modèle pour la simulation en continu ...

    African Journals Online (AJOL)

    Hamouda

    conformément à l'organigramme général de la figure 6. Enfin, pour des besoins de convergence du schéma explicite de résolution et d'adéquation avec les modèles d'hydrologie urbaine. (assainissement pluvial), le pas de temps pris, est le plus fin possible. En hydrologie urbaine, le pas de temps des simulations est de ...

  19. Processus de construction de la confiance et configuration de contrôle de gestion

    OpenAIRE

    Khlif, Wafa

    2000-01-01

    International audience; L'enrichissement de la compréhension du contrôle de gestion par une dimension plus “humaine” a conduit naturellement à l'émergence de concepts “qualitatifs”. La confiance fait partie de ces concepts ignorés dans un contexte instrumental. L'objectif de cette recherche est d'analyser le processus de construction de la confiance relativement aux éléments de contrôle de gestion. En premier lieu, ce travail discute le lien entre le contrôle de gestion et la confiance dans l...

  20. Phyllactinia mali and Podosphaera tridactyla var. tridactyla – new hosts of Ampelomyces quisqualis

    OpenAIRE

    Beata Czerniawska

    2014-01-01

    In 2002, the occurrence of fungi of the order Erysiphales on plants of the Słowiański Park located in Goorzów Wielkopolski was investigated. Plant samples were collected once a month, from August to November. The samples examined were above ground plant parts colonized by powdery mildew fungi. A total of 78 samples were collected. Apart from 14 species of the order Erysiphales, Ampelomyces quisqualis parasitizing on Erysiphe cichoracearum var. cichoracearum, Phyllactinia mali and Podosphae...

  1. Implementing preventive chemotherapy through an integrated National Neglected Tropical Disease Control Program in Mali.

    Directory of Open Access Journals (Sweden)

    Massitan Dembélé

    Full Text Available BACKGROUND: Mali is endemic for all five targeted major neglected tropical diseases (NTDs. As one of the five 'fast-track' countries supported with the United States Agency for International Development (USAID funds, Mali started to integrate the activities of existing disease-specific national control programs on these diseases in 2007. The ultimate objectives are to eliminate lymphatic filariasis, onchocerciasis and trachoma as public health problems and to reduce morbidity caused by schistosomiasis and soil-transmitted helminthiasis through regular treatment to eligible populations, and the specific objectives were to achieve 80% program coverage and 100% geographical coverage yearly. The paper reports on the implementation of the integrated mass drug administration and the lessons learned. METHODOLOGY/PRINCIPAL FINDINGS: The integrated control program was led by the Ministry of Health and coordinated by the national NTD Control Program. The drug packages were designed according to the disease endemicity in each district and delivered through various platforms to eligible populations involving the primary health care system. Treatment data were recorded and reported by the community drug distributors. After a pilot implementation of integrated drug delivery in three regions in 2007, the treatment for all five targeted NTDs was steadily scaled up to 100% geographical coverage by 2009, and program coverage has since been maintained at a high level: over 85% for lymphatic filariasis, over 90% for onchocerciasis and soil-transmitted helminthiasis, around 90% in school-age children for schistosomiasis, and 76-97% for trachoma. Around 10 million people have received one or more drug packages each year since 2009. No severe cases of adverse effects were reported. CONCLUSIONS/SIGNIFICANCE: Mali has scaled up the drug treatment to national coverage through integrated drug delivery involving the primary health care system. The successes and lessons

  2. P. falciparum malaria prevalence among blood donors in Bamako, Mali.

    Science.gov (United States)

    Kouriba, B; Diarra, A B; Douyon, I; Diabaté, D T; Kamissoko, F; Guitteye, H; Baby, M; Guindo, M A; Doumbo, O K

    2017-06-01

    Malaria parasite is usually transmitted to humans by Anopheles mosquitoes but it can also be transmitted through blood transfusion. Usually malaria transmission is low in African urban settings. In West Africa where the P. falciparum is the most predominant malaria species, there are limited measures to reduce the risk of blood transfusion malaria. The aim of this study was to evaluate the prevalence of P. falciparum malaria carriage among blood donors in the National Blood Center of Bamako, capital city of Mali. The study was conducted using a random sample of 946 blood donors in Bamako, Mali, from January to December 2011. Screening for malaria was performed by thick smear and rapid diagnostic test (RDT). Blood group was typed by Beth-Vincent and Simonin techniques. The frequency of malaria infection was 1.4% by thick smear and 0.8% by the RDT. The pick prevalence of P. falciparum malaria was in rainy season, indicating a probable high seasonal risk of malaria by blood transfusion, in Mali. The prevalence of P. falciparum infection was 2% among donors of group O the majority being in this group. There is a seasonal prevalence of malaria among blood donors in Bamako. A prevention strategy of transfusion malaria based on the combination of selection of blood donors through the medical interview, promoting a voluntary low-risk blood donation and screening all blood bags intended to be transfused to children under 5, pregnant women and immune-compromised patients during transmission season using thick smear will reduce the risk of transfusion malaria in Mali. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  3. Comparative morphological analysis of apple blister mite, Eriophyes mali Nal., a new pest in Serbia

    OpenAIRE

    Vidović Biljana; Marinković Slavica; Marić Ivana; Petanović Radmila

    2014-01-01

    The apple blister mite, Eriophyes mali Nalepa, 1926 (Acari: Prostigmata: Eriophyoidea), has been recently found in Serbia as a new pest of apple. The history of its research, the results of a morphological analysis and degree of infestation are presented. A comparison of the main morphological features of mites from different populations of remote geographical origin has shown that the apple blister mite from Serbia is most similar to another European popul...

  4. [Contraception and protection against STDs. CERPOD measures use of the Protector condom in Mali].

    Science.gov (United States)

    Konate, M K

    1993-08-01

    In April 1993, a technical assistance contract to measure general condom use, particularly use of the brand name Protector, which has been marketed in Mali since March 1992, was made between the Center of Studies and Research on Population for Development (CERPOD) and the Popular Pharmacy of Mali. In June-July 1991, the SOMARC project and the Malian Institute for Applied Research in Development conducted a baseline survey to determine the condom use rate in Mali before Protector was introduced on the Malian market, so the social marketing project for contraception could be evaluated. It examined knowledge, use, and achievable target level and determined the characteristics of users of the Protector condom. It revealed that more than 90% of both men and women believed birth spacing was a good idea. Men approved of birth spacing for cost-saving reasons, while women approved birth spacing because it allowed mothers time to recuperate between births. Another earlier study in 1987 in Bamako found that 78% of the women already favored birth spacing. 90% of the men in the main cities in Mali knew about condoms. 63% of these men had used them in the past, mainly to prevent sexually transmitted diseases. 30% used them consistently. One hoped that this number was going to grow, since 80% of the men said that they would use condoms in the future. The evaluation of the 1991 social marketing campaign will end in August 1993 and will measure whether it was successful or not. In November 1992, CERPOD followed the framework of a recent baseline survey for an IEC (information, education, and communication) family planning program, operated jointly by the Malian Association for the Protection and Promotion of the Family and Population Communication Services, to measure the effect of the brand name Protector. CERPOD's survey results will be compared with those of the 1993 survey.

  5. Le kyste de la vallecule : a propos de 2 observations | Hariga ...

    African Journals Online (AJOL)

    Le kyste de la vallecule : a propos de 2 observations. I Hariga, A Mardassi, S Zribi, A Charfeddine, M Amor, O Gamra, C Mbarek, A El Khedim. Abstract. Le kyste de la vallécule est une malformation laryngée rare pouvant parfois mettre en jeu le pronostic vital. Diagnostiqué et traité à temps, le risque de complications et de ...

  6. Le Cercle de vie : l'agriculture biologique au Mexique | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    13 juil. 2011 ... Le marché, Le Círculo de producción y consumo responsable [le Cercle de production et de consommation responsables] est un projet local du Collectif écologique du Jalisco créé il y a 15 ans. Le Círculo s'inspire des anciens tíanguis mexicains, ces lieux d'échange de produits alimentaires et d'idées ...

  7. Le commentaire de cartes et la «nouvelle géographie»

    Directory of Open Access Journals (Sweden)

    Alain REYNAUD

    1987-06-01

    Full Text Available Les cartes topographiques intéressent le public et attirent l'attention des penseurs, car elles constituent un support aussi bien pour le raisonnement et le rêve que pour l'action. Au même moment, le commentaire de cartes est remis en question parmi les géographes; mais il peut garder sa place à la condition d'affûter ses outils conceptuels et de diversifier ses thèmes.

  8. le des mitochondries dans les voies immunitaires innées | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le projet est dirigé au Canada par l'Institut neurologique de Montréal (Université McGill) en collaboration avec le Weizmann Institute (Israël), l'Universidad Andres Bello (Chili) et le National Institute of Biological Sciences (Chine). Ce projet et son financement ont été approuvés par le deuxième concours de recherche du ...

  9. Lele des associations  dans la médiation en archéologie

    OpenAIRE

    Sence, Christophe

    2014-01-01

    Le milieu associatif est connu en France pour son dynamisme et sa réactivité. Il en va de même en archéologie, notamment dans le domaine de la médiation. Si le public ignore bien souvent qu’une association se cache derrière le lieu qu’il vient de visiter, nombreux sont les sites archéologiques, toutes périodes confondues, dont la mise en valeur est entièrement assumée par une telle structure. Dans ce cadre, tout est envisageable, de la simple ouverture pendant les Journées européennes du patr...

  10. AcEST: DK956296 [AcEST

    Lifescience Database Archive (English)

    Full Text Available PIRVV Pre-glycoprotein polyprotein GP complex OS=Pirital virus (isolate Rat/Venezuela/VAV-488/1995) Align le...30 7.7 >sp|Q8B119|GLYC_PIRVV Pre-glycoprotein polyprotein GP complex OS=Pirital virus (isolate Rat/Venezue...la/VAV-488/1995) GN=GPC PE=3 SV=1 Length = 510 Score = 32.0 bits (71), Expect = 2.6

  11. Agrobacterium tumefaciens-Mediated Transformation of Valsa mali: An Efficient Tool for Random Insertion Mutagenesis

    Directory of Open Access Journals (Sweden)

    Caixia Wang

    2013-01-01

    Full Text Available Valsa mali is a causal agent of apple and pear trees canker disease, which is a destructive disease that causes serious economic losses in eastern Asia, especially in China. The lack of an efficient transformation system for Valsa mali retards its investigation, which poses difficulties to control the disease. In this research, a transformation system for this pathogen was established for the first time using A. tumefaciens-mediated transformation (ATMT, with the optimal transformation conditions as follows: 106/mL conidia suspension, cocultivation temperature 22°C, cocultivation time 72 hours, and 200 μM acetosyringone (AS in the inductive medium. The average transformation efficiency was 1015.00 ± 37.35 transformants per 106 recipient conidia. Thirty transformants were randomly selected for further confirmation and the results showed the presence of T-DNA in all hygromycin B resistant transformants and also revealed random and single gene integration with genetic stability. Compared with wild-type strain, those transformants exhibited various differences in morphology, conidia production, and conidia germination ability. In addition, pathogenicity assays revealed that 14 transformants had mitigated pathogenicity, while one had enhanced infection ability. The results suggest that ATMT of V. mali is a useful tool to gain novel insight into this economically important pathogen at molecular levels.

  12. First detection of Leishmania major DNA in Sergentomyia (Spelaeomyia) darlingi from cutaneous leishmaniasis foci in Mali.

    Science.gov (United States)

    Berdjane-Brouk, Zohra; Koné, Abdoulaye K; Djimdé, Abdoulaye A; Charrel, Rémi N; Ravel, Christophe; Delaunay, Pascal; del Giudice, Pascal; Diarra, Adama Z; Doumbo, Siala; Goita, Siaka; Thera, Mahamadou A; Depaquit, Jérôme; Marty, Pierre; Doumbo, Ogobara K; Izri, Arezki

    2012-01-01

    Leishmania major complex is the main causative agent of zoonotic cutaneous leishmaniasis (ZCL) in the Old World. Phlebotomus papatasi and Phlebotomus duboscqi are recognized vectors of L. major complex in Northern and Southern Sahara, respectively. In Mali, ZCL due to L. major is an emerging public health problem, with several cases reported from different parts of the country. The main objective of the present study was to identify the vectors of Leishmania major in the Bandiagara area, in Mali. An entomological survey was carried out in the ZCL foci of Bandiagara area. Sandflies were collected using CDC miniature light traps and sticky papers. In the field, live female Phlebotomine sandflies were identified and examined for the presence of promastigotes. The remaining sandflies were identified morphologically and tested for Leishmania by PCR in the ITS2 gene. The source of blood meal of the engorged females was determined using the cyt-b sequence. Out of the 3,259 collected sandflies, 1,324 were identified morphologically, and consisted of 20 species, of which four belonged to the genus Phlebotomus and 16 to the genus Sergentomyia. Leishmania major DNA was detected by PCR in 7 of the 446 females (1.6%), specifically 2 out of 115 Phlebotomus duboscqi specimens, and 5 from 198 Sergentomyia darlingi specimens. Human DNA was detected in one blood-fed female S. darlingi positive for L. major DNA. Our data suggest the possible involvement of P. duboscqi and potentially S. darlingi in the transmission of ZCL in Mali.

  13. Urinary schistosomiasis among preschool-aged children in Sahelian rural communities in Mali

    Directory of Open Access Journals (Sweden)

    Doumbo Ogobara K

    2011-02-01

    Full Text Available Abstract Background Mass chemotherapy with praziquantel is the main control strategy for schistosomiasis in Mali. However, in the national control programme for schistosomiasis and soil-transmitted helminthiasis, infants and preschool-aged children are overlooked in preventive chemotherapy campaigns. We therefore determined the prevalence and intensity of urinary schistosomiasis in children between the ages 1-4 years in three villages across Diema health district, a rural community with endemic schistosomiasis in Mali. For Schistosoma haematobium diagnosis, a single urine sample of 10 ml obtained from each child was subjected to the standard urine filtration method. Results Of the 338 children examined 173 (51.2% were infected. Both prevalence and intensity of infection varied significantly between communities (p Conclusion Our study showed that preschool children living closely to lakes across in Mali are at high risk to be infected by schistosomiasis and contributed largely to the transmission; therefore schistosomiasis control interventions should also target infants in addition to school children and adults in endemic areas.

  14. First report of Echinococcus granulosus (genotype G6) in a dog in Bamako, Mali.

    Science.gov (United States)

    Mauti, S; Traoré, A; Crump, L; Zinsstag, J; Grimm, F

    2016-02-15

    Cystic echinococcosis is one of the most widespread and important helminthic zoonoses, caused by the larval stage of Echinococcus granulosus sensu lato. However, to date there is little information about the disease in West Africa. Faecal and fur samples from 193 dogs, the main final hosts, were collected in 2010 and 2011 in Bamako, Mali. Taeniid eggs were found microscopically in 28/118 (24%) and 80/223 (36%) faecal and fur samples, respectively. One faecal and one fur sample from the same dog were positive for E. granulosus s. l. DNA. In the remaining 27 faecal (96%) and 77 fur samples (96%) only Taenia DNA was detected. Three microscopically positive fur samples were negative by PCR. Sequence analysis of part of the NADH dehydrogenase subunit 1 gene identified the parasite as E. granulosus (genotype G6; Echinococcus canadensis). This is the first study to focus on the final host of E. granulosus s. l. in Mali and the first report of E. canadensis in Mali. Copyright © 2016 Elsevier B.V. All rights reserved.

  15. I Play Wassoulou, Jeli, Songhay and Tuareg Music: Adama Drame in Postcolonial Mali, Bimusical or Multimusical?

    Directory of Open Access Journals (Sweden)

    Luis Gimenez Amoros

    2014-08-01

    Full Text Available Adama is an accomplished guitarist in diverse Malian styles. The Malian guitarist is able to analyse the forms and contexts of the national musical styles he performs in regards to: the musical interaction with other musicians, timbre, rhythm and melody. In this article, I examine how Adama performs a wide range of Malian musical styles in Bamako; and how he represents and participates in different postcolonial musical cultures in Mali. In this article, Adama’s capability of understanding different national musical styles as part of the social contexts in a variety of musical cultures in Mali is defined as multimusical. Multimusicality debates the concept of bimusicality (Hood 1960 defined as the capacity of performing both, a western and non-western musical style; therefore separating musically the Self [western music] and the Other [non-western]. For Adama, the concept of multimusicality does not only extend the possibility of learning more than two musical styles, but examines the national styles he is able to play as a Malian citizen (insider and not as the Other. This paper is based on my musical contact with Adama Drame during November-December 2006 in Mali and in the last eight years.

  16. Le citoyen rieur

    Directory of Open Access Journals (Sweden)

    Anna Rycman

    2009-11-01

    Full Text Available Dans la Pologne d’aujourd’hui, l’évolution des modèles d’engagement civique et politique s’opère plus particulièrement auprès des jeunes générations. Parmi les expériences nouvelles de participation politique, les nouvelles technologies de l’information et de la communication offrent des opportunités radicales de reconfigurer l’espace public. La jeunesse polonaise investit en masse le Web. Dans le flux de paroles affranchies circulant et dialoguant dans le cyberespace, nous nous intéressons ici au développement d’un discours qui emprunte au registre de la dérision et de la satire politiques. Une multitude de sites critiques, de nature apparemment contestataire, des sites d’opposition fondés sur le genre satirique, ont émergé comme réponse apportée à la situation politique. Cet espace public électronique représente une forme moderne de « folklore politique », contribuant au processus de socialisation des jeunes citoyens polonais.The laughing citizen. A modern form of civic commitment in democratic Poland?In present day Poland, the evolution of civic and political commitment models is above all the affaire of the younger generations. Among the current opportunities for political participation, the new information and communication technologies offer radical opportunities to reconfigure the public arena. Polish youth are flocking to the Web. Amongst the flux of frank points of views circulating and dialoguing in cyberspace, our interest here is the development of a discourse inspired by political and satirical derision. A multitude of critical, apparently anti-establishment, sites and general opposition sites using the satirical style have emerged as a response to the political situation. This public electronic space represents a modern form of « political folklore », contributing to the socialising processes of young polish citizens.El ciudadano que rie. ¿Nueva forma del compromiso cívico en la

  17. Le theatre d'Afrique noire francophone: un art tourne vers le ...

    African Journals Online (AJOL)

    Cette étude a pour objectif de porter un regard analytique sur le théâtre d'Afrique noire francophone, depuis les années d'indépendances jusqu'à nos jours, afin de mettre en relief sa contribution au développement du continent. Il est à remarquer, en effet, que ce théâtre, dans son cheminement, est essentiellement un ...

  18. Projet pilote pour le programme national de recherche et de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'idée d'un programme national de recherche et de formation (PRIDE en espagnol) est issue du projet Mise en place de systèmes d'apprentissage au Honduras (projet 100133), soutenu par le CRDI. La subvention est accordée pour appuyer une version pilote de PRIDE, reposant sur deux appels à propositions.

  19. Le cosmos et le lotus confessions d'un astrophysicien

    CERN Document Server

    Trinh, Xuan Thuan

    2011-01-01

    Que nous dit vraiment la science sur la nature de l'univers, sur son origine et son avenir ? Par quel mystère le langage mathématique, pure création de l'esprit humain, se révèle-t-il aussi performant pour nous décrire les phénomènes physiques, de l'infiniment petit à l'infiniment grand ? S'il existe un ordre du monde, ce que nous en disent la physique quantique et la théorie de la relativité est-il compatible avec ce qu'enseigne le bouddhisme ? Et que peut-on en conclure concernant notre propre vie ? A ces questions passionnantes et à beaucoup d'autres, le célèbre astrophysicien Trinh Xuan Thuan répond ici d'une façon personnelle, en s'appuyant sur son expérience. Son itinéraire l'a placé d'emblée à la confluence de trois cultures : issu d'une famille de lettrés vietnamiens imprégnée de traditions bouddhiste et confucéenne, il a reçu une éducation à la française puis une formation scientifique à l'américaine. Une telle richesse de points de vue lui permet d'apporter, non pas de...

  20. Le devenir actif du corps affectif

    Directory of Open Access Journals (Sweden)

    Pascal Séverac

    2005-09-01

    Full Text Available Le but de cet article est de saisir ce que signifie, pour le corps, être actif. À partir de la proposition 49 de la partie IV de l’Éthique, on propose de distinguer deux manières d’appréhender le corps – soit comme corps organique, soit comme corps affectif -, et l’on montre que la question éthique du devenir actif s’adresse à la dimension affective du corps. Il faut penser le devenir actif du corps affectif comme augmentation de son aptitude non seulement à affecter, mais aussi à être affecté. En effet, être affecté pour le corps n’est pas identique à pâtir : au contraire, plus est grande l’ouverture sensible d’un corps aux autres corps, plus est grande son activité éthique.The aim of this paper is to understand how the body can be active. With the proposition 49 of the fourth part of Ethics, two ways of conceiving of the body are distinguished : like an organic body or like an affective body. The ethics question of becoming active is about the affective body. This becoming active must be understood as increasing of the ability to affect, as well as to be affected. To be affected is different from to be passive. On the contrary, the more the body is able to be affected, the more he becomes active.

  1. L'astronomie dans le monde

    OpenAIRE

    Manfroid, Jean

    2004-01-01

    comètes en pagaille; Recherche d'astéroïdes; Voisinage galactique; Titan en X; Titan à haute résolution; Alignement parfait dans le Sagittaire; Où est la lune de Sedna; SgrA*; Première image d'une planète extrasolaire?; Deux Jupiter chauds; Cycles stellaires; Le trou noir de M87; Un nouveau bras pour la Voie LactÃée; L'étoile la plus massive jamais observée!

  2. Le rapport Coopération pour le développement de l'OCDE souligne ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    est exclu, l'appel visant à combler la fracture des données est devenu le principal enjeu du Programme 2030. Les données et les statistiques sont essentielles pour éclairer les décisions relatives aux politiques, et l'adoption ...

  3. Renewable energy resources in Mali : potential and options for a sustainable development

    Energy Technology Data Exchange (ETDEWEB)

    Diarra, D.C. [Queen' s Univ., Kingston, ON (Canada). Dept. of Mechanical and Materials Engineering Solar Calorimetry Lab; Dembele, P. [Mali-Folkecenter, Faladie SEMA, Bamako (Mali)

    2006-07-01

    With a population of approximately 12 million, the per capita energy consumption of Mali is 228 Kilo tons of oil equivalent per inhabitant per year. Household energy consumption accounts for nearly 86 per cent of the total energy consumed with almost 99 per cent coming from wood energy. Energy consumption in the transportation, industrial and agricultural sectors is 10, 3, and 1 per cent respectively. The energy sector in Mali is characterized by the over-exploitation of forestry resources, dependence on imported oil and an under-exploitation of potential renewable energy resources such as solar, wind and biomass. The supply of solar energy is inexhaustible as the country receives almost 12 hours of sunshine with an average daily insolation of 5-7 KWh/m{sup 2}/day. Applications of photovoltaic (PV) technology in Mali concerns the basic needs of the population such as water pumping, lighting, battery charging and refrigeration. In 1994, the Mali government gave preferential fiscal policy on all solar equipment in order to encourage the wide spread use of solar energy, but technical constraints such as low efficiency, appropriate technology transfer methods, and sustainable financing mechanisms remain to be addressed. This paper described several programs that have been initiated to promote the use of renewable energy, protect the fragile environment threatened by the Sahara Desert and to provide access to drinking water. These achievements however, have not yet guaranteed energy sustainability, particularly in rural areas. It was recommended that efforts should be made to strengthen the renewable energy sector, correct inadequacies, introduce a sustainable renewable energy technology transfer process, and consolidate knowledge and experiences to focus on low cost renewable energy technologies. It was suggested that a natural resource map of the country should be made available in order allow for comparative cost and technology sustainability analysis before deciding

  4. Samson le nazir : un mythe du jeune guerrier

    OpenAIRE

    Lemardelé, Christophe

    2010-01-01

    L’histoire de Samson reste énigmatique tant pour son origine que pour sa signification. Il apparaît que le récit doit être qualifié de récit héroïque ou de mythe. En effet, Samson est typique de la figure du héros, qu’il s’agisse d’Héraklès comme de Gilgamesh : c’est à l’origine un demi-dieu accumulant les fautes. Il est contestable d’affirmer que le récit est grec car on retrouve dans le texte des motifs propres aux guerriers du livre des Juges et des livres de Samuel. Parmi les titres du hé...

  5. Bruno Milly, Le travail dans le secteur public. Entre institutions, organisations et professions

    OpenAIRE

    Hély, Matthieu

    2012-01-01

    L’intérêt principal de l’ouvrage de Bruno Milly est de mettre en évidence les limites d’une analyse du travail dans le secteur public qui se limiterait à l’appréhender uniquement à partir de son cadre institutionnel et normatif, un peu à la manière de la « science administrative » qui essentialise certainement un peu trop le travail public par rapport au travail dans le secteur marchand. En effet, si la sociologie du travail et des organisations s’est intéressée aux métiers de l’État social, ...

  6. Le merveilleux dans le roman algérien de langue arabe

    OpenAIRE

    Daoud, Mohamed

    2013-01-01

    L’étude essaie de définir le merveilleux, en tant qu’aspect littéraire introduit dans le romanesque en passant par Freud, Todorov, Caillois, Caxtex, Steinmetz, qui donnent une définition très poussée du fantastique, qui est différent du merveilleux. Mais c’est à Todorov que l’étude consacre la plus grande partie de l’analyse du merveilleux ; elle essaie de compléter cette réflexion par d’autres apports théoriques. Et dans la perspective de l’étrangeté, du surnaturel qu’aborde l’étude, le text...

  7. Quel est l'impact de l'indice de masse corporelle pré-gestationnel insuffisant et d'une prise de poids gestationnelle inférieure à la norme, notamment chez les femmes souffrant d'anorexie, sur le poids de naissance de l'enfant et la prématurité: travail de Bachelor

    OpenAIRE

    De Freudenreich, Emilienne; Wicht, Aline; Kaiser, Barbara

    2014-01-01

    Introduction : Des préoccupations autours de poids sont présentes lors de grossesse chez beaucoup de femmes, notamment chez celle qui souffrent de troubles alimentaires. L’obésité et la prise de poids gestationnelle excessive sont aujourd’hui des problèmes de santé dont les conséquences sont bien connues tandis que les effets des phénomènes inverses restent ambigus. Objectif : le but de cette revue de littérature était de mettre en évidence les effets du souspoids pré-gestationel et de la fai...

  8. Intelligence artificielle et agents collectifs : le modèle EUROSIM

    Directory of Open Access Journals (Sweden)

    Denise Pumain

    2007-07-01

    Full Text Available EUROSIM est un modèle multi-agents conçu pour simuler l’évolution à moyen terme du système des villes européennes. Les agents sont des entités collectives, les grandes villes caractérisées par leur taille et leur fonction dans le système des villes, et dont les interactions (échanges modulés par des relations de proximité ou de réseau déterminent la dynamique relative, tandis que la croissance d’ensemble dépend de l’innovation. Des outils d’analyse multiscalaire ont été développés afin d’interpréter les sorties du modèle et faciliter le calibrage.

  9. Luther contre le protocole de Kyoto ou le retour des « indulgences ».

    Directory of Open Access Journals (Sweden)

    Bernard Jouve

    2005-05-01

    Full Text Available Le 16 février 2005 a marqué la mise en œuvre du Protocole de Kyoto. En fait, depuis l’annonce par la Russie, le 25 octobre 2004, de sa décision de ratifier ce protocole, l’affaire était entendue. Menacé depuis le refus des États-Unis, l’un des plus grands pollueurs de la planète, de ne pas le ratifier pour des raisons purement économiques alors que ce pays produit à lui seul 40 % des gaz à effet de serre ( ges , l’accord survenu à Kyoto en 1997 est enfin entériné et ...

  10. Le corps dans l’espace architectural. Le Corbusier, Claude Parent et Henri Gaudin

    Directory of Open Access Journals (Sweden)

    Julie Cattant

    2016-12-01

    Full Text Available Le premier geste de l’espace architectural est d’accueillir nos corps humains. En leur offrant un espacement à habiter, il leur permet de s’abriter, de se mouvoir et de se rencontrer. L’homme et l’architecture s’affectent l’un l’autre. Nombreux sont les architectes qui interrogent cette coexistence car, renouveler la pensée de l’espace nécessite de reconsidérer le corps humain. L’étude des relations entre le corps et l’espace chez trois architectes français sera l’occasion d’évoquer les écarts et les convergences entre l’homme et l’architecture. L’œuvre de Le Corbusier, protagoniste du mouvement moderne, maintient ainsi une distance entre un corps machinisé et un espace idéal. Marquée par un mode de pensée dualiste, l’architecture de Le Corbusier annonce toutefois son propre dépassement, dépassement que Claude Parent et Henri Gaudin opèreront par la suite à leur manière, le premier en introduisant l’oblique et la déstabilisation du corps, le second en transgressant la limite de l’espace et du corps pour envisager leur porosité réciproque. Finalement, c’est la manière dont l’homme appréhende l’espace avec son corps qui est questionnée par ces trois architectes, de la prégnance du visuel à son évincement.

  11. [A cutting obstacle to the harmonious development of the country. The migratory phenomenon in Mali].

    Science.gov (United States)

    Diarra, S

    1991-04-01

    Mali has long been affected by migration because of its location between North Africa and sub-Saharan Africa. Around 80% of the population depends on agriculture or herding for its livelihood. During the rainy season, from June-October, most of the population is busy in agricultural work, but during the dry season from November to May seasonal migration in search of wage employment is common. Seasonal migration is also part of the long tradition of commerce with neighboring countries. Economic difficulties of the last several years have encourage migration to urban centers and foreign countries. The drought that has afflicted Mali for over a decade is a further impetus to migration. 2 types of migration can be distinguished in Mali, shortterm movements of nomads and seasonal migration lasting less than 6 months, and definitive movements lasting longer including rural-urban and international migration. 4 further categories of migration include rural-rural movements especially in the south and in areas of industrial development, rural-urban migrations which are 1 of the most important factors in rapid urban growth especially around Bamako,, urban-urban migration essentially reflecting step migration from rural areas to secondary urban centers and finally to large cities, and urban-rural migration which occurs much less frequently. Over 80% of temporary movements take place within Mali. About 80% of those residing temporarily outside Mali are men. Temporary migrants inside Mali are oriented from the north to the region of Sikasso and the District of Bamako in the south and primarily are young men aged 15-29. There has been a progressive decline in the proportion of nomads in the general population from 7% in 1976 to 4% in 1987. There has been an increase in definitive migration from areas less favored ecologically to more desirable areas. A 1985 demographic survey found that 21% of the population aged 15 or over were migrants. 51.4% of migrants were male. 86% cited

  12. DNA sequence analysis of herbarium specimens facilitates the revival of Botrytis mali, a postharvest pathogen of apple.

    Science.gov (United States)

    O'Gorman, Daniel T; Sholberg, Peter L; Stokes, Sarah C; Ginns, J

    2008-01-01

    The fungus Botrytis cinerea has been widely accepted as the species responsible for causing gray mold decay of apple, although a second species causing apple decay, B. mali, was reported in 1931. Botrytis mali was validly published in 1931, nevertheless it has always been considered a doubtful species. To study the relationship of Botrytis isolates causing gray mold on apple, DNA sequence analysis was employed. Twenty-eight Botrytis isolates consisting of 10 species were sampled, including two B. mali herbarium specimens from apple originally deposited in 1932. The DNA sequence analysis of the beta-tubulin and glyceraldehyde-3-phosphate dehydrogenase (G3PDH) genes placed the isolates into groupings with defined species boundaries that generally reflected the morphologically based model for Botrytis classification. The B. cinerea isolates from apple and other host plants were placed in a single clade. The B. mali herbarium specimens however always fell well outside that clade. The DNA sequence analysis reported in this study support the initial work by Ruehle (1931) describing the apple pathogen B. mali as a unique species.

  13. AcEST: BP914262 [AcEST

    Lifescience Database Archive (English)

    Full Text Available p|Q8LE43|DOF21_ARATH Dof zinc finger protein DOF2.1 OS=Arabidop... 31 4.7 sp|P18102|TLL_DROME Protein taille...RNA domain-cont... 32 2.7 sp|Q9LSL6|DOF57_ARATH Dof zinc finger protein DOF5.7 OS=Arabidop... 32 2.8 sp|O16845|TLL_DROVI Protein tail...less OS=Drosophila virilis GN=tl... 31 3.6 sp|Q96QE4|LR37B_HUMAN Leucine-rich repea

  14. AcEST: BP921082 [AcEST

    Lifescience Database Archive (English)

    Full Text Available B Pol polyprotein (Fragment) OS=Cas-Br-E murin... 52 1e-06 sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation... muri... 52 1e-06 sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation muri...LLLPLALYRARN 431 >sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 Le...N Sbjct: 75 ADLLGIDWKLHCAYRPQSSGQVERMNRTIKETLTKLTLATGSRDWVLLLPLALYRARN 132 >sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiati...on murine leukemia virus (strain Kaplan) GN=pol PE=3 SV=1 Length = 581 Score = 52.0

  15. AcEST: BP919842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G07 567 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G07. BP919842 - Show BP91984...is mRNA. clone: YMU001_000129_G07. Accession BP919842 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919842|Adiantum capillus-veneris m...c Acids Res. 25:3389-3402. Query= BP919842|Adiantum capillus-veneris mRNA, clone: YMU001_000129_G07. (567 le

  16. J.-M.-G. Le Clézio et le récit poétique

    Directory of Open Access Journals (Sweden)

    Pascal Rannou

    2009-11-01

    Full Text Available Dans Le Récit poétique (1978, J.-Y. Tadié analyse les caractéristiques d’un genre un peu marginal, qui ne tient ni du roman, ni de la nouvelle, et se signale par une conception originale de l’espace, du temps et du personnage. Si Tadié évoque les œuvres de Limbour, Gracq ou Mandiargues, il ne mentionne pas celle de Le Clézio. Or, l’écriture de ce dernier correspond souvent aux critères formulés dans son essai. Les personnages de Le Clézio sont souvent des « êtres de fuite », prétextes à rêverie géographique, des anti-héros, peu actifs, contemplatifs. Ce sont souvent des marginaux en rupture de ban avec la société. Le lieu du récit poétique est pour Tadié un lieu de rêve, éloigné de la fureur urbaine, et c’est souvent le cas chez Le Clézio. Ce dernier a également tendance à diluer le temps pour le faire tendre au mythe, en négligeant les références précises. Le temps du récit poétique est souvent celui de l’enfance, ce que corrobore aussi Le Clézio, notamment dans Mondo et La Ronde, qui forment notre corpus. L’écriture de ce type de récit est proche du poème en prose. Elle cultive les parallélismes et le travail sur le signifiant. Mais les récits poétiques de Le Clézio s’éloignent aussi des critères définis par J.-Y. Tadié. Les personnages n’y sont pas que des prétextes à rêverie, mais les victimes de rouages sociaux qui les écrasent : voleurs, orphelins, mères célibataires, travailleurs immigrés. Le récit poétique leclézien s’éloigne, par sa dimension politique et sociale, du récit poétique défini par Tadié, qui se caractérise par une certaine gratuité.

  17. Ghana and Mali. Grade 7 Model Lesson for Standard 7.4. World History and Geography: Medieval Sub-Saharan Africa. California History-Social Science Course Models.

    Science.gov (United States)

    Zachlod, Michelle, Ed.

    California State Standard 7.4 is delineated in the following manner: "Students analyze the geographic, political, economic, religious, and social structures of the sub-Saharan civilizations of Ghana and Mali in Medieval Africa. Seventh-grade students focus on the Niger River and the growth of the Mali and Ghana empires; analyze the importance…

  18. Etiology and factors associated with pneumonia in children under 5 years of age in Mali: A prospective case-control study

    NARCIS (Netherlands)

    T. Bénet (Thomas); M. Sylla (Mariam); M. Messaoudi (Mélina); V.S. Picot (Valentina Sánchez); J.-N. Telles (Jean-Noël); A.-A. Diakite (Abdoul-Aziz); F. Komurian-Pradel (Florence); H. Endtz (Hubert); S. Diallo (Souleymane); G. Paranhos-Baccalà (Gláucia); P. Vanhems (Philippe)

    2015-01-01

    textabstractBackground: There are very limited data on children with pneumonia in Mali. The objective was to assess the etiology and factors associated with community-acquired pneumonia in hospitalized children <5 years of age in Mali. Methods: A prospective hospital-based case-control study was

  19. Food Groups Associated with a Composite Measure of Probability of Adequate Intake of 11 Micronutrients in the Diets of Women in Urban Mali

    NARCIS (Netherlands)

    Kennedy, G.L.; Fanou-Fogny, N.M.L.; Seghieri, C.; Arimond, M.; Koreissi, Y.; Dossa, R.A.M.; Kok, F.J.; Brouwer, I.D.

    2010-01-01

    The prevalence of micronutrient deficiency is high among women of reproductive age living in urban Mali. Despite this, there are little data on the dietary intake of micronutrients among women of reproductive age in Mali. This research tested the relationship between the quantity of intake of 21

  20. EST databases and web tools for EST projects.

    Science.gov (United States)

    Shen, Yao-Qing; O'Brien, Emmet; Koski, Liisa; Lang, B Franz; Burger, Gertraud

    2009-01-01

    This chapter outlines key considerations for constructing and implementing an EST database. Instead of showing the technological details step by step, emphasis is put on the design of an EST database suited to the specific needs of EST projects and how to choose the most suitable tools. Using TBestDB as an example, we illustrate the essential factors to be considered for database construction and the steps for data population and annotation. This process employs technologies such as PostgreSQL, Perl, and PHP to build the database and interface, and tools such as AutoFACT for data processing and annotation. We discuss these in comparison to other available technologies and tools, and explain the reasons for our choices.

  1. Effets du charbon actif dans le milieu de culture sur l'induction de la ...

    African Journals Online (AJOL)

    antioxydant. Il est devenu une nécessité pour régler le problème d'oxydation qui est particulièrement épineux lors de la phase d'initiation de culture, où une oxydation rapide des méristèmes mises en incubation sur le milieu d'initiation est constatée.

  2. Evidence of local evolution of tomato-infecting begomovirus species in West Africa: characterization of tomato leaf curl Mali virus and tomato yellow leaf crumple virus from Mali.

    Science.gov (United States)

    Zhou, Y-C; Noussourou, M; Kon, T; Rojas, M R; Jiang, H; Chen, L-F; Gamby, K; Foster, R; Gilbertson, R L

    2008-01-01

    Tomato yellow leaf curl (TYLC) and tomato leaf curl (ToLC) diseases are serious constraints to tomato production in Mali and other countries in West Africa. In 2003 and 2004, samples of tomato showing virus-like symptoms were collected during a survey of tomato virus diseases in Mali. Three predominant symptom phenotypes were observed: (1) TYLC/ToLC (stunted upright growth and upcurled leaves with interveinal yellowing and vein purpling), (2) yellow leaf crumple and (3) broccoli or bonsai (severe stunting and distorted growth). Squash blot (SB) hybridization with a general begomovirus probe and/or SB/PCR analyses revealed begomovirus infection in plants with each of these symptom phenotypes and no evidence of phytoplasma infection. Sequence analysis of PCR-amplified begomovirus fragments revealed two putative new begomovirus species associated with the TYLC/ToLC and yellow leaf crumple symptom phenotypes, respectively. Full-length clones of these begomoviruses were obtained using PCR and overlapping primers. When introduced into N. benthamiana and tomato plants, these clones induced upward leaf curling and crumpling (the TYLC/ToLC-associated begomovirus) or downward leaf curl/yellow mottle (yellow leaf crumple-associated begomovirus) symptoms. Thus, these begomoviruses were named tomato leaf curl Mali virus (ToLCMLV) and tomato yellow leaf crumple virus (ToYLCrV). The genome organization of both viruses was similar to those of other monopartite begomoviruses. ToLCMLV and ToYLCrV were most closely related to each other and to tobacco leaf curl Zimbabwe virus (TbLCZV-[ZW]) and tomato curly stunt virus from South Africa (ToCSV-ZA). Thus, these likely represent tomato-infecting begomoviruses that evolved from indigenous begomoviruses on the African continent. Mixed infections of ToLCMLV and ToYLCrV in N. benthamiana and tomato plants resulted in more severe symptoms than in plants infected with either virus alone, suggesting a synergistic interaction. Agroinoculation

  3. Le CRDI au Vietnam

    International Development Research Centre (IDRC) Digital Library (Canada)

    des agriculteurs trouvent des solutions de rechange à la culture du tabac. □ des responsables de politiques agissent pour réduire la pauvreté. Soutien accordé par le CRDI depuis 1991. 111 activités d'une valeur de 30 millions cad. CRDI. Le CRDI au Vietnam centre de recherches pour le développement international ...

  4. Comment ameliorer la selection et le traitement des messages verbaux? (How to Improve the Selection and Processing of Verbal Messages)

    National Research Council Canada - National Science Library

    Rivenez, Marie; Darwin, Chris; Guillaume, Anne

    2005-01-01

    L'objectif de cette recherche est d'ameliorer la selection des messages verbaux. Nous cherchons a determiner les facteurs influencant le traitement d'un message verbal lorsque l'attention est portee sur un autre message...

  5. Lele de l'IL6 dans le cancer du foie lié à l'hépatopathie métabolique

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le cancer du foie est souvent mortel. Il n'existe que très peu d'options de traitement, et il s'agit de l'un des cancers dont l'incidence augmente dans le monde entier. L'obésité ou les maladies métaboliques (comme le diabète et la stéatose hépatique) constituent des facteurs de risque du cancer du foie qui sont mal compris.

  6. Le mal et ses complots imaginaires

    OpenAIRE

    Frankfurter, David

    2012-01-01

    Les récits d’abus rituels sataniques que les médias ont largement diffusés, aux États-Unis et au Royaume-Uni, entre le début des années 1980 et la fin des années 1990, soutenaient le parallèle avec les allégations avancées, durant l’Antiquité et au début des Temps modernes, contre les chrétiens, les hérétiques, les juifs ou les sorcières. Quelle est la nature de ces parallèles ? Cet article examine plusieurs types de modèles convoqués lors de diverses occurrences historiques des peurs panique...

  7. Le catch, la domestication du risque

    Directory of Open Access Journals (Sweden)

    Jeremy Lacoste

    2015-09-01

    Full Text Available Cet article vise à questionner les logiques de gestion, réappropriation et détournement du risque à travers le catch. Il s’appuie sur la monographie d’un club de la région parisienne observée durant huit mois. Parce que la discipline est à mi-chemin entre la sportivité théâtrale et la scénarisation pugilistique, elle pioche dans le registre de la représentation. Ainsi, art de la surenchère et du pastiche, le catch constitue un terreau majeur pour déconstruire les figures du risque.

  8. Farid Ameur, Le Ku Klux Klan

    OpenAIRE

    Laberge, Yves

    2018-01-01

    S’il existe de nombreuses études en anglais sur le Ku Klux Klan, et notamment celles — percutantes — de Stetson Kennedy (1916-2011), qui avait réussi à infiltrer cette organisation, on en trouve relativement peu en langue française. De ce fait, la réédition de cette monographie de l’historien Farid Ameur tombe à point nommé. Mouvement social d’extrême-droite prônant le racisme et la suprématie blanche, le KKK a une histoire secrète qui est de ce fait difficile à raconter de manière exhaustive...

  9. Comment fonctionne l’Univers ? Ce que le LHC peut nous apprendre

    CERN Multimedia

    CERN. Geneva

    2008-01-01

    L'Univers en son enfance était une "soupe" de particules, de plus en plus chaudes (de plus haute énergie) à mesure qu'on remonte vers sa naissance, le "big bang". C'est ainsi que les observations à des énergies de plus en plus élevées nous permettent, par exemple, de nous approcher de plus près de la prime jeunesse de l'Univers et, donc, de mieux le comprendre. L'étude du macro- et du micro-cosme sont une science unique dans laquelle, de façon surprenante, ce que nous comprenons le moins bien est le vide, qui ne semble pas l'être: il existe une différence fondamentale entre le vide et le néant. Le LHC pourrait nous permettre de voir les vibrations de la "substance" du vide, qu'on appelle les particules 'de Higgs'.

  10. Identification de Staphylococcus aureus : est-il possible de réduire ...

    African Journals Online (AJOL)

    Dans le contexte de pays moins avancé comme le Bénin, cela est un premier jet en vue de l'efficience des méthodes de diagnostic au laboratoire d'analyses biomédicales. Mots-clés : staphylocoagulase libre, plasma de lapin, efficience. ABSTRACT. Objective: The high cost of lyophilized rabbit's plasma, which is used for ...

  11. Le harcèlement organisationnel des relations sous emprise

    CERN Document Server

    Guhel, Cécile

    2014-01-01

    Le lien entre harcèlement et emprise professionnelle est bien réel. Il est aussi puissant que destructeur. L'aide extérieure est importante mais la prise de conscience du sujet et sa mise à distance sont primordiales pour le retour à Soi. Un facteur de risque organisationnel est un facteur qui relève de l'organisation et qui comporte le risque ou la probabilité qu'un tel comportement abusif voie le jour et qu'il ait des effets négatifs. Un tel facteur peut également contribuer à la persistance ou à l'aggravation du comportement. En abordant la relation d'emprise sous l'éclairage de différentes théories psychologiques, cela vous permettra d'observer les mécanismes intrapsychiques conscients et inconscients qui sous-tendent les comportements de l'instigateur de la relation d'emprise d'une part, et de sa victime d'autre part. Enfin, à travers trois témoignages, de salariées en poste, vous découvrirez combien la parole sur le travail est importante dans la prise de conscience du processus de de...

  12. Giving birth at a maternity hospital: the key strategic option to be adopted in order to combat maternal and neonatal mortality in Mali Faire de l’accouchement en maternité l’option stratégique essentielle pour lutter contre la mortalité maternelle et néonatale au Mali Dar a luz en un hospital maternal: la opción estratégica clave a adoptar para combatir la mortalidad materna y neonatal en Malí

    Directory of Open Access Journals (Sweden)

    Hubert Balique

    2012-04-01

    Full Text Available The end result of the past 40 years of experience in combating maternal mortality in Mali suggests that the emphasis should be changed, and that giving birth at a maternity hospital should be the basic strategic option chosen. This means creating “compounds set aside for mothers-to-be”, where women approaching the end of their pregnancy will be invited to come and await the onset of labour, and at the same time enjoy the rest they need. However, the prerequisites for such an initiative will be first to guarantee the necessary quality of care in maternity hospitals, by virtue of an accreditation system, and second to ensure that the system is fully operational in terms of referring obstetric emergencies. Giving birth in the woman’s home village will then no longer be regarded as a clearly expressed strategic choice, but as an unintended course of events. The introduction of a subsidised system of fixed-charge obstetric care will remove any financial obstacles, and is a necessary step to ensure the feasibility of such a programme.Le bilan des 40 ans d’expérience du Mali en matière de lutte contre la mortalité maternelle plaide pour un recentrage faisant de l’accouchement en maternité l’option stratégique fondamentale. Pour cela, doivent être créées des « concessions des mamans » où les femmes en fin de grossesse seront invitées à se rendre pour y attendre le début du travail en bénéficiant notamment du repos qui doit s’imposer à elles. Le préalable à cette initiative sera cependant de garantir d’une part la qualité des soins dans les maternités grâce à un mécanisme d’accréditation, d’autre part la pleine fonctionnalité du système de référence des urgences obstétricales. Ainsi, l’accouchement au village ne devra-t-il être plus considéré comme un choix stratégique affirmé, mais comme un incident de parcours. La mise en place d’un forfait obstétrical subventionné permettra de lever l

  13. La responsabilité de rendre compte : lele des médias dans le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    28 janv. 2011 ... Au Darfour, il se produit la même chose qu'au Rwanda, mais au ralenti, prévient Allan Thompson. Les médias ne sont pas là, ils n'ont pas - ou ne veulent pas affecter - les ressources nécessaires pour couvrir de façon systématique les événements qui s'y déroulent. C'est loin, c'est difficile, comme le sont ...

  14. Le stéréotype dans le roman policier

    Directory of Open Access Journals (Sweden)

    Marion François

    2009-12-01

    Full Text Available Le roman policier offre à l’étude du stéréotype une grande variété de redondances, lexicales et structurelles, qui permettent d’éclairer le concept même de genre, en fait issu du constat de stéréotypie. Il est également manifeste que contrairement aux idées reçues, les clichés font du texte policier un texte littéraire, parce qu’ils naissent d’images associées, distinctes de la réalité, qui révèlent d’ailleurs le cheminement même de l’écriture. Par ailleurs ces images jouent un rôle fondamental dans le plaisir du lecteur, comme dans les contes de fées de notre enfance. Les clichés ouvrent la porte des fantasmes : le stéréotype rejoignant l’archétype, les clichés policiers réactivent de nombreux mythes, le texte évoquant l’Autre Scène. Le constat de stéréotypie provoque l’écriture, en particulier parodique, et stimule le renouvellement et l’essaimage des clichés dans toutes sortes de textes, qui bénéficieront de la présence du déjà-lu, laquelle donne au lecteur une assise pour affronter l’inconnu et une expérience pour apprécier la nouveauté.

  15. APPLICATION DU MODELE "DEFECT POOL" POUR LA SIMULATION DE LA PHOTOCONDUCTIVITE TRANSITOIRE DANS LE a-Si:H INTRINSEQUE ET DOPE PAR LE PHOSPHORE

    Directory of Open Access Journals (Sweden)

    A.F MEFTAH

    2004-06-01

    Full Text Available Le profil d'énergie de la densité des états le long du gap du a-Si:H est déterminé conjointement par le modèle defect pool (MDP et la queue de bande de conduction (QBC calculée par la transformé de Fourier de la photoconductivité transitoire (PCT. La PCT obtenue par la simulation numérique est comparée avec les données expérimentales pour le cas du a-Si:H intrinsèque et le a-Si:H dopé par le phosphore. Les caractéristiques observées dans les courbes de la PCT à différentes températures permettent de calculer la fréquence d'émission au bord de la mobilité, le minimum de la queue de la QBC dans le a-Si:H intrinsèque et le pic de la bande des donneur dans le a-Si:H dopé .

  16. Mel Gibson contre le boulevard Raspail

    Directory of Open Access Journals (Sweden)

    Boris Jeanne

    2007-03-01

    Full Text Available Que peuvent faire les historiens et les anthropologues spécialistes de l’Amérique face à la puissance médiatique et commerciale d’Apocalypto, le dernier film de Mel Gibson, produit par Buena Vista (c'est-à-dire Disney et ayant déjà engrangé plus de 50 millions de dollars de recette avant même sa sortie en France ? Le cinéma est un art du présent, et quelle que soit l’exactitude de la reconstitution historique qu’il prétend parfois présenter, il demeure un puissant vecteur d’analyse de la soc...

  17. Masse rénale avec image stellaire centrale: Quel est votre diagnostic?

    Directory of Open Access Journals (Sweden)

    A. Qarro

    2013-03-01

    Full Text Available Le carcinome chromophobe se voit essentiellement à la cinquième décennie et représente 5% des tumeurs rénales. Il existe deux sous types de cancer à cellules chromophobes: le type clair (70% et le type éosinophile. La variante à cellules éosinophiles doit être distinguée de l'oncocytome. Ce dernier se caractérise par une cicatrice fibreuse centrale d'aspect stellaire. Le carcinome chromophobe et l'oncocytome peuvent même coexister dans le cadre du syndrome de Birt-Hogg-Dubé. Certaines tumeurs appelées hybrides partagent des caractéristiques architecturales et cytologiques de ces deux tumeurs. Le pronostic du carcinome chromophobe est favorable. Il est le plus souvent limité au rein et de bas grade nucléaire. Il semblerait donc licite dans les cas ou un examen extemporané mettrait en évidence une tumeur chromophobe, de limiter l'intervention à une néphrectomie partielle si techniquement réalisable.

  18. Communiquer le changement climatique: un voyage dans les stratégies et plans d'adaption

    NARCIS (Netherlands)

    Stoverinck, F.; Dubois, G.; Amelung, B.

    2013-01-01

    Les stratégies d’adaptation au changement climatique devraient normalement s’appuyer sur la meilleure information climatique disponible. Or le constat scientifique initial est souvent transformé, interprété, mis en forme par le processus de politique publique. Le message original s’en trouve

  19. Le style modal de la science-fiction

    Directory of Open Access Journals (Sweden)

    Emmanuel Boisset

    2013-04-01

    Full Text Available La faiblesse de style dont souffrirait la science-fiction est en fait le signe que la science y est davantage discours du possible que description du réel. Un « style modal » va suspendre la valeur de vérité, et le style de la possibilité va décontextualiser les métaphores disponibles. En science-fiction, le processus métaphorique génère et structure la diégèse. Un exemple chez Iain M. Banks montre un dialogue quasi incompréhensible mettre à l’épreuve la signification comme possibilité. Les métaphores figées sont revitalisées par la décontextualisation de la fiction, dont le texte peut exploiter l’impertinence.

  20. 1. Le Soleil, une étoile dans notre Galaxie

    OpenAIRE

    Vial, Jean-Claude

    2017-01-01

    Par une belle nuit sans Lune (et sans nuages), levons les yeux vers le ciel. L’œil est immédiatement attiré par le cortège d’étoiles brillantes qui a donné son nom à la Voie lactée. Il s’agit en fait d’une galaxie de près de 200 milliards d’étoiles qui abrite notre Soleil et ses planètes, c’est notre galaxie, « la » Galaxie, comme une île dans le vaste cosmos. La Galaxie : ses 150 à 200 milliards d’étoiles sont réparties selon des bras spiraux autour d’un noyau central et pour la plupart conf...

  1. Le nu au service de la santé

    OpenAIRE

    Andrieu, Gilbert

    2010-01-01

    Le nu à la fin du XIXe siècle et au début du XXe siècle fait son apparition dans de nombreux ouvrages consacrés à l'éducation physique et à la culture physique. Son utilisation est essentiellement pédagogique et esthétique. Le nu devient acceptable car il est avant tout démonstratif de la santé, d'une santé presque naturelle ou du moins associée à la nature. Le corps nu témoigne d'un homme non déformé 'et trahi par le progrès matériel. L'analyse de l'iconographie d'ouvrages de vulgarisation d...

  2. Increasing Access to Family Planning Choices Through Public-Sector Social Franchising: The Experience of Marie Stopes International in Mali.

    Science.gov (United States)

    Gold, Judy; Burke, Eva; Cissé, Boubacar; Mackay, Anna; Eva, Gillian; Hayes, Brendan

    2017-06-27

    Mali has one of the world's lowest contraceptive use rates and a high rate of unmet need for family planning. In order to increase access to and choice of quality family planning services, Marie Stopes International (MSI) Mali introduced social franchising in public-sector community health centers (referred to as CSCOMs in Mali) in 3 regions under the MSI brand BlueStar. Potential franchisees are generally identified from CSCOMs who have worked with MSI outreach teams; once accredited as franchisees, CSCOMs receive training, supervision, family planning consumables and commodities, and support for awareness raising and demand creation. To ensure availability and affordability of services, franchisees are committed to providing a wide range of contraceptive methods at low fixed prices. The performance of the BlueStar network from inception in March 2012 until December 2015 was examined using information from routine monitoring data, clinical quality audits, and client exit interviews. During this period, the network grew from 70 to 135 franchisees; an estimated 123,428 clients received voluntary family planning services, most commonly long-acting reversible methods of contraception. Franchisee efficiency and clinical quality of services increased over time, and client satisfaction with services remained high. One-quarter of clients in 2015 were under 20 years old, and three-quarters were adopters of family planning (that is, they had not been using a modern method during the 3 months prior to their visit). Applying a social franchising support package, originally developed for for-profit private-sector providers, to public-sector facilities in Mali has increased access, choice, and use of family planning in 3 regions of Mali. The experience of BlueStar Mali suggests that interventions that support quality supply of services, while simultaneously addressing demand-side barriers such as service pricing, can successfully create demand for a broad range of family

  3. Increasing Access to Family Planning Choices Through Public-Sector Social Franchising: The Experience of Marie Stopes International in Mali

    Science.gov (United States)

    Gold, Judy; Burke, Eva; Cissé, Boubacar; Mackay, Anna; Eva, Gillian; Hayes, Brendan

    2017-01-01

    Background: Mali has one of the world's lowest contraceptive use rates and a high rate of unmet need for family planning. In order to increase access to and choice of quality family planning services, Marie Stopes International (MSI) Mali introduced social franchising in public-sector community health centers (referred to as CSCOMs in Mali) in 3 regions under the MSI brand BlueStar. Program Description: Potential franchisees are generally identified from CSCOMs who have worked with MSI outreach teams; once accredited as franchisees, CSCOMs receive training, supervision, family planning consumables and commodities, and support for awareness raising and demand creation. To ensure availability and affordability of services, franchisees are committed to providing a wide range of contraceptive methods at low fixed prices. Methods and Results: The performance of the BlueStar network from inception in March 2012 until December 2015 was examined using information from routine monitoring data, clinical quality audits, and client exit interviews. During this period, the network grew from 70 to 135 franchisees; an estimated 123,428 clients received voluntary family planning services, most commonly long-acting reversible methods of contraception. Franchisee efficiency and clinical quality of services increased over time, and client satisfaction with services remained high. One-quarter of clients in 2015 were under 20 years old, and three-quarters were adopters of family planning (that is, they had not been using a modern method during the 3 months prior to their visit). Conclusion: Applying a social franchising support package, originally developed for for-profit private-sector providers, to public-sector facilities in Mali has increased access, choice, and use of family planning in 3 regions of Mali. The experience of BlueStar Mali suggests that interventions that support quality supply of services, while simultaneously addressing demand-side barriers such as service pricing

  4. Le Service Accueil et Contrôle d'Accès

    CERN Document Server

    Ducastel, C

    1999-01-01

    L'utilisateur qui vient au CERN pour la première fois, est accueilli généralement par les membres du service 'Accueil et Contrôle d'Accès'. Cet utilisateur sera tout d'abord orienté vers un des postes d'hôtesses d'accueil en charge de l'enregistrement et de la délivrance de cartes CERN. Les informations seront saisies et immédiatement disponibles et transmises, via le système AMS, aux équipements de contrôle d'accès et à la Centrale de Surveillance des accès, chargée de la supervision de tout le dispositif de contrôle d'accès au domaine. Ces contrôles aux entrées et accueil des visiteurs individuels sont complétés par des missions de surveillance à l'intérieur du Domaine pour les agents, et par des travaux de gestions de dossiers administratifs (service enregistrement) pour les hôtesses. Un contrat commun assure une uniformité de formation des agents et hôtesses. Ce contrat est assorti d'une clause de Bonus Malus afin de tendre vers une optimisation des performances.

  5. LE MARCHE FINANCIER EN ALGERIE : SITUATION ET ...

    African Journals Online (AJOL)

    Administrateur

    Dans les pays en transition, la performance du marché financier apparaît loin des espérances suscitées. ... la création et de la croissance des entreprises, conditions objectives du développement économique. ... L'emprise de ce marché est telle que même certaines entreprises activant dans le secteur formel y recourent, ...

  6. Le CRDI en Indonésie

    International Development Research Centre (IDRC) Digital Library (Canada)

    défricher les terres. Autre exemple : la carte de la vulnérabilité aux changements clima- tiques en Asie du Sud-Est réalisée par le programme, qui attire l'attention sur les risques associés aux changements climatiques et a aidé les responsables des politiques et les bailleurs de fonds à établir un plan d'action à cet égard. B.

  7. First Detection of Leishmania major DNA in Sergentomyia (Spelaeomyia) darlingi from Cutaneous Leishmaniasis Foci in Mali

    Science.gov (United States)

    Berdjane-Brouk, Zohra; Koné, Abdoulaye K.; Djimdé, Abdoulaye A.; Charrel, Rémi N.; Ravel, Christophe; Delaunay, Pascal; del Giudice, Pascal; Diarra, Adama Z.; Doumbo, Siala; Goita, Siaka; Thera, Mahamadou A.; Depaquit, Jérôme; Marty, Pierre; Doumbo, Ogobara K.; Izri, Arezki

    2012-01-01

    Background Leishmania major complex is the main causative agent of zoonotic cutaneous leishmaniasis (ZCL) in the Old World. Phlebotomus papatasi and Phlebotomus duboscqi are recognized vectors of L. major complex in Northern and Southern Sahara, respectively. In Mali, ZCL due to L. major is an emerging public health problem, with several cases reported from different parts of the country. The main objective of the present study was to identify the vectors of Leishmania major in the Bandiagara area, in Mali. Methodology/Principal Findings An entomological survey was carried out in the ZCL foci of Bandiagara area. Sandflies were collected using CDC miniature light traps and sticky papers. In the field, live female Phlebotomine sandflies were identified and examined for the presence of promastigotes. The remaining sandflies were identified morphologically and tested for Leishmania by PCR in the ITS2 gene. The source of blood meal of the engorged females was determined using the cyt-b sequence. Out of the 3,259 collected sandflies, 1,324 were identified morphologically, and consisted of 20 species, of which four belonged to the genus Phlebotomus and 16 to the genus Sergentomyia. Leishmania major DNA was detected by PCR in 7 of the 446 females (1.6%), specifically 2 out of 115 Phlebotomus duboscqi specimens, and 5 from 198 Sergentomyia darlingi specimens. Human DNA was detected in one blood-fed female S. darlingi positive for L. major DNA. Conclusion Our data suggest the possible involvement of P. duboscqi and potentially S. darlingi in the transmission of ZCL in Mali. PMID:22276095

  8. First detection of Leishmania major DNA in Sergentomyia (Spelaeomyia darlingi from cutaneous leishmaniasis foci in Mali.

    Directory of Open Access Journals (Sweden)

    Zohra Berdjane-Brouk

    Full Text Available BACKGROUND: Leishmania major complex is the main causative agent of zoonotic cutaneous leishmaniasis (ZCL in the Old World. Phlebotomus papatasi and Phlebotomus duboscqi are recognized vectors of L. major complex in Northern and Southern Sahara, respectively. In Mali, ZCL due to L. major is an emerging public health problem, with several cases reported from different parts of the country. The main objective of the present study was to identify the vectors of Leishmania major in the Bandiagara area, in Mali. METHODOLOGY/PRINCIPAL FINDINGS: An entomological survey was carried out in the ZCL foci of Bandiagara area. Sandflies were collected using CDC miniature light traps and sticky papers. In the field, live female Phlebotomine sandflies were identified and examined for the presence of promastigotes. The remaining sandflies were identified morphologically and tested for Leishmania by PCR in the ITS2 gene. The source of blood meal of the engorged females was determined using the cyt-b sequence. Out of the 3,259 collected sandflies, 1,324 were identified morphologically, and consisted of 20 species, of which four belonged to the genus Phlebotomus and 16 to the genus Sergentomyia. Leishmania major DNA was detected by PCR in 7 of the 446 females (1.6%, specifically 2 out of 115 Phlebotomus duboscqi specimens, and 5 from 198 Sergentomyia darlingi specimens. Human DNA was detected in one blood-fed female S. darlingi positive for L. major DNA. CONCLUSION: Our data suggest the possible involvement of P. duboscqi and potentially S. darlingi in the transmission of ZCL in Mali.

  9. Situational analysis of infant and young child nutrition policies and programmatic activities in Mali.

    Science.gov (United States)

    Wuehler, Sara E; Coulibaly, Mouctar

    2011-04-01

    Progress towards reducing mortality and malnutrition among children Sahel', starting with a situational analysis of current activities related to infant and young child nutrition (IYCN). The main objectives of the situational analysis are to compile, analyse and interpret available information on infant and young child feeding, and the nutrition situation of children security, and hygienic practices. Most of the key IYCN topics were addressed in national policies, training materials, and programme documents. Information on the national coverage and impact of these programmes is generally not available. Exclusive breastfeeding (<6 months) has increased in Mali, but no studies identified the contributors to this increase. Despite improvements in breastfeeding practices, optimal infant, and young child feeding is still practiced among too few young children in Mali. Several research articles were identified, but few of these were linked to programme development. Some programme monitoring and evaluation reports were available, but few of these were rigorous enough to identify whether IYCN-specific programme components were implemented as designed or were achieving desired outcomes. Therefore, we could not confirm which programmes contributed to reported improvements. Monitoring of programmes managing malnutrition identified gaps in human and institutional capacities to fully carry out intended interventions and the government has recognized the overall lack of adequate numbers of health care providers to carry out necessary programmes in Mali, of which nutrition programmes are a part. The policy and programme framework is well established for support of optimal IYCN practices, but greater resources and capacity building are needed to: (i) conduct necessary research to adapt training materials and programme protocols to programmatic needs; (ii) implement rigorous monitoring and evaluation that identify effective programme components; and (iii) apply these findings in

  10. The match between motivation and performance management of health sector workers in Mali

    Directory of Open Access Journals (Sweden)

    Touré Hamadassalia

    2006-02-01

    Full Text Available Abstract Human resources for health (HRH play a central role in improving accessibility to services and quality of care. Their motivation influences this. In Mali, operational research was conducted to identify the match between motivation and the range and use of performance management activities. Objectives To describe the factors motivating and demotivating health workers in Mali and match the motivators with the implementation of performance management. Methods First an exploratory qualitative study was conducted: 28 interviews and eight group discussions were held. This was followed by a cross-sectional survey, during which 370 health workers were interviewed. The study population consisted of health workers of eight professional groups. The following issues were investigated: • motivating and demotivating factors; • experiences with performance management, including: job descriptions, continuous education, supervision, performance appraisal and career development. Findings The study showed that the main motivators of health workers were related to responsibility, training and recognition, next to salary. These can be influenced by performance management (job descriptions, supervisions, continuous education and performance appraisal. Performance management is not optimally implemented in Mali, as job descriptions were not present or were inappropriate; only 13% of interviewees received 4× per year supervision, and training needs were not analysed. Some 48% of the interviewees knew their performance had been appraised in the last two years; the appraisals were perceived as subjective. No other methods were in place to show recognition. The results enabled the research team to propose adaptations or improvements upon existing performance management. Conclusion The results showed the importance of adapting or improving upon performance management strategies to influence staff motivation. This can be done by matching performance management

  11. [A case study of the interrelations among population, health and development. PSD-Mali].

    Science.gov (United States)

    Konate, M K

    1992-06-01

    The population, health, and development project in Mali (PSD-M) hypothesized that the construction of the Selingue dam would probably improve the income of the populations, cause socio-cultural changes, and degrade the environment. The prevalence of urinary schistosomiasis decreased after construction while the prevalence of intestinal schistosomiasis increased. The prevalence of onchocerciasis fell from 3.6% to 0.2% during 1980-1983. PSD-Mali could not adequately follow up on other parasitic diseases. Information on consumption of fish by the fishermen themselves was unavailable. PSD-Mali did learn, however, that fishing for self-consumption was very much lower than commercial fishing. Fish sales comprised the greatest source of income, so fishing contributed somewhat to improvement of living conditions. Fishing has become a microindustry for the indigenous women, practiced with rudimentary means, with the creation of the artificial lake. The Office for Exploitation of Resources of the Upper Niger lends itself to fishing activities which encourages migration of ethnic fishermen to the Selingue zone. Income-related data were not better available after the dam than before, except for some data related to commercialization of fresh fish. Environmental degradation continues as predicted by PSD-M, which is contradictory to rural practices in the zone. In the past, land was left fallow for several years. 1350 hectares downstream from the dam, 68.7% of which is favorable for growing rice, is not irrigable. Construction of access roads as well as the opening of new tracks allowed deforestation, but the selling of wood for heating, of charcoal, and of bamboo has resulted in a comfortable income. These findings show that there is still need for evaluation of different aspects of life of the population concerned.

  12. Molecular characterisation of Mycobacterium bovis isolated from cattle slaughtered at the Bamako abattoir in Mali

    Directory of Open Access Journals (Sweden)

    Bonfoh Bassirou

    2008-07-01

    Full Text Available Abstract Background Mali is one of the most important livestock producers of the Sahel region of Africa. A high frequency of bovine tuberculosis (BTB has been reported but surveillance and control schemes are restricted to abattoir inspections only. The objective of this study was to conduct, for the first time, molecular characterisation of Mycobacterium bovis strains isolated from cattle slaughtered at the Bamako abattoir. Of 3330 animals screened only 60 exhibited gross visible lesions. From these animals, twenty strains of M. bovis were isolated and characterised by spoligotyping. Results Organ lesions typical of BTB were most often detected in the liver, followed by the lung and the peritoneum. M. bovis was isolated from 20 animals and 7 different spoligotypes were observed among these 20 strains; three of the patterns had not been previously reported. Spoligotype patterns from thirteen of the strains lacked spacer 30, a characteristic common in strains of M. bovis found in Chad, Cameroon and Nigeria. However, unlike the other three Central African countries, the majority of spoligotype patterns observed in Mali also lacked spacer 6. Of the remaining seven strains, six had spoligotype patterns identical to strains commonly isolated in France and Spain. Conclusion Two groups of M. bovis were detected in cattle slaughtered at the Bamako abattoir. The spoligotype pattern of the first group has similarities to strains previously observed in Chad, Cameroon and Nigeria. The additional absence of spacer 6 in the majority of these strains suggests a Mali specific clone. The spoligotype patterns of the remaining strains suggest that they may have been of European origin.

  13. Molecular characterisation of Mycobacterium bovis isolated from cattle slaughtered at the Bamako abattoir in Mali

    Science.gov (United States)

    Müller, Borna; Steiner, Benjamin; Bonfoh, Bassirou; Fané, Adama; Smith, Noel H; Zinsstag, Jakob

    2008-01-01

    Background Mali is one of the most important livestock producers of the Sahel region of Africa. A high frequency of bovine tuberculosis (BTB) has been reported but surveillance and control schemes are restricted to abattoir inspections only. The objective of this study was to conduct, for the first time, molecular characterisation of Mycobacterium bovis strains isolated from cattle slaughtered at the Bamako abattoir. Of 3330 animals screened only 60 exhibited gross visible lesions. From these animals, twenty strains of M. bovis were isolated and characterised by spoligotyping. Results Organ lesions typical of BTB were most often detected in the liver, followed by the lung and the peritoneum. M. bovis was isolated from 20 animals and 7 different spoligotypes were observed among these 20 strains; three of the patterns had not been previously reported. Spoligotype patterns from thirteen of the strains lacked spacer 30, a characteristic common in strains of M. bovis found in Chad, Cameroon and Nigeria. However, unlike the other three Central African countries, the majority of spoligotype patterns observed in Mali also lacked spacer 6. Of the remaining seven strains, six had spoligotype patterns identical to strains commonly isolated in France and Spain. Conclusion Two groups of M. bovis were detected in cattle slaughtered at the Bamako abattoir. The spoligotype pattern of the first group has similarities to strains previously observed in Chad, Cameroon and Nigeria. The additional absence of spacer 6 in the majority of these strains suggests a Mali specific clone. The spoligotype patterns of the remaining strains suggest that they may have been of European origin. PMID:18637160

  14. AcEST: BP918428 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_D05 431 Adiantum capillus-veneris mRNA. clone: YMU001_000113_D05. BP9184...28 CL2013Contig1 Show BP918428 Clone id YMU001_000113_D05 Library YMU01 Length 431 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_D05. Accession BP918428 Tissue type prothallium Developmental stag...s. 25:3389-3402. Query= BP918428|Adiantum capillus-veneris mRNA, clone: YMU001_00...c Acids Res. 25:3389-3402. Query= BP918428|Adiantum capillus-veneris mRNA, clone: YMU001_000113_D05. (431 le

  15. AcEST: BP918426 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_D03 504 Adiantum capillus-veneris mRNA. clone: YMU001_000113_D03. BP9184...26 CL2Contig2 Show BP918426 Clone id YMU001_000113_D03 Library YMU01 Length 504 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000113_D03. Accession BP918426 Tissue type prothallium Developmental stage -...c Acids Res. 25:3389-3402. Query= BP918426|Adiantum capillus-veneris mRNA, clone: YMU001_000113_D03. (504 le...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  16. AcEST: DK954060 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK954060 CL412Contig1 Show DK954060 Clone id TST39A01NGRL0019_G24 Library TST39 Length 6...26 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_G24. 5' end sequence. Accession DK95406...s Res. 25:3389-3402. Query= DK954060|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0019_G24, 5' (626 le...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK954060|Adiantum ca...TST39A01NGRL0019_G24 626 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_G2

  17. AcEST: DK949897 [AcEST

    Lifescience Database Archive (English)

    Full Text Available P29425|TX26_PHONI Neurotoxin Tx2-6 OS=Phoneutria nigriventer Align length 50 Score (bit) 32.7 E-value 1.9 Re...9425|TX26_PHONI Neurotoxin Tx2-6 OS=Phoneutria nigriventer ... 33 1.9 sp|Q10MN8|C...honeutria nigrivente... 30 9.3 >sp|P29425|TX26_PHONI Neurotoxin Tx2-6 OS=Phoneutria nigriventer PE=2 SV=2 Le...C+ GVG A G+PS Sbjct: 147 GGFPSLPWASSLERLLTSPSSCVSDSRGVGNADGFPS 183 >sp|O76198|TX21A_PHONI Neurotoxin Pn2-1A OS=Phoneutria nigriventer

  18. AcEST: DK953467 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3. 5' end sequence. DK953467 - Show DK953467 Clone id TST39A01NGRL0017_N13 Library TST39 Length 578 Definiti...on Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0017_N13. 5' end sequence. Accession DK953467 Tissue t...s Res. 25:3389-3402. Query= DK953467|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0017_N13, 5' (578 le...eic Acids Res. 25:3389-3402. Query= DK953467|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0017_N13, 5'...TST39A01NGRL0017_N13 578 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0017_N1

  19. L'apiculture au Mali : expériences villageoises de développement intégré

    Directory of Open Access Journals (Sweden)

    Capitte, R.

    1986-01-01

    Full Text Available Beekeeping in Mali : experiences of integrated development in villages communities. With the perspective of improving considerably traditional beekeeping in Mali, the Forestry commission of this country has begun, with the help of various international organisations, some experiments on integrated development in four villages communities. In two years, these experiments have enabled us to obtain greateryields in honey and in wax thanks to : using new simple and cheap techniques (Kenyan or Senegalese improved behives... ; giving training and technical help to the interested farmers ; the farmers creating cooperatives and Beekeepers associations ; replanting with forestal plants which are useful to the bees ; developing village orchards.

  20. L'utilité de la télémédecine au Mali | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    30 avr. 2013 ... Au cours de leurs études à la Faculté de médecine de l'Université de Bamako, au Mali, Cheick Oumar Bagayoko et ses camarades ont souvent redouté d'être affectés, une fois diplômés, dans la zone intérieure peu peuplée du Mali. On savait alors qu'un médecin établi en milieu rural finirait par perdre une ...

  1. Le Minh Duc

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. Le Minh Duc. Articles written in Bulletin of Materials Science. Volume 36 Issue 5 October 2013 pp 779-788. Study on photocatalysis of TiO2 nanotubes prepared by methanol-thermal synthesis at low temperature · Chau Thanh Nam Wein-Duo Yang Le Minh Duc · More Details ...

  2. Le Bon, Gustave

    DEFF Research Database (Denmark)

    Borch, Christian

    2017-01-01

    Gustave Le Bon (1841–1931) was a French physician and crowd psychologist who published extensively on themes such as crowds, war, race, revolution, socialism, and war. His work on crowd psychology in particular was highly influential, including beyond scholarly circles. Le Bon argued that crowds ...

  3. Le Recul de la Forêt au Viet Nam

    International Development Research Centre (IDRC) Digital Library (Canada)

    La voie de recherche et les outils d'analyse utilisés dans le cadre de ce projet étaient nouveaux pour les Vietnamiens, et les conditions sur le terrain étaient nouvelles pour les Canadiens; c'est donc dire que tous les participants ont réalisé un apprentissage important. L'expérience a démontré l'efficacité et l'utilité de telles ...

  4. Publications | Page 19 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La Méditerranée est un endroit du monde ou les effets des changements climatiques se font particulièrement sentir. Transfert de responsabilités (2009). Au cours des deux dernières décennies, le Centre de recherches pour le développement international (CRDI) a participé à la mise sur pied et à la fermeture ou au transfert ...

  5. Publications | Page 51 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Explorez les extrants découlant de plus de quatre décennies de recherche soutenue par le CRDI. Visitez la Bibliothèque numérique du CRDI maintenant. ... Aux fins de l'élaboration de sa prochaine stratégie quinquennale, le CRDI a organisé... Agents de changement : la philanthropie dans certains pays d'Asie du Sud-Est.

  6. Quand le cerveau joue avec les notes | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    4 janv. 2018 ... La musique nous rend-elle plus performants en calcul ? C'est ... Autrement dit, en osant le raccourci, faire du piano rend-il meilleur en calcul mental, par exemple ? ... Le groupe assigné à la tâche simple devait comparer deux mélodies comportant d'infimes variations de tons pour déterminer si elles étaient ...

  7. Publications | Page 153 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Quelle part véritable ont la science et la technologie (S-T) dans la satisfaction des besoins humains essentiels ? Leur rôle dans le développement est assurément une des questions les plus complexes et délicates auxquelles soient confrontés aujourd'hui les décideurs et les professionnels... Human Security and Mutual ...

  8. Publications | Page 222 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Transport et réduction de la pauvreté : étude de cas sur la contribution du secteur des transports à la réalisation des Objectifs du Millénaire pour le Développement (Burkina Faso) (restricted access). Le Burkina Faso, comme la plupart des pays en développement, est confronté à des problèmes liés à l''aggravation de la ...

  9. le traitement de la tuberculose ganglionnaire cervicale a propos de ...

    African Journals Online (AJOL)

    Introduction : La tuberculose ganglionnaire cervicale représente la localisation extra pulmonaire la plus fréquemment observée. Cependant, le traitement d'une affection aussi répandue dans le monde ne fait pas consensus. L'objectif de cette étude est de préciser, à travers une revue de la littérature, les différents moyens ...

  10. Le Projet hippocampe devient un important protagoniste de la ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le Projet hippocampe devient un important protagoniste de la conservation de la faune marine. 29 octobre 2012. Image. Stephen Dale. Des effets durables. Pour certains, le Projet hippocampe est un organisme qui a mobilisé des collectivités de pêcheurs pauvres des Philippines pour créer des dizaines d'aires protégées ...

  11. Afrique subsaharienne | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... d'approvisionnement en eau surchargés sont de plus en plus éprouvés par la croissance galopante des zones urbaines sans compter l'érosion des sols, le rétrécissement des forêts, la désertification et la dégradation des zones humides. Qui plus est, l'épidémie de VIH fait le plus de dégâts en Afrique subsaharienne.

  12. Publications | Page 56 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Cap sur l'Ouest : les Prairies canadiennes, élément essentiel de la lutte contre la faim dans le monde. Il y a plus de vingt ans, Charlie Mayer, exploitant d'un ranch dans le sud du Manitoba et également ministre fédéral de l'Agriculture, est rentré au Canada troublé par ce qu'il avait entendu.

  13. Le processus entrepreneurial en algerie une adaptation du modele ...

    African Journals Online (AJOL)

    De ce fait, notre ambition, à travers cette recherche est, d'étudier le processus entrepreneurial en Algérie inspire du modèle de Gartner qui permet une meilleure analyse à travers une démarche qualitative (les entretiens semi directifs) sur un échantillon de 30 entrepreneurs de Tlemcen qui répondront aux questionnements ...

  14. Publications | Page 145 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'Initiative régionale concernant la demande d'eau (WADImena), que finance le CRDI, aide les pays de la région aride du Moyen-Orient et de l'Afrique du Nord à ... urtant, bien que la GDE gagne du terrain auprès des responsables des politiques, elle n'est pas encore assez ancrée sur le plan politique pour être mise en ...

  15. Publications | Page 5 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... produits et de services financiers à l'intention des jeunes. Revitalizing Health for All : Case Studies of the Struggle for Comprehensive Primary Health Care. Le concept de soins de santé primaires complets (SSPC) est axé sur les efforts déployés par le système de santé pour améliorer l'égalité d'accès aux soins de santé, ...

  16. Publications | Page 15 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le projet Cultiver l'avenir de l'Afrique (CultivAf) du CRDI et l'Australian Centre for International Agricultural Research (ACIAR), organisme collaborateur, ont organisé l'activité parallèle « Science and Innovation to Transform ... Depuis quelques années cependant, c'est avec plus d'optimisme que l'on parle de ce continent.

  17. Publications | Page 20 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Cependant, il est couramment utilisé comme combustible, dans les régions rurales, pour faire cuire le pain dans un four traditionnel. Des chercheurs insistent sur l'importance de favoriser la résilience aux changements climatiques des producteurs de maïs d'Afrique du Sud. Des recherches ont démontré que le rendement ...

  18. colombia : tous les projets | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Financement total : CA$ 650,800.00. Prévenir les maladies liées au virus Zika avec de nouvelles approches de lutte antivectorielle. Projet. Ces dernières années, c'est en Amérique latine qu'on a observé le nombre le plus élevé de cas de dengue, soit au Brésil, en Colombie et au Mexique. Région: Brazil, Colombia, Mexico.

  19. Monitoring local food security and coping strategies: lessons from information collection and analysis in Mopti, Mali.

    Science.gov (United States)

    Lambert, R J

    1994-12-01

    Save the Children Fund (UK) established a local food security monitoring project in the Mopti region of Mali, which was operational between 1987 and 1993. This article describes some of the lessons learnt from this experience of monitoring food security and coping strategies. It illustrates how coping strategies can be an important element in tracking vulnerability in the Sahel, but that interpretation is complex and there are limitations to their use. Secondly, consideration must be given to the institutional context in which information systems are set up. Information providers must be linked institutionally to response mechanisms, to ensure that data are fed systematically into the design, implementation and monitoring of appropriate response.

  20. Genetic differentiation of watermelon landrace types in Mali revealed by microsatellite (SSR) markers

    DEFF Research Database (Denmark)

    Nantoume, Aminata Dolo; Andersen, Sven Bode; Jensen, Brita Dahl

    2013-01-01

    This study describes the genetic differentiation of a collection of 134 watermelon landrace accessions from Mali, representing red fleshed dessert and white fleshed seed and cooking type watermelons from five regions, plus three commercial dessert type cultivars with red flesh. The material...... % of the variation. Analysis with the software Structure revealed that the accessions with confidence could be separated into two major genetic groups, related to flesh colour (red and white) of the watermelon fruits. The same analysis further indicated that the material may be differentiated into eight genetic sub...